3O3LA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol (1,3,4,5)tetrakisphosphate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
315
Chain Sequence
b'EQTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
molecule tags Hydrolase
source organism Selenomonas ruminantium
publication title Structural analysis of substrate binding in PTPLPs
rcsb
total genus 109
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o3lA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3o3lA02
3ZV2A 1G1GA 1MKPA 1Q6TA 2QDMA 4GE6A 4KI9A 1QZ0A 4YAAA 3EMUA 2H03A 5KA4A 2QBRA 2BV5A 2VEXA 4R0SA 4MBBA 2CMCA 2F46A 4ERCA 2I75A 2ZMMA 4YR8B 4R30A 2F71A 2BGDA 3S3EA 1AAXA 1XBOA 3SR9A 1ZCKA 2CNHA 1T49A 2CM3A 4DGXA 5KA2A 1GFYA 1FPZA 1PTUA 4QAHA 1ONYA 4NNDA 2QDPA 2G59A 5KA8A 4D3PA 2I42A 1YGUA 4PYHA 1T4JA 1U24A 2HC1A 1M3GA 2Y2FA 4QAPA 4ZN5A 2FJMA 1OEMX 5BZXA 2I6PA 1L8KA 1G7FA 3QKPA 1NO6A 3MMJA 4H34A 2DXPA 1G1FA 1QXKA 3GXHA 2CM7A 2P4DA 1XXVA 1LQFA 4H1OA 2CFVA 4ICZA 3I36A 4I8NA 2F70A 4BPCA 2CMAA 3V0FA 2F6FA 3ZM2A 1FPRA 4QBEA 4JMKA 3A5KA 1P15A 2QBSA 5I6VA 1PXHA 2F6YA 3QCJA 4NWGA 3D1QA 1YN9A 3EU0A 1G1HA 1OEVA 2HCMA 5IBMA 2HC2A 5KA9A 2C46A 4RHGA 2NV5A 4NX8A 3CWEA 4RDDA 3V0JA 5K9WA 2I6JA 2QCTA 1C87A 2I4GA 3QCHA 3QCKA 2A3KA 2BIJA 2I5XA 5M43A 5EHPA 1KAKA 4RI4A 2F6WA 2PSZA 1BZHA 1I9TA 2GP0A 3U96A 4KYRA 2HVLA 3BLUA 3EAXA 2VEVA 2OUDA 1JF7A 3QCDA 2B07A 5GTJA 3QCGA 3QCMA 1ECVA 3V0GA 2GWOA 2PA5A 1YFOA 4BJOA 5K24A 4JBCA 1EEOA 2NTAA 2QBQA 2I6IA 1PTYA 3D1HA 1I57A 3RGQA 1FQ1A 2H02A 1XXPA 2J16A 1OHEA 1G4US 1LYVA 1XRIA 3ZM3A 4RH9A 5KADA 3S4OA 2CM8A 2H04A 2R0BA 2G6ZA 2ZN7A 1C85A 3V0DA 3F99A 1ZC0A 2I3UA 1PTTA 2OC3A 1NNYA 3D1OA 3F81A 1I9SA 2B3OA 5KABA 3OMHA 1SUGA 2J17A 4GFVA 3PS5A 2CNFA 1U25A 3F41A 3O4SA 3ZMPA 3BLTA 5KA0A 2VEWA 1Q6SA 3BM8A 2F6ZA 3MOWA 2CM2A 3BRHA 1PTVA 1YTNA 2QBPA 2NT2A 1NL9A 1JLNA 3D44A 4OHDA 2I6OA 1OHDA 5J8RA 2P6XA 1R6HA 4GFUA 4S0GA 2A8BA 1RPMA 4OHEA 3SMEA 2B4SA 1Q6JA 2H4GA 3QCLA 3AWEA 4WU3A 1C88A 1OEUA 1A5YA 2I4HA 1Q6MA 1Q6PA 1J4XA 2HNPA 2CMBA 4QUNA 3LJ8A 2HXPA 2MBCA 3GXGA 1YPTA 2IMGA 3EZZA 4OHLA 1YGRA 2H4VA 2CNGA 2WGPA 4R0TA 2YDUA 3QCNA 2B49A 5BUGA 2HNQA 4J51A 1OESA 3S3KA 1WCHA 2QEPA 2SHPA 1L8GA 2OOQA 1YWFA 3V0HA 3D9CA 1YZ4A 1PYNA 4B04A 3QCEA 1PA1A 1G7GA 2FH7A 2QDCA 2JJDA 3O4UA 5KA7A 2F6VA 4AZ1A 5K9VA 4IKCA 4NWFA 5KACA 1C83A 4KYQA 3QCIA 1ZCLA 4JMJA 1Q1MA 1BZJA 1WRMA 4Y2EA 5BZZA 3ZM1A 1NWEA 4ZI4A 5EHRA 1V3AA 4HRFA 3M4UA 1WAXA 1U26A 1YTSA 2PI7A 3V0EA 1VHRA 4HJQA 5AWXA 3O5XA 2HB1A 2PT0A 2Q47A 3S4EA 2F6TA 2PQ5A 2OZ5A 3QCFA 3MOZA 1XM2A 2AHSA 4OHHA 4Z6BA 3ZM0A 1RXDA 2RF6A 4GE2A 4OHIA 2HY3A 3QKQA 1X24A 4TVVA 2Q05A 5K25A 3I7ZA 3RGOA 3S3FA 2I4EA 3N0AA 2BZLA 3B7OA 4QUMA 4NYHA 3D42A 1ONZA 1PH0A 3RZ2A 3CM3A 1OHCA 3I80A 4RI5A 2I6MA 3QCBA 3NMEA 