3O3LA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol (1,3,4,5)tetrakisphosphate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
315
Chain Sequence
EQTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
publication title Structural analysis of substrate binding in PTPLPs
rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 109
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o3lA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3o3lA02
4PYHA 4GE6A 3D42A 2QBSA 1ZZWA 4WOHA 1Q6PA 1BZCA 4GFVA 2C46A 4QUNA 1PA9A 3V0JA 1WAXA 1LYVA 1YTWA 3O4UA 2IMGA 3S4EA 2F71A 2I3RA 2J16B 1YTNA 1X24A 2P4DA 2I75A 2CM2A 3PS5A 1NWEA 2PSZA 2B49A 1G1FA 3F81A 1I57A 5KAAA 4JNBA 2QBQA 5KA9A 2Y96A 3V0IA 1I9TA 3O5XA 5K25A 1C86A 4JBCA 3S3KA 2I4HA 5KA8A 1G7FA 2CFVA 1C83A 3D9CA 1ZC0A 2CMCA 2PA5A 3QCLA 2H4GA 3BRHA 3BM8A 2C7SA 3MOWA 2QDCA 4OHHA 4KI9A 2CNFA 2J16A 1YTSA 4GRZA 5KA1A 1PTVA 2G59A 3O4TA 2QDMA 1RXDA 2VEVA 4GS0A 3I36A 2BIJA 4WU2A 2CM7A 4GE2A 4PVGA 2CNIA 2I6MA 3QCMA 1NWLA 2F70A 4QUMA 2Y2FA 5BZXA 2BZLA 4DGPA 5BUGA 1JF7A 2AHSA 1LQFA 1ONYA 1I9SA 3EMUA 1U24A 2HNQA 2I6JA 2OZ5A 4R0SA 3RO1A 2ZMMA 2H02A 3QCEA 2F6ZA 1YGRA 2NT7A 2PQ5A 5BZZA 1KAKA 2J17A 1PTYA 3D1QA 4JMJA 1YWFA 4OHDA 2E0TA 1OEUA 1NL9A 5IBSA 4RDDA 5KACA 3A5KA 5IBMA 2I6OA 2MBCA 1OETA 4J51A 3GXHA 4WTYA 2CM8A 3U96A 2QDPA 3BLTA 2NLKA 3QCHA 2NZ6A 3ZM0A 3SR9A 2CJZA 4QBWA 4TVVA 2F6TA 1NO6A 4QBEA 1Q6JA 3S3FA 2F6WA 1T4JA 2B4SA 3M4UA 1NNYA 3V0HA 2HXPA 5KADA 3QCNA 2B07A 2PBNA 2B4UA 2NT2A 1L8GA 1C87A 5M43A 1XM2A 5EHRA 3V0DA 4HJQA 1U25A 1GWZA 5KA7A 1G1HA 4BPCA 1G1GA 5K23A 3EAXA 2F6VA 4H1OA 3QCGA 2NV5A 2BGEA 1OEMX 5K24A 3EU0A 2I4EA 3QCJA 1XRIA 3F41A 2I4GA 3RGQA 5KABA 2AZRA 2JJDA 2FH7A 1PYNA 4Y2EA 1SUGA 3O4SA 1A5YA 4OHLA 4HJPA 4QAPA 3H2XA 4RKKA 2VEXA 3F9BA 1EEOA 1YZ4A 1GFYA 3S4OA 2HC2A 2GWOA 3O3LA 1PH0A 3QCIA 2CNEA 1J4XA 2I1YA 1V3AA 3S3EA 5HDEA 5K9WA 4NX8A 1OESA 2A8BA 5KA2A 1XXVA 3ZMPA 4NNDA 3BLUA 2B3OA 1C88A 1XXPA 3ZM2A 5KA3A 5K9VA 1OHDA 1RPMA 4Y14A 1QXKA 3I7ZA 3AWEA 2GJTA 2BV5A 4S0GA 1FQ1A 1BZHA 1LARA 5BX1A 1G4US 4B04A 1Q6NA 3ZM3A 4ICZA 4KYQA 3S3HA 2ESBA 1D5RA 2CMBA 2RF6A 4D3PA 2OOQA 1YN9A 3F9AA 5KA0A 2HVLA 2H04A 2NTAA 1Q6SA 2HC1A 1XBOA 2H4KA 2I6IA 4OHIA 2R0BA 4DGXA 3QCFA 4NWFA 1WCHA 5EHPA 2QCTA 2CNGA 4KYRA 4H34A 3N0AA 1JLNA 4ERCA 2HNPA 3B7OA 1G7GA 2I6PA 3QCCA 2QCJA 5MMZB 5I6VA 2DXPA 1L8KA 3EZZA 5K22A 1ZCLA 1M3GA 1U26A 2QBRA 1NZ7A 2I42A 3V0EA 4ZI4A 3EB1A 2G6ZA 2P6XA 4GE5A 3QCBA 3ZV2A 1T49A 1WRMA 3MOZA 5GTJA 2PT0A 1AAXA 1PTUA 3CM3A 1EENA 3D44A 4YAAA 2ZN7A 2I3UA 2GP0A 4GRYA 3ZM1A 1BZJA 1YFOA 2HY3A 3V0FA 4R0TA 1KAVA 2VEWA 2H4VA 3I80A 3V0GA 4RI4A 4D3RA 1ONZA 2PI7A 4IKCA 2QEPA 4ZN5A 2HCMA 1C84A 4Z6BA 2Q47A 1PTTA 4NWGA 2OC3A 2F6FA 3MMJA 1ZCKA 2Q05A 5AWXA 1QZ0A 3AWFA 1OEOX 3F99A 4RI5A 1PA1A 2F46A 1VHRA 1Q1MA 3RZ2A 2VEUA 3SMEA 4NYHA 1P15A 5LXQB 1ECVA 2H03A 2SHPA 3GXGA 1OEVA 4RH5A 3LJ8A 2CNHA 3D1HA 2VEYA 1FPZA 4OHEA 2M3VA 1T48A 3QKPA 4RHGA 4YR8B 2FJNA 2CM3A 3OMHA 3QKQA 1G4WR 4D3QA 1FPRA 4RH9A 3CWEA 3D1OA 2B4OA 1OHEA 2F6YA 2QBPA 4JMKA 1YGUA 2CMAA 3RGOA 3A5JA 4WU3A 4HRFA 1Q6MA 4QAHA 4GWFA 5J8RA 1OHCA 2HB1A 4BJOA 2B4PA 2YDUA 4ZRTA 2OUDA 3QCKA 3NMEA 2A3KA 4R30A 4MBBA 2FJMA 3QCDA 1R6HA 2BGDA 3ZMQA 2I5XA 4GFUA 1Q6TA 1PXHA 4I8NA 5KA4A 1YPTA 3OLRA 4AZ1A 1MKPA 2WGPA 3AWGA 1C85A
chains in the Genus database with same CATH superfamily
2MYFA 4FBUA 2XZWA 5C25A 4KIAA 1UWAA 1WG4A 1X24A 2MZSA 2PMHA 1C0UB 3ETMA 1RKJA 4OZJA 4JI5F 3F81A 2HQFA 5IWAF 3GYNA 1XNQJ 2I4HA 3Q0AA 1RDRA 1I51B 4NLUA 1N5YB 2ZUAA 2GHWA 3OXLA 1CJUA 3DRPB 2QDCA 2C3PA 3DDKA 3KUHA 2W9CB 1YRTA 2YQ1A 5BJRA 3PIPQ 4ZJOA 1RXDA 1FA0A 2EEYA 3Q8RB 1T9UA 3KK1B 3W5ZA 2WB1D 1S6QA 2RKIB 2X1AA 1U02A 4ZPTR 2P8IA 4QIFA 2IDEA 3NLCA 2JEIA 2GGPB 2B5JA 1FNXH 2DGOA 1ZS6A 3M30A 1VGYA 4UUWA 2XMMA 3DGPA 1S9GB 3WBZA 4OI2A 1NSAA 3GJQB 3THTA 3MD3A 3B78A 3ZZYA 1KAKA 3D1QA 4B9SA 4JMJA 5FIIA 3TUPA 4U6PA 1CS4A 1YZ7A 4J51A 3TRGA 1IBMJ 1S79A 2NLKA 4N8NA 2QA1A 2NZ6A 3QCHA 4E98A 1XK8A 2DD8S 3Q8VA 2B4SA 3GFXA 4LVOP 4YR0A 5C7PA 5DO2A 4MJKA 3CO9A 3MDFA 1LFWA 2YX4A 5E5NA 4I69A 1L8GA 2M4MA 1OSCA 2VBXA 3C66A 2H5IB 1U25A 4LT6A 2RQMA 1G1HA 4NASA 4JV2A 4WFNQ 3MM6A 5KG1A 1D9FA 3CCTA 1IKWB 3DLEB 4TYBA 1VLOA 2I4EA 2XJAA 1LWCA 2NSCA 4IOCQ 3IRWP 3QJLA 3QIDA 4KKOB 2L9NA 2ZOMA 4WYWA 4ZVUB 3THPA 1IN0A 3FBFA 4YB1P 3ETOA 3JXOA 2ZZTA 1YHQS 3V6JA 4TN2A 4F3QA 3HHEA 3H5UA 1LWFB 2XMVA 1F60B 2E9ZA 1WTBA 3M32B 4R25A 2XGQA 4DV7F 1KNZA 1ROFA 4DJBA 4H4KA 5CABA 5F8IA 4KR0B 3HPOA 2NXJA 1PJ7A 4Y14A 2MSTA 1FXDA 2UAGA 1T9WA 2E66A 3MUTP 1TV6A 1QAIA 2VJVA 3H2UB 4CYUA 2EFQA 1Q6NA 4ICZA 1RWVB 4KYQA 1CBKA 2NUHA 1LK5A 3M8SA 5DJBA 3POTA 4YUDA 3F9AA 2X3GA 1PC5A 2IRXA 2CQCA 3MD1A 4B3TF 2E5JA 4U96A 5KFRA 2QL5B 4KHPJ 5H9EK 1ZA1B 3EVWA 2QCTA 2CJKA 1VK8A 4UF4A 1KOOA 2XGPA 1EIYB 2QLJB 4USUA 5RUBA 2LCWA 1O8BA 1HR0J 3BDEA 3ITHA 4MIAA 4A8OA 2E1AA 4QIWD 3W5XA 3M2RB 3NBPB 4DMZA 1VRTB 5D6GA 3BN4A 3EB1A 1NJXA 4OL8A 2B8QA 1X60A 2A1BA 1URNA 3M8PB 4OFZA 3QPIA 2D3O1 1TTHB 5CHCB 4YY3J 2VEWA 3I80A 1KDNA 2GV1A 2FLPA 2YWGA 1CJTA 3W1YC 3H5XA 2BKPA 