3O3LA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol (1,3,4,5)tetrakisphosphate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
315
Chain Sequence
EQTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of substrate binding in PTPLPs
rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
total genus 109
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o3lA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3o3lA02
2H02A 3MMJA 2BZLA 4NWFA 4GFVA 4NYHA 4NX8A 1LYVA 1FQ1A 4GE2A 2QDMA 1G1HA 4KYQA 2C46A 2I42A 2Y96A 4QAHA 3I7ZA 2G59A 1VHRA 1T4JA 1KAVA 2HC2A 4JNBA 3O5XA 2CMAA 3QCGA 2HCMA 2NT2A 2H4VA 4OHIA 1PYNA 4QBEA 4BJOA 3ZM3A 2MBCA 1XBOA 3O4SA 2P6XA 3I80A 5AWXA 4HRFA 2CNGA 3S4OA 3BM8A 3ZMQA 1T49A 4GE6A 5K9WA 2PQ5A 3S3EA 1OESA 2F6WA 1D5RA 1C85A 2QEPA 2F6ZA 5BX1A 5GTJA 1PTUA 3GXGA 3EU0A 2ZMMA 1I9TA 2F6VA 2CNHA 2CJZA 1RXDA 1A5YA 2CFVA 3F9AA 2J16A 2M3VA 2HVLA 5KABA 2QCTA 2HNPA 1NWLA 2B4PA 4DGXA 3AWEA 4S0GA 3D42A 3V0FA 1L8GA 2H04A 2RF6A 2R0BA 3CWEA 2ZN7A 2A3KA 4QBWA 4PYHA 1GFYA 3QCCA 1PA9A 1U25A 3RO1A 1YZ4A 4KYRA 1U26A 2I4EA 3F41A 2NT7A 5KADA 2CM8A 2I3RA 1NWEA 2HNQA 2YDUA 5J8RA 5KA4A 5KA7A 1ZCLA 1I9SA 5IBMA 1YPTA 2B4SA 4QAPA 5BUGA 5K23A 2HXPA 3S3KA 2I4GA 2QBQA 4HJQA 2OZ5A 1C84A 2Q05A 4Z6BA 1PTVA 3AWGA 1FPRA 1YN9A 2A8BA 3ZM1A 1XM2A 4RHGA 4RI5A 4DGPA 1YTNA 4MBBA 2PBNA 2VEXA 1ZC0A 2NZ6A 3D1OA 2WGPA 1EENA 1G7FA 4H1OA 2QBPA 1G1GA 2F6TA 1GWZA 4RI4A 2F71A 5KAAA 2I6IA 3QCFA 4OHLA 2F6FA 2QCJA 3MOWA 3QCKA 3F99A 2FJMA 3RGOA 1YGRA 1EEOA 2I6MA 4AZ1A 1MKPA 2BV5A 3EB1A 5K24A 3V0JA 2J16B 4D3RA 2CM3A 4GS0A 1NNYA 3S3HA 1OEVA 4ICZA 2BGEA 5KA3A 2Q47A 3A5KA 1LQFA 1PH0A 3D44A 3H2XA 3BRHA 3D9CA 1OHDA 1Q6SA 1C86A 2I6JA 3MOZA 1JF7A 1Q6MA 1NZ7A 4JBCA 3SR9A 1M3GA 4PVGA 1OHCA 5K25A 4I8NA 2ESBA 2PI7A 2F6YA 3RGQA 1OEOX 2H4GA 4GE5A 3OLRA 2JJDA 2F46A 2NLKA 1Q1MA 3QCIA 3EMUA 2CMCA 3EZZA 4GRZA 3M4UA 4WOHA 1JLNA 4B04A 5EHRA 3QCNA 1ECVA 4GRYA 1OEMX 2VEYA 2AHSA 3D1HA 1NL9A 1PTTA 1Q6PA 4D3QA 1Q6TA 4ERCA 5M43A 3F81A 2H03A 3QKPA 4JMJA 2B4UA 2CNEA 1NO6A 2I5XA 1SUGA 4RH9A 4ZRTA 1WAXA 2HY3A 2VEUA 3U96A 1ONYA 4RDDA 1G4US 2B4OA 1LARA 4OHHA 4Y14A 3ZMPA 2G6ZA 2B07A 1PXHA 2CM7A 1KAKA 3ZV2A 1PA1A 3D1QA 1V3AA 1Q6NA 2I6OA 1C83A 2SHPA 4TVVA 1T48A 2VEVA 2CNFA 5EHPA 1XXVA 3AWFA 3EAXA 3QCEA 2CM2A 1PTYA 4JMKA 2QBSA 1R6HA 1OEUA 4OHDA 3V0DA 3GXHA 2OUDA 3V0HA 2E0TA 2VEWA 1L8KA 3BLTA 5BZZA 1FPZA 1U24A 5K9VA 3QCBA 2OOQA 4GWFA 1YFOA 4QUNA 4J51A 1OETA 4WU3A 2PT0A 5KA8A 3PS5A 2PSZA 3I36A 1BZJA 1J4XA 1ONZA 1G1FA 4WU2A 1C87A 3S3FA 2B3OA 5KA1A 2CNIA 1C88A 1G4WR 3BLUA 1ZCKA 2DXPA 4KI9A 4GFUA 2QBRA 3RZ2A 1QXKA 4ZI4A 5MMZB 1P15A 1X24A 3QCHA 2AZRA 5LXQB 1XRIA 2IMGA 4QUMA 3ZM0A 1YGUA 4NNDA 2J17A 4Y2EA 1RPMA 2CMBA 1WCHA 5K22A 4YR8B 4IKCA 4OHEA 1I57A 3S4EA 2I4HA 2P4DA 4HJPA 3LJ8A 4H34A 1OHEA 2I75A 3B7OA 3NMEA 5KA2A 1YTWA 1G7GA 3A5JA 1YTSA 2HC1A 3QCJA 2GP0A 4BPCA 2BGDA 3O4UA 3V0IA 2I6PA 2H4KA 2NTAA 5IBSA 1QZ0A 2QDPA 1AAXA 2I1YA 1YWFA 4RKKA 2QDCA 1ZZWA 4D3PA 3N0AA 4R0TA 3QCDA 4R30A 4YAAA 1WRMA 4NWGA 5KA9A 5BZXA 2BIJA 5HDEA 5KA0A 3SMEA 3CM3A 4R0SA 2B49A 2GJTA 1XXPA 3V0EA 4ZN5A 3ZM2A 2NV5A 2PA5A 3O3LA 3F9BA 3O4TA 1BZCA 2F70A 2HB1A 2OC3A 2Y2FA 3QKQA 3QCMA 1BZHA 3V0GA 4WTYA 2GWOA 2FJNA 4RH5A 3OMHA 5KACA 2C7SA 2I3UA 1Q6JA 2FH7A 3QCLA 5I6VA
chains in the Genus database with same CATH superfamily
4QWCA 2CPHA 2QGFB 1Q8BA 3MMJA 4K59A 1HQEB 1M1KT 5B08A 3HSDA 4C0BA 3QRQA 1QD1A 3OUYA 1X8DA 1VQOS 2Y1JA 3X1LB 1FK9B 4RWXA 3FFIB 3ZL8A 1ULRA 1CJTB 1RT4B 4LIWA 2AMCB 3GG1A 3OTOJ 4DL7A 1KTQA 1I94F 1VQ8S 2QA4S 4GFVA 4X4SA 2J76E 2YTCA 4ECTA 3RW6A 4ITSA 5GVQA 1LYVA 1XMQJ 1S9FA 5LXYA 1NH7A 1S1VA 2K2PA 1G6BA 4QR0A 4YUDA 2W9CA 2KZMA 2PMZD 2VUGA 2V5HG 5CYJA 2W2QP 5J2PA 3SCKE 5KFNA 2FJXA 3KMQA 4GE2A 1HWLA 3FQKA 3HVTA 1SVDA 1R27B 2MKYA 3MR6A 2R7RA 4DN9A 1B99A 3RTVA 2C46A 1VQMS 3A1YG 3QAEA 1X31C 3UNYA 3KLGA 4F2RA 3KTQA 1T4JA 1G7CB 2QV6A 3C19A 4YEAA 4RPFA 2W9AA 4QR1A 3GILA 4TXSA 2HC2A 2YWGA 2KFNA 3IMQJ 4KT0C 4ED8A 2IRUA 2HQIA 2WVEA 3P8BB 5KG7A 1HWUA 5SUHA 2PD1A 4J9UE 3DLGB 5DM6Q 4DQSA 2PN6A 2HCMA 2H9ZA 4RW4B 2P6SA 1GQEA 2V68A 4YDDB 4CLTA 3QO9B 3OW2R 4Q8FA 4C3LA 2HVIA 5HVFA 1UAGA 2KXFA 3JAMY 1Z4UA 1PYNA 1YIJS 2LQ5A 3DI6A 2ZH5A 1N52B 1HLWA 3HO1A 3EGZA 1XBOA 4CWBA 2ZVSA 3MMBB 1R0AB 1VJQA 5DZ7A 2VFTA 4NEZA 1PILA 2KH9A 2ZM6F 4DS5A 2CPEA 4D3GA 4DV7F 1RTDB 3TUIC 5KTQA 1UW4A 3JTOA 1J5OB 1Z2ZA 3FCHA 2YKNB 4NMLA 4LF9J 3MUTP 1GWZA 3D6FB 3S3EA 4LFAJ 3OHAA 2F6WA 3TI0A 3UN2A 4QYZJ 3BN7A 3MCNA 1SQFA 2Z58B 3MHYA 1G3OA 4WPAA 3T5JA 4DFJA 2QEPA 3K5MA 4M5IA 3TNVA 2WBRA 4DLEA 3OR1A 1MWQA 1TL3B 2GQ2A 3JAMU 1PTUA 3HD1A 1UEKA 5C2GA 3GXGA 1C1CA 3FZ2A 4CH0S 4F26A 3GIKA 4QJVA 1S4FA 1I9TA 1HNVB 3CCQS 2F6VA 5KFEA 2BE7D 1C0TA 1PAUB 3PIOQ 4OV1A 1TKXA 4X65F 4X4TA 5I42A 2HZVA 4KY3A 1WF1A 4F50A 1BLUA 2OO4A 2VDIA 3R5DA 5FLXU 3UD5A 3K58A 4W92B 2RU9A 3D5MA 4QPXA 1S4EA 4IR9A 5CA5A 1A7GE 3DGVA 4Y65A 2QCTA 4JV1A 4RU2A 2HNPA 3CCVS 4IOAQ 3TVZA 3R8YA 4PXDA 4YR0A 3RAXA 1NWLA 4DGXA 1UW9A 2R4FA 4RKUC 2QRRA 4F8RA 2XC9A 2R7TA 4O4GA 1EZZB 3AWEA 1HWKA 3AD8C 4Y3CA 