4DGPA 4D3RA 1T48A 1YTWA 3RO1A 4HJPA 2AZRA 2PBNA 3V0IA 5KA1A 2CJZA 1PA9A 5IBSA 2QCJA 3F9BA 1OETA 5KAAA 2BGEA 1BZCA 2B4PA 2B4UA 5K22A 4GE5A 2CNIA 1G4WR 2CNEA 1LARA 3ZMQA 4WOHA 5HDEA 1KAVA 3O3LA 2I3RA 5K23A 4JNBA 4Y14A 5LXQB 2NZ6A 4PVGA 3OLRA 4GWFA 3QCCA 1D5RA 1C84A 2J16B 2GJTA 4ZRTA 3S3HA 2NLKA 4WU2A 4RKKA 3AWFA 2M3VA 1OEOX 3A5JA 1Q6NA 3O4TA 5BX1A 1C86A 3AWGA 3EB1A 4WTYA 3F9AA 2NT7A 2Y96A 2C7SA 4RH5A 2VEYA 2E0TA 2ESBA 1NZ7A 5KA3A 4QBWA 3H2XA 2I1YA 4GRZA 5MMZB 4GS0A 1NWLA 2VEUA 2H4KA 4D3QA 1EENA 2FJNA 1GWZA 1ZZWA 2B4OA 4GRYA
chains in the Genus database with same CATH superfamily
2HZAA 2I6WA 4FYVB 2FLPA 3M8QA 3G87A 3CUNA 4Y34A 1OYEA 1NJZA 4IRCA 1HYSA 2QDMA 3HHEA 3TOQA 4GKJJ 2N3LA 1RISA 1TU0B 5AE2A 4OX7A 4EO8A 2RDJA 2MSTA 1T11A 2DD8S 4FYWB 4IH6A 2YWFA 5G4DA 3KLGB 1UA1A 1NMEB 3GCWP 5KA4A 1Q8BA 4RUHA 3K5OA 1ZYQA 2QX0A 2IVYA 4QDIA 2VEXA 4DSIA 2RS8A 2AGOA 2GC6A 2AX0A 4RL1A 3IC1A 2YY3A 1VRTB 2PN6A 3GILA 2C2NA 1R7IA 3TJAA 2AYMA 3WX8A 1WACA 2XY5A 4WWSA 1VBXA 3MEGA 1W2BR 2HNYB 4XPCA 5HROB 1KP6A 3HHLA 4JI7F 2BGDA 3S3EA 3JXOA 3PIPQ 3PYFA 2XGPA 1XEZA 2FVSA 1QLNA 2FVCA 1AAXA 4MBBA 2AU0A 1ZCKA 4NI2A 4DR6F 1AA1B 3M2RA 3H40A 4DV5F 1N36J 3DLEA 2ZD1A 3LTOA 1WC3A 2Z2YB 3FK4A 4O4RA 4BC7A 1JLBB 2HAFA 2RILA 1HMVA 3LH2S 3R1HA 3NS6A 1FPZA 1YI2S 3AJ2A 3CJ5A 2QFJA 4DMZA 4LFBJ 3DOKA 4WK3A 1RTIA 4P75A 5KFNA 1VQYA 1Q16B 2JSXA 4O0IA 2MZRA 5IC4B 4NNDA 1I6JA 3WDOA 1X4DA 2QDPA 4DPXA 5KA8A 3JQMA 2P8IA 3BSAA 4F50A 2ASYA 2HLTA 1Q8KA 1TK5A 3QJLA 4C8OA 4EO6A 1Q8IA 2HWTA 2VPXB 3HKWA 2OAUA 2O66A 4ATNA 4Z37A 3WIVA 4OZJA 1VQSA 1HWUA 1H98A 2E1CA 1H2TZ 4M5DA 4RUCA 4RNMA 2HC1A 3QT5A 2WCXA 4ETZA 2FJWA 2VL1A 4UOGA 3K0JA 2KZZA 4LQ3A 2QBRA 1CQMA 1U1QA 1S97A 2FJMA 3IO1A 3FEYB 4QIGA 1KFDA 2W2NP 3UFCX 1O5ZA 2J8AA 1KVKA 3PW4A 4C97A 1TL1A 1L8KA 4EBDA 3C6TB 4WXOA 1UFLA 4DDFA 3QKPA 1U6FA 1NZAA 2HK3A 5F0WA 1FDNA 1FRLA 1TUVA 3QGGA 5BYQA 2YWHA 2DGQA 2O01C 4NPOA 3ZZZA 4AFFA 4H34A 1PYOB 1REVA 4RW7A 1BY9A 4JI0F 4X4UA 4QF5A 4ZPDA 3M7VA 1XXVA 2QFIA 4ECUA 4XDCA 1F60B 4H1OA 5KFPA 1NU4A 1GNKA 1U0HA 1TL4A 2NXEA 2XMUA 3IR5B 2VFSA 4KB7A 1FRMA 2W4DA 2DISA 2W4PA 4NLVA 2VPYB 4Z7CA 1T0TV 2KT5A 1OJ4A 5C2CA 2Q3PA 4OHZA 1S9GA 3K5NA 2ACYA 2DO0A 2G1HA 4HHHA 2FY1A 2WSFC 1SQGA 3AXMA 4ZP7A 5AXKA 4TXSA 3TEGA 4URQU 1GXLA 4KV8A 4NL5A 4RNHA 1JWWA 1FPRA 2FZKB 4LR9A 1RT3A 4ZVRB 1S12A 2LA4A 2R2RA 2HRUA 3IAS9 1UVIA 2M7SA 1FD2A 1YRTA 3FZ2A 3QPIA 1TR0A 4ZVGA 2F6YA 1YZ6A 2V5HG 2GC5A 1DQAA 2IAJB 3SCJE 2OELA 3BR8A 3RYLA 5KFMA 5DGBA 5A76A 5B0AA 3AQOA 2HC2A 3TVZA 5KA9A 2C46A 3BYRA 2EPIA 3G82B 4RHGA 1FCAA 2GV1A 3GU0A 3M6WA 5DGAA 1GG4A 4DL7A 5EN1A 4NX8A 5KFFA 1U2FA 4ETXA 1NDPA 4RW4B 4U6PA 1FERA 4DR2J 1GH8A 4W92B 3CTRA 5EGYA 2PI5A 3AOAA 5E7OB 4ZDNA 2XCPA 1W7KA 2I6JA 5K5MA 2IMOA 3FFIB 2GQQA 1M5OC 3DXSX 