1S0OA 5H9FK 2Q3PA 5KFTA 2M8DB 1QSLA 2Y8YA 2RAQA 4LRBA 4WJBA 2JX2A 4LSLB 2P6TA 4JI8F 1VHFA 4F3OA 1UEKA 4DFJA 1X0FA 1VQYA 1EARA 1X4BA 2SHPA 3P45B 1RWWB 4OYBA 2R2UA 2CZVC 3QKPA 3KJQB 4TY9A 3AXKA 1Y9OA 1K44A 3TJ8A 4RH9A 1NK4A 4LSLA 2JLGA 3OR2A 2HMIB 4P6QA 4NCGB 4HRFA 1GAOA 1TKZA 3CJRA 2QA4S 2I1RA 2HB1A 4BJOA 1RLCL 2NYIA 2W25A 5J1PA 3I0SA 3JSBA 2COLA 1FD2A 2CAJA 2HNDA 1TFYA 2FJMA 4PRFA 1Y11A 4F4YA 3N2AA 4KGZB 5KT2A 3LP1B 4GFUA 2A3JA 3OW2R 4LF6F 1MG7A 4IO1A 1UVIA 3JSMB 2HBZB 2IVFB 4C6AA 1V3SA 1ZZWA 1UPMB 2BE2B 4MIWA 1UFWA 1JK9B 2IMGA 2A2DA 5DLFA 4O4RA 2I3RA 2CNKB 3HSDA 2CM2A 2LVWA 2AM2A 3M9MB 4CTAB 1CEZA 4GKKJ 4X4OA 3VQSA 3PKMA 3S3KA 2R8HA 1AXQA 1TELA 4UZBA 4DV0F 2H4GA 3BRHA 1S1VB 3C6UB 2E9TA 3HDSA 3S6EA 5AE3A 2WVDA 3DYAB 3BO4A 3NXZA 4PYAA 4WU2A 1HFEL 4GE2A 2CZ9A 1D8YA 5DG9A 1FTCA 3IGNA 4DU8A 1D09B 4M8LA 3PM9A 3AJDA 5BUGA 1YG0A 2MGZA 3MAHA 1L3VA 1M1KT 4UTGA 4DLEA 4FYWB 2PFDA 2BANA 4EWTA 2QSWA 2B9EA 1EP4A 2VV5A 2ZZMA 2XEXA 2VFSA 5HVGA 1QY7A 3SMZA 2EKNA 2M8HA 2BR0A 3IR5B 4FS1A 2EFPA 1NB7A 3GV5B 3L3CA 3DHXA 4FBTA 3P5BP 2YX1A 2L9DA 2ASYA 1I5OB 3PYEA 3OFGA 5IXUA 1U0HB 1E8CA 1FRJA 3PJ9A 3V0HA 3OT9A 5CQGA 1NSQA 4CRJA 4OYXA 2KO1A 1RT5B 3HFVA 3UNYA 3F73A 5I3QA 3QATA 2VQEJ 3MUVP 3IR6B 1KEKA 4LJMA 4BPCA 4DPOA 5K23A 3IS9A 1R27B 1ULRA 3GFZA 1RAIB 2F5GA 5HI7A 5KFNA 2K7JA 2NZ4A 1G6BA 2FH7A 2RU9A 3OL9A 1S4FA 2A0FB 2HHXA 4I2QA 2J8SA 4Y3CA 4OV1A 2XO7A 4UAGA 2YQ3A 3QZ7A 3NGKA 1EEOA 3G87A 4M5IA 4OZ0A 1WSRA 2DKOB 3J7AN 1FK9A 2R2SA 3C16A 3M6XA 4ZCIA 1ZBTA 1IWAA 2GVDA 3JYTA 4BBYA 1UCNA 4ANDA 2RDDA 4WP9A 5J2NA 2ZDOA 5A5FA 5ETLA 4U8YA 1RPMA 3R6GB 1I1GA 2K1RB 2A2CA 2Y66A 3HP6A 1DLOB 3HHKA 3C15B 1PGZA 3OLAA 2FTRA 2IC3A 4L3KA 5JXSA 2X3DA 3OTOJ 3QAUA 2OP5A 1CULB 1UZHA 3QSIA 2GNKA 3A8IA 2MMYA 3PG9A 4OLOA 1Q82T 2ZBCA 4F2RA 2EWHA 3G71S 3R5CA 1RI7A 3QCCA 3TAQA 2CUYA 4DHVA 1RZMA 3EJMA 2IMWP 3U1MA 4NEYA 1F2HA 3NP5A 1IJEB 5ETPA 4ZA1A 3N6MA 2C2ZB 1RAEB 2N4DA 1F2GA 3GQCA 2WW8A 4N7TA 3MM8B 2QBRA 4U95A 4DR3J 2FQQB 1BLUA 1E6VB 2DIUA 2DXDA 2OEMA 2Y8WA 4ED6A 4NMLA 3D44A 4IKAA 5EHHA 4YDXA 4I64A 3DU6A 1QM9A 2HY3A 2OO4A 4GC6A 1VQSA 5L46A 4J9KA 1SVDA 2WHOA 4EO8A 2I8EA 2J9DA 5HP1B 3W66A 4OI3A 1SH3A 1GMWD 4CVLA 4JUZA 4FYXB 3CCJS 2ZBQA 1NHKL 1VJWA 5M2RA 4P7VA 4DR6F 4ELVA 1UW4A 5CZVA 3AB4B 4ECVA 5B7WA 3BZQA 1S9FA 4IRCA 3GIMA 3D0HE 1KS2A 4CWBA 3MR3A 2VBWA 4LSNB 3MPDA 2I9SA 3HHLB 2MZRA 1XMBA 3I0RA 4PXEA 5HQ8A 3NGSA 3CJQA 2B51A 1YSJA 5KFQA 3KK2A 4IOAQ 1HNIB 3M1VA 2MPUA 2OPQA 4O3SA 4I2PB 1YGUA 1WF1A 4WU3A 2DNKA 2R8GA 2K8GA 3CMAS 4C11A 2B4PA 2JNJA 4F4ZA 1LW0A 4BDPA 3ZTPA 2A6MA 3P4UB 4R8UB 4NE9C 3KMSA 2P9GA 3EGVA 3CW2C 2A3KA 4TYAA 4NI2A 2MQNA 1KR4A 4MT1A 4DOZA 3PXGa 3OFHA 4OX7A 3K8VA 5KFHA 1VIOA 1UVNA 1SQFA 3GPAA 3IGVA 2HGMA 5A0YB 2DO4A 2JVOA 1T8EA 4DUZJ 1Q6PA 4O4GB 4QUNA 3C19A 4UY8T 2BE7D 4K5SA 1U0SA 5GMKa 2ZM6J 2NXUA 5SZTA 5AXNA 2A10A 1JLAB 2V8HA 3DOLB 2F4VJ 2WVCA 2YKAA 3C14B 3FUYA 3A3NB 5B09A 2PA5A 2QYCA 1UAWA 4Y2IA 3FDSA 3PIOQ 2YWHA 4CZCA 1JX4A 2G59A 1Q95G 3O4TA 4X66F 4K8RA 2AZ1A 2F8MA 3A8EA 3BSNA 4OYZA 4DUYF 2GCFA 4UY85 2BVZA 3DGVA 2PIIA 1DTTB 1RWPB 2BUNA 5HJXA 1FWKA 4RBUA 5K8PA 1VOMA 1O0PA 4CNYA 1I9SA 3I5BA 3U1NA 2NYHA 3A8KA 3N0VA 4QYRA 4C7QA 1FNMA 3Q8QB 3TW0A 2BA9A 4CO5A 2V4QA 2BW2A 3K8WA 1Y7PA 1IBLJ 2DNYA 2AYEA 5KACA 3MR2A 3ZZZA 3MM5B 1YJVA 2J6UA 2UXBJ 1YX2A 3JQMA 5KTQA 4BUCA 4F26A 3S1TA 1VQKS 4DV3J 1JXLA 2FVPA 1WORA 1W2BR 3SYZA 4RW8B 1MN7A 2JDJA 1S9EA 5KFOA 4NRUA 2GIQA 4JV5J 3CJ3A 2B8PA 4LFAF 2C2EA 3J81j 3BM7A 2LFVA 2B9XA 3EZUA 1WDTA 5F8HA 2RU3A 4ZLJA 2JFFA 2V8DA 3PYFA 4Q45A 1VQOS 1Q53A 3NNCA 3V0DA 3T1YF 4B9VA 1GWZA 2ERRA 1Y3JA 3QQCD 4H1OA 1QE1A 2NV5A 2AJ1A 3CTRA 2B6AB 3KLFB 1VC5A 1S1TB 4ZLLA 4GVBB 4LF9J 1S6UA 4DR5J 2CQPA 2DR7A 1YRUA 2VEXA 3PDNA 1Y00A 3HX9A 2W4PA 4HL9A 4OI1A 4OZ2A 3LGNA 4DCOB 2RS2A 3RR8A 2ZJQQ 2AF6A 1R3NA 2EFGA 3BR8A 4GVBA 1VFJA 2A8BA 3C46A 1FKOA 1ZAXA 3K57A 2UUWA 2W9BA 3KMQA 3CD6S 5KFFA 1SKUB 5F8LA 5FDLB 1NDPA 4Q44A 3GFHA 3SFGA 1LWEB 3JSYA 4C8LA 1ZM4A 1N36F 2GA7A 4YB5A 4IOBA 3T1HJ 2QT7A 4DZDA 3S3HA 2BEFA 2HNYB 2LXIA 1Y10A 2ZH3A 5IQQA 1YN9A 3SCJE 1TQLA 5KFSA 1CC8A 1YIJS 2NTAA 1H2VZ 3V6DB 3PX0A 2DIVA 4QWBA 4LF7J 3EDRB 3G82A 2IDLA 4Q2LA 5J2QB 4HYKA 2RHQB 2QCJA 5I6VA 4CO3A 3HKZD 4CLWA 2ZITA 2AX0A 3E8OA 3PYDA 1KFSA 1VQMS 2EG1A 4I0WA 1EJ7L 2FY1A 3HM9A 3W3SA 4B3OA 2AEMA 2QL9B 3VZHA 1N34F 3ZV2A 4DQIA 2IBOA 2BJDA 2O66A 1SJ3P 3CM3A 2LQBA 4JI4J 4YAAA 4ECSA 4KFBB 2ZN7A 3B54A 2HNZA 1IBKJ 2DHHA 1B3TA 1RADB 5F3TA 2ZZNA 4AL7A 2QIFA 2XC9A 1J5OB 4QW9A 1APSA 1HPZA 5HL7Q 1ZCKA 2BM0A 4FF3A 2ZOGA 1SUQB 1QZ0A 2HURA 3PEHA 4USTA 1FO1A 4B9MA 5FLXY 5LXQB 1P15A 1VS3A 1P1TA 4NXMF 1JLFB 3RW6A 2OD6A 3J7A1 3D6HB 1NKCA 3VVTA 4FKXA 3CCUS 1MMDA 1KQFB 2WVEA 1FPRA 3RBZA 1I94J 3GYGA 3CWEA 1M5VC 1GG4A 4P9SA 3MMAB 4NEZA 3E51A 4RWWA 1F6TA 1NZ8A 2DRBA 4ECXA 3I9V9 4ILLA 3QCKA 1DHMA 1DFDA 4O0IA 2FJBB 4DI6A 3UNGC 2M3DA 3PZPA 5D3GB 3GYXB 2LQ5A 2ZE2B 3OR1A 2OPPB 4USKA 4M1KA 3ILOA 4GC7A 4GE6A 2VIHA 5EWFA 2XS5A 3DRXA 3DI6A 4GFVA 3QCZA 4J5OA 3IO1A 2KVQE 4DV4F 3UDVA 1WC3A 4NA3A 3J80Y 4Q2MA 3RAXA 4Z7YA 5B0DA 