4JV2A 1CJVA 5KFHA 3D42A 4ZPVR 2V4JA 4KRWA 1BWEA 2M7SA 2BE2B 2MTLA 2J9EA 1O6XA 3JSMB 1U47A 1H72C 3THTA 1DURA 2RF6A 2YWWA 3EDRB 3V2UC 3KLGB 3H25A 3ILIA 2XS2A 5KG4A 3CB4A 4GKJF 4M5MA 2ZN7A 1P9QC 2BJ7A 1RAAB 1Y11A 4CLYA 4DV3J 2HHXA 4J9SA 3MFHA 2UVRA 4DR6J 2H65B 5EX0A 4DX8H 4PYHA 2EFOA 3KK3A 5J2NB 5LM7E 1PA9A 5DRKA 1CQMA 1CBKA 2RDDA 2AM1A 4U7UK 3R7BB 3M8SA 2XMTA 2HK2A 4OYPA 4UZCA 4K5RA 4DUYF 4I67A 3RO1A 2DCLA 1KHWA 1YZ4A 2IM1A 2V8GA 3FGVA 3M6UA 5E7OB 3MEEA 4EBEA 4PRFA 4TKTA 2I4EA 2NT7A 4UTGA 3W9HA 3P3DA 3MCOA 3BGFA 1JLGA 3CCZA 3LGHA 4RL1A 4AXJA 5J2MB 4UQGA 4F4XA 5D8HB 5KA7A 3KLIA 3RB3A 3OFEA 4LSZB 4IDKA 3UNGC 1TKDA 5D78A 4B3MF 2R7VA 3UE2A 1U4BA 2B4SA 5K23A 2R8GA 2Y8WA 1GMUA 4L6V3 1AA1B 4ANDA 3T1HF 5F3ZA 2QBQA 1EJ7L 4L74A 3AD9C 1Q0NA 5ITHA 4J9MA 1J5OA 3T1AA 1NJZA 4O3PA 1L3UA 2XS7A 3Q8RB 2ZNZA 3KK3B 3CDWA 4GC6A 4Q0BB 3AWGA 5HP1B 2JLGA 4OYMA 5ETMA 5JVHQ 2A8BA 1HBMB 3ZZZA 1PSDA 3AT1B 2HHPA 4CVLA 1MMLA 3JQMA 4LFAF 4YY3F 1WOSA 1YTNA 1R0AA 5LMUF 1U1RA 3ZM6A 4YHHF 2J9DE 4Q0BA 2DHAA 5ETOA 3PHEA 3HKZD 3MM9A 3RBXA 7FD1A 1CJVB 4ZVOB 2UXBF 2M88A 1DAXA 4Y2CA 4DMZA 3H0PA 4DPTA 2B7CB 3N79A 4NA2A 1SV5A 4MFBB 5FDLB 4DPWA 3OFHA 1WUUA 4X65J 2FZKB 4RUAA 1NK4A 2IC3B 3VALA 1VC6A 2LQBA 3DOLA 1UFWA 3Q2SC 4PG6A 4UQTA 2GQQA 1T95A 3CJKB 4EGLA 3J81j 2QBPA 5E2QA 2IM0A 3W5YA 4K4ZA 3W1YC 3F56A 3LH2S 4NLTA 1TKXB 4TN2A 2RKIB 1F2HA 2UUWA 4B3TF 4ZVUB 1RBAA 2WVBA 2KTQA 3LK7A 1RTIA 1HNVA 3W9JA 2Y0SD 3OTCA 5A8RA 5DQHA 1RKJA 3RR8A 3GCXP 2AF6A 2RSQA 1SL1A 1Q1KA 2EG1A 2VC0A 1YJWS 4B9MA 5J2PB 1TL3A 1IVZA 2ZFHA 2DK2A 4NLXA 1JLFA 2EW9A 2HG4A 5D4OA 2MKSA 4AE5A 2XY5A 4IRCA 2PA8D 4F4KA 3UR3C 1URNA 2DGSA 4USJC 3BKTA 4KIAA 1ACMB 1RWUA 3SFGA 1BGXT 2HQDA 1GT8A 1EP4A 1RHRB 1XK8A 5LSLA 5F8MA 3R2DJ 3ET6A 3FFIA 1REGX 4ZLJA 3S1TA 2YKNA 5E3PA 4ES2A 3F99A 4C8MA 3CC2S 1PYTA 2HVZA 2D9OA 3IA0A 3JSRA 4ICLB 4JB8B 3SSSA 3W60A 2E5GA 1NK6A 8AT1B 4B3SF 2BV5A 4AZ1A 4E8UA 3HHLB 4JOUA 2EFGA 2MKIA 2ZHAA 4J9QA 1H2UX 2BVZA 1I51B 3MEKA 1QAJA 4DX5A 2CM3A 2PA3A 1C1BA 4KFBB 2JL9A 3M1VB 2O66A 3I5AA 5HL7Q 3KK1B 3GV8B 3POTB 1WC0A 3PV8A 1S9EA 2NPIA 4ILLA 4ELTA 4WFZA 1OEVA 4ICZA 4DU8A 2Q47A 5A0YB 2X1BA 2OPQB 3OL9A 4RW7A 2EFVA 4U7CA 2QMWA 2A6MA 3KJNB 2YH1A 4F2SA 3HK2A 1GFWB 4ZLPA 3QGHA 3A5KA 1N0VC 3CDEA 3NL0A 2R7SA 5A0YA 4HI2A 3WC0A 1HPZA 2HFZA 3NWGA 4OZ2A 4W98A 1ONZA 1OMSA 2RHQB 4FNHA 2FJAB 4CH7A 2BUNA 2DBBA 2FZCB 2OUGA 2DH8A 2E44A 2UUPA 2KRBA 3RYLA 1CEZA 3L7PA 4FXDA 2HNZA 2YQ3A 3CD5A 5SZTA 4DV7J 3UN3A 1RWXB 4K8RA 1T9VA 3HHLA 4AFFA 4CH1A 2OTLS 1U7LA 2ZBRA 3BGUA 4MAKA 2EVZA 4N8NA 4NRTA 5ETTA 4RUCA 1NMEB 3MM7B 2DGQA 4ICLA 1C2PA 3DHXA 5DGAA 4A8MP 2DO0A 1JF7A 3FSYA 3TEGA 1RKIA 1YJRA 4GVLA 4LBIA 3WX4A 2O67A 3FBCA 1V5VA 2FGOA 3OQ2A 4OX6A 4IUFA 3KHRA 1XIQA 2ESBA 2F6YA 2BKPA 1QXKA 2F00A 2NYIA 4HT5A 3RJMB 3GIIA 2P9GA 1HI0P 2BJ9A 3OR2B 2XB2D 1OEOX 3KLIB 2Q1LA 3H98A 2RHSB 3O5TB 3A12A 1RT7B 1Q5YA 1U2RA 3I32A 2DPIA 1T9TA 5IM0A 3I87A 2EKYA 3EICA 1S9GA 3N5BA 3RB6A 1R0CB 5CD4A 1M0SA 1WF2A 3R2CJ 3RZAA 4UOFA 2JJDA 2BMBA 4UF4A 1VLYA 3RAQA 1SC3B 1OIAA 1RTIB 1ZBTA 2CQPA 2F65A 3N0VA 3NCQA 3CO9A 3UR0A 1D9DA 2CMCA 2MZQA 3ETMA 2R7UA 4L76A 2AQ4A 3G96A 2NUUG 2VKRA 1TTHB 4IYQA 2DHGA 4FXWA 4RW8A 4L72B 1RSCA 3ZZUA 3UN5A 5L1KA 4NA3A 3KUEA 4QQBA 5EWEA 4Z7CA 1ECVA 4FYWB 1VMBA 3G8SA 1OEMX 4NX9A 2JZ5A 1IWAA 1DHMA 3EZUA 4DI6A 5B0GA 5FDLA 5JMNA 4DSKA 4IRDA 5M43A 1X5SA 1HNXJ 1QE1A 5KFFA 2YY3A 4I0WA 2CNNB 2A2CA 4DG1B 4MKAA 2JHEA 2DJWA 2BE2A 1K1SA 2BACA 4NLUA 3K5OA 4TVAB 4HKQA 1XJWB 1EETB 2CNEA 1I94J 1J6UA 5KG0A 2IRXA 1HYSA 2AJ2A 3BB5A 4WP3A 4O4GB 1EHWA 4OI6A 4DL6A 1CSJA 4PQAA 2E1PA 4DL4A 1P9YA 1RT3B 1RWKB 1FKOB 1SQGA 1UZHA 3R5BA 1TL4A 4ETXA 2LEAA 3G6ES 2HHSA 2DNHA 1HBMA 2MQMA 3M9OB 2HY3A 4FVMA 1RWWB 3IWLA 5F41A 1HMVA 1B0PA 1G4US 2I6PA 1LARA 2KG0A 4P10A 1WD6A 1MROB 1OY8A 2W24A 2B7BB 2DVIA 1H98A 4NOHA 5L38A 2M8DB 1PXHA 2LMIA 2UZAA 2QN6B 1PA1A 2I6OA 1C83A 4KYQA 4IDKB 3JYTB 5A5EA 3GR0A 3BPDA 1FWKA 2W7PA 2QA1A 5KT2A 1KRPA 1YWXA 5J2MA 1U1NA 1PGZA 2CNFA 1D3WA 2GMJA 2KJVA 2VFUA 2RDJA 2V8PA 3T5HA 3DOKA 3AWFA 1JB0C 1U09A 3R7SB 4U67Q 4DR5F 1JIHA 1XR6A 1OYDA 2OGUA 1SI9A 3J7AN 3ENAA 3Q23A 1XNRJ 4JMKA 1Y10A 2ZBPA 1Q78A 1R6HA 1TELA 4X4OA 3G82B 3MMAB 5THWA 4X4UA 1TUGB 3KHLA 1SH0A 1YK9A 2RJZA 4QBUA 4ZK7M 2BKOA 4DUZJ 1QY7A 5D15A 1IKVA 2J6UA 1UJ5A 2IYGA 2VQFJ 2BQRA 1N88A 2RDIA 3BLTA 4DV5J 1NK5A 1IR0A 4EEYA 4FYVB 3THPA 1WDDA 5C7PA 1RWMB 4ZA1A 3JB9k 2HHHF 4HDHA 1L3VA 2XCPA 2WZ1A 1J2VA 4URSA 4R25A 3DRRA 3G8TA 1XWLA 3CE8A 2VG7A 3NCPA 2CQGA 4HDGA 3I4PA 3A3NB 1KEKA 4QYRA 2BOPA 4NXMF 4LRBA 3OTEA 1ZAXA 1N33J 1OETA 2VORA 1YBAA 4ED2A 4WU3A 4OZ0A 2CQCA 2JRSA 2PFFB 2E9TA 3H7HB 3I36A 3KUHA 2VD3A 1IJFB 2MEWA 2KM8B 2YNHB 4BHQA 4M5KA 3TO8A 2D1CA 2GS8A 3R7NB 4F25A 4Q2MA 2C1EB 3AB4B 3PNIA 4DWIA 1U6BA 3QJPA 1C88A 3BLUA 2DXPA 1TKZA 3G6YA 3DRXA 2PI4A 1C0TB 3LA0A 3GJTB 2FLPA 2QBRA 2HIYA 3QLHA 1MWZA 3RZ2A 1NDLA 1YJTA 3PW7A 1YDLA 5BJRA 1P15A 4ZI4A 3C15B 1RJJA 2F3JA 3AQPA 2MYFA 2WVCA 3GYGA 3LW5C 5CH7B 4OX9F 4ED1A 1DRZA 2JEGA 4V19J 2AX0A 2OMLA 4ZN1A 3M30B 4U8VA 4GRSA 1RHQB 3ZM0A 1NPPA 1Y3KA 