3GONA 1HNIB 1FDDA 3E8OA 3EZ5A 1S1UB 1RXOB 1U2CA 2C2OB 2DT9A 1KAKA 2V2VA 3AAWB 5C2GA 4YN3B 5H9FJ 1VIOA 2H5JB 5KFZA 4DV2F 5A8KA 5KG2A 3G8SA 2Y8WA 3EGZA 3AOCA 1HKAA 2V2KA 2JVRA 4AT1B 1KQFB 1RB0A 1TKTB 1PSDA 2LQJA 2DR8A 3BLUA 3G86A 4PUOA 3QIPA 4OZ3A 5KT6A 4B9LA 3PJXA 1HPZB 1N52B 3LANA 1MLAA 4HT7A 2AJ0A 1V3SA 2CZ4A 4OI2A 5ETVA 4DS4A 1RT6A 1PAUB 4LF2A 4M1KA 2OFGX 5AT1B 3TAPA 2ATLA 4JI0J 3TUPA 3I6PA 3QCDA 2WB1D 2JLGA 4DI6A 1X4FA 3J80U 1UKUA 4ID8A 1JJ2R 5HJYA 4PQUA 2XJAA 5GTJA 3T6JA 1WELA 2R7RA 3OPKA 3CMAS 1R6YA 2GWOA 3V0GA 3D67A 3V6DB 3DLGB 3HSDA 3M1VA 1YVFA 1ULRA 2Y1JA 1HFEL 5K24A 3I5AA 3WZ0A 2A1BA 4PYDA 2CPYA 2KHCA 1BQNB 4ENOA 3OW2R 3E2EA 1DY3A 2CNOB 4ANEA 4PXDA 4F0KA 2HNZA 1FFGB 2DXEA 3ILIA 4NRUA 3DM2A 3MAQA 1LQ9A 3T6BA 3NOGA 5HROA 1K8AT 4TU7A 1LWCA 4CVKA 2YX4A 3EPIA 2J6SA 2RRBA 2N4CA 2XHCA 2ZH8A 1Z4UA 2CQ4A 3JB9k 4B3MF 2BE2A 2M2BA 4LUBA 2KJWA 2IBKA 4IRDA 4O3QA 4HT5A 4DPYA 4NXNF 4QW9A 2DGOA 2ZE2B 3CWJA 3OL8A 3G8QA 1RAGB 3CCSS 2H04A 2YKAA 5F8JA 5A8KB 1FRIA 2R0BA 3MUTP 1LXNA 4CT9A 3DXBA 1YX2A 4NYZA 1C85A 2QG9B 3EE3A 1WF0A 3C16B 2Q79A 1RKJA 3V0DA 2WRMA 1UWAA 3FRZA 3C6TA 4K4UA 2PD1A 2E5JA 3HHNB 2JOQA 3DRPB 4L6V3 1XQIA 3NCRA 5C7PA 4QBUA 1URNA 5IQQA 2XMKA 2MJNA 3POTB 1KOHA 5KFUA 4QZVB 4PXBA 2BZ2A 2AYGA 1LEOA 1OMSA 1XR5A 4PCQA 1MWQA 1NK5A 3BBFA 2FIUA 1UEUA 3D1OA 4NLXA 5GMEA 3TI0A 3F81A 2DR6A 1I9SA 3W64A 5KFVA 3M30B 4ECSA 2BQ3A 3UI3A 2ZDOA 2HFZA 4RNNA 4Q8FA 1YDLA 3F56A 1S1WB 3U1LA 3VAGA 4A8QA 1S9FA 4RJVA 3MCSA 4WXWA 4TY9A 4CQ1A 5A5FA 3F41A 3MAHA 1QE1A 1WC6A 4Q43A 4FXWA 4P72A 1NBEB 4E8UA 1Q7YT 2IM1A 2N4DA 3BV8A 2HVZA 5DDPC 1HW9A 2DPJA 1HIYA 2R8KA 5KG4A 3NRBA 3KJFB 1QM9A 1RT1A 2KTQA 2M3DA 3W60A 2R8HA 1Z2ZA 4ZJLA 3BM8A 3GE9A 2LQ8A 3B82A 2JFDA 3PX6A 4LF4F 3NBPB 2CM2A 1QD1A 2MQNA 5GAGU 2PFDA 4WFAQ 4Q2MA 2RT3A 4P2MA 3NAHA 2B0GA 3HKZD 5A0YA 5HQLA 4Q8EA 4K0KJ 1NL9A 4BS2A 4OHDA 2BXJA 2GVDB 4JI5J 3ENAA 4KHMA 4NMXA 4PPDA 3GJRB 3MHYA 4B9VA 4C8ZA 3PDNA 1EETA 1V9OA 1RLDA 2HGLA 2MKJA 4WJBA 4JI2F 4QWCA 5IC6B 2WZ1A 3IRWP 3CCVS 4KSEB 3SV4A 5CYMA 2GW8A 2CUYA 1UPMB 3MDFA 1S6QB 1ZM2A 2ASLA 1RPMA 2A8BA 4GFUA 4ECXA 3D0HE 3THPA 2E5LF 1NM2A 1HI0P 2QMXA 1IM6A 2Z57B 1RAIB 5GAEI 2VH7A 2CQCA 3R6GB 5KFWA 2VASA 1SJ4P 1M5KC 1EIYB 2XEXA 3U1MA 3QCZA 2ZH6A 4DL5A 2VPZB 3U7JA 1IBCB 4BUCA 1C0UA 3D28A 3TUIC 3MD3A 1YJWS 2VOOA 1OEMX 1Q82T 4C9DA 2L9WA 1OQ6A 2NXNA 3DU6A 4LSLA 3ULHA 3HX9A 2ZFHA 3FKBA 1JNRB 2YQ1A 1Q7LB 4IH5A 2HNPA 2WW4A 3V4IA 3IBFB 3ZO7A 1M5HA 1N34J 4ZP6A 1HBNA 3LJ8A 4IQXA 1Y4ZB 4EMDA 5KFJA 3GXGA 3DRRA 3ZNUA 5JXSA 2GGPB 4Z2XA 3V6DA 1D8ZA 4JB8B 1NK0A 5HL7Q 4OHLA 3MPUB 2NYIA 1QUVA 5J2MA 1YGRA 3N5FA 4DQQA 1LV5A 2ZJPQ 2O5DA 3D6FB 1PG5B 5D4LA 3ITHB 1KS2A 1RT5A 3G82A 5KG3A 3VVUA 4L3NA 2MTLA 4YHHF 4DFMA 1I51B 2VFVA 3M32A 3NLCA 1WKLA 2ZHBA 2ZWPA 2B49A 