5DGBA 2PSZA 3HHNB 4ZVRB 2JZ5A 2QBQA 3RBEA 4DV2F 2J0QD 4LIWA 3R8YA 4DR4F 2LYVA 1MWZA 1CJKB 4CLPA 1Z4UA 2GIFA 2MZTA 2NREA 1JLGB 1H0HB 4ZIVA 4A46A 3OFFA 3QYYA 3P8BB 1VQLS 2F7VA 4WK1A 4DQRA 1C0TB 2CNIA 3CULA 5HATA 4CLYA 4W98A 1AFJA 1NWLA 1CQNA 5BZXA 3PEJA 2YKNA 4EBEA 2YWWA 5BYQA 2L3MA 4L75A 2X1BA 2YKMB 1SL0A 2VBYA 3UPFA 1EKRA 2QEXS 3LP0A 3Q86A 5ETSA 4Y2MA 2XLKA 3QT6A 3D2WA 1F9EB 1U4BA 2YWFA 5ETRA 1PSDA 2CG8A 2RILA 4OX9F 4DUTA 3MAAA 1T05B 1DAXA 3GTYX 1H98A 5KG4A 1SBRA 2MQ8A 2VDIA 4WTYA 1RU1A 1IWGA 4DV0J 3RBXA 3BLTA 1TL3A 1WOOA 3SSSA 1QD1A 3MEKA 2E29A 2DGUA 1DRZA 1B7YB 3RB0A 2ZH7A 2FVRA 4KHMA 2HZAA 3NY0A 1BWVA 1K9MT 4Q8EA 4WFXA 4L72B 2DNMA 2Z2YB 3QCNA 1VQ9S 2CQIA 4YR2A 4Q5VA 2DJWA 2GJFA 3DXSX 3I6PA 1XR6A 2VU5A 2UUBF 4N41A 3J7ZT 2D3ZA 2FHJD 1VRQC 4CM2A 2ZD1B 2BJEA 4DSFA 1XRIA 4O3PA 3RGQA 2KFYA 2AZRA 4ENOA 3PRVA 1SUGA 3ZNJ1 3O4SA 3CIMA 3KHLA 3FC9A 1YJ7A 2CPDA 2ZNZA 1FEHA 3CCLS 4DS5A 1TAUA 1RA6A 4QR1A 4PQUB 2V69A 2DXFA 3HZEA 2DCLA 3CNQP 2BJ8A 2MXYA 2HZCA 3G2XA 2ZHBA 5KFIA 5KT3A 3RB6A 1V5IB 2EC0A 1WHVA 5CXTA 4IH7A 2BRKA 1FFWB 1S12A 3I7ZA 3GSIA 2B43A 1MROB 2ALZA 3TZYA 3KNAA 3TUJC 1M0SA 3FVYA 4RUCA 2CKWA 5KA0A 2ILYA 4ZVPB 3JAMU 2X51A 3N5BA 5D0GA 3CWJA 4CH0S 3NAHA 3FSIA 2HFUA 2H4KA 4OYAA 4CM0A 1Q7YT 2NZCA 1JJHA 4KYRA 1RTIA 2V9WA 5J2MB 1BQNB 2VHGA 4X65F 2CA9A 3N6LA 1B0VA 4UUXA 4KGKA 2J9DE 5KFVA 3FKBA 2G6ZA 3RRHA 2Y1RI 5CYJA 4USJC 3CD0A 3L4BC 3OPKA 4QW8A 3CEDA 4GRYA 2J8AA 1RKIA 4K5RA 3V0FA 4R0TA 4KC5A 2GJ2A 3R2DJ 4D3RA 1B99A 1RHRB 2W9AA 5DM7Q 4ZVOB 3MWBA 3NRSA 3ZZ0A 2QRRA 4HHHA 2YNIB 4ZP6A 2O1PA 4OJ3A 4NRTA 2OELA 1IR0A 1HYSA 1QAJA 4RI5A 1PA1A 3QRPA 2F46A 4OHXA 1SJ1A 3Q2TC 4RH5A 3N9UC 3SEOA 1TK5A 4RKUC 5CCLA 3KK3A 4J90A 4N47A 2OMLA 2R7WA 2FGOA 1R89A 1HI8A 5GAHU 2B4OA 1NH7A 1U1MA 2EG2A 2W01A 2E1PA 3EUNA 4M5DA 2CJYB 3TZWA 5I3UB 3ZM6A 3N5FA 4ED5A 3ZZRA 2FYXA 2EFVA 4S0MA 1SB6A 2YX7A 4R30A 4MBBA 5C2GA 3BGOP 3QCDA 3MFHA 3RRKA 3K5MA 1ZTWA 5T14A 1IXKA 1TUGB 3A4TA 5KA4A 4FYYB 3OLRA 4DL0C 1ICEB 2C2RA 3O44A 2CNLB 3DDIA 5A8KA 3DLKB 1Q86T 3FMWA 5HANA 4ED8A 2FGCA 1BMQB 3TZXA 2M88A 3OTEA 4DL6A 1SV5B 1DQ8A 1Q4RA 1I57A 2BE9B 1PYOB 4ANEA 4Z37A 3V0IA 1HQEA 4MKYA 4TY8B 3KKFA 3D7SB 1C4CA 4JI6J 2ZKTA 3LPYA 4DBQA 1N33J 2V6AA 4OHHA 4KI9A 1HW9A 3DRRB 3P6YC 4NYOA 4FP9A 3FNNA 4JYAJ 2CQ2A 1YGYA 3I36A 1IKVA 2IRYA 1PKUA 3D54A 4ANCA 2OKQA 3L95X 3SQGA 3EMUA 3SSRA 5E3CA 2JSXA 1HNWF 2HQDA 3TANA 1JWWA 2HRTA 4DR1F 3TWZA 2XNRA 3NG8A 2F6ZA 4B3SJ 2PQ5A 1PTYA 3CF5Q 3US5A 1M1GA 2OPSA 2MQOA 1NL9A 3D6MB 3J7YI 3SCLE 2I6OA 3AOCA 1G3OA 2B9WA 3PX4A 5HO4A 5AJ3J 2IBKA 5ETVA 1TP7A 1F9FA 3UDCA 2FLOA 1WJ9A 4QBWA 1XMOF 3GCWP 3VGSA 4QU6A 4QBEA 3DMJA 1IUJA 2HSEB 4AQYF 2XMKA 1VK3A 4HLBA 3AY0A 1T4JA 2V50A 1NNYA 4CH1A 2ZH6A 2DH7A 3ZFVA 2R4FA 3DHWC 4FF4A 4WKYA 2H4WB 2K3KA 3HSZA 1C1CB 4ZPCA 1SC4B 2EXUA 1EEHA 2RRNA 5E41A 5BXIA 1C1BA 1KTVA 1G1GA 3EAXA 1YQHA 1OEMX 2KG0A 2CQ4A 2Z2MA 4CLKA 3M6VA 4ZHRA 1KTQA 2HHSA 2J0SD 2MY7A 1T7PA 3DOKB 3K5NA 2JJ4D 4QQBA 4ZVHA 2JFGA 2LP4A 1MU2A 1KQGB 2JEJA 3UD4P 6FD1A 1SCJB 1S1WB 1D8ZA 4E0DA 1R0AB 4XAKA 4NLTA 2QFJA 4X4TA 3ZL8A 4PYDA 5THWA 1MLAA 2GX8A 4YHHF 3LP2B 1H2UX 3UDLA 4DSLA 3ZM2A 1LK7A 1REVA 3T19A 2YTCA 2DRDA 1FFGB 3P96A 4MIBA 3LH2S 4A8SA 6AT1B 4S0GA 1XNQF 4H4MA 1LOUA 4JI7J 4B08A 2Q66A 3B8HA 2DYAA 3CJ4A 5C42B 2IFXA 3TVYA 1FJGJ 2NXEA 5LOQA 1U1NA 3BGRA 3U7JA 2DGTA 5AE2A 5HBMA 1RT2A 2VFTA 3ZO7A 2HC1A 2J6TA 4CQ1A 1WKKA 1TKTA 2OEJA 2VOPA 5HLFA 3TJAA 3W2VB 1NK8A 5KAKA 2NPFA 2GVZA 2CNOB 4U67Q 2XPCA 1ITPA 3ENAA 1NDLA 1M5SA 4H54A 4KGMA 1P3DA 4LVNP 2QZ8A 5A8WA 1KOHA 1ZZNA 5H1SV 1RTHA 3W2VA 5JVGQ 4NPOA 4PG5A 2V2VA 2XLIA 1GQEA 4DSIA 5HSPA 3ZM1A 1RT4B 2OPRB 1N52B 2Q43A 4R0EA 4O0NA 3UQSA 4EUVA 3ET6A 1TR0A 2HIYA 4IKCA 1FX2A 1IBMF 3WDOA 3M8QB 3NCQA 2I38A 4NLWA 4CDIA 1RT6A 1OPIA 3BKTA 2OC3A 1B0TA 3GP9A 2DHGA 4CIOA 2CVIA 1RT4A 2GC5A 3DOMA 1XMQJ 1UETA 3PTWA 2RDIA 2Z4PA 2XB2D 3JQJA 4K4SA 1OEVA 3V2UC 3LJ8A 2G2YA 5SUHA 4DSEA 4RHGA 2FJDB 3OMHA 2DPJA 2WB4A 3F44A 2APOA 2ZH4A 5G0RB 3RGOA 3D0IE 2NUUG 3RTVA 4BWMA 3JQKA 5F41A 1UEUA 3T5HA 4UT4A 5L39A 2J7KA 3JTOA 2VFRA 5HROB 1NSPA 5CD4H 5G0RA 2O01C 2ATCB 3DC2A 2WVBA 1WOSA 3M2VA 1TUVA 2VQFJ 3UO0A 3V81B 4TU8A 4OLPA 3D42A 2YPYA 4KHRA 3HD2A 1PA9A 2Z2ZA 3V0JA 2L48A 4K2JA 3DNCA 2KM8B 4F4AA 4DL5A 1RQ0A 1DQAA 2CDQA 1NWEA 1G1FA 5KAAA 2Y3YA 4AXJA 4JNBA 3KUGA 4O23A 2F65A 4PWDB 5KFGA 3KLHA 1RT3B 4ES1A 1FWLA 3KLVA 2ZH2A 3D9CA 2HHTA 4A8KA 2AIRB 1ACMB 4KHPF 3QO9A 1FHTA 2CWXA 3GSDA 3L09A 3IRXB 2WOMB 1NRKA 3R5GA 2ASDA 4C9DA 2FZCB 1RTZA 2KTQA 1D9DA 1CC7A 5D15A 4DU7A 1BUXA 3QT5A 4K4TA 4DG1A 1VIXA 2CPFA 1HR0F 1RCXB 1RE1B 9RUBA 2AU0A 2DNZA 1TVRA 2VKRA 2DR5A 1U24A 4WE1A 4ED7A 1HBOA 4QWEA 1XWLA 2I6JA 4R0SA 2CJQA 7AT1B 2X5OA 3K0JA 5K5MA 1HLWA 3QCEA 2MQPA 3CJSA 4ETXA 3DLBA 2NT7A 2CPHA 1OYEA 1JIHA 4OHDA 3HN7A 2MBCA 1FI4A 4ED1A 3TQ1A 1HL6A 3QFHA 1F0XA 1HMVA 2QDPA 1AUSL 2RUGA 3BGUA 2J9CA 3EGWB 2AV5A 4ZPDA 3MZIA 1T3OA 4RWXA 5CD4A 1FERA 3D4JA 2R8JA 3H40A 2P9CA 1Q6JA 4ZIWA 4NLVA 2V4JA 3KLEA 3AJ2A 2PI4A 3OVAA 4BCAA 4AL5A 3NS5A 1RWUA 3K7RA 4WZMA 2IPOB 4KE5A 1WC0A 3MMCA 1JLBB 