4EI2A 5F8HA 2BR0A 1EX8A 1JJ4A 2HVHA 3KDNA 4TQSA 2RF2A 1S1TB 3V6HA 5LMNJ 4IKCA 3G2XA 4F7VA 2DXEA 4U8YA 1EEHA 3LAKA 2ROEA 3CJ8A 3CXCR 1S5ZA 1EAYC 3M9NB 3GFXA 2N3LA 3EXCX 3CDUA 3H2VE 3GPAA 3QATA 4Q5VA 5I6VA 4HTIA 1E8CA 2GC5A 5G4DA 2IMWP 1RZMA 2X1GA 3I96A 3MPVA 3BQ1A 1YJNS 3OJUA 5KA2A 3I0RA 1YTWA 2QL7B 1G7GA 3MEDB 2K8GA 1U1OA 4MK8A 1ZYQA 5HQMA 1FXLA 3QRRA 3QCJA 3MOJB 3I56S 2Z2LA 3G87A 2MQPA 2DIUA 2JDJA 2XO7A 4K0KF 1L3SA 2NYHA 4LSLB 3V0IA 3P4UB 3DLGA 4LBHA 3CWJA 4IG3B 2ROPA 1WOOA 2KB2A 2MQNA 1DTTA 3TZXA 2DHXA 3G6XA 2VJUA 4DL3A 5EWGA 2PI5A 1QJHA 2KVIA 2XGQA 2H4KA 2CKWA 5IBSA 1ZM9A 3A13A 1JLAB 2QYCA 1LK7A 1AUSL 2XI2A 2F8HA 3C16A 3K2YA 1HFEL 2G2ZA 2V2ZA 2IJFA 2FJDB 3MCMA 5GAGI 3KMSA 2VZ9A 4NCBA 3QJLA 1JBVA 4HACA 4TY9A 3IWNC 3RBZA 1NDKA 2Z8QA 3FCWA 4C8OA 4JI8J 4P73A 4JI2J 4DV4F 4O3NA 2ZE2B 3KJFB 4OYAA 3IR6B 3W8GA 1ZTWA 3N0AA 4OZNA 4O0NA 1NSQA 1IQZA 1S1VB 1RDRA 3JS9A 3MPWA 5C25A 5DDPC 4F04B 2RU3A 1RT5B 2W9CB 3KG1A 3T3FA 3DLBA 1KQFB 2ZH9A 3PIPQ 5DM7Q 1NK9A 4WKYA 4YY3J 1CC8A 4U7UD 1SBRA 2MQLA 1GMVA 4YAAA 2CWXA 3M2VA 1U1QA 2UVWA 4XDCA 2ACMA 4IRKA 2W4DA 5I4MA 2OHDA 2DIVA 3GZ7A 4OMFG 1TL5A 1ZAVA 5BR8F 1UFLA 4PYDA 3T9NA 4OHYA 3EMTA 1APSA 1GTHA 3ZM2A 3K5LA 2B49A 4HH1A 1IM6A 2JH3A 1XNQF 5L39A 4E0DA 1FE4A 3CCRS 1WORA 3C14A 4OX9J 2HZAA 2HBZB 3R5GA 1XXPA 3V0EA 2UXDJ 7FDRA 2ABYA 2GX8A 3VCDA 1CJUB 4NXMJ 4DR4J 4BUBA 4NLPA 2GJ2A 4R8UA 3HXMA 2HRUA 2HGMA 1N48A 4C0OC 4M5DA 3N01A 3BYRA 1S77D 4DZ6A 2CAJA 4USTA 5J2QA 2ZUGA 3SZ2A 2GVDB 2BYCA 2DNKA 1TL1B 3QT8A 4H54A 4TYBA 5KAKA 3CIMA 5KT7A 4Q45A 4F36A 3J7A1 3FRZA 1YZ7A 5B0BA 4OFZA 3HPOA 2DH7A 3T1YJ 2CQDA 2E5HA 1ZZFA 3OFGA 3GMGA 4KO0A 1XR5A 3FMWA 2KG1A 4DR3J 1QTMA 2IBKA 5ETRA 3M8PB 3MM8A 1S76D 1YTYA 1NO8A 3PJ9A 4NLDA 2ZH4A 4LMZA 1T94A 3K8VA 4FVCA 5KACA 1M1HA 4J5OA 2M0GB 2GAGC 1X4EA 1KBRA 2ZHOA 3ZZ0A 1XMOJ 4TU8A 4CZCA 3PO4A 3QCLA 4K4XA 1AYEA 4ED4A 4KPYA 1MMDA 4WZMA 3C6UA 2BZLA 1AB8A 1FTRA 1BQMA 4NWFA 1IWGA 1UVJA 2J6TA 2BX6A 2UU9J 3V0GA 3P96A 3VAGA 3RB4A 4B9LA 5J1NA 1BXNA 3BQ0A 5KG1A 3VQSA 3JTNA 1U6ZA 3EE3A 4UT4A 2F7VA 2XMAA 4EWTA 4EZ6A 1FRXA 5CCLA 3I0SA 2L9WA 2QDMA 5CZXA 3WIUA 2XLKA 5HMYA 1Y7PA 2VQEF 2I42A 4PWWA 1Q7LB 4DS4A 4B08A 2VTDA 4DV4J 2Y96A 3I7ZA 4K4YA 4QAHA 1UWBB 1NBEB 2EXUA 2VBWA 1TMMA 2IAJA 1PIEA 2MXYA 1OPIA 2G0CA 5LJ5Y 4RWWA 5JXSA 1M90T 3BR8A 1WTBA 1UEUA 1WDTA 4RUBA 5T7LA 3O5XA 1YI2S 2M70A 4KE5A 3B8HA 2G2YA 3MAAB 2EK6A 3N5FA 2LVWA 3EVOA 1RT2A 3T9ZA 2RQCA 2LQ8A 5EUHA 1KQKA 2VFRA 2MKKA 4B9NA 2NT2A 3D6MB 1H6KX 5KFRA 1NJYA 1TFWA 1JJHA 3GIMA 2ZOMA 1S10A 2H4VA 1JK9B 1ZAWA 3PACA 1N5QA 2M2BA 1RCOB 2KN4A 1SUQA 4KKOB 4TYAA 2HBRB 2JLEA 1HKAA 1G1XA 4K4VA 3QT7A 4DQQA 5H9FJ 2UXDF 1JMTA 3PCOB 4ATNA 5HROA 3MM5B 4DEZA 1RWNB 2E7WA 1FGSA 1N5TA 4M1KA 4YB6A 3BM8A 1FFSB 4CTAA 2XMWA 4G1QA 4JYAJ 3ZMQA 3BGOP 1V5IB 2YWHA 3P5BP 2HZCA 4N47A 1M5OC 3S01A 2RQKA 1RTJB 4LF4J 1UAWA 1PJ7A 4X2BA 2G4BA 2IHR1 2KHCA 4Y2KA 2PQ5A 1JLQA 2ATCB 4C8LA 1S1WB 1ZM2A 1RLDA 2KO1A 2NUHA 3BSCA 4WIQA 3MUVP 1IBMF 1D5RA 1C85A 4PUOB 3MPUB 1OESA 1RTHA 4KHPJ 2GC8A 3TAMA 3UD4P 2UAGA 2XGPA 3E51A 3QT5A 3VVUA 2F6ZA 2NXEA 4DX7A 2PFDA 4MYTA 4XPCA 1RT2B 1GH8A 2DNQA 2V6AA 2GV1A 2HURA 4LFBF 1C4CA 2PEBA 2CNHA 3DYAA 4J90A 4Q44A 4EBCA 3PKMA 6FDRA 3PX6A 2GNKA 2LA6A 4DQPA 3FZBA 3N4WA 3CSKA 2CFVA 4Y28C 2M3VA 3CW2C 2C2KB 2JNJA 1MU2B 4A4JA 1DLOA 3KK2B 3K57A 1AFJA 4EO8A 4AQYF 4X62F 3I4HX 1B70B 2B4PA 4OX7A 4A8YA 1KNZA 5BXIA 2AIRB 2N4CA 3T6JA 2OLWA 2OSRA 5A8KA 3ZM5A 1FDBA 2K1RA 3GJSB 2F8EX 1L8GA 5HMXA 3CTRA 1HA1A 2MLXA 3LP1B 3C6TB 2WTFA 1NJXA 2NLWA 1HHTP 2YWKA 2VQEJ 3BO2A 2HFVA 4WKRA 3M8RA 1HD1A 5H9EK 2FLLA 1FX2A 2NXCA 2H51B 3MCSA 2VA2A 2BJ3A 2K3IA 4N56A 4J9KA 4TU7A 4DR5J 3QCCA 2F1FA 2B5JB 2H5IB 3SDEB 2BQUA 3HFZB 3E01A 5DDOC 4YOEA 2XPCA 4P2XA 1IKYB 1CLFA 5KFBA 1YJ7A 1OJ4A 2IJNA 3GSDA 4O44A 3J7YI 2ILYA 2MGZB 3T19A 2E1AA 1RT6A 2HHVA 1PC4A 5CZVA 2GWOA 2VFVA 2GZOA 1I1GA 1U26A 1JXEA 1UPMB 2DNNA 2QSWA 3F41A 4M63A 3OLBA 3V6DA 1YHQS 4EYHB 2Y8YA 2BJEA 2FPHX 2HWHA 4J37A 3FK4A 1IQTA 4HHUA 4C0HA 3EUNA 2OPSA 4IFVA 1AZSA 1O5ZA 3MPDA 5D0GA 5K8NA 2J7WA 3H5SA 3WQPA 1ZCLA 2GGPB 1U8WA 2CRLA 3L09A 3SQGA 2XMUA 2BEFA 3I9ZA 2ROGA 1FHTA 3A4TA 1YPTA 4CYUB 2J9CA 4C4WA 4MIAA 3S3KA 3AJ2A 4QIWD 5JUMA 4ZOSA 2Z56B 4RLEA 5GADU 4F4WA 3MURP 2N3OA 3GJRB 4HJQA 1HD0A 3DDIA 3ITHA 1DQAA 1GX6A 1OY6A 3NRBA 2L08A 4FPIA 1VQ5S 4UOHA 1S1XB 3RRGA 1UJ4A 4TY8A 4Z6BA 1PTVA 2LQ9A 2Z2YB 4QIGA 3ZM1A 4QWEA 1RA6A 2NXJA 1AUDA 2E29A 2FLNA 3NY0A 1IBMJ 4PPDA 4JI4J 1N32F 4RI5A 4UY85 1T9XA 2HQFA 2PBNA 1Q86T 3LQVA 2NR0A 2WB4A 2VEXA 2DR6A 1NJIT 2F4VF 4NLQA 3BREA 3GLJA 2UUAF 2LDIA 1KLMA 3MEGA 2AJQA 2OFHX 1QAIA 4NLSA 2RIJA 3GV7B 4WE1A 5HBMA 3PKYA 4IKAA 3T1YF 1U49A 2KZZA 1YQHA 3H8YA 4F4YA 1R89A 1VDHA 2AHOB 2LXFA 2VBYA 1VQ9S 2QT7A 2XMKA 2AEFA 3DXBA 4M94A 1JLCB 2AT1B 2MJUA 3TJAA 3QQCD 5D4NA 1WOPA 3UDLA 3L3CA 3NLCA 2I5JB 1RABB 2OEMA 4L73A 4ZDNA 4TLRA 4O3OA 1AXQA 2D9PA 5C24B 5CCMA 4NMXA 1RE1B 1XN9A 2VH7A 2FHJA 1VC5A 2QMXA 3SYZA 3KG4A 3B4MA 3UVJA 4LF5J 3OTOF 1X0FA 1H2TZ 1MW7A 1FF2A 3LP1A 4K7QA 1F6TA 2J0SD 3L7UA 5DJBA 3MOWA 1VBZA 4J7CA 