5BUGA 4NASA 3R3TA 3LK7A 1JLGA 5IT0A 2UU9J 1LWCB 2AM1A 2FY8A 2BE7D 4KAIA 3KHRA 4HV4A 3R5GA 2UVWA 2LCWA 3OT9A 2QO3A 4OZ0A 2YPZA 2JEIA 1D09B 2HHVA 3D6MB 2JFKA 2J5AA 4K4VA 3HHLB 1RHJB 4C48A 4AL6A 1FXRA 2AJ4A 3WBZA 1R89A 4JI8F 4DR1J 3CF5Q 1FEHA 2MZ1A 5AWXA 2P9EA 3A3NB 4DEZA 2ZC3A 4LF7F 1LWFB 3BGOP 1NPRA 1EB0A 2GQ2A 4ILMA 3SCKE 2H5EA 1P6TA 1FNMA 2OLWA 4WE1A 3RBEA 2FVQA 2GVDA 4FF4A 1G7GA 1GQYA 2KN4A 3G6VA 2JJDA 1VBKA 1O8BA 1VMBA 4ZIYA 2ILZA 1JJ4A 2W8KA 5KA7A 2CQBA 4MAKA 2KRBA 2O3DA 4X84A 2VICA 4OQJA 2ADBA 3C15A 2UUWA 2VU5A 3I96A 1SKSA 5E5NA 3KUGA 4N41A 5B7WA 1RK8A 1LW0B 4CM0A 1P9QC 2CDRB 3UO0A 2XM3A 3HT0A 2DIUA 3KDNA 1WKJA 1S99A 2MSSA 3HVWA 3T9NA 5IWAJ 4Y0FA 1D3WA 1S6UA 2LQBA 2PDAA 3E01B 5D6GA 5HMYA 4C3LA 1XIQA 1PO6A 5JUMA 3C3LA 4CH1A 1B70B 1SI9A 3TUZC 2Q66A 1FEEA 2DCUB 2HQDA 4LF9J 4HRFA 4H4KC 1S0OA 4DX5A 3RZAA 3A8IA 1S9EA 4OJ3A 4P74A 3J7Z5 2IVFB 5EWFA 3SXLA 4CVMA 2EKNA 2WSEC 2FZCB 5DQHA 4UZCA 3V0EA 3JSBA 4HJQA 5KG0A 2AGPA 3W5ZA 3QRQA 3O5XA 5L1IA 3JYTB 2BJ3A 1RAOA 2G2OA 2HBZB 2DY9A 4CI0B 4UUWA 4FPRA 3CB4A 3GP9A 3M2RB 4I2QB 1TKXA 4NZ0A 4ZVOB 3VQSA 1EKSA 2KM8B 1ZBTA 3ILLA 4ZPCA 2UUTA 2HMIB 2XS7A 3G2XA 1KFSA 3PS5A 2UUAF 1ZTWA 1JJHA 3ETMA 5ETMA 1QTNB 2DNNA 4KV8B 5KT7A 4ZPWR 4B9SA 2AHSA 4WIQA 4Z6BA 1OWXA 2OPPA 3K5LA 2WSCC 3QGIA 4DSJA 4TQSA 5HI7A 1T3NA 2ZJQQ 4ZPBA 4OHIA 2F1FA 3QKQA 2V68A 4YR2A 2JRSA 2WB4A 4OI1A 4DOZA 5DLGA 1F3VA 5K25A 5A8RA 4N7TA 3GQCA 3S3FA 3ADAC 2Y2FA 1ZS6A 1EETB 5KFCA 3TVYA 4OI4A 2F8EX 2BZLA 2I4EA 1DLOA 2DNRA 3I32A 1YTYA 4NYHA 3JS9A 5HVFA 3MM9A 3TWZA 3OVAA 1RHMB 2CPEA 3F73A 3AH6A 3ENWA 4PG4A 2DNQA 3S7RA 4OMFG 3SQOP 4CZCA 2GJIA 4FXDA 1V3RA 1OHCA 1L3UA 2ZZNA 4ED6A 1RCOB 1RU2A 3E51A 4F2SA 1U7LA 3NWRA 2MQQA 3C6UA 3NMEA 3M4XA 1NHKL 2WVEA 4DGPA 5LSOA 4JI4F 5F8IA 1JMTA 1URRA 3QT8A 1YIJS 1T48A 3OFEA 1T03B 2L48A 2RAQA 1TVRA 1UETA 2BACA 4WPAA 1IJEB 2CPFA 4YEAA 1U09A 5HO4A 2H4WB 4ED3A 3MOJB 2OTJS 5KA1A 5CYQA 2DR5A 4AYBD 3HMJG 2KM8C 2QA4G 2MQPA 2DPIA 5D0HA 3QIPB 5E3RA 2GAGC 3IWLA 1UJ5A 4X4QA 5A6PA 1T03A 3DLKA 2MQ8A 5SZTA 4DR5F 4ZPVR 3OLAA 1JLCB 4PYAA 1RUSA 3CCWA 2JC1A 1VR6A 2VG7A 4KBIA 4DS5A 1XNQJ 1B4SA 1GFWB 2EK1A 2Q43A 3D6HB 3ISNC 3MEGB 3OUYB 5K22A 1RT2A 2O1PA 2CNIA 4NLQA 2OPSA 4JV5J 3FVYA 5AJ3J 1G4WR 1LARA 1REGX 5JVHQ 4DV2J 3PX0A 1HBUB 2F65A 3BYPA 4DQRA 2Y0BB 3O3LA 3IWNC 3GPAA 5A6WA 5GADU 2KXNB 4JNBA 1JIHA 3OFGA 1IKWB 1S57A 1FA0A 2RHSB 4Y14A 5KFAA 3RBDA 1VQPS 4A8WA 3CW2C 4CCHA 2COLA 4NOHA 2HVEA 2XYGB 3BEGB 2W7PA 1LWEB 1X0PA 2HEKA 2H3EB 5EWEA 2BKNA 2ZBQA 3QCCA 2I38A 3HM9A 3NMRA 2V8HA 3EYZA 3OHAA 5CQGA 2OIHA 4F02A 4MIAA 2B6AA 1HQUB 4YMEA 1NDCA 2D3ZA 4YQWA 4QCLA 1C84A 2MHNA 1AFJA 4ZRTA 1HNXJ 4O44A 3TJ9A 4K4XA 2KVQE 4IOAQ 4QYZJ 4X4NA 3IG1A 1TV6A 1YJTA 1SL0A 1KDNA 1H6KX 1DTQA 4CWBA 4OI0A 1U8SA 2GHVC 3NGTA 1XRIA 