2FZKB 3GILA 1TMJA 3QCGA 1S57A 2LECA 2BGEA 4YDDB 2VG6B 2D69A 2CJ9A 2VPZB 3H25A 1AT1B 3UN3A 2KRBA 1S6PB 5A2QU 2RIJA 1SQEA 4A47A 4QAPA 1X5OA 3MM9A 2FJXA 2W7OA 1WKLA 1YBUA 2GO9A 4USMA 2Q6CA 2GWOA 2LEAA 3HVRA 1A6LA 3RB4A 3W63A 1ZZFA 2VG6A 5IOLA 1WOPA 2QA4G 3H0PA 1RWNB 1HWUA 4MK9A 4NX8A 5D8HB 3HVTB 1UVKA 3ZMPA 3BLUA 2N7YA 1HNVB 3GB0A 3CCQS 3TARA 4C8ZA 5K9VA 3IR7B 1EHWA 4K0KJ 4FNIA 1UVMA 4GKKF 2RQ4A 2YKOA 1X4EA 3ULHA 2VJUA 2BZ2A 4DQSA 5J1NA 3AD7C 4G1PA 2H04A 4I6AA 1Q6SA 2VUGA 1BHNA 1R6VA 1AA1B 2EW9A 4ZJLA 5HMZA 4F04B 4FKYA 4ED3A 3N0AA 2BXJA 1JLNA 2HNPA 4F25A 8AT1B 4HH1A 1K0TA 2PMWA 3LWLA 2XG8A 2PE8A 4Q0BB 4C0BA 2DXPA 1QAXA 3UVJB 3PV8A 1KP6A 1XIQA 3RAQA 1JLEB 2KN4A 2DNNA 2GS8A 2M2BA 3M7VA 5K9FA 1N0VC 5GAGI 1TZ0A 1ZA2B 4JI2J 4J9PA 1T49A 2YWKA 5GTJA 2PT0A 4RW7B 4G6VB 1XQIA 1TL7B 2IA6A 1V9OA 4F3MA 3NS7B 4KV8B 3UVJA 3FSYA 3H59A 3VAHA 4WP8A 3OL8A 2PI7A 2VPXB 1S1XB 1MWYA 2B0GA 4OHYA 4EO6A 3D0GE 1WC4A 2ABYA 3CB4A 2CJBA 2UV8A 3T6JA 1FJCA 5D4NA 2FZGB 1ZPVA 1MSWD 4NYHA 4ZVTB 4XK8C 4DR7J 1WG5A 4MMOA 3I55S 4H4OB 2VQEF 1H74A 2GZOA 4V1Ak 2OSRA 3FJ2A 4WFYA 1G4WR 4B9NA 4ZMMA 2KZMA 5B08A 1NKBA 1VQ7S 2QGFB 1N4LA 2AKWB 3QMQA 5ETMA 4QAHA 5K20B 4U8VA 2B56A 2FHKA 4H4OA 3WIUA 2WRMA 3W9IA 1ZYQA 2HWTA 3WC2A 3AT1B 1JLQB 3MVNA 4YB7A 1R6HA 3MF5A 4ZP7A 1S77D 3MTKA 1S5ZA 3JTPA 3UR0A 3O1LA 2VKZG 3M2UA 4WOHA 3HSGA 4I67A 3CDBA 2ALYB 3RZAA 3BN7A 1JLQA 3S4EA 3GIRA 3NMAA 1RCOB 1OY9A 3CCWA 3RAMA 3CC7S 2HGLA 1WF0A 3MEDB 2FUG9 5GAEI 1H7WA 3WHIA 3UCZP 3OTOF 1JB0C 4E8UA 4ALZA 1FKPB 2R7UA 4QPTA 4FVCA 3WX8A 1OPZA 2YNHA 2KZZA 4KQZA 4O3QA 5IT9U 3GLJA 2HYIB 5IM0B 1FGSA 2M52A 4EFAC 2RJZA 2QDMA 5HQLA 2BKOA 3SSQA 4P71A 5I42B 2MQQA 4FXWA 5CH7B 3Q2SC 3CVKA 1C2PA 1OY6A 2HK3A 1YJRA 3EXYA 1UWBB 1CLFA 1AYEA 4ZVGA 3IG1B 3FFIB 2ZVSA 3MGJA 2DRAA 2G0CA 4DR3F 4QR0A 4FVMA 3U27A 2OD4A 2C42A 1R8BA 4DWIA 5DQIA 5I42A 2QMUB 2YNFA 2ZC3A 4ED2A 3IWNC 2QMXA 4Z7CA 4DV1J 1RT7A 3OLBA 2W8KA 2XMWA 1FDNA 5CYMB 4Q8FA 2XM3A 4ECRA 2JC1A 1LW2B 1N56A 3FFIA 2GQCA 3L7PA 4GKJJ 2J6SA 2G9OA 5A76A 3VVUA 4XIUA 2ROEA 2KDOA 2V0NA 3D9BA 4CT9A 2H51B 3R97A 1LWXA 4DDFA 3CD5A 5LT5A 4ZCLA 4I7FB 4PUOB 3OUYA 4URSA 2RS8A 1OWXA 1U1OA 4DXLA 4TLRA 1XR7A 1M5HA 2EBEA 5M43A 5T7LB 3IAS9 4IFVA 2VF3A 4HJQA 2AT1B 3FK4A 1N48A 4BC9A 4ICLB 4OHZA 1BQXA 2AJFE 4IG3A 3F41A 3ZZUA 1FRKA 3VZIA 1F5CA 4A8MP 3RYLA 3H2LA 1JQGA 5KFEA 2LQ8A 3MEEA 5B0EA 1YZ4A 5IV4A 1NJYA 1EZZB 2R3VA 3Q83A 2IAJB 4K4UA 3S4OA 3JS9A 4DN9A 2JFKA 3GV8B 5F0WA 2Q79A 4MK7A 2ZJRQ 3BEGB 4ID5B 5D0RA 4DUZF 2HS3A 5KA2A 1XXVA 5A8RA 3DLGA 2XMJA 1HBNA 1K8AT 1OHDA 2ZM6F 1RHMB 3O2IA 2GC8A 2F4VF 2R7SA 1LARA 3I4HX 2JRSA 4DN0A 3T6BA 1YWXA 3OTCA 1T03B 1RWXB 3CXCR 2P6SA 4UQTA 1QTMA 4FZVA 4NLSA 1P31A 1DJ0A 2I6IA 1RTJA 1X31C 2D3UA 3QJJA 1QJHA 2W2PP 1XNRJ 3M05A 1WCHA 2BBEA 3HO1A 3ISZA 1LV5A 3R27A 2UVRA 4KH0B 4DX6A 1G7GA 3BDPA 2I6PA 3ZZTA 2DHAA 3T5KA 3M8ZA 3PY8A 2NLWA 1NB2A 5F8JA 3LOUA 1RWKB 5DDQC 2UUOA 1H7XA 2Q6BA 1MN9A 2RF2B 1B70B 4YHHJ 1FNOA 3H5YA 3M8WA 1YBTA 4D3HA 3DM2B 4LREA 3AOBA 5AXLA 3W2WB 1RAFB 3TQEA 2AM1A 4MKBA 5L1JA 1IBLF 3UCGA 4ER8A 1IBCB 4OZLA 4RI4A 5GADI 2KYZA 4OJHA 2UXBF 2X7IA 3QAEA 4CLLA 3QGIA 2MSSA 4IFYB 5J2PB 2Q47A 4DV3F 3K59A 1PTTA 4UW2A 2BV3A 2HQGA 4MAKA 5C24B 1C0UA 5KFJA 5T41A 1G7CB 4JV5F 1OJ4A 1UA1A 3G8QA 2PI5A 4DQQA 3QIPB 1P9QC 4NLGA 1N5YA 2VDHA 2CNHA 3DRPA 4DX5A 5F9LA 2UXCJ 2W9CA 3ELHA 2CM3A 2C3UA 4DPXA 1WF2A 1IR1A 4JMKA 3KK1A 4Y6IA 3A5JA 4B3MJ 2ZH1A 2FLNA 1NK0A 4LF9F 1OY8A 2YH0A 2RKIA 4DR5F 2UU9J 1SC1B 3HLUA 3TUZC 1EETB 3ONQA 5DZ6A 4QF5A 4CI0B 1E6YB 2AGPA 2GGPA 3PYGA 3DLHA 3NMRA 1S0MA 2QJ3A 3MTJA 5IC6B 1S9GA 3OJSA 4XPEA 1VQ8S 4IH6A 1R0CB 4PYHA 3MXHP 4NLPA 2WAQD 4K4WA 1KLNA 2GAGC 3BBFA 4H4KC 3HI9A 2OJ3A 1H73A 3BQ2A 5EDWA 2LXUA 1YTNA 1VBKA 1RLDA 2A18A 1HI1A 4ECTA 2XTJP 5HAOA 4WIQA 5E7OB 3T1HF 3ZTSA 2ZUGA 2JEGA 2LA6A 1ZC0A 2CMCA 4LFCJ 1HHQA 3OD2A 1L3KA 3HHDA 3K2YA 1F5AA 3A12A 4YQWA 4LF7F 5LMUJ 1PTVA 3EYZA 4PXDA 5FJ4A 1KSPA 3FBEA 1U47A 5DS7A 3OBIA 1IKXB 2WBMA 1IKWA 1SJQA 4CO2A 2H5EA 3DLEA 3QCMA 4RZRA 1L5UA 4KKOA 4X64J 3EDQB 4QBUA 3QRRA 1FRIA 2GCBA 4DV6J 2G4BA 4R5PB 1VQ5S 3A13A 2OUGA 1TAQA 4HHUA 4JI4F 5K14B 3NGRA 1HI0P 1IBKF 1Q5YA 1LWFA 2Y9HA 5CAAA 1N88A 1YWFA 3M32A 3K5LA 2DHSA 5IBSA 2RT3A 1XJWB 3UD3P 1FDBA 3CGIA 2I5JB 2CM8A 1G4CA 3W9JA 1O6XA 3PR4A 4KPCA 4ZS6A 3NOCA 3I9ZA 3PO5A 3J80U 5CYQB 2W8LA 3B4DA 4JI0J 5KADA 2HW3A 2I5JA 2X1FA 1R8HA 4J9NA 4C2MA 5EHRA 1I94F 4MH8A 1VR6A 3GE9A 4C8OA 2CZ4A 3LAKA 4PWUA 2J0XA 5KABA 3D6TB 4Y2EA 4D3GA 2DK2A 2GIRA 1R6YA 3M2RA 4PZVA 3NBPA 1RAAB 1KN6A 3OHAA 1VRTA 2R7VA 1SH0A 2R7OA 1NK5A 1NSKL 1Q8BA 2BM1A 3O3LA 2G0JA 1RWOB 3M8PA 3LO3A 5JMNA 1HWJA 3MEGB 1S76D 4C0OC 2QLBB 1VI7A 2QC3A 1K1SA 2W2QP 1KLMB 3KWMA 1NDKA 3BBCA 3TAMB 1EB0A 4QOTA 4HACB 3GV7B 4DF4A 4C3KA 2UUAJ 3I31A 3BQ1A 3R1HA 1OMSA 3EVOA 2NXCA 2P9EA 4RJVA 1JJCB 4KAIA 4G1IA 4C97A 2C2OB 2E44A 1RAOA 2D7SA 3UE2A 1N5QA 4BS2A 4H34A 2XY7A 4HVZA 1SKWA 3OHBA 4C8KA 2MKIA 3B7OA 2N3LA 2HMIA 4EMDA 4TKTA 4NCGA 4G1QB 3KJNB 3VHQA 4G3IA 1WC5A 5F8GA 1ZCLA 2FPHX 2HHHJ 3T3FA 2MJUA 3MOZA 3BJYA 1FE4A 3LP1A 4C8MA 5L1IA 