2G2OA 4KAIA 3C66A 3CJ0A 3HKWA 2MZJA 4AXIA 1REVB 5IWAJ 3RGOA 4AQYJ 2YNIA 2R9LA 4I1TA 4QU7A 4I7FA 3S6EA 2RMLA 5BYQA 4IO9Q 2HFOA 3PFEA 3GB0A 3IC1A 4PCQA 3QJJA 2RVJA 1VRTA 2C42A 4AUKA 1Q16B 2FQQB 1D9FA 3EB1A 4MKVA 5K24A 5I3UB 3BR9A 1TR0A 4R0EA 4D3RA 3C8YA 3DRPA 4NL5A 4MH8A 5HVHA 3ULHA 2K7JA 3EM1A 4LRDA 3TZZA 1HIYA 1H73A 2OI2A 5HANA 4A47A 1KVIA 3S3HA 2EC0A 4A8XA 4C3MA 1FESA 3T5KA 2V9WA 4JI8F 3CDAA 4MK9A 3SQGB 5B0DA 1T02A 4ECUA 2ZZMA 2DTJA 1WF0A 3MUMP 1KSPA 2KYXA 4IFVB 3D2WA 2AKWB 1MNEA 1X9MA 2RUGA 4YB7A 2UXBJ 1F9HA 2Y68A 3M30A 3GU0A 1U1LA 2EBEA 1YRTA 1T03A 1RTHB 3AXMA 1BHNA 2CDRB 2DY9A 1HBOB 1LW2A 3VR1A 5KFDA 1VQ7S 1J5EJ 3RG6A 1EQMA 2KHDA 1BC6A 2ZC4A 1HWIA 2YKOA 2MZRA 2QL5B 2XZWA 1VS3A 1Y0HA 5FIIA 1MMNA 3OTBA 2VOOA 1K8AT 3BS9A 2V63A 3QLHB 4JI7J 1OHDA 3CCMS 5L1LA 4AT1B 1KVKA 1C86A 3ZTQA 2R7XA 1TVRB 3H2UB 4CTAB 1N56A 2QG9B 3PW2A 1Q6MA 1IKWB 1Q4RA 2J7UA 2J0QD 2RAQA 1M3GA 4PVGA 5A6WA 2IM3A 4NLRA 2JEFA 4I8NA 3LANA 2P6TA 3MM5A 1YSJA 2UUAJ 4LF9F 5JVGQ 3QCZA 3TA2A 3T6BA 3RBEA 1H74A 1IN0A 3C6TA 2Z30B 3HULA 4LF6J 2GCBA 3MD1A 4I4BA 2RRAA 5DQGA 2FYXA 2DH9A 3HMJG 5C42A 1TL7B 3CVKA 1TUWA 2CQHA 2FHOB 3KXDA 3R6LB 5A8KB 4WIIA 3OLRA 1H3DA 2V67A 4M5HA 3ZNJ1 1WHVA 3H20A 4U96A 5HJXA 4H4MB 2M8HA 4ZCMA 4JI3F 2O3DA 1WNEA 1EQ0A 3W2WA 4HV4A 1S7IA 1UTAA 3EMUA 1NB2A 3PEJA 1HR0J 2P9EA 5DO2A 3GP9A 4GRZA 2EWHA 4YR2A 4LF1A 1LXJA 2AYEA 1OO0B 2A10A 2WVFA 4ZJQA 4R0JA 3RGIA 4WOHA 2DD8S 3F44A 1UWBA 2DGXA 1B0TA 2R7OA 4GMKA 2NSBA 2M9KA 2LCWA 5DS7A 3DYAB 4DV3F 2ALZA 2BXJA 3G82A 3MMAA 1D1UA 3C3LA 1UVLA 3BBBA 1NKEA 1R31A 3R97A 4GRYA 2RB7A 2XWYA 2ZDPA 2AHSA 3D1HA 3KG0A 4IH5A 4GKKF 4KV8B 1NL9A 1C0UA 2R2SA 3PJXA 5CHCB 4A8FA 2GVZA 3F73A 2Q6BA 2FJVA 3AOCA 2VA3A 1Y00A 3F81A 2FZGB 2G1HA 1P1TA 3D0GE 2YWFA 3LP0B 3NGUA 3ZZOA 5A5FA 4KGMA 4LF8F 2YH0A 3DM2B 4FF2A 2ZZTA 1GNKA 1JLQB 1JWWA 1SUGA 3BGLA 2JEJA 4IH6A 3C6UB 4B9VA 2HBYB 3HSZA 1TP7A 4GKJJ 2CNKB 2BKNA 2IRYA 3L7OA 5LSRA 3ENQA 3V4IA 1PKUA 2H5EA 2ZNYA 3A8EA 3FQLA 3MF5A 4OHHA 2F8MA 1TZ0A 2PMWA 3J80U 1DZ5A 2B07A 2CM7A 1KAKA 1HI8A 3GV5B 1V3AA 3MM8B 1R0BG 1Q6NA 2WBMA 2IA0A 2XSJB 1YKWA 2EFNA 2W7OA 4KO0B 2LEBA 1SJFA 2BW2A 2GMLA 4F3QA 1T03B 3ILJA 1N33F 3SBMA 4TVVA 3HZGA 2NS1B 2CPZA 2XYPB 4DPUA 5KT4A 3H40A 1J5EF 4M95A 2P8IA 5EHPA 1XXVA 1TL1A 1TK8A 2GVDA 4LVOP 4DDFA 4KR0B 3MAAA 3KJQB 3QNWB 2ZUAA 1NU4A 3CNQP 4LQ9A 4WFBQ 4Y2MA 5AJ3J 2CM2A 3UW1A 4W4MA 3PR5B 2KDOA 1FWPA 4PQUB 4J9LA 6AT1B 2VJVA 1B0VA 3M2UA 5K8OA 2OUDA 3V0HA 1RISA 4FDFA 1ZETA 3S7RA 3VAMA 2ZWPA 2C2EA 3KLEB 1M5KC 1UPPA 1NH8A 5A8WA 2IY5B 4I7FB 2QX0A 1PBUA 2DR5A 4DPXA 3J80Y 3N6MA 4GKKJ 1U24A 4DR2J 2J6SA 3NGRA 4LR7A 1A6LA 2XCAA 2C2DA 3OVBA 2ZBQA 1GEHA 4OI3A 4NASA 1OYEA 4FF4A 3QCBA 4C8NA 1JJ2R 4MKYA 3LAMA 1I6JA 3H5YA 4LF4F 4QUNA 2XY6A 5AXNA 3WX8A 4X64J 1HR0F 5AT1B 3QRPA 4H4KA 1MLAA 5KA8A 4F3MA 1X4DA 4TQRA 5MAOA 5HO4A 1J4XA 1ZM4A 2G0JA 2YNFB 2ZD1B 4GO5X 2GMHA 2VG6A 4YQWA 4LQ3A 1C87A 2B6AA 4HYKA 2B3OA 2D3OR 3I31A 4BUCA 4HH0A 2R3VA 4KGXB 3DCAA 5E41A 2HMIB 3DRSB 3DMJA 4JI5F 1UVKA 5CYQA 3DOMA 2VONA 1G4WR 3AJDA 1J27A 4CI0B 2EI5A 4C13A 2OEJA 4HHHA 1BD6A 4G3IA 1KOOA 1JLCA 4CNYA 3BO3A 1JNRB 3QIDA 3TJ8A 3HVAA 4F3OA 4LSNA 2B8PA 4QYZK 2JVRA 4LRCA 4NZ0A 1ZOTA 3EDQB 3ZC4A 5KFQA 1VK3A 4NCGB 1X24A 2IFXA 1HNIB 4A8OA 3QCHA 1FJCA 4LT6A 4MTPA 4IG3A 4ZPBA 2P2CB 2B3TB 2P4DA 5LXQB 1P8GA 2HRYA 2VB6A 2XEXA 3KJVB 1GG4A 2J17A 1FJGJ 1UA1A 3N2AA 2W1BA 2RH3A 4QWDA 2M4MA 1S0VA 2WSFC 2OPQA 1QVFR 1L3KA 5GAEI 5K8MA 1GFYA 5K22A 1XTZA 3RU0A 2RE1A 1ITPA 1VQPS 2PMHA 4USVA 4ZMMA 3IP0A 3KK1A 1I57A 4OHEA 2M3DA 4PG8A 2I4HA 2VBZA 4K4TA 2AU0A 1FERA 1LWCA 2LEPA 1KWMA 3NOCA 3VAKA 1S6OA 4B3SJ 5D0HA 4ZVGA 1DQ8A 4HJPA 3THVA 3Q8SB 4TNOA 3PW0A 1QVGR 5KFYA 1QLNA 4H34A 4E98A 1YZ6A 1TMJA 1K73T 2D3ZA 3SSQA 4LF7J 5EN1A 4Q43A 1OHEA 2I75A 1V9OA 4OJGA 5KFPA 1U02A 1H7XA 2RF2B 4ZN3A 2DO4A 1QAXA 1SJRA 3AQOA 1U6FA 4ID5B 1RXOB 3M2VB 2GGPA 1YTSA 3DU5A 4BPCA 1YJUA 1S0NA 2OPSB 3KLVA 2W8LA 3HN7A 2FLOA 2I6WA 1R3NA 4KBIA 3O4UA 3MZIA 3BV8A 3KDOA 1JLFB 3O44A 5A2QU 2J9DA 5IV4A 4RNMA 1VBXA 4NXNF 3BBFA 1GXUA 3SV3A 2MZ1A 4YB1P 4QCLA 4WBFA 2QLJB 3R5JB 2YKQA 3ZTPA 4YP3A 2MGZA 3OJSA 1HHQA 3HM9A 5IQQA 5DDRC 1H2VZ 5LL6d 3TAPA 1NSAA 3NS7B 3GIJA 4RW6A 1NKCA 2I1YA 3NG8A 3MECA 1U48A 4P2MA 2HHQA 1RI7A 2GJFA 4ECXA 4Y2IA 3QMQA 1ZZWA 2D7SA 3PYZA 4NRUA 2DNRA 2KFZA 4X64F 1RLCL 1DTTB 3GONA 2MQQA 2EPIA 3IBCB 2ZJRQ 4ED3A 1FVQA 2MHNA 2VASA 4KPCA 5DG9A 4OL8A 3QCDA 3GSIA 3PX0A 2K1RB 2AYBA 2APOA 1HI1A 1TV6A 5KA9A 2DYAA 3FNNA 5A2QY 1ZZNA 1UETA 4JI5J 4PG5A 2IDEA 4K4UA 4WP9A 4IQMA 1VK8A 3M6XA 1FO1A 2B9WA 3TQEA 2B56A 2OPRB 5HAOA 1MU2A 1V3SA 2N4DA 5F8GA 4DL5A 2LDYA 4R0SA 1E6VA 3D67A 4F0KA 2HHWA 2EEYA 2JC1A 1VGYA 4F02A 4PKDB 2CG4A 2Q66A 4HHJA 1WHXA 3HX9A 1VISA 3DLEB 3KHHA 1B7FA 2CPDA 1LNQA 2ZJPQ 3CJQA 3O3LA 4C8KA 2DXDA 1KD1T 1SH2A 1ZA2B 3F9BA 3MDFA 1HNZJ 5T41A 3B82A 4C11A 3DOKB 5B0AA 2F9JA 4DUZF 3TUPA 3TX8A 3UD3P 2J8AA 4KHMA 1VRUB 4KGZB 4EO6A 3MAQA 1HBNA 4NYZA 4X4RA 3C15A 4Z2XA 3MEEB 1JXLA 3IS9B 2D3UA 5F8NA 3UAGA 2W2PP 1RT1A 2RS2A 2ZH3A 2PDAA 2DGUA 1B4SA 4I69A 1TKZB 3HHLD 3U7JA 2K06A 