1X9MA 1C1CA 1PC5A 3M6VA 3J81U 4B02A 8RUCA 4NWBA 4DSEA 5J2QA 3PACA 3C14A 2HBQB 1C86A 2BJEA 3LW5C 1UW4A 3NGRA 3NGUA 3EB1A 3L09A 2DHSA 3OLBA 4H4OA 2C7SA 1JLGB 1Q5YA 5T7LB 2ZM6J 1N33J 2E0TA 1PIEA 1VS3A 1T95A 1HWJA 3KYLA 4RUAA 4OYZA 2B3TB 4PRFA 3UDCA 2Z58B 1NZ7A 5KA3A 2ASJA 2RNEA 1WHWA 2KVIA 1S6OA 1VQKS 1W7WA 2YH0A 1KD1T 2F6TA 5KFIA 4IFYA 4CLWA 4X2BA 4KYZA 3UD4P 4GRZA 4IG0B 5MMZB 1T9WA 5KG7A 4OV6A 3K57A 2CKWA 2EK6A 4UF4A 5IV4A 1B7FA 2QL5B 1YJNS 2H4KA 3S6EA 2H48B 5BR8F 5D4OA 3W2WB 1DJ0A 1ZZWA 2B4OA 3MR2A 1WI6A 2VG5A 4CNYA 4XTTA 3DMJA 3HO1A 2E1MC 1VQMS 5IFMA 3QZ8A 4ECRA 1X4HA 1QVGR 3OTOJ 4C8LA 4KI9A 5GAHU 4A8OA 3QYYA 3KWMA 3DDNA 2ACMA 3GB0A 1UZHA 1U49A 4ZLNA 1YZ7A 3LGHA 2RSQA 3GV7B 5E3CA 1K9MT 1R27B 3NGKA 1K1QA 1IR2A 1RTHB 3IXQA 4DPTA 2H03A 3H4DA 3EMUA 1WWHA 4KY3A 4ECZA 1XERA 3R97A 1GK8A 2VFTA 4ZVPB 1FE0A 3KLHB 3WHIA 4OJGA 2UUBF 1HL6A 2FGCA 2AM2A 4X4OA 2GHWA 2DNZA 4DQPA 2A6MA 2AJQA 2QA2A 4I2PA 1RTZA 1JLAB 2YKMB 2XZDB 2MGZA 4CO1A 4Y2CA 3MCNA 2F46A 2BBEA 1UTAA 3CGIA 3EDQB 4QWEA 5ETLA 3KOAA 2AX1A 1F0XA 1YRXA 2UV8G 3W65A 2U1AA 5AXMA 1DFDA 1GXTA 3CJ2A 1HNXF 2OPQA 1CLFA 1XBOA 4HACB 1R31A 4DR7J 2KDOA 2HHHJ 2DRAA 1T49A 2XQCA 4IOCQ 1Q95G 1C1BB 2EFGA 3OXFA 3SEOA 4YR3A 4ELUA 3T1HJ 1X5SA 5KFSA 3TAMA 4ID5B 3M2VB 2BKPA 5C25B 1JKHA 2X1BA 2W2QP 2Z2MA 4M5MA 4NX9A 3KK1A 3QATA 1QTMA 4LR8A 4DR3J 2DGUA 4PZVA 2LDYA 1GEHA 1C1CB 1X5OA 1GX5A 4ER8A 3T3FA 4QIWD 4C0HA 2HVHA 2KB2A 3PXGa 4DSKA 5IM0B 4GVBB 2GGPA 3A3OB 5EUHA 4A48A 4C3MA 1TVRB 3PIOQ 2CIMA 2VB6A 1JX4A 4V19J 2VKZG 4PYHA 4NYOA 1ZETA 1T4JA 3UVJA 1U02A 5K8NA 2Q6BA 1NSAA 4OI6A 3PTWA 3VCDA 4CLFA 2AD9A 1S77D 3OHBA 2YKNB 2UXCF 3ZM5A 2W24A 3MZIA 1N88A 1ZAWA 2CZVC 2AZ3A 2ZKUA 1KLMA 1SJQA 3FDSA 3MTJA 1H73A 1T94A 2QLWA 1LWEA 1ZM9A 2HURA 2IFXA 1I1GA 3POTA 4OX8A 3CJKA 3BQ0A 4H4MB 2NXUA 1HNIA 1PGZA 2HS0A 4LVOP 3GIIA 1G7FA 1NO6A 3O4SA 4RNOA 3K8WA 1SQEA 2LKZA 5FIIA 2KH9A 4J9MA 1N34F 1KSPA 2F8MA 4E0DA 2DNLA 2I5JB 3OTOF 1QXKA 3UNGC 1EJ7L 2V50A 4NA1A 3J7A1 3GXHA 4MYUA 2CM7A 4X65F 4CRJA 2PEBA 3TZYA 3ISZA 3OTEA 2E66A 4RW4A 3RB3A 1LQFA 1HBOA 2JL9A 3BGRA 4ZVFA 2KFNA 4YFUA 2K3IA 3KG1A 3HD2A 4N56A 2VA2A 2VOPA 4DPOA 1KHWA 1SC6A 1R6VA 2BRKA 3HPOA 4DL3A 5EDWA 2ZUAA 4ZKAA 1P3DA 2IYGA 4I8NA 2OEMA 1SIWB 1R0BG 1WEXA 2DTJA 3DRSB 2YNGB 5T41A 1TFYA 1NJWA 1EEHA 2CMAA 2F6FA 2FHMA 4GMKA 4CLLA 2M52A 2EFVA 4URGA 1TMMA 2FHJA 4LF5F 3GIMA 4JMKA 2LDIA 1V5IB 3CMES 1P15A 2QBSA 1TKXB 1V3ZA 1V5VA 2L08A 3BKFA 4CO3A 2FHJD 1TKDA 1MROB 1PAEX 1SIZA 1JQGA 2GQCA 3O44A 4ZPTR 3R8YA 2HHTA 1JLEA 4O0NA 4USIA 4A8MP 2LEBA 2XI2A 5HANA 1AZSB 3IGVA 4RWWA 3TA2A 3T1HF 3IBWA 2UXDF 4WZQA 2XBPA 2NV5A 4USUA 5KT4A 4ES3A 2ABYA 3H98A 1RABB 3DU5A 3LPYA 4YDXA 1XC9A 2ZHOA 4TNOA 5HMWA 4YB1P 1VHFA 1IKYA 2E7VA 2GZOA 3N6MA 4H54A 4A8YA 5K9WA 2L3MA 2ZWOA 1TFWA 