4F4XA 3JSMA 3FRZA 1HW8A 1O5JA 5IFMA 2I3UA 3ZXWA 5IV3A 4HT5A 2BE2A 1DTQB 2XSFA 2JLFA 2H54B 1Q16B 2C3YA 1NPPA 4IDKB 3R6LB 3H20A 3L7UA 3T9ZA 4CTAA 2GHPA 2VEUA 5DDRC 4DX7A 4XPCA 1ZOTA 4X4NA 2M5YA 2CDRB 1D9AA 2DVIA 5DGAA 1QAYA 4FYVB 1FPZA 4ZVEA 4WKRA 2KT5A 5HVFA 2M3VA 1S1VA 3C6UA 2QLWA 1T48A 2ZBPA 1NCLA 4EBDA 4DR2J 2U1AA 1S10A 2JEFA 3DYAA 5F8NA 1OHEA 2F3JA 4EBCA 3JTNA 2CMAA 1HQUB 2V68A 3GZ7A 1OS5A 2GC6A 1NK6A 2OUDA 1RHKB 3I96A 4DFKA 3GFYA 1QTNB 2GAHC 2YWEA 3VWSA 2C3OA 1F9HA 1PBUA 2FDNA 3KJVB 1TKDA 1PXHA 5D4OA 3MMBB 1U49A 3WIVA 1M1HA 3QLHB 2WGPA 3MM7B 1PG5B 1HQUA 1C85A 3ENWA 3R5AA 1RHQB 5E3RA 4OV6A 3W5YA 2XZTB 2C46A 4K4VA 1YTWA 1JKHB 4X4RA 3FZBA 4DPYA 1DZ5A 4CLZA 1T94A 1LQ9A 3CPWR 3SZ2A 2F8EX 4RBTA 5KG6A 1KKHA 2E5GA 3CCZA 4W92B 4JOUA 3O5XA 1U0HA 3TZZA 3MPVA 1C83A 4IQXA 4RLEA 3G9CA 4RUAA 9ATCB 4YR3A 1OYDA 2HQ3A 2AJQA 2XMAA 1X5SA 2AYMA 1RT5A 2WTFA 1VDHA 4TNOA 2VG5B 5KA1A 3OXFA 4M5MA 1PAUB 3QT8A 4NXNJ 1WTFA 1HBMB 1OQ6A 3THVA 2PFFB 1IVZA 1U48A 4M5KA 4A48A 1IQZA 3KDNA 4ZLPA 4ECUA 3TO8A 3CJ0A 3MPUB 4B9LA 3MAQA 3MECB 2VFUA 3LW5C 2CQ1A 1VLYA 2PA8D 2VG5A 4P10A 1O51A 1BXNA 1W78A 2ZHAA 2VA2A 5DLGA 4X4QA 2LEPA 3CCSS 2MJNA 3Q8SB 3KLGB 4X62J 4RPFA 3PACA 2DR8A 3A3PB 1X9WA 1TL1B 1MMLA 3AHPA 5BZZA 4K50A 4KGXB 3L9ZA 4Y28C 1WHWA 4ES2A 1CJVB 3R7BB 1HNZJ 4PG8A 2R2TA 1GMVA 3UW1A 1S1UB 5LSOA 1H3DA 1U2FA 3ZM0A 3AA9A 2K1RA 4KO0B 3LA0A 1S97A 1NO6A 3I32A 1DLOA 5U47A 3CMQA 2D9PA 3C15A 1ZAVA 2LA4A 1GX6A 4LR7A 1CULA 3T9NA 1JBWA 5A6WA 5BR8J 4L3NA 1ZETA 1UVJA 2F6VA 4CLTA 3QCJA 1W26A 2CWKA 1RISA 2DNGA 3SDEB 4F8RA 3QWPA 2GMHA 2DGVA 1U8WA 3CJ2A 3C8YA 1T0TV 2WONB 4J9OA 1A5YA 4IRDA 3AH6A 1ZH5A 3MM8A 4ZOSA 3N79A 3D3CJ 1OIAA 2M0GB 1E6VA 4CLUA 2V2KA 2E5HA 1VCTA 4PG6A 1RABB 1U8SA 3EICA 1DURA 4L6V3 1XXPA 1X5PA 1K0VA 5KA3A 5L38A 2RE1A 1FRMA 5ETKA 5HP1A 3MPWA 3DRSB 1VRUB 1CSJA 4LQ9A 5KFKA 3S01A 1ZM2A 5CZXA 3E01B 2B4VA 4B04A 3LGHA 3J81U 4ES3A 1D5RA 4JI6F 2R8IA 2ROGA 2UUCJ 1N33F 3OV7A 3QWUA 1X4DA 1Z2LA 1N5SA 4LSNA 2HFOA 3HHLA 1Q8LA 1VRUA 4QIEA 4JYAF 2W4CA 2M7SA 1AUDA 3QCFA 1Y0HA 2CNGA 4C12A 1GQYA 3JAMY 1HNIA 4RW4B 5MMZB 4I2PA 4OMFG 3KLIB 1IJFB 1JLCB 5IZHA 4NLOA 2NPIA 4R8UA 1U26A 4HH0A 4O3RA 2I42A 5DETA 4IR9A 4GO5X 4M5NA 1YLXA 3K5PA 3VV2B 4B3SF 3KLIA 3VGUA 4ZJQA 2GP0A 4WP3A 3EGZA 4ZCKA 5A0YA 2AZ3A 2H4VA 2BW7A 2HQCA 3V0GA 2XMUA 4O4GA 5D0HA 5AJ3F 1C84A 2W4DA 4RNHA 2JWNA 1M5OC 1SC3B 4E2FB 1JBVA 1X4CA 4ILRA 4OI4A 1UFKA 1JLAA 2KT3A 3DOLA 3F99A 2HQIA 2E1CA 1PYSB 1AZSB 1D3WA 3RZ2A 2HVEA 1HBUB 3C14A 2HVDA 1Q8IA 3ZNUA 2ZFHA 5E0OA 2XHCA 4J9QA 4PKDB 4QR2A 5ITHA 5KT5A 4B3RJ 1TL5A 5E3QA 1YKWA 5F0UA 2D9OA 4O44B 4EGLA 3T41A 4RW9B 1P9YA 3HFKA 1HWKA 4J9RA 4CP5A 3DLJA 3QBCA 1VQPS 1DTTA 5KFMA 3G4SS 1M5PC 1IKYB 4XDCA 3EPGA 3D66A 4ZCMA 1RBAA 1TL4A 2IIHA 3W65A 3V4IB 3C6TB 1QSYA 1NBEB 1S6OA 2H3EB 3IBFB 1WAXA 1C4AA 3EMTA 3MM5A 3BBBA 2V67A 4N76A 2J7WA 1TKXB 4EI2A 4JI7F 4RW8A 1VQ6S 4PWWA 2AW0A 2FVQA 4NLDA 1FJGF 2RD5C 3VAIA 3BYRA 3QGGA 1D0EA 3W7BA 3TA1A 4RNOA 4KSEB 2KJVA 3LGMA 4LRCA 2R7RA 3KHHA 4F02A 3M4XA 2VEVA 2DGQA 2GQQA 5J1EB 2BIJA 2LQ9A 1EKSA 3BB5A 2B6AA 3KLFA 3B4MA 3KXDA 2HHWA 4DCJB 1S1TA 2LXFA 4A8WA 3U02A 1RHUB 5EX0A 4YFUA 1JF7A 3RU0A 3AJ1A 1W7KA 2HNQA 4O3OA 4QIVA 5IT0A 5LJ5Y 4X4PA 3CIZA 2Z57B 4ZP8A 2J17A 1MMNA 3Q8YA 1TK8A 5C25B 2KFZA 4RDDA 4FF1A 3WZ0A 3TX0A 4DZ6A 4X4VA 4P75A 4AYBD 3TR5A 1CPZA 3NGUA 1JMTA 1WI6A 5FDLA 4F7VA 1NNDA 4J9UE 1LWEA 1XMQF 2ZOFA 2XI3A 4Y2AA 2HHVA 1RAHB 4AFFA 1CJUB 4J37A 2HXPA 2HNYA 2NT2A 3BSCA 2UXDJ 3PFEA 3HSJA 2AGOA 3V6DA 1Q8KA 3H2VE 2DISA 2JHEA 5KA7A 2RVJA 1FWPA 2DNPA 1S6QB 5J2QA 3TUIC 3PW0A 1PIEA 2ACMA 1Q78A 3G6ES 3QT7A 3HMJG 2CPEA 2B7CB 1J27A 2ZKUA 2B5JB 2Z30B 4Y2CA 3M30B 5A6PA 5LL6d 1XTZA 3DGPB 2V9KA 4X2BA 4LF8J 2G2OA 1RHJB 1PH0A 2VQFF 2WTZA 1GEHA 1NK9A 4KFBA 1YZ6A 3AODA 3G96A 5K9WA 3MURP 1CS4B 1Y3KA 2HBYB 4AD6A 4P2SA 3IWXA 3V6KA 1C88A 1BY9A 4LMZA 1HQ2A 1S0VA 1J5OA 2E1RA 2XZDB 3GIIA 1ZM3A 5HJYA 2ZH8A 1WC1A 2BV5A 4NYPA 1BZHA 3QJPA 1KVIA 1SUQA 1G4US 3OL7A 1S48A 1WACA 2GFFA 5D4LA 2RF6A 2KKHA 2OOQA 4C3LA 4EU0A 1JLFA 5KOWA 1S49A 2AEJA 4W4MA 3WQPA 4OHIA 4DGXA 1BWEA 2CJXB 3MM6B 4DX8H 3R5JB 1LWCB 1REGX 4OHWA 1GFWB 3MMAA 2EFOA 4HEA9 5LSLA 2E7XA 2VOOA 2DB1A 4ELUA 2UVVA 3ZTOA 2DY1A 1OO0B 2POKA 4ZI4A 1QVGR 3QCBA 5L1LA 2ZDPA 1FDAA 5D3GA 4OIXA 2ZE2A 2OPPA 2VBZA 4YP3A 4ECZA 2V2ZA 3CUNA 4U7UD 4UZCA 2J9EA 2KT2A 2DNLA 3ZC4A 1Z2ZA 1X4GA 3FCHA 1TV6B 1VJQA 4OZ3A 4CYUB 3EZOA 5GMDA 1RTDB 4LFBJ 3FEXB 1W25A 3POTB 2NS1B 1YTYA 3VAFA 1CJKA 1FVQA 2FJVA 5HMXA 2GMLA 4IO9Q 4K7QA 3B6BA 1JLGA 3BS9A 5KFUA 1RU2A 2QG9B 4LRFA 1RTDA 4ZITA 1RACB 1C0TA 3HXMA 1SH2A 1HIYA 5I3PA 2D3OR 1YRXA 1GTEA 3ITHB 4P2MA 1G1XA 1U1RA 3VCDA 3HZGA 2C2KB 2E5LJ 2BQ3A 3I87A 2YKMA 3J7YU 3ZMQA 2OLWA 3IA0A 3H42A 4LF5J 4HT7A 3AWGA 2KJWA 4X84A 3FEYB 3QNWB 1N32J 2YPZA 1T05A 4P72A 1CJTB 3IXQA 4YN3B 5DG7A 4K0KF 2Y1OA 1S99A 2F71A 1X5TA 2GW8A 2HVHA 2HBRB 3TP2A 3HFZB 5ETOA 2JFHA 3HJVA 4QDIA 2HZVA 4R0JA 1NZAA 4WFBQ 2E7WA 2C7SA 1VBYA 1R8PA 4IUFA 2RSQA 3CJ5A 1UMJA 5DQHA 3OR2B 4BWJA 4PVGA 3Q89A 2CM7A 4C4WA 3GJTB 1VQNS 2ZD1A 8RUCA 1TKZB 2Q1LA 