5GMEA 1MROA 3VWSA 1KFDA 4OZLA 2AGQA 4PPZA 4YDXA 4FS2A 5HROB 3BGRA 1SQEA 5LSOA 3SI8A 3ZZYA 2DR7A 4DQIA 1YX2A 3B54A 1FKOA 1GX5A 2RNEA 4UOCA 3OL6A 5KFMA 3Q0AA 2VOPA 2CJBA 2HPUA 1N6QB 1HYSB 2AWZA 4DV5F 4ALZA 1FCAA 3R1HA 3D54A 3JSMA 1K0TA 4K5SA 4NYHA 5KFUA 3SCLE 2ZDOA 1XR7A 3BKUA 2AYGA 1SJ4P 4ZVSB 2HNYB 3BPSP 4BWJA 5AJ3F 3UQSA 2IVYA 2YX7A 3G6VA 3FKBA 1Y5NB 9ATCB 2WSEC 5IC4B 2D3O1 2BQ3A 4OZ5A 1SB6A 3H42A 5KG5A 2CXEA 3CD0A 2IPOB 2C3MA 2PC6A 3UFCX 2G59A 4CLLA 2NTAA 3V81A 2XHCA 4E2FB 1NAQA 1HNWF 2DR9A 3D68A 3GYNA 2NXUA 3KLHA 1K9MT 4RNFA 1RB0A 2Q43A 3CCES 3CJ4A 3PX4A 8ATCB 3QCGA 3IR7B 1IM4A 1C1CB 3LGMA 3TYTA 4NZ6A 4P9SA 1FXDA 5IM0B 1LQ9A 4PWUA 5HSPA 1FA0A 3K59A 4B9TA 4OHIA 1TAUA 2Y67A 5H9EJ 4QBEA 2WOMA 3H5UA 3OR2A 2OTJS 1FFGB 1X4BA 4BJOA 4NLWA 2MBCA 3MM6A 5LT5A 4OJHA 3TX0A 3I80A 4B04A 5AWXA 1PYSB 4UAGA 4HRFA 5KFAA 2VQFF 2MLYA 3PRDA 2ZH8A 4J9RA 1EEOA 1Q8LA 2OJ3A 2CNGA 2QYGA 3HLUA 3MM7A 2HLUA 2ZITA 2VBXA 3KKFA 3J7Z5 1VYAA 2HNDA 1T05A 4KHPF 3CMQA 1T49A 1R8CA 1RWPB 3D44A 4NI2B 2LXUA 4Q7AA 3TZWA 3CEDA 3NKYA 3OL8A 2D69A 2GIQA 1RAHB 1WELA 1N36J 4P75A 3MTJA 4PZVA 1HPZB 4X66J 3BQ2A 1WG1A 2QO3A 3TANA 4PUOA 2Y1OA 4WYWA 3NAHA 5DZ6A 2LA4A 5J2QB 3MR7A 2DNOA 2XNQA 4HVZA 3OXLA 4DCPB 5BX1A 2W7AA 3WC2A 2V8VA 2HWTA 1XMBA 4M5DB 2DNMA 1WI8A 3W65A 1U0HB 2U1AA 3I5BA 1S6PB 2CPJA 2ZZNA 3M8QB 1P3DA 1T9WA 3JSYA 4GVBA 4OQJA 1KTVA 3VF0B 5F8IA 2MZTA 2X51A 3Q83A 5KFWA 1A5YA 3F9AA 1AROP 3IRXA 1CULB 1Q79A 4ZCIA 4DPYA 3AY0A 3PW5A 4XO0A 3H5XA 3IM8A 2HVLA 5KABA 2WW4A 2CJAA 2E5LJ 2AW0A 1SIWB 3HVTB 2FGCA 4H4KC 4I2PB 1S6QB 1SKWA 3MVNA 1S9GB 1KS2A 1IR1A 2WAQD 3CIZA 3RBDA 2DRAA 2HWIA 4PG4A 1EP4B 4RR5A 3TA1A 3V0FA 5F8LA 4DSFA 3D66A 4DR7J 2XY7A 3KHGA 1RT5A 2CUYA 2XZDB 2H04A 4C9DA 1NM2A 2VC1A 3JTPA 1R8AA 2R0BA 4W90B 1S12A 2AJFE 2MY8A 2ZE2A 3FBEA 1M5VC 3QSIA 5KG3A 5J1EA 4K2JA 4I2QB 1HQUA 4LFCJ 1P1LA 4LIRA 5D4PA 3QZ8A 3GIRA 4DXLA 2PGCA 2BANA 2QLWA 2RKIA 2ZWOA 3MI7X 4HACB 2EC2A 3GCWP 4USKA 3HFVA 5GAHI 1T3OA 2HNZB 4JI2F 3CMES 1U25A 2L9NA 1JLAA 1S99A 3C16B 1WC4A 3JQJA 4KQZA 4OYOA 5D4LA 4LVNP 5GADI 4KYRA 1LK5A 5EX3A 1O5JA 2X7IA 4Q2LA 4DR1F 1SKUB 3HT3A 3HJFA 1PCAA 2MKHA 2DB1A 3CJTA 4LSLA 5DG8A 3ONQA 1SV5B 4MFBA 1NKBA 2CM8A 2BM1A 2YDUA 1NWEA 1YG0A 2KFYA 2HNQA 2IIHA 2SXLA 2AJ4A 3HHLC 5J8RA 2ZKTA 1X4GA 1I9SA 3MTKA 2YKAA 3OVAA 4QU6A 1E6YA 3LTOA 4NA1A 5IBMA 1S57A 1KN6A 2L3MA 4QAPA 2RRBA 5BUGA 2V50A 1G4CA 5L8RC 2I4GA 3M1VA 2CG8A 1C1BB 4KFBA 1LWXA 1R43A 2M52A 2IBOA 3PYEA 4DFKA 2MHEA 1S1UB 3UCUP 2LU2A 4I6WA 4FKYA 4LR8A 2BV3A 1LWEA 1TAQA 2BANB 3NBPB 5U47A 3OVSA 3R5CA 2XYHB 2I6JA 2G9OA 1N5YB 1FPRA 1YN9A 2CPXA 2V2VA 1XM2A 1X0PA 3BN4A 2FJBB 2HQCA 3VTIA 3CULA 2ZC3A 2A0FB 2F4FA 4DLGA 5IQ6A 1WC1A 2E5JA 3US5A 2O1PA 2HHTA 3LWLA 2WVDA 2CPYA 3LPYA 1ZC0A 3PFOA 1TFYA 1FEHA 4RBUA 1LW0B 4I68A 2VDHA 3D1OA 2CNOB 4OIXA 4UZBA 1JLEB 1F3VA 2DT9A 1S6QA 4Y00A 3K7RA 2WJPA 4F0MA 2Q6CA 3CPWR 2ADCA 2ZEJA 3C2PA 2UUBJ 4B3OB 4ZCKA 1FDDA 2JSXA 1ICEB 3CJ2A 2E1RA 2Q3PA 3QIPA 2E9ZA 1G7FA 4O23A 3ZNUA 1IKXA 5E3RA 4ZVPB 5HLFB 2Z2MA 2QFIA 4DR6F 3IRXB 2D74B 3QGGA 4ZS6A 3RRKA 3NMRA 1RADB 4PR6A 5J2NA 1G1GA 2OIHA 2UUTA 5D3GB 3FUYA 2YNHA 3W9IA 3TQ1A 4ILMA 5CABA 3VAJA 4R5PB 1T8EA 1Q6PA 2FHKA 4WWSA 2IC3A 5KFSA 4DUYJ 1QUVA 4RI4A 4DBQA 5E3QA 4ZPWR 4CDIA 4EBDA 2MZSA 1RAGB 1TUVA 2FY8A 2CJ9A 2I6IA 3FSXA 1ZTTA 1N4LA 3QCFA 4QDIA 3DRRB 4ECWA 1F1BB 2V4JB 1VQSA 3PTWA 2F6FA 3BO4A 2I0XA 2V0NA 3L95X 3FDSA 4IFYA 1FTCA 2ZH2A 3RAMA 1X4HA 2QCJA 3NOGA 1N6QA 3QCKA 4OZJA 5HN0A 2GJIA 2FJMA 4JI1F 4CLPA 2E5LF 4R5PA 4CCHA 3KUGA 1YGRA 2I6MA 5HVGA 2IVMA 4H4OB 4CM0A 5KT6A 1T05B 2H54B 2Y66A 3GFZA 4WP8A 1IR2A 2I8EA 4RNOA 5B0FA 1V3RA 3QZ7A 1QSLA 3DLHA 3KNAA 3PY8A 3W66A 2Y1IA 4LRAA 3CT9A 1X5TA 4CP5A 2MQ8A 1TK0A 1IKXB 2AP6A 5HLFA 2VOSA 4GS0A 1IXKA 2LFVA 2LKZA 1UL3A 1DY3A 1RT1B 4DHVA 2HLTA 1UA0A 3OT9A 4Z7YA 2JOQA 2Y9HA 2WOMB 5KA3A 3HHEA 2C2NA 4JV5J 4B3TJ 2DISA 2COLA 3OTDA 1VRUA 1JLGB 1W2IA 2MY7A 4HL9A 1W2BR 2POKA 1LW0A 1S48A 3K0JA 3RB0A 4C11B 5KOXA 1TKTA 3IGVA 3JYTA 1PH0A 3VZIA 3MR2A 4LJMA 4CM2A 3H2XA 1AT1B 1R8PA 2YQ0A 3B78A 4MKBA 3KLHB 3D9CA 2E9RX 1S49A 2ERRA 3RW7A 2FIUA 1PYOB 1KKHA 3LALA 2OD6A 3ZTOA 3TOQA 4FN5A 4JYAF 2UV8A 3NWRA 1VQNS 4H4OA 1LWEB 1QAYA 1RAJA 1RHUB 3CCWA 2QJ3A 3HT0A 4JBCA 4PAAA 1RT3A 2WHOA 2XTJP 1B3TA 1OHCA 1OS5A 1P31A 3M7VA 2LECA 3IFEA 4DL2A 5E3CA 4WFYA 1SIZA 3EYZA 3TA0A 4OI1A 5EWFA 2CVIA 1N36F 1NSKL 2WK4A 2Y1LB 1GAOA 1EETA 3CCJS 1OQ6A 1FX4A 3DFEA 1ZA1B 3VGSA 5ETQA 2WRMA 4ED6A 3QO9A 1JQGA 1QE1B 2Z2ZA 3GTYX 4OI2A 4LUBA 3VVTA 4KH1B 4JI0J 4K4WA 4GE5A 3H4BA 2KT3A 4PG7A 3TR5A 4BLGA 2RS8A 3IRWP 4LBPA 2NLKA 3BZQA 1NEEA 3OSPA 2DCUB 3BGRB 3CD7A 4EMDA 4XTTA 3E8OA 3NEKA 4QOTA 4WJBA 5ETPA 2HQ3A 1KC8T 5D3GA 3EZZA 3NRSA 2AJ1A 3V0DA 4GO7X 3LF0A 2HS0A 4DGPA 1KP6A 1NNDA 3M4UA 3NGKA 4I6AA 2FJEB 5KFVA 1OPZA 1KOHA 3BKFA 3MECB 3QAUA 3LPEA 1VHFA 1JBWA 1HQUB 2VICA 3QIPB 1F5BA 5J1EB 1N34J 3G9CA 3QCNA 2DNPA 1E0DA 4ELUA 3QSYB 2R8IA 3O1LA 4C3KA 1T9UA 2KXNB 2C3OA 4D3QA 1HBNB 2CFXA 1ZPVA 3UCGA 1FT8A 2QZ8A 3TUJC 1D09B 2A6OA 1PTTA 3A8IA 4A8WA 1Q6TA 3P6YC 1RT7A 2CZ4A 4PXCA 