2YNFB 4I2PB 1S1XB 4LRAA 1NJYA 4FF3A 4MFBA 1NXIA 5LJ3Y 2I4GA 1VDHA 4NLPA 2D9OA 2RRNA 3W2VA 2YQ0A 4RPFA 3DLJA 3Q8PB 2W2PP 2X1FA 1WOPA 3KHLA 3V6HA 2V2ZA 3CJ8A 2H51B 2J0WA 1Q8LA 3MMAA 4EFAC 3GWCA 4LIWA 4J5OA 2B9XA 2EKYA 3HXMA 2K7KA 2C22A 2L9DA 3EZOA 4XK8C 3QJPA 3JTNA 3UD5A 1HHSA 3BO4A 5IWAF 3G4SS 3IGNA 1AROP 2R7UA 1I9TA 3DMJB 3U96A 5EX3A 2P9GA 2HVLA 5K14B 2KKHA 2P9CA 1Q81T 2A3JA 4L72B 4ECWA 2QSWA 3UNYA 4A8FA 4NCBA 4L74A 3DOMA 4J9KA 2Y0SD 2AW0A 1Y7PA 4PWUA 3KTQA 3SFGA 1BWVA 3KLIA 3DN9A 3GLJA 3NY0A 3NXZA 4TVAB 3MAAA 5E3AA 3QCMA 2CG8A 3QCGA 1SH3A 1R43A 4LF8F 5HP1B 3H5XA 1EEOA 3HULA 4DBQA 3RAQA 3I0SA 3GJSB 3W66A 2D3OR 1ZH5A 2NTAA 2ZH9A 3EXYA 3R1LA 1RHKB 2PC6A 4ZITA 5L38A 2IRXA 3MM8B 2X3GA 2XGQA 5E3PA 1CJKB 4LF6F 4C2MA 1FNXH 1PTYA 2MQLA 2XMTA 4C98A 1JK9B 3K17A 2RE1A 5LM7E 1ZZNA 2UUAJ 2D74B 2P6TA 3QWPA 4K7QA 4USMA 4EZ9A 2CPXA 2M5YA 4RBVA 1S4FA 1E0DA 2H02A 1XXPA 3JTPA 5DJBA 2BOAA 2KFZA 4FS1A 1OHEA 2FJXA 2CQHA 2XMAA 2ZEJA 5F8GA 4WCEQ 4CTAA 1FDBA 1QE1B 3I0RA 2Y66A 1EP4A 2YKPA 4B3TF 4OYOA 2GVZB 4ICLA 4QR2A 2CM8A 4ZK7M 4R5PA 2G6ZA 3CO0P 5EX0A 1IBMJ 2KFYA 1JBWA 4MKAA 2RU3A 2ZN7A 2R2TA 2CZ9A 2R7OA 1JBVA 3W5XA 4HL9A 1G6BA 1FK9B 1QAYA 3BDEA 4GRSA 2MLXA 4N5SA 4K4TA 3P3DA 4EGLA 2D9PA 2DITA 1VC0A 3SSRA 1IBKF 4C8NA 2KL8A 3HCXA 2I5JA 1HQ2A 4HI1A 4J90A 1ZC0A 4Y2IA 2G9OA 2EC2A 3IN5A 2QIFA 2RVJA 2AKWB 4M63A 1WKKA 1BQXA 3SCLE 1PTTA 2OC3A 3IAM9 1G4CA 1SC1B 2LQ9A 3BGFA 3ILJA 4MMOA 3BR9A 2OPPB 3B78A 3VZHA 4ANCA 1RT2B 4DFJA 1K73T 4JI4J 5EHHA 4OLOA 5I3UA 2J0SD 2CPDA 2BJ1A 8AT1B 3OMHA 4USWA 4D3GA 4DZDA 5CCMA 5J2PB 2J17A 4M94A 2H1YA 2YKOA 3EGWB 4P7VA 3DOLB 5I4MA 1T3OA 1HR0J 4DV6F 2SXLA 1TUWA 2CNFA 2CVEA 1AXQA 2MKCA 4TLQA 2CQDA 3OR2B 2WONB 4P2SA 1C0TB 3EXCX 3VGTA 1KEKA 2M0GB 3D3BJ 5H9EJ 2MZTA 3CJ0A 3L7PA 3PRVA 4IG0A 4OHVA 3BLTA 3U27A 4L75A 1RWUA 2ZNYA 4ZJQA 4LREA 1RDRA 4KFBB 4U8YA 2P2CB 3ZXWA 4AUKA 1Q6SA 5F8LA 3LWLA 1Q4RA 3C66A 3OR2A 2W9CA 5DQGA 4M5NA 2AIRB 1MN7A 3QQCD 2RMLA 4P6QA 2HFUA 4FDFA 4K50A 1JLEB 2VONA 3I5CA 3MOWA 3T5JA 3KLFA 1N36F 2R7VA 2V8DA 3BDPA 2YDUA 3P8BB 1DURA 4C7QA 4EBCA 5J2NB 1JLNA 2HHPA 1DQ9A 1T7PA 5L9NA 1OSCA 2C2KB 4RNFA 4NLYA 2VTDA 2BQRA 3Q8YA 1H7WA 1OHDA 3FEXB 2QC3A 2X1GA 3HK2A 1F9FA 2YPYA 2P6XA 3HZEA 3J7YI 3HVRA 2ASDA 3G6ES 1P1TA 1NJXA 4WFNQ 1BGXT 1WHXA 2ZH3A 5BYSA 2ALZA 1VBYA 4CH0S 1QAIA 3PV8A 1SKRA 2HNDB 1VQOS 1NSPA 3FCHA 3PYGA 2V67A 1BD6A 1CJTB 2K06A 3MMCB 1B64A 3SMEA 4BUBA 2G13A 3HVTA 4USKA 1Q6JA 1KVJA 4CO4A 1HBOB 3BGRB 1IBMF 5GMKa 4CM2A 4FYYB 4Z7YA 3M9OB 1UVNA 3NNCA 3AWEA 1UVJA 3MPWA 1GQEA 1OEUA 2YNFA 1MMNA 3FGVA 3FQKA 3PRDA 4OZ1A 1KTVA 2BE9B 2VKRA 1YJ7A 4F04B 5DG9A 1JXVA 1TTHB 2AEMA 3VAIA 2W9BB 1CG2A 1IBKJ 1J4XA 3JQKA 3KUEA 1IR0A 1ICEB 2OGUA 1WORA 2D7SA 2RS2A 2CMBA 2ZM6F 2EC0A 3EPGA 1XMOJ 2G0JA 6AT1B 1YPTA 2UVRA 