4ZIYA 1W2IA 1G2EA 3RBDA 2Y2FA 2IM3A 4NZ0A 3I0SB 1UA0A 2JH3A 2AHSA 5BYSA 4DPTA 2HNDB 1HWIA 3M9OB 4EYIB 3OVBA 4JI2F 1EQMA 1SJ4P 3MHYA 3X1LB 5KG0A 4ZPAA 3I4PA 1SKSA 2FY8A 1GT8A 1MWQA 1J6UA 2HEKA 4OI6A 1EQ0A 3S8SA 3IM8A 4PQUA 4F0KA 2E0TA 4A8YA 4LR8A 2CQHA 2DNRA 4HKQA 3R9LA 1UP1A 2ZWOA 1L3TA 4CO1A 3TOQA 1UVLA 1YJ9S 1MROA 1NAQA 1BE4A 4DR7F 4JV1A 2PC6A 2LLZA 1SJFA 1LXJA 3SCIE 5MLCV 2CQDA 1TUWA 3BPSP 1DBDA 1J5EJ 1NLKL 2HS4A 3IMQJ 4K59A 4HDGA 2ZVIA 3TEHB 4ECWA 3GU0A 5J2MA 1BQNA 2I4GA 2MGZB 1FCAA 1RUSA 2MZQA 1PBAA 2BANB 1NK7A 2L9WA 3IM9A 1FXLA 3QFWA 4WF9Q 3UN5A 5JUMA 2LU1A 3M8YA 1EP4B 2CQ0A 5A2QY 2I1YA 2KXNB 1V3AA 2H48B 2OMOA 4HHJA 2NSBA 3SBMA 2DNHA 4LF4J 4M5JA 4NWBA 1M90T 2KYXA 2YVSA 3CDUA 4TU9A 4F50A 2Z56B 2YNIA 2MQLA 4BC7A 1FQ1A 4CVMA 5B0FA 3ZM3A 4KBIA 1EAYC 3GR0A 1Q81T 4DFMA 1X0PA 2F9JA 1KC8T 2PGCA 2IY5B 1X8DA 4ELTA 1XBOA 4FS2A 3SFUA 3A1YG 1L3UA 2WSEC 1YITS 5EHPA 3IS9B 1T9VA 1N6QB 4ERCA 2RQKA 3GG1A 3M6WA 4UOHA 3PHEA 3QZ8A 4I4BA 4I2QB 5I3UA 1TFWA 1KVKA 2W1BA 3W64A 3FMBA 4JI1J 2I6WA 2J7UA 1HARA 4GE5A 4C0HA 1N6QA 4KPYA 3HK2A 1FK9B 1FXRA 5HQMA 4DV1F 3C16B 3UWTA 1HNXJ 3ILJA 2GVDB 2J0WA 3JYTB 4GKJF 5J2NB 1IM4A 3DLKA 4WTOB 2K7KA 1F3VA 4ILMA 2F40A 4OI0A 4DL4A 4C98A 5ETNA 1FVSA 2MKJA 5HK4A 4ZPWR 3MMJA 4RNFA 1SV5A 4CO0A 2HHUA 3IBWA 3I56S 2IC3B 4DL3A 3GMGA 5LMNJ 4TY8A 3RR7A 3E2EA 1KFDA 1JXEA 2XY6A 3CMES 3DRRA 3MCMA 4J7CA 4Q7AA 3D1OA 1HWLA 4MYUA 4LSZB 2HFZA 5BYRA 2V5HG 1SQGA 4C13A 2BJ7A 5K8NA 1GH8A 1Y5LB 5LXYA 3T5JA 1Q6TA 1RBLA 1UJ4A 2NQPA 5HMYA 1UZDA 2LMIA 4FN5A 4ERDA 1YBAA 2CYYA 1W7WA 4AE5A 1NEEA 3O4UA 5EX3A 4TXSA 3VAJA 3VALA 2CIMA 2MKSA 4DCPB 3LANA 3VR1A 2OTJS 4F4WA 3PO4A 2MHNA 3UR3C 5DG8A 4PEOA 4YOEA 3FEZA 3R7NB 4OX6A 1FF2A 4JBCA 1U6FA 1XC9A 1G7FA 2CFVA 1FT8A 4DV5J 5AXKA 2L08A 3GONA 3GR1A 2GO8A 4F0MA 1YTSA 1XNRF 3I0RB 1C1CA 5G4DA 2C3MA 4GRZA 1YK9A 2EK6A 3WX4A 1U6BA 3KK2B 1KQSR 3M1VB 3LALA 2OPQB 4NLRA 4C11B 5DM6Q 5IT9Y 2F70A 4QUMA 1LW0B 2F8HA 3KOAA 3DOKA 2FHOB 1ONYA 1V3ZA 3R7SB 5KFLA 2HWIA 4NI2B 1NPRA 2W24A 4JI3J 1GNKA 3SV4A 2IHR1 4GMKA 4QIGA 1S1WA 4RL1A 2BJ3A 1R0AA 1RSCA 1VHIA 3MOJB 4U9RA 3X3UA 1YJWS 2PO4A 7FDRA 1PILA 3C3LA 2XS2A 3LP2A 4HI2A 5F9NA 3IN5A 4ECYA 3G86A 4X4UA 2UVWA 4RNMA 4RX6A 3DKDA 4NCBA 3BREA 4F4KA 4QZVB 2EC2A 3R5BA 1R8CA 1WKJA 3M4UA 5C42A 3ZTQA 5LM7E 1KWMA 2UXCF 2CPYA 2QE5A 2D74B 1RYRA 4B3MF 3OFEA 5K24A 3D28A 5GAGU 1VMBA 4K2XA 2UU9F 2XCAA 1RA7A 1WWHA 1AROP 1M5KC 3VF0B 3UCUP 3I82A 4DF8A 3KG4A 2R8KA 1FFSB 3F9BA 3PJWA 3NCPA 2IM1A 4OYMA 4C8YA 3T5LA 5EUHA 2N7CA 3AFGA 4CT8A 5KG3A 1U45A 3S3EA 5HDEA 4LF1A 1U1KA 4ETZA 2OPRA 1YVFA 2B3TB 1UJ6A 2B3OA 4J9LA 2HRUA 3SXLA 1R31A 1GK8A 4J91A 3M8QA 1PO6A 2MDAA 1FD8A 3PJXA 4QWCA 4FYDA 1S9EB 3G6VA 1D1UA 3QSYB 4JI5J 2EFNA 5IWAJ 1UJ5A 4LRDA 3HT0A 3I5AA 4LFCF 4D3PA 2VH7A 2KM8C 3BKUA 3NRBA 2Y68A 2LKZA 4QJVA 5C5JA 1KONA 4K4XA 5LMUF 3OQ2A 2R0BA 2JL9A 2RRBA 1QSSA 2ZBRA 2RMLA 2CVEA 4ZPVR 3FSXA 1QE1B 3KFWX 1WEYA 3NL0A 2XSJB 1SC6A 1DQ9A 5AXMA 1PJ5A 2DXEA 2AD9A 4Y2KA 4X64F 3I5CA 2HFSA 1RAGB 4B9UA 2A6OA 3AA8A 4DV6F 4ECQA 4ID8A 3BSOA 2P6XA 1VYAA 5L1KA 3IAM9 3HT3A 5HROA 1PTUA 2XSJA 4OZ5A 4YS2A 2M9KA 5HN0A 1BZJA 1YFOA 1FKOB 5GAEU 3V81A 4KRWA 1HHSA 2W9BB 3MPYA 3N4WA 2DGXA 2VORA 2HCMA 4NYZA 1LFPA 4DL2A 4HV4A 2QTWA 2BOPA 4PCQA 3NCRA 2HFVA 4JI0F 4PWDA 2AJ0A 1NDCA 2K06A 1RT3A 5CA5A 2HAFA 3HCXA 1S7HA 3OXGA 2UUPA 4CLSA 2XI2A 1WC6A 2DTJA 1H72C 3PNIA 3IRXA 5M2UA 2WOMA 4TQRA 1RXOB 3G82B 4I6YA 2F6YA 1N5VA 2VD3A 3FCWA 5J8RA 4LF2A 2UVUA 1RB0A 5D77A 4ZRTA 4P52A 2VFVA 2AP6A 4FPRA 4B3OB 4M94A 1LEOA 5IQ6A 3GIJA 3PYZA 4F0HA 2BQRA 2FD2A 2I5XA 4FXDA 2VTEA 3BSAA 1UW9A 2HNZB 4MK8A 1PCAA 3FBCA 4EK2A 2YBVA 2E9RX 4P2FA 2QBSA 2YKPA 2C28A 2AYGA 1YJTA 2BJ9A 1BZCA 3ILLA 4DV7J 5D78A 1HPZB 3PR5B 2OHDA 3SI8A 3LK7A 3UAGA 1RJJA 3HVWA 2UUAF 3PW7A 2B7BB 4OYWA 5DQGA 2O67A 1UPPA 2KXHA 4N8OA 3FZ2A 2FJAB 1KHVA 3BGFA 3AQPA 3PVXA 2RUSA 4UOCA 2KHCA 2KFNA 1U1QA 3NEKA 3MOWA 2VASA 2IJNA 1WG1A 2YH1A 1FX4A 4QWAA 3TAPA 4B3TJ 1FRHA 2MKHA 3D68A 4LRAA 2V94A 4ZVFA 1JLBA 1BQMB 3GCXP 4IH5A 4QCLA 2AEFA 4USWA 3UDEA 3PX6A 4WYLA 2HGNA 4ZVSB 4CCHA 3LTOA 4A8QA 2HHHF 2VPWB 4ATNA 1FESA 1S6PA 1GMWA 3UN2A 3EE3A 3WC0A 3OSNA 3S7RA 3RO1A 3MR6A 1BQMA 4O3NA 3OR1B 4RO0A 1N5TA 5ADZA 4CH7A 1KQKA 2XS7A 5FD1A 2VZ9A 4HI1A 1RGVA 3DI6B 2IMOA 2BRLA 1EX8A 3HVTA 5IBMA 2LDIA 1OETA 3DRYA 2M70A 2K2PA 1HNVA 3P3DA 2CXEA 4I56A 3U96A 4J9SA 2EVZA 2OH2A 2HIQA 2CJZA 4TVVA 4L76A 2UUTA 2WSFC 4JI8J 1L3SA 2K3IA 2DNOA 2RH3A 1CG2A 3PW2A 2BMBA 2B07A 2PBNA 2B4UA 1N8RT 4DR2F 2W2OP 3CCRS 3AB2B 3HVAA 3LAMA 2CQGA 3ZZPA 2SXLA 4K4YA 2MKCA 3P49B 5KFXA 2UP1A 1U2RA 3EU0A 2JC0A 1WHYA 1FEEA 2BX6A 4Q0BA 2CQ3A 2G0IA 2YKNB 1WEZA 1PYNA 2R7TA 4JB8B 1JLEA 2GMJA 3H2XA 4URGA 1QLNA 4RKKA 1S59A 4WFZA 5GADU 2IRUA 2Z0GA 3LP0B 4A8FA 2ZH5A 5DZ7A 3DLLQ 4LF6J 3QCIA 1J4XA 3VTIA 4RW7A 1MW7A 1RWMB 1TL7A 3MAAB 1OESA 4LIRA 4KV8A 2Y1LB 2WW4A 3VAGA 3BQ0A 4TLQA 1WELA 3AD9C 1S1XA 4RW6B 3CT9A 1TL3B 4P73A 2R42A 2H1YA 1UAGA 4UQGA 2PMZD 3GWCA 2W2NP 2MLXA 3CCMS 4M63A 3R1LA 4PABA 1N0UA 1HKAA 4YEAA 4ZK7M 2H9ZA 5KFAA 2FC8A 3UD5A 4RW6A 2N4CA 2LQJA 