4DPOA 2HBQB 4DR7F 4ZVEA 1X4CA 1N54B 2DEIA 2B4UA 1WEXA 4MIWA 4DJBA 3VAHA 4C6AA 3D0HE 1C4AA 2I5XA 4DQRA 2JFDA 5K9FA 5LMUJ 2Y3YA 1VC0A 3HVRA 3Q8YA 4I2PA 2XHWA 3WIVA 5MLCV 2W2OP 4XPEA 4RH9A 4ZIYA 2QLXA 3PW4A 1YBTA 2J0WA 2VPXB 4DFPA 4DN0A 3HVWA 3U1MA 1N5YA 1ONYA 3Q86A 2IYIA 2B4OA 3IAS9 3NBPA 4CLWA 1E6VB 1KHVA 1VFJA 1W26A 4ERDA 2IDLA 1CULA 3FJ2A 1S1UA 2NPFA 1Q8KA 4DV6J 2UXCJ 4EK2A 4Y14A 2ILZA 2G6ZA 4RZRA 1VOMA 3ZTRA 1PC5A 3G71S 4DSIA 1FRKA 3ZV2A 1KLNA 1S6PA 2BABA 2DRBA 1U0HA 3ZZTA 3DI6B 3FEXB 4DFMA 1IBLF 1E6YB 1M1GA 1TV6B 2EFPA 2UUCJ 3HP6A 4RJVA 3QWPA 2J5AA 1FRHA 2C2OB 2E66A 1T48A 1WC5A 5F9NA 1GXLA 1H38A 1YRXA 3W62A 5KA0A 4ZKAA 2CYYA 4J9NA 1T7PA 1HNIA 2NXNA 1X60A 2IJRA 2AV5A 1UJ6A 2KI2A 4NI2A 2XQCA 1VQLS 3GXHA 4OHDA 4CO5A 3TARA 4GC7A 2E0TA 3BSAA 2KRRA 5K14A 4JV5F 1RBOB 2HNDB 3DOMB 3HHKA 4N7TA 4ANCA 3DMJB 3PRVA 4I2QA 4C97A 1S72S 5L1JA 2HMIA 2OELA 3GQCA 1SC6A 2LLZA 4BC7A 3CDBA 2FC9A 3MWBA 1FPZA 3DDKA 2B9EA 2YNFA 2B9YA 1ZM3A 2CWKA 3ET6B 3MM6B 3O2IA 4M5GA 3W64A 1URRA 1NZ8A 2OZ5A 2E7XA 1W25A 2V69A 3CGIA 3MD3A 3UDVA 4P71A 1XMQF 3Q2TC 2QMUB 1YFOA 3SCJE 2A1BA 1KDNA 3LWMA 1WSVA 2BA9A 4LF8J 4OI0A 5H9FK 1EIYB 1VBKA 4OI4A 4P2FA 5EDWA 2XNRA 3OUYB 4AL5A 1Z2LA 2PSZA 4L75A 1HQEA 4RU9A 3WHIA 1RHJB 3FSIA 4EU0A 5A8RB 4ECYA 5DG7A 2H5JB 2H48B 3B4DA 5CYMA 1X5OA 4J9VA 1U8SA 4WU2A 2R7WA 4WZQA 2OD4A 3OFFA 4IG0B 4OZ3A 3KLFA 2LU1A 2VU5A 5B0CA 4RNNA 4HLBA 5KFXA 5A8WB 4MMOA 2CQIA 1XERA 2N7CA 1LWCB 1M5HA 5J1PA 3V81B 3MPYA 4GVBB 4YN3B 1XNRF 2HYIB 5A6PA 4GFUA 3M8QA 1RHKB 3GFYA 3CJKA 4UUXA 4J9OA 3DOLB 2HEKA 3NNCA 2GIRA 2OAUA 4N77A 4PQUA 2CJXB 1LXNA 5ETNA 1VRQC 3WZ0A 2HNYA 5HJYA 5AE2A 2C2RA 1F60B 2IMGA 5IC6B 3MM9B 1JKHB 3TUZC 2ZH6A 4NNDA 4QUMA 4WK1A 4B02A 1IBKF 3R27A 2G0IA 4LR9A 4MT1A 1RPMA 2CMBA 4OHZA 2XSJA 1L3TA 2B43A 4LSNB 3V5RA 1U1MA 2YKMB 4A48A 4DV6F 1RCXB 2CVEA 3QCIA 1K44A 4YR8B 4B17A 2C2MB 4CLFA 4C98A 1SCJB 2GAHC 4KH0B 5CYQB 1Y5LB 3DRSA 4CNZA 2HC1A 4QW9A 4HR2A 2WW8A 3V6JA 3IM9A 1BWVA 1X4FA 2B6AB 1XQIA 3IN5A 3BM7A 2VG6B 3U1NA 3V4IB 2ZD1A 3ISNC 2IVFB 4DR2F 3LJ8A 3DU6A 2PE8A 3E2EA 3B7OA 2B9XA 2LYVA 4B3RF 1X7VA 2V2KA 3IS9A 4Q8EA 1SKRA 2DGOA 3M8ZA 2GP0A 4ZLNA 5CD4H 4J9PA 3DC2A 3TEHB 4WF9Q 2AZ1A 1HL6A 2MJNA 3VZHA 3W63A 4G65A 4RO0A 3RR7A 4LF6F 4UOGA 2WGPA 4NLOA 3TVYA 2E5IA 4IOBA 5E5NA 1CG2A 1NDCA 3PJWA 1F5AA 4NEYA 5LJ3Y 4ED5A 2DY1A 3Q8QB 3PXGa 5KFTA 3DHWC 1FD2A 2BE9B 3OL7A 1QZ0A 2C3YA 2YNGB 3ENWA 3ISND 3OV7A 1BUXA 1RYSA 4O3SA 1WG4A 3QWUA 3PR4A 4JI3J 1S97A 1RU2A 4HI1A 3EGVA 2L48A 2VIHA 3M4XA 2CA9A 3EJMA 1AW0A 3DLLQ 4UUWA 3CJSA 4ZVFA 2KM8C 2EG2A 4AL6A 1U45A 2ADBA 1HNZF 2ZJQQ 4CO0A 4OYBA 3PM9A 4C8ZA 4KJIA 4R0TA 2C3PA 3UCZP 1TL7A 1HWJA 4R30A 4FS1A 5JJBA 3CCSS 3OSNA 1FWLA 4I56A 4DL0C 1WRMA 3M2RA 1NPKA 2RQ4A 3ZXWA 5BZXA 1DQ9A 2BOAA 3NAIA 4ZVTB 1SJQA 3NS5A 4ES3A 1GQQA 2BIJA 5HDEA 2CZVC 3SMEA 4ZVHA 4M8LA 1Q6SA 2AZ3A 2WONA 3G86A 4OLPA 5DDQC 3W5XA 2V8HA 1IKWA 5F3TA 3PRBA 4V1Ak 4EUVA 3BH6B 4X4PA 1EARA 1SJ3P 4ECSA 2F5GA 5FD1A 5I42B 3ILOA 5KFLA 2DITA 4C8YA 3DLJA 4RW6B 1JX4A 2YPYA 3P5TL 1YGYA 3JXOA 4N5SA 2V34A 2NV5A 3F0NA 3T5LA 5IT9U 3DM2A 1FNMA 3VGTA 2CIMA 2AGPA 4FBUA 3O4TA 3OR1B 1CS4B 2PIIA 4OHXA 4ZP9A 1FRLA 4OJ1A 2J8SA 4URGA 1SPBP 2WCXA 2F70A 2HB1A 3QCMA 1BZHA 3QKQA 4K0KJ 5D77A 3Q8VA 2DGWA 4WTYA 2KVQE 2YQ1A 2G13A 5G0RB 1RAIB 4A8QA 5HATA 1JXVA 2GFFA 3TW0A 2C2ZB 2G1DA 3DLEA 4I6YA 5IOLA 3TRGA 3U1LA 1OY9A 3AXKA 3BF4A 3J7YU 4BDPA 2X5OA 4RH5A 2VTEA 2P5VA 3KFWX 2C7SA 2RILA 4OJ3A 5A76A 5I3UA 1Q6JA 2FH7A 2QTWA 1Q5VA 2FD2A 2NZCA 4DUTA 4ECRA 3T41A 2OPRA 2GHPA 1SC1B 4ETZA 3MMBA 2ASYA 2R2UA 1NB7A 1UZDA 2H02A 1JNZB 4H4MA 1WG5A 3NNHA 2DNYA 3ADAC 1U0SA 3NP5A 2DHSA 3R6GB 4ANEA 5C42B 5M2UA 1VI7A 3IG1B 4DV0J 1M5PC 4RW4A 1N5SA 4L3NA 2QLBB 3AB2B 3HCXA 4MIBA 1RUSA 3EXYA 4NX8A 2OSQA 4A46A 2BDPA 1FQ1A 1Q95G 2AYMA 1YVFA 1NDPA 1ELOA 2BRKA 1NK0A 1N32J 1G1HA 4JV0A 1ZPWX 3PHTA 2MSSA 4NYPA 1Z1ZA 5GAHU 4FF3A 2HS4A 2V9KA 3IAM9 3KYLA 1TVRA 2UP1A 3N6NA 2OPPB 5LXRA 1U1KA 1VHRA 2BRLA 1W78A 4ES1A 1EB0A 1P27B 2Y0BB 1SXLA 4FYXB 5I3PA 2A2DA 2V4QA 3ICLA 2RRNA 3K17A 2JLFA 4OHWA 5HQLA 5GAEU 4V19X 1KAVA 3W7BA 4URQU 2CJYB 4JNBA 3M6VA 4X66F 2UVVA 4MYUA 4CLSA 2MLZA 1HBOA 1LW2B 2CMAA 3M8YA 1RK8A 3QFWA 4RW9B 2H4WB 2EKNA 1X5PA 2HAFA 3CUNA 2QEXS 1P6TA 4NYOA 4K50A 3X3UA 2ASJA 3GYXB 2D41A 3FEZA 2XMVA 4XAKA 3CMAS 4NLVA 4X4NA 1CJTA 1RT4A 1WSRA 1JJCB 4ID5A 4J91A 4CRJA 1FK9A 4EFAC 3VHQA 3SFUA 2GCFA 5D0RA 4RBVA 4AD6A 4USUA 2E1CA 3KWMA 3D7SB 4O3QA 2ZHBA 2CQ0A 3ZM3A 3I9V9 3O4SA 4QIEA 2AEMA 3R5AA 2P6XA 5AXKA 4B9UA 3LP2A 4X62J 3S4OA 4IH7A 1VRTB 3O6QA 3ZZRA 1GMWA 1HHSA 3MR3A 2OP5A 1VCTA 4PYAA 3M32B 1LEOA 2ZBCA 4ZP8A 2CQBA 2HKEA 1XMOF 2OKQA 2WTZA 1REVA 4GE6A 5K9WA 2PO4A 4BBYA 1RAFB 2O5DA 2W8KA 3CCLS 4KB7A 5ETSA 9RUBA 4K4SA 4M5JA 3PVXA 4HT7A 4Y0FA 4CYUA 3EPIA 1N34F 2QIFA 2MB0B 4UY8T 4LREA 2B0GA 3W2VB 1K47A 2FDNA 3KJVA 4C12A 3TJ9A 1V3ZA 1FI4A 1QDUB 1F9FA 3BYPA 1AZSB 3QPIA 4ID8A 4YB5A 3UVJB 5GTJA 2OH2A 3VGVA 2C3UA 4NCGA 4CO2A 3EU0A 4B9SA 4O0IA 2ZMMA 2W25A 1LKZA 1K1QA 3CJ3A 3EGNA 3PYFA 2ZKUA 4Y2AA 2Q79A 2BW7A 1NPRA 3O8WA 2LXIA 3R1LA 2CJZA 