1TKZB 1LFPA 1E6VA 4EWTA 2Y9HA 3THTA 2GMHA 2VPWB 3NKYA 3X3UA 3BSCA 4CLUA 1D1UA 4R0JA 2OEKA 4ED7A 4IFVB 1VQ7S 3ZZTA 4ZLPA 4DN9A 3CDAA 9RUBA 1NDKA 2AQ4A 4GKKJ 1S5ZA 2MMYA 3ET6A 1HLWA 4ED4A 2I1RA 5IV3A 1WOOA 5DG8A 3L3CA 4DV6J 1NK7A 2B5JA 2HZVA 3PY8A 3VGUA 4F4KA 1DBDA 3BS9A 2FJAB 3G8TA 5K8MA 2HNQA 1OY8A 4HYKA 4NI2B 1FX4A 2QTWA 3KUHA 2GHPA 3H8YA 2NZCA 3D9BA 3DM2B 3F0NA 3AD9C 4M5KA 2BGEA 2QEPA 4NLDA 5LMUJ 2DGSA 3CCTA 2OOQA 2VBXA 1SV5A 2A2CA 2OUGA 2NPIA 4LSLB 1JLFA 1TL5A 2XSJA 3Q2SC 1QAJA 4C13A 5SUHA 4ECYA 3ICLA 3R5AA 2JHEA 1AUDA 1PYNA 1DHMA 1RWPB 4ZVTB 4BHQA 3VAFA 4BLGA 2CDQA 4F0HA 3KK2A 1HNWJ 2AF6A 1WSRA 2GMLA 2OPRA 2D1CA 3BZQA 2I2YA 3CCES 1VC6A 2MB0B 1YITS 2Y1RI 2KXFA 4AQYF 2QDCA 3JSMA 4PABA 1N54B 1WHVA 4HDHA 3LQVA 1PYSB 4K2XA 3SBMA 1SB6A 5LJ5Y 1J6UA 2MPUA 2QMUB 1W26A 3HJVA 1NRKA 1YJVA 2XTJP 3VZIA 3W63A 5IM0A 5IS2A 1NK4A 1MSWD 2C3OA 2ZBRA 2F6VA 5K9VA 4RBTA 4NWFA 2RDDA 4QWAA 4LR7A 4XPEA 2HBYB 2W2MP 2BW2A 3QLHA 3GCXP 2W2OP 3KLEA 2MYFA 3BO2A 3LALA 1N4LA 5BJRA 1BWEA 3KLFB 2V8PA 3A3PB 3HSZA 3MM5B 4RX6A 1CJUA 4DQSA 1HD1A 4JMJA 3SSSA 3ENQA 1I94F 2R7XA 1MROA 1S7IA 2RUGA 4J91A 5A8WB 3OJUA 3MPVA 1NWEA 2MY7A 2YX1A 1KOOA 2DB1A 1Y3KA 3DLGA 3N6NA 1YJUA 4J9NA 3A8EA 2UUCF 1LKZA 2H54B 4IG3B 4DX6A 3M4UA 3DGVA 4QQBA 3TAQA 4DV3F 1U26A 2M70A 4F2RA 4DHVA 3VWSA 1EZZB 3ZC4A 3KHHA 1WF1A 1HHTP 2XLIA 2DK2A 2J9DA 5CYQB 3MWBA 4DUTA 1NEEA 1REVB 3PX4A 1HBMA 4HTJA 4YR0A 4KO0B 4B3SJ 2WONA 4K5SA 3J7AN 5AE3A 2B4VA 4M5LA 1P27B 1KVIA 3J80Y 4QYRA 3CJRA 2OPRB 4KRWA 3RW7A 3V4IB 2MKYA 1VJQA 1B0PA 2CADA 3FRYA 1XM2A 4FKXA 4CT8A 4WYLA 4Y28C 2F9JA 4ZLJA 3Q22A 5KT3A 2HVIA 1DAXA 4FPIA 2FLOA 4RLEA 5LMUF 4ZCIA 3IFEA 1N5YB 1S1VA 2V0NA 3LP2A 1VRTA 2HGMA 4OYPA 3RBZA 4F4XA 4GE2A 3AD8C 2QA4S 1H74A 4QU7A 5DLFA 2Q05A 3AA9A 4TVVA 1VC5A 2DKOB 4WF9Q 4KR0B 3W61A 2M8DB 2Z8QA 1BMQB 1JLCA 4MH8A 3ZTSA 2DR9A 2JEJA 3UVJB 3I82A 4A4JA 2J9DE 2YH1A 1HQEB 2XLJA 2HFVA 3D42A 1W78A 2V2QA 4I67A 4KHRA 3CM3A 3AB2B 1HMVB 4LFAJ 4RI5A 1L3SA 4ECQA 1K0VA 5L9XA 4LF5J 2I6MA 3V81A 3CDUA 3D3CJ 2H9ZA 3IBCB 4G65A 1IKWA 3KHGA 1XR7A 2AP6A 5AXLA 3PHTA 2J0QD 3C8YA 1N5TA 2HWIA 2XI3A 3QMQA 2B8QA 3AJDA 2Q6CA 5J1NA 5KFLA 4A8XA 2VA3A 3Q8UA 4HJPA 3R5JB 3PNIA 5D78A 2GIFA 3M6XA 2UXDJ 3EX7B 2K7JA 5BXIA 2HFOA 2OTLS 2D41A 4QR0A 1UZDA 2BVZA 2P6SA 3ITHA 4OFZA 3TRGA 3KLEB 4U96A 1PA9A 6FDRA 1RKIA 4DJBA 3MR3A 2E5IA 3UCZP 3IR7B 3CMQA 3O8WA 2UUCJ 3CD0A 3MEDA 1BZCA 1AB8A 1YSJA 3GV5B 1HPZA 3FBBA 5F8HA 2VF3A 3FSYA 4B3RF 5L46A 4F4WA 1FJEB 1GXUA 3U02A 3UCUP 4JV5F 3I87A 4DF8A 3TR5A 1RE1B 4K0KF 1ITPA 4WOHA 5CZXA 5HDEA 3VTIA 3V6JA 2I3RA 1N6QB 2BJDA 2LEAA 2XWXA 1PKUA 3H0PA 1FX2A 2QLJB 4LF1A 1GMUA 2RUSA 3D4JA 3HZGA 4PQAA 1U48A 3PO5A 4JI2J 2CAJA 3BQ2A 2A0FB 2ZH5A 1CSJA 2F4VF 5D3GA 4K4YA 2RQMA 3SQGA 3M9NB 2F6WA 1IN0A 1JLFB 