2RRAA 2QL7B 2Y67A 4NXNF 2AWZA 3CC4S 2V63A 2AYBA 1LNQA 1X9SA 3H8YA 3DU5A 4PAAA 1R8AA 1SIWB 3NGDA 3PW4A 2BDPA 2E5IA 1YDLA 4RUBA 2JOQA 3CD7A 4XDDA 1A9NB 4DS4A 2KU7A 3N28A 3QGPA 4DLGA 1NKEA 4WZQA 3D67A 5D4PA 3BO2A 5KFZA 2HFNA 1VQ4S 2OIHA 3BH6B 4X62F 3F0NA 3G8TA 1A0OB 1GXTA 2KXFA 1H38A 3ICLA 2QN6B 5LSRA 4PR6A 4M5HA 4NOHA 4GRSA 1HNZF 2QEPA 1JXVA 1KHWA 3PHTA 2F6FA 2OGUA 1SXLA 4QYZJ 3PRDA 2J5AA 3MEDA 4LBPA 3RJMB 2IYIA 3VGTA 1Q1MA 2MLZA 4OZ1A 3J7Z5 2GCAA 4URQU 3TYTA 4ED0A 3GXGA 1S0NA 1FKPA 4UOGA 3U1LA 4LUBA 3TVZA 5BR8F 5IM0A 1RTIB 3RW7A 5KG5A 2QBPA 2CJAA 1Q6MA 4P7TA 4ZP9A 3MFIA 2F9DA 4XTTA 2J76E 3NNHA 4M5GA 1Y4ZB 2FIUA 3H98A 4IQMA 1UWBA 1FRXA 4KGVB 2HAIA 3IG1A 5E3AA 2ASLA 3LWMA 4TQSA 2KH9A 2O5DA 3A3OB 2ZH9A 2XYGB 1YPTA 4AZ1A 2BKNA 4Y34A 2EI5A 3H5SA 2UZAA 1U2CA 5CYMA 3H7HB 1FTRA 1LW2A 1PYTA 2N82B 2XY5A 2Z58B 3UI3A 1WUUA 2WCXA 2MZ1A 2W7PA 2I75A 1XN9A 2MEWA 4CNZA 1HYSB 2HVIA 4I7FA 1X4AA 3MUMP 5KA9A 4IRKA 4PUOA 1C86A 2DEJA 4F2SA 5A5EA 1R7IA 2UUCF 2PA3A 3HF5A 3V4MA 1U09A 2W2MP 1Q79A 4BUBA 3KK3B 2CNFA 2AJ2A 1HHTP 5T7LA 3KHGA 2Y1IA 2LDYA 2KL8A 4GS0A 2F63A 4ICLA 1ZTTA 4M5DB 1HD1A 4KJIA 5KFBA 4DPWA 2VPYB 2DGSA 2Y0BB 3TA0A 5I4MA 2BZLA 4DGPA 1XEZA 4I68A 4I1TA 1LQFA 1BC6A 3W62A 5F3ZA 2NXNA 3N01A 2ZMMA 4WK3A 3CJTA 1AFIA 1S4EA 2IAJA 2UV8G 2OEKA 5D0EA 4C8NA 4PXCA 3L7OA 4I6WA 4ID5A 5A8KB 1B7FA 2V8PA 5LJ3Y 2NCKL 5HMWA 2DHXA 4DQPA 3FQKA 1KBRA 1P27B 1K1QA 3IBCB 1GMUA 3BYPA 3IC1A 2DT9A 2QSFA 2F6TA 3G8SA 2CADA 1HQEB 2HHQA 3OSPA 5B0CA 4DR6J 1T11A 3AAWB 3MCNA 4LBIA 4B3RF 3BF4A 4B17A 4PXBA 1T03A 5IT4A 1QDUB 1C87A 1F1BB 4USHA 3H4DA 3ZTRA 2G2ZA 3NAIA 2BJ1A 3CC2S 1A7GE 2PDAA 4MKAA 1IKVB 3BO3A 5E3PA 5KOXA 3KG0A 3CO0P 3GJRB 1Z1ZA 2JJDA 1AW0A 3ZM5A 1YI2S 3SQGB 4AXIA 2OSQA 4DEZA 2F4FA 2RF2A 1GFYA 2IYGA 2ZJPQ 3CCVS 2HC2A 3DM2A 3W2WA 1T9XA 5EWGA 4UOFA 4EZ6A 2CNEA 5AE1A 4OYPA 1LKZA 2OPSB 4NCAA 2FJEB 3NWRA 5C2CA 2AJ4A 2H65B 2F00A 3KJFB 4FF2A 2E1MC 2YKQA 1XR5A 4IFYA 2VOSA 3AQOA 5J2PA 3G6YA 3RRGA 4PPZA 3K58A 2EKYA 2DEIA 3R3TA 3DMJB 5KT7A 5C24A 1RK8A 4HTIA 5DRKA 4CLFA 3GG0A 2V34A 4DSJA 2PN6A 4EZ9A 1V3RA 2QV6A 4LQ3A 3OTBA 4YMEA 3BKFA 4JV0A 4J9MA 1H6KX 5KT4A 2Y0SD 2HVLA 3JSRA 3QIPA 2RHSB 3J81Y 1JNRB 2XYHB 3CSKA 3R5DA 4NWFA 1BD6A 1C1BB 1NO8A 4F67A 3MR7A 4X66J 1X7VA 1KD1T 2FJWA 4ZHRB 4B02A 2QX0A 2DPIA 4DUYJ 2VICA 5B0BA 1MNEA 3EZZA 2XYPB 1DY3A 1MU2B 3ISND 2IJRA 2MKKA 2R2RA 1EETA 4NZ7A 1WSVA 3TNVA 1NPKA 1M3GA 1NXIA 2XBPA 1E6YA 4AL6A 3T1AA 1KRPA 1IR2A 3FQLA 1UL3A 3EWGA 1NU4A 4IR1A 3K5OA 1ONZA 1REVB 2ZBIA 3AXMA 2HRYA 4YB6A 5ETTA 2WBRA 2BYCA 5FLXU 2FHJA 4H4MB 5AWXA 5L9XA 4RBVA 1OEOX 2IJFA 4U7UK 3EM1A 1VHRA 4NLYA 1VBZA 4F36A 2AGQA 4LFAJ 3BGRB 2UXDF 4RUHA 2KB2A 5HBMB 1RT2B 3D1HA 1R0BG 1FKAF 4YR8B 1TKTB 2DBBA 1K47A 3QKQA 3H4BA 5HLFB 4D3QA 4RU9A 3T1YJ 2IVYA 2IA0A 2HG4A 2GVZB 3MI7X 1IKXA 1GX5A 2C2NA 3VAMA 4ZPBA 2YDUA 5A8WB 2Z2LA 1BGXT 1V5VA 2C1EB 2ZWPA 1CQMA 1WHXA 1RTHB 4LF8F 1U1LA 4R5PA 4M5LA 2HHPA 1X4FA 1GTHA 4I8NA 5L8RC 5K14A 2HPUA 3LF0A 4PG4A 1MKPA 2L41A 1OQ3A 1T02A 3ET6B 2CPZA 4HTJA 2V8GA 1PJ6A 5K8MA 1N54B 1LYVA 1Q7LB 3LUYA 4GO7X 1JNZB 1S7IA 1RT6B 4NMXA 2J16B 3TVKA 3PS5A 2DY9A 2VODA 2B49A 1FE0A 3SQOP 1U7LA 3DOMB 3MR5A 1I9TA 5K25A 1N36J 5KFCA 5KA8A 3IFEA 2KHDA 5GMEA 5CYQA 2YQ0A 2XULA 1ZM9A 3BM8A 3DXBA 5E33A 4QYZK 2J16A 2QA2A 3OL6A 4OHVA 4N56A 5HVHA 2XLJA 1F3FA 2VC1A 2MB0B 2KVIA 3KYLA 3QRQA 1RT1B 1T9YA 4X4SA 2HBQB 5GAHI 4IYQA 4QWDA 2DH8A 3HHLD 2XWXA 5EWEA 5EGYA 2H02A 2JVRA 2WVFA 1N34J 2OFGX 4NZ6A 1FDDA 3M2VB 2FHMA 2HLTA 1KVJA 1YGRA 1SI9A 1WI8A 2AHOB 5ETQA 2HWHA 4JP8A 1RT1A 1QUPA 2R7XA 3MEGA 2PEHA 1CVJA 2CPJA 4OYIA 3GXHA 2B9YA 1S72S 2YNGB 1KLMA 3VAKA 3TAMA 1O5ZA 1NUEA 3O8WA 4XO0A 1H2TZ 3SR9A 4LFBF 4HACA 3KLHB 3H90A 2YY3A 3K17A 5MAOA 4KT0C 1RYSA 3PW5A 3QO9B 1ELOA 4ZKAA 4NXMJ 2G1HA 4OJ1A 2YNGA 4DPUA 2OI2A 4OX8A 2VL1A 1XM2A 5IS2A 5E2QA 2VONA 1AB8A 4PPDA 4U7CA 4IG0B 1T3NA 4Y00A 4DG1B 1WEXA 1F5BA 3BGLA 4G1QA 4HR2A 2ATLA 2DO0A 1TVRB 2E5LF 4WE1B 4DSKA 4C3MA 3D5MA 4QU7A 4HJPA 1HBOB 3V6HA 1NMEB 3CCES 4CO4A 2I0XA 4LF5F 4IG0A 2KG1A 3BV8A 2WK4A 2BOAA 3NKYA 1N32F 1R43A 3HJFA 3KDOA 4WBFA 3D6FB 2FVCA 3RUBL 3NWGA 1HMVB 1DTQA 3Q23A 4DV4J 5LXRA 3M9NB 3AWEA 4YY3F 1UKUA 1IQTA 2GJTA 1TU0B 4IDKA 3EZ5A 4FPIA 5BX1A 2V4JB 3LPEA 4FXVA 3KLEB 3ISNC 2OFHX 2RNEA 4DV2J 4OQJA 2OTLS 1DARA 1VBXA 4DR4J 4P74A 2R9LA 5DDOC 2CQBA 4Y65A 6FDRA 2FC9A 4WXWA 2DR9A 2X1GA 2DR6A 3MMCB 3SV3A 2PEBA 3IP0A 2QYGA 5EN1A 1P8GA 2PD1A 3Q8PB 1B4SA 5K8OA 4KY3A 1L8KA 2MY8A 1U1PA 2NR0A 5K22A 4HDHA 2VTDA 1QUVA 2BACA 1PC4A 1V6HA 2CNNB 4QPXA 2H4YB 3MM9B 2IM2A 1RBOB 3MCOA 2Z8QA 2HKEA 3KJVA 4WFAQ 3MMBA 2CPXA 4DFPA 3QLHA 2DH9A 2JFDA 3MM7A 2QMWA 4ITSA 4OX9J 3KUEA 3W9HA 2YXLA 1WNEA 2C22A 5M2PA 4ZN5A 4M95A 3W60A 2CG4A 3TA2A 1JKHA 3R2CJ 1NJZA 1GXUA 3CJKB 2FVSA 3FGVA 2XO6A 1SKRA 1JJ2R 3AWFA 3RB3A 4L74A 3NNAA 3TEGA 2C2DA 3SMEA 5IC4B 3BR9A 4ZN1A 1ECVA 2H03A 3SIPB 3CJ8A 2VEYA 4OHEA 4KB7A 1FJ7A 4GVLA 2WZ1A 3CJKA 2C2MB 1J5EF 3NGTA 5KFPA 3FCVA 2UUBJ 1I3OB 1GXLA 2MQMA 1HBMA 2V4RA 4Z2XA 4NA2A 1K73T 4MKVA 2XMTA 4BLGA 4GWFA 2HK2A 2P5VA 5AT1B 1FJEB 4PG7A 3KTQA 3MECA 1TK0A 2MZJA 4W90B 3EVMA 3MCSA 4MTPA 1HA1A 3CDAA 1VC0A 3PKYA 1UEVA 1OSDA 3GJSB 3KLGA 2VB6A 4LF4F 5GVQA 1TL1A 5JJBA 4ZDNA 2JLEA 1NJWA 4OYOA 2FLLA 2O3DA 1XERA 1CJVA 3ENQA 2G1DA 4AT1B 4FDFA 2P4DA 4USVA 2F1FA 3JB9k 1S1UA 2W7AA 3HD1A 4A4JA 4KO0A 2R7QA 1X4HA 5KFDA 4G65A 2Y96A 5KFYA 2AQ4A 3QCLA 2QO3A 3HHLC 2EK1A 2AX1A 5B0GA 2EBGA 3O6QA 1NH8A 4FNHA 4KH1B 1RAJA 2H5JB 3N6NA 2RQCA 3V5RA 2MKYA 2I6MA 1TMMA 4WXOA 5B0AA 2MTLA 3SDEA 4EYHB 1JJ4A 2XNQA 8ATCB 2DCUB 2WJPA 4JI1F 2WONA 4X65J 1SL1A 1B64A 2LU2A 4NX9A 1YJUA 3CE8A 2OZ5A 3AD8C 4NLQA 3TX8A 3UFCX 1HNXF 4Q43A 2XHWA 3CDWA 3CDEA 3DN9A 3M2UB 3DCAA 2U2FA 2ACYA 1OEUA 1NJIT 1NM2A 1VISA 3A5KA 3SCKE 2MLYA 3TI0A 1VC6A 1NHVA 3PFOA 3W8GA 4ZLNA 1URRA 4RR5A 2QFIA 4KTQA 4KYZA 3DRSA 4USIA 1T95A 1U6ZA 1P6TA 5DDPC 4NL5A 2GHVC 3BH7B 5LMNF 3S3FA 3E01A 4BHQA 3QGHA 4RNNA 2XQCA 2F6WA 3HULA 5H9EJ 2KI2A 1I6JA 3P5TL 2CFXA 3OTDA 1Y5IB 2YNHB 2GJIA 3OJUA 3RGIA 3B82A 3W61A 4AUKA 2ADBA 4Y0FA 3G6XA 2GQ2A 3VQTA 5CCMA 3D3BJ 2E7VA 4LR9A 5KT6A 4NA1A 2LEBA 4WCEQ 1Q5VA 2ZNYA 3EPIA 4ZVQB 3ENVA 4RW4A 3K89A 3Q24A 4J9VA 4WWSA 1JLCA 4ED4A 2VC0A 2RDJA 4OHLA 4CVKA 4MFBB 2YNFB 1X9MA 4ZN3A 2XCPA 2ROPA 1Y5NB 2DGWA 1RT7B 3TJ9A 3OVSA 4A8XA 2HS0A 1J2VA 4EEYA 5H9FJ 1QVFR 2ZEJA 4NNDA 3O5TB 1FRLA 2HLUA 3A8JA 1ZPWX 4MFBA 5KFWA 2EPIA 2V2QA 1QXKA 2MHEA 2Y1JA 3FRYA 2CPIA 3OUYB 1XBWA 2V8VA 2ZHOA 2OAUA 4DV5F 3PRBA 2QLXA 5F8MA 2G13A 1Q0NA 2ESBA 2CMBA 1E0DA 1AZSA 1HBUA 1UFLA 3DFEA 4WIIA 2I2YA 3AOAA 4IFVB 1WD6A 7FD1A 3BPDA 5L9NA 2ASJA 3F56A 2VG7B 3EX7B 2DNQA 4OZNA 2ILZA 2KRRA 4O44A 4V19J 4LBHA 3Q22A 1GQQA 4IG3B 3ADAC 4RW9A 2XWYA 1PAEX 1SJRA 1UTAA 3NOGA 3NS6A 3KG1A 4DL7A 3PCOB 1NHUA 3MEEB 3W8PA 4JI3F 3ZZOA 3Q8UA 1IKYA 4K4ZA 3V0EA 1NZ7A 2VG7A 1WRMA 1HNWJ 1AAXA 1Q1KA 2D41A 1EENA 2ZC4A 4DR1J 2HVZA 4L73A 4P2XA 1T9TA 2QLFB 5A8RB 3V4IA 1WDDA 1KAVA 3C6TA 3DLGB 2IM0A 1HBNB 5JVHQ 2BQUA 2P2CB 1YJNS 2IVMA 2D1CA 4PQAA 4WPAA 4N5SA 4Z6BA 1P1LA 3E3XA 3M8RA 3VGVA 4NWGA 3RG6A 2ADCA 3KHRA 4V19X 2Q05A 3LQVA 1LXNA 1TKXA 3ILIA 2FB0A 1XMOJ 1HD0A 4AQYJ 1SIZA 4RU2A 2BABA 4MYTA 1RTJB 3EXCX 2FJNA 4B9TA 4OJGA 4NLXA 3FBBA 2VA3A 1B0PA 3C2PA 1SPBP 1SL2A 4TU7A 2N3OA 5J1EA 1IM6A 3GIKA 3DDNA 1OHCA 5KG7A 4C48A 3KNGA 4TVAB 4N77A 2AMCB 2CRLA 2DITA 2WSCC 3NMEA 2BGDA 5KG2A 3IWLA 3HKWA 2RB7A 1ZAWA 1RP5A 3EGNA 3M6UA
chains in the Genus database with same CATH topology
3R5AA 2MYFA 5E3RA 4FBUA 2E9RX 2QBSA 5A8KA 2YKPA 2C28A 2AYGA 2XZWA 1YJTA 3DLKB 1Q86T 1BZCA 5C25A 2C46A 4KIAA 3FMWA 4K4VA 1YTWA 1JKHB 5D78A 4X4RA 4ED8A 2FGCA 3FZBA 1HPZB 1WG4A 3PR5B 1X24A 2M88A 2MZSA 1DZ5A 3SI8A 2PMHA 1RJJA 1C0UB 1T94A 3OTEA 4DL6A 1LQ9A 3CPWR 3HVWA 1SV5B 2UUAF 3SZ2A 2B7BB 5DQGA 1DQ8A 1Q4RA 2O67A 4OZJA 2F8EX 4RBTA 3PW7A 5KG6A 1RKJA 4JI5F 1I57A 5IWAF 2E5GA 2KXHA 3CCZA 3GYNA 4N8OA 4W92B 3FZ2A 4Z37A 2FJAB 4JOUA 3V0IA 3O5XA 1HQEA 1KHVA 3AQPA 3BGFA 2I4HA 3Q0AA 4MKYA 3PVXA 1RDRA 3MPVA 1C83A 4TY8B 4IQXA 4RLEA 3KKFA 4NLUA 4UOCA 1N5YB 4RUAA 3G9CA 2KHCA 2GHWA 2KFNA 4YR3A 1C4CA 3OXLA 1U1QA 2HQ3A 2ZKTA 3DRPB 3LPYA 3MOWA 4DBQA 2AJQA 2VASA 2IJNA 1WG1A 2QDCA 2C3PA 1X5SA 3DDKA 2YH1A 2AYMA 1RT5A 1HW9A 2WTFA 4KI9A 3DRRB 4OHHA 2W9CB 1YRTA 4NYOA 4QWAA 3P6YC 4FP9A 5BJRA 3PIPQ 3TAPA 1FRHA 4TNOA 2MKHA 2VG5B 5KA1A 2V94A 3OXFA 3FNNA 1RXDA 4ZVFA 1FA0A 2CQ2A 3Q8RB 1YGYA 1WTFA 1HBMB 1OQ6A 3KK1B 3THVA 1JLBA 3I36A 2PFFB 1BQMB 4IH5A 4QCLA 1IKVA 1U48A 2IRYA 2WB1D 4A48A 1S6QA 1IQZA 4ZLPA 4ECUA 3TO8A 3CJ0A 4B9LA 2RKIB 3MAQA 2X1AA 3D54A 3MECB 3PX6A 4WYLA 4ZPTR 2VFUA 2HGNA 4CCHA 4A8QA 3LW5C 2OKQA 2HHHF 2CQ1A 2VPWB 3L95X 3NLCA 4QIFA 4ATNA 2JEIA 2GGPB 1FESA 1S6PA 2B5JA 3SQGA 1VLYA 2PA8D 2VG5A 3SSRA 1FNXH 3EMUA 1O51A 2DGOA 3WC0A 3OSNA 3M30A 2ZHAA 1VGYA 5E3CA 2JSXA 4UUWA 2XMMA 1HNWF 3TANA 3S7RA 2VA2A 1JWWA 3DGPA 5DLGA 4X4QA 2LEPA 3RO1A 3MR6A 1S9GB 1BQMA 3CCSS 2MJNA 3Q8SB 3KLGB 4O3NA 3OR1B 4DR1F 3WBZA 4OI2A 3PACA 2DR8A 3THTA 1X9WA 3MD3A 1N5TA 1TL1B 3B78A 3NG8A 1MMLA 4CH7A 5ADZA 2XNRA 2F6ZA 3ZZYA 3AHPA 1KQKA 5FD1A 2XS7A 2PQ5A 5BZZA 1KAKA 1PTYA 3D1QA 4B9SA 3CF5Q 4JMJA 2VZ9A 4HI1A 1RGVA 5FIIA 3US5A 3DI6B 2IMOA 2OPSA 2MQOA 4U6PA 1NL9A 2BRLA 3HVTA 4K50A 3J7YI 5IBMA 4Y28C 2LDIA 3SCLE 2I6OA 1WHWA 1OETA 3DRYA 2M70A 4ES2A 2K2PA 4J51A 1HNVA 1G3OA 2B9WA 3PX4A 5HO4A 3TRGA 1C86A 3P3DA 4I56A 4PG8A 2R2TA 3U96A 2IBKA 1S79A 3UW1A 4J9SA 1S1UB 1TP7A 2EVZA 4N8NA 5LSOA 1H3DA 1F9FA 1U2FA 2QA1A 2NZ6A 3QCHA 2NLKA 3ZM0A 3AA9A 3UDCA 2OH2A 2K1RA 2FLOA 2HIQA 4E98A 2CJZA 4KO0B 4QBWA 4TVVA 1XMOF 1XK8A 1S97A 1NO6A 4QU6A 4QBEA 3DMJA 1IUJA 4AQYF 2DD8S 3I32A 2UUTA 1DLOA 2XMKA 5U47A 2D9PA 1VK3A 2WSFC 4HLBA 3AY0A 1T4JA 2B4SA 3GFXA 1L3SA 1ZAVA 2K3IA 2LA4A 1NNYA 4LVOP 4YR0A 4CH1A 2DNOA 1GX6A 2RH3A 5DO2A 1CG2A 2ZH6A 2DH7A 3PW2A 4MJKA 3CO9A 3MDFA 3ZFVA 2B07A 1LFWA 2R4FA 2YX4A 3DHWC 2B4UA 4I69A 5E5NA 4FF4A 4WKYA 1L8GA 2PBNA 2K3KA 1OSCA 2M4MA 1N8RT 1C1CB 4DR2F 4ZPCA 3T9NA 3CCRS 2VBXA 3AB2B 3HVAA 5A6WA 2RRNA 3C66A 5E41A 3LAMA 2CQGA 1U25A 3ZZPA 4LT6A 1C1BA 1KTVA 2RQMA 2SXLA 4L3NA 1G1HA 1ZETA 4K4YA 1UVJA 2MKCA 1G1GA 4JV2A 2F6VA 3EAXA 4WFNQ 3P49B 1YQHA 3MM6A 5KG1A 3CCTA 1D9FA 5KFXA 2UP1A