3K89A 1MG7A 1Q8IA 1U2FA 2K3KA 4WFXA 4DV2J 1RXDA 2J16A 5GMDA 4NXNJ 4FZVA 1NZAA 4A8KA 5DLFA 3E01B 3CD6S 1NUEA 1NJWA 3MGJA 3VAFA 2JFGA 1Q7YT 2CQ2A 3J7ZT 4DR1J 1VQ4S 3TWZA 2H4YB 1IBCB 5ETVA 4QWBA 2DKOB 3P49B 3MXHP 2NSCA 3PYGA 4CO4A 4WYLA 2VPYB 1FVSA 4M5NA 3UO0A 2QA2A 4S0GA 4G1IA 2YX1A 2KKHA 2UXCF 3V6KA 4KTQA 1VIOA 1JLBB 2XZTB 4X4QA 5EGYA 2R7QA 1Q82T 3HHNB 2AM2A 3LP0A 1KLMB 1NRKA 3MEGB 2XM3A 4IOCQ 3EWGA 4Z37A 2KJWA 4ZPCA 2QFJA 3IG1A 3D6TB 4F67A 3N28A 4KV8A 4YS2A 1FDAA 4PABA 2RQMA 1BQXA 3QYYA 1NHUA 1BQNA 3K5PA 3CWEA 1RTZA 4NPOA 5F8JA 1YITS 2A3KA 1FD8A 3IO1A 5ETKA 4QBWA 2JC0A 2CNLB 5KOWA 1UCNA 4FBTA 2H1YA 3DN9A 4YFUA 2C28A 2DEJA 1S1XA 1SJ1A 4YMEA 1ROFA 1FE0A 3KLEA 3UDEA 1F5CA 1LFWA 4OHVA 4DV0F 3ITHB 4D3HA 1O8BA 2IM2A 4C7QA 2OMOA 4DR3F 3M2UB 2V4RA 1NLKL 1NSPA 5IFMA 5FJ4A 3HFKA 3HF5A 1WHWA 3W2WB 2X3DA 2NCKL 1VQYA 1HNXF 2I1RA 2DGTA 1BMQB 1RQ0A 1UMJA 3D28A 2VKZG 4P72A 4ZP7A 5KADA 4IQXA 3DGPB 3IXQA 4CLZA 1FDNA 2NQPA 4USIA 5KA4A 3ZTSA 2GHWA 1QUPA 1DTQB 2AEJA 2YBVA 5K25A 2E7VA 1CS4A 3ZFVA 3ZO7A 1DARA 4NLGA 2HXPA 3W3SA 3K5NA 1S1WA 5IWAF 1RT6B 5E33A 3DLKA 4DCOB 3BEGB 1DJ0A 3PG9A 5F0UA 1CQNA 2FVPA 1TQLA 2IA6A 2R8KA 1WAXA 1WWHA 5IZHA 2FJWA 1PJ5A 3AA9A 1FJGF 2B5JA 1C84A 2Q05A 2W2MP 3VQTA 1RGVA 1UFKA 2P9CA 3FBFA 1O0PA 4N8OA 4RHGA 4BCAA 1T0TV 4USWA 2UUOA 5KFCA 2F63A 1IUJA 2WONB 3DKDA 8RUCA 2OC3A 3FBBA 5CXTA 4MBBA 2BJ8A 1WKKA 2YKPA 3AFGA 3DLKB 4MJKA 4NE9C 3UI3A 5I3QA 2W9BB 3CO0P 3BJYA 1HBUB 3IBWA 2GHVC 4O4RA 1LWFA 3IWXA 2M5YA 2QE5A 1SKSA 1CJKB 2NZ6A 2GVZB 3EZOA 3MMCA 4EZ9A 1C0UB 5BYRA 2IMOA 2VG5A 4P7VA 1EENA 4DU7A 4A8SA 2AGOA 4N41A 5AE1A 4ED7A 1QM9A 4ZPAA 5F9LA 1IBKJ 1Y5IB 4PWDB 5KG2A 5HP1A 2XLJA 4O3RA 4B3MJ 1FKPB 1DLOB 2FVCA 5M2PA 3S8SA 4H1OA 2V8DA 4ILRA 4RNHA 2H3EB 3DRPB 3T1HJ 1WEYA 3AA8A 2A18A 2B51A 1HW9A 3W61A 2C22A 2QL9B 5GAGU 3KOAA 1UP1A 1FJEB 2VL1A 1AFIA 3AODA 2F6TA 2YNGA 5KFKA 4CVKA 1I3OB 3NXZA 2XWXA 4EYIB 2GQCA 4DV1F 1RAEB 1Y9OA 2FTRA 3D6HB 4FXVA 4P7TA 1VQKS 4PWDA 3OPKA 3B6BA 3TVKA 3AAWB 3EX7B 2R2RA 1DFDA 3SMZA 3E3XA 2F71A 3R3TA 5HQ8A 4DSLA 1LFPA 3M05A 2OEKA 1WJ9A 1CJKA 2CPFA 2HVEA 4B3RJ 1A0OB 2XLIA 2CJKA 5HI7A 2V94A 5KAAA 4OHLA 2JX2A 3H2LA 4ZPDA 1JLBA 4JI7F 3BSNA 4S0MA 1BQMB 1UEVA 4ZJLA 4QZVB 4XDDA 3CCTA 4FKXA 4P74A 1RTJA 2GA7A 4G1PA 1RU1A 3QT6A 1QSSA 3LGNA 1Q81T 1IJEB 2BJDA 3SV4A 4G1QB 1VLOA 1RP5A 4C2MA 1MKPA 3D3BJ 4QR2A 4ZPTR 3V0JA 1R6VA 2HRTA 1RA7A 2KT5A 3HHDA 1M5SA 5E3AA 4U95A 2ASDA 2J16B 2X1AA 1FRJA 2ACYA 1NNYA 1R8BA 3M8PA 2ZH7A 3U27A 1R6YA 3DDNA 4KKOA 1SUQB 1WACA 4FP9A 4F4ZA 3OBIA 4CT9A 1A9NB 3OXFA 2BGEA 1FXRA 1RAOA 1H0HB 1HARA 3H90A 4FPRA 2DNLA 4I64A 4WE1B 3DGPA 2YVSA 1JKHA 2N7YA 3FMBA 1RWOB 2F40A 5HBMB 4ZHRB 4AL7A 4DF4A 3A3OB 3HSGA 1LQFA 3W2VA 2LP4A 1WKJA 1WEZA 5L9XA 5D6GA 4ECQA 2DXFA 3HD2A 1QSYA 2UUBF 1GQYA 2WSCC 5IXUA 4FNIA 3BH7B 1HW8A 3IGNA 1RTDA 3BRHA 1LV5A 1KONA 4WFNQ 1MN7A 2YXLA 2E1MC 3AD7C 2PEHA 3D9BA 2AX1A 2FC8A 2VPWB 3HDSA 3QBCA 2RT3A 4QIVA 2KU7A 1D8ZA 3MOZA 4RX6A 3VV2B 2XYGB 5C5JA 1FRIA 4TY8B 2UU9F 1CC7A 2XMMA 1NZ7A 2YNIB 4JI0F 2AD9A 4DSEA 1MSWD 3SR9A 1FNOA 1XEZA 1PO6A 2HAIA 3I0SB 3EVMA 3V4MA 4QPTA 3TAQA 2PI7A 4YR3A 1F0XA 2KXHA 4TU9A 2ZVIA 3FRYA 2HHUA 2HK3A 4X84A 4ZCLA 3RGQA 4KYZA 2K7KA 3J81Y 1MWYA 1L5UA 1GMWD 3WDOA 2H4GA 3ENVA 2ATLA 4ZP6A 4PEOA 2EK1A 5C2CA 1Y4ZB 2ZM6J 3RRHA 4OYZA 1VBYA 1MN9A 3I82A 3MAHA 3NGSA 4NWBA 2F46A 5C25B 4RW9A 5BR8J 4ED0A 3FVYA 2JJ4D 2FVSA 4QF5A 2YX4A 4LF2A 4CO3A 3Q24A 4G6VB 1Q1MA 2CADA 2FB0A 4DSJA 5C24A 3UWTA 2VHGA 4DV1J 3EVWA 1S7HA 2VF3A 3HZEA 1NHVA 3NNAA 4NLYA 2I5JA 5KFIA 3BSOA 1TU0B 1XBWA 1JLNA 3RUBL 2OPPA 3DXSX 2EFQA 5HMWA 1R8HA 2I2YA 3G4SS 4DX6A 4LFCF 1RWVB 3P45B 2VPZB 5EHRA 4ZVRB 1CPZA 4X4VA 2ALYB 2VEYA 3MFIA 5DQIA 4L3KA 4WTOB 1FFWB 3SIPB 2CQ3A 3QGPA 1UVMA 3GR1A 4MK7A 4CVMA 4ERCA 1YJ9S 1HNWJ 2H03A 2B8QA 4CQ1A 3J81U 3NGTA 4OZ1A 1FNXH 3N6LA 1W7KA 3QKPA 2W4PA 3NGDA 1Y3JA 3ISZA 3LOUA 4QW8A 5DETA 4JMJA 1EKRA 1NO6A 1XNQJ 1YRUA 4KGKA 5IT0A 1X9SA 1UVIA 2JVOA 2F9DA 3ELHA 5AE3A 2N82B 2JWNA 3I0RB 4LRFA 1CJUA 4DR4F 3M32A 2XMJA 2Z4PA 3N9UC 3UDCA 3KK2A 2VEUA 3U96A 5B7WA 2ZOFA 5LOQA 4RDDA 1D0EA 2NZ4A 2W2NP 3KNGA 3LP2B 5K20B 1H7WA 4OV6A 4ZIWA 2CPIA 3D4JA 1Q53A 3ZMPA 3Q8UA 2AJ0A 2DPJA 3Q22A 3BDPA 3SQOP 2FUG9 2CJQA 3D1QA 2MMYA 3M6WA 4JUZA 1N8RT 3EZ5A 2SHPA 4USHA 4LFBJ 5G0RA 4UW2A 4ZHRA 1NCLA 4ZJOA 3FEYB 2ZH1A 3A8KA 3QGIA 2ZOGA 3PYDA 4F0HA 4OX8A 4N76A 2VEVA 3PDNA 4DF8A 3EAXA 2NREA 4KHRA 3QCEA 2GO8A 1PAEX 5EHHA 1U2CA 3V6DB 3AHPA 1RHMB 3VAIA 4NCAA 4PXBA 4ZVQB 4JP8A 2KL8A 1PTYA 5ADZA 1N0UA 3BDEA 3HSJA 4O44B 1OEUA 1OQ3A 4CO1A 2QBSA 2VFSA 1IKYA 3Q8PB 1T9YA 5B09A 2VEWA 3IR5B 4WXWA 4QIFA 1FJ7A 3SDEA 5ETLA 3U02A 3PEHA 1L8KA 1PG5B 1WC6A 2V2QA 1WI6A 1SL2A 4LF7F 4WXOA 2WB1D 1N5VA 4P6QA 3VGUA 5BZZA 3H59A 5K9VA 2HQGA 1YBUA 5AXMA 2Z0GA 2JFKA 2QLFB 2KT2A 3I6PA 3TP2A 1S6UA 5F0WA 2MQOA 3DNCA 2JFHA 2OOQA 3C46A 4BS2A 4GWFA 2HFSA 2I9SA 2BM0A 2Z57B 2RUSA 4Y6IA 5KFZA 5BYSA 4J51A 1QTNB 3H4DA 2EBGA 2VG7B 1UWAA 4AYBD 2YWEA 4IR1A 2CZ9A 2PT0A 3ETOA 3PS5A 4C48A 2HHHJ 2I38A 1BZJA 4CLKA 5L9NA 3SSRA 2BJ1A 3SEOA 2A3JA 3W5ZA 2L41A 