2XSJB 1N6QA 1UCNA 3W3SA 1UVLA 2J16B 3FCVA 3CULA 5IT9Y 2GJTA 3B4MA 2J7KA 3RB6A 2NLKA 2IA0A 4ILLA 3IR6B 2QJ3A 4RKKA 1FRKA 4K59A 1EP4B 3TNVA 3QO9B 1NAQA 1RZMA 1T9XA 4ZVHA 3T19A 1X60A 1L5UA 4KFBA 1NUEA 5KFEA 4DR6J 3W8PA 2HFNA 5K8PA 1FI4A 3O4TA 3Q89A 1Q1KA 5KFRA 4OLPA 2AZRA 2WVFA 1IJFB 3B54A 3Q8QB 2R3VA 4DL6A 3ZM1A 3CDEA 3M8WA 2B9YA 1J2VA 7AT1B 3PW5A 2WBRA 4WTYA 2KHDA 4DV0F 2GC8A 3F9AA 2NT7A 2Y96A 2EFQA 4IG3A 2R4FA 4NYPA 2MQMA 4K5RA 5IOLA 4USJC 5K8OA 1NK9A 1BE4A 4N47A 4G6VB 4I64A 5D77A 1LFWA 2YWWA 2YNIA 4KGZB 2HNYA 3H2VE 1RT5B 4P52A 4QPTA 3S1TA 4U95A 1NKCA 1KONA 1NHVA 3GJTB 3R5CA 3RW6A 2AV5A 1CJUB 1KBRA 1WHYA 5CYJA 5JMNA 4RU2A 4B3TJ 2MZQA 2HQGA 3NCPA 5EHRA 2VV5A 4RUBA 1YBUA 3KG4A 2CVIA 3CJQA 2DYAA 2DJWA 2QSFA 2FLNA 2B9EA 4WE1B 5EWGA 3CCZA 4DUYJ 1NHUA 2CWXA 2YBVA 2YKQA 1A0OB 2OJ3A 3SFUA 1XNRJ 1HQEA 3AFGA 4CLTA 1EAYC 4OL8A 3ZV2A 1TKTA 1G1GA 1MKPA 1HHQA 1YK9A 3H5YA 4IRKA 4MKVA 3IWXA 2RQCA 1EQMA 2CQIA 1QZ0A 3O1LA 2ZH7A 2PO4A 3SDEA 4EU0A 5HN0A 1VQ5S 1XWLA 2XMWA 4YAAA 2E1PA 2IJFA 3LAMA 2UUPA 4P9SA 4KC5A 4C12A 3GG1A 5FDLA 4W98A 3CCRS 1LXJA 1KTQA 1WC5A 2AEFA 2FQQB 5HBMA 3J81Y 1T9TA 3EDRB 3D2WA 3FQLA 3PM9A 1U1RA 1RBAA 4K4ZA 1ROFA 1UVKA 2M4MA 3HFZB 3R6LB 4NMLA 2BV3A 4R0SA 2VQEJ 2CMCA 1M5SA 2IHR1 3JAMY 1R8BA 2VG7B 2DGWA 1WTFA 4IR1A 4B9MA 2I75A 2R8JA 4R30A 1HA1A 1S1XA 1GMWD 3ZTPA 1HNVA 2XG8A 4PPZA 4I7FB 4WFZA 4FS2A 2F71A 4I6WA 3DKDA 3VV2B 4PWWA 3NMAA 5HJXA 1RACB 4ZA1A 4J9LA 4OYIA 2E7XA 2CM3A 2YWKA 3H5UA 1HBNB 4IH7A 3QRRA 1Y9OA 4QWBA 1NZ8A 1GFYA 5LT5A 4ZS6A 4ECVA 2CQ3A 3E3XA 3RGIA 3EZUA 2ADCA 1PTUA 3KK3A 3MECA 5E33A 1H72C 2OP5A 3SIPB 4PXEA 1R0CB 1U45A 4IUFA 1ONYA 3RJMB 3MM6A 3PW7A 4ECTA 4LF9F 1U1OA 2FYXA 4FNHA 3R7SB 4LRFA 1WUUA 4RKUC 1CS4A 1FRJA 2VJUA 2I42A 3IG1B 4PAAA 1YGUA 1NCLA 3CSKA 2R7TA 3US5A 2YNGA 1RQ0A 4B9UA 3VR1A 3NP5A 1DLOB 4N8NA 4WZMA 2HQCA 1U24A 4F26A 2CQPA 4QAPA 1CJVA 4ZIWA 4ZN5A 2CXEA 4MK8A 1HW8A 4WBFA 1HWLA 1RTHA 3TVKA 5HMXA 4DUYF 3MXHP 2HBRB 3MMCA 3BO3A 2VBYA 3GIKA 2XNRA 2I6PA 5L1KA 1SJ1A 2U2FA 2FJVA 3CCJS 1SXLA 1U6BA 2UAGA 2LEPA 2QL7B 3DNCA 4KGVB 3MMJA 1WG1A 4OHXA 3VQTA 3PO4A 4LFCJ 4UY85 4WKYA 4J9SA 3EGNA 3HVAA 3QT7A 4RR5A 2ROGA 3QGHA 3QSIA 3P4UB 4JI6F 2KYZA 3MCMA 3OSPA 5MAOA 2P4DA 4DV7J 2D3O1 5J1EB 4FKYA 1QDUB 2QZ8A 3UW1A 1FTRA 3BN4A 2W7AA 4HTIA 2CFVA 1TAUA 3G6XA 2BJ7A 3D7SB 2PIIA 3CJSA 3P96A 1MN9A 4QYZK 4ICZA 1N0VC 1GX6A 1J5EF 3AD7C 4QU6A 3OXGA 1W2IA 5GAHI 2F70A 1FKOB 2JFHA 4YY3F 3OV7A 1RTIB 2CPZA 3K89A 4Y3CA 3LP0B 1IWGA 3FBEA 3M2UB 2BE2B 2IJNA 1GMVA 5ETSA 1Y10A 2POKA 3ZM2A 4ZCMA 1UAWA 1U2RA 1JKHB 4DQIA 4NLOA 5HLFA 3UQSA 3QCIA 3QWUA 2HGNA 3WX4A 1I3OB 3M30A 2AGQA 1PXHA 3FJ2A 2Y68A 3T1AA 5I6VA 3E01A 3EU0A 2I8EA 1OEVA 4NXNJ 4O4GA 2GIRA 1X4BA 1XK8A 3I4HX 5IBMA 4M5IA 1HR0F 1CC7A 4WFXA 2BOPA 2VOSA 1RA6A 2IC3B 2