2HW3A 1BE4A 3D0IE 1G1FA 3S3FA 2DR8A 3R9LA 2JEIA 1S0MA 3HJVA 3ILLA 2CNIA 5KA1A 3M9MB 4OYWA 1IKVB 5FLXY 1OSDA 3D3CJ 1IBLJ 2IAJB 5M2RA 1D9AA 5K5MA 1ZCKA 1G2EA 4KI9A 1FKPA 3M8WA 2X3GA 2R2TA 4NZ7A 1S1TA 4IO1A 4YHHJ 1KQGB 1WKLA 2DNGA 4XIUA 5IV3A 4DV2F 1U1PA 1F2GA 5MMZB 1RYRA 2VG5B 3JSBA 3MMCB 1KFSA 2AZRA 4JI6F 2I3RA 1TKTB 3LO3A 4KGVB 1LWFB 5CQGA 3PO5A 5AXLA 3TAMB 3EPGA 1XRIA 1HBUA 1GTEA 1YGUA 4RBTA 3BBCA 4ZRTA 3ZZPA 5IS2A 2GCAA 4Y2EA 4WK3A 2W9BA 1WCHA 2J0XA 3AJ1A 3CC7S 4PXEA 2U2FA 3AOBA 4KC5A 2FHJD 2GO9A 1LOUA 1T11A 1WC3A 2MDAA 4CIOA 2HSEB 4JI1J 3SXLA 3S4EA 2QC3A 2RD5C 2XS5A 3L4BC 2F4VJ 1V6HA 1KR4A 4CLUA 1WHYA 1HMVB 5B0EA 3OLAA 3SCIE 4QWAA 2VV5A 2DRDA 1PJ6A 3HI9A 4FYDA 2XO6A 2YPZA 5LMNF 3NMEA 2Y1RI 2ZBIA 3IBFB 1OWXA 4Y34A 3M2RB 5HMZA 2R42A 3A5JA 5KG6A 1DTQA 4HTJA 4IFYB 6FD1A 1FRMA 1NXIA 1O51A 4ECZA 4LF5F 5KT5A 2KYZA 1ZH5A 2XI3A 2BGDA 2HIQA 4FYYB 1K0VA 2XBPA 2XG8A 4DG1A 3TZYA 2LQJA 2HS3A 4ENOA 1CVJA 2O01C 4OYIA 4DOZA 4U6PA 2DNZA 4HEA9 4K2XA 1UKUA 4ZITA 2FVQA 5D0EA 3K8WA 5T7LB 4U9RA 1UVNA 2BZ2A 2JFFA 4R8UB 5GMKa 2QDPA 2BBEA 1XC9A 5DGBA 4RW8B 1AAXA 5KFJA 4WCEQ 3OHBA 2VODA 4M5LA 1F9EB 1RACB 2DGVA 2CQ1A 2HGNA 5RUBA 5T14A 1YWFA 3FC9A 5CAAA 4RKKA 3GJQB 4ECVA 2QDCA 3NS6A 2MSTA 2J7KA 1SC4B 1BQNB 5H1SV 5DLGA 5KFOA 4D3PA 2HFNA 1GK8A 1VIXA 1ZS6A 2HFUA 2XSFA 5CYMB 4RUHA 4BC9A 3A8JA 4B3OA 2XJAA 4ELVA 2L9DA 2GC6A 5IT4A 3OXGA 1R7IA 1SL0A 3JQKA 1X9WA 1OSCA 2FY1A 1JLEA 1X4AA 5KT3A 3GE9A 2CQ4A 3UPFA 1GXTA 2MKCA 2GIFA 2ASLA 3CCUS 4NWGA 3PZPA 2MPUA 4XK8C 1VJWA 3I55S 1F3FA 2CDQA 3GFHA 1NK7A 5L46A 4P52A 1VQ6S 1FKAF 3A3PB 1I5OB 5KFGA 3CM3A 3OD2A 2HVDA 3LUYA 3AH6A 3CJRA 1NHKL 3I5CA 3L9ZA 2X1FA 2XULA 2QSFA 3GG0A 2GJTA 1HQ2A 1W7WA 2FHMA 2MKJA 4FF1A 4ZN5A 2W01A 3DRYA 5K14B 3CF5Q 1PBAA 3QFHA 3AOAA 1VR6A 2UV8G 5L1IA 1KQSR 4JI6J 1BY9A 1RBLA 1WTFA 2YKMA 4CT8A 2FVRA 4TLQA 4OLOA 2PA5A 1S0OA 4WFAQ 3GWCA 2HGLA 4ZLLA 5IT9Y 5K8PA 5HK4A 4BWMA 1D8YA 4ER8A 3CC4S 3FCVA 1BZCA 2R8JA 1FEEA 2Y2FA 3CJ5A 3EGWB 1B7YB 1DBDA 2GW8A 4KSEB 4OYXA 1VHIA 3G8QA 1TK5A 5E0OA 1YJVA 4RW7B 1T3NA 2W4CA 2UUCF 4F4AA 3MEDA 2FJNA 1S9EB 1YLXA 1B64A 3NCRA 1EKSA 2B4VA 3POTA 4DCJB 7AT1B 4DZDA 3MR5A 3OMHA 1S59A 1SH3A 3W8PA 4ZIVA 2OFGX 3C14B 4USMA 2R8HA 1NK8A 3NMAA 1KVJA 2I3UA 4JI4F 1S79A 3WBZA 4IG0A 3KLFB 2QA4G 2UVUA 3Q89A 2DHHA 4P2SA
chains in the Genus database with same CATH topology
4QWCA 2CPHA 1Q8BA 3MMJA 4K59A 1HQEB 1M1KT 5B08A 4C0BA 3X1LB 3OUYA 1X8DA 1VQOS 2Y1JA 1FK9B 4RWXA 3FFIB 1ULRA 1RT4B 4LIWA 4DL7A 4GFVA 3GG1A 1KTQA 1I94F 1VQ8S 2QA4S 4X4SA 2J76E 2YTCA 4ECTA 3RW6A 4ITSA 5GVQA 1LYVA 1S9FA 5LXYA 1NH7A 1S1VA 2K2PA 1G6BA 4QR0A 4YUDA 2W9CA 2KZMA 2PMZD 2VUGA 2V5HG 5CYJA 5J2PA 2FJXA 3SCKE 5KFNA 3KMQA 4GE2A 1HWLA 3FQKA 3HVTA 4KYQA 1R27B 3MR6A 2R7RA 4DN9A 3RTVA 2C46A 1VQMS 3A1YG 3QAEA 4F2RA 3KLGA 3KTQA 1T4JA 1G7CB 2QV6A 4YEAA 2W9AA 4QR1A 3GILA 4TXSA 2HC2A 2YWGA 2KFNA 4KT0C 4ED8A 2IRUA 2HQIA 5KG7A 1HWUA 5SUHA 2PD1A 5DM6Q 3DLGB 4DQSA 2PN6A 2HCMA 2H9ZA 4RW4B 2P6SA 1GQEA 3OW2R 4YDDB 4Q8FA 3QO9B 4C3LA 2KXFA 3JAMY 1Z4UA 1PYNA 1YIJS 2LQ5A 3DI6A 2ZH5A 1N52B 3HO1A 3EGZA 1XBOA 2ZVSA 3MMBB 1R0AB 2KH9A 2VFTA 1PILA 2ZM6F 4DS5A 2CPEA 4D3GA 4DV7F 3TUIC 5KTQA 1UW4A 3JTOA 1J5OB 1Z2ZA 3FCHA 2YKNB 4NMLA 3MUTP 3S3EA 3OHAA 2F6WA 3TI0A 4QYZJ 3BN7A 3MHYA 1G3OA 3T5JA 4DFJA 2QEPA 3K5MA 3TNVA 2WBRA 4DLEA 3OR1A 1TL3B 2GQ2A 1PTUA 3GXGA 1C1CA 3FZ2A 4CH0S 4F26A 3GIKA 4QJVA 1S4FA 1I9TA 1HNVB 3CCQS 2F6VA 5KFEA 1C0TA 3PIOQ 4OV1A 1TKXA 4X65F 4X4TA 5I42A 1WF1A 4F50A 1BLUA 2OO4A 3R5DA 3K58A 4W92B 2RU9A 3D5MA 4QPXA 4IR9A 5CA5A 1A7GE 4Y65A 2QCTA 4JV1A 4RU2A 2HNPA 3CCVS 4IOAQ 3TVZA 4YR0A 4PXDA 3RAXA 1NWLA 4DGXA 2R4FA 4RKUC 2QRRA 4F8RA 2XC9A 2R7TA 4O4GA 3AWEA 1HWKA 4Y3CA 4JV2A 3D42A 5KFHA 4ZPVR 2V4JA 4KRWA 1BWEA 2M7SA 2BE2B 2J9EA 3JSMB 1U47A 3THTA 1DURA 2RF6A 3V2UC 3H25A 2XS2A 5KG4A 3CB4A 4GKJF 2ZN7A 1P9QC 2HHXA 1APSA 4J9SA 3MFHA 2UVRA 4PYHA 5EX0A 4DX8H 2EFOA 3KK3A 5J2NB 1PA9A 5DRKA 1CQMA 4U7UK 3M8SA 2XMTA 4DUYF 3RO1A 4K5RA 4I67A 2DCLA 1KHWA 1YZ4A 2IM1A 2V8GA 3FGVA 3M6UA 5E7OB 3MEEA 4EBEA 2I4EA 4TKTA 2NT7A 3P3DA 3BGFA 1JLGA 3CCZA 4AXJA 2I3RA 5J2MB 4F4XA 4UQGA 5D8HB 5KA7A 3KLIA 3RB3A 3OFEA 3UNGC 4IDKA 1TKDA 2R7VA 5D78A 4B3MF 2B4SA 3UE2A 1U4BA 5K23A 2R8GA 4L6V3 3T1HF 5F3ZA 2QBQA 5ITHA 4J9MA 1J5OA 3T1AA 1NJZA 4O3PA 1L3UA 2XS7A 3Q8RB 2ZNZA 3KK3B 3CDWA 4GC6A 4Q0BB 3AWGA 5HP1B 2JLGA 5JVHQ 2A8BA 1HBMB 3ZZZA 1PSDA 2HHPA 1MMLA 4LFAF 4YY3F 1YTNA 1R0AA 5LMUF 1U1RA 4YHHF 2J9DE 2DHAA 3PHEA 3HKZD 3MM9A 7FD1A 2UXBF 2M88A 1DAXA 4Y2CA 4DMZA 1NJYA 2HVIA 2B7CB 3N79A 4NA2A 1SV5A 4MFBB 5FDLB 4AL7A 3OFHA 2WGPA 1NK4A 4RUAA 1VC6A 2IC3B 3VALA 2LQBA 3DOLA 1UFWA 3Q2SC 4PG6A 4UQTA 2GQQA 1T95A 3CJKB 4EGLA 2W7PA 2QBPA 5E2QA 2IM0A 4K4ZA 3F56A 3LH2S 4NLTA 1TKXB 4TN2A 2RKIB 2UUWA 4B3TF 2KTQA 1RTIA 1HNVA 2Y0SD 3OTCA 5A8RA 5DQHA 1RKJA 3RR8A 2AF6A 2RSQA 1SL1A 1Q1KA 2EG1A 2VC0A 1YJWS 4B9MA 5J2PB 1TL3A 2ZFHA 2DK2A 4NLXA 1JLFA 2EW9A 2HG4A 5D4OA 2MKSA 4AE5A 2XY5A 4IRCA 2PA8D 4F4KA 3UR3C 1URNA 2DGSA 4USJC 4KIAA 4Y0FA 2W7OA 1RWUA 3SFGA 1BGXT 5LSLA 1GT8A 1EP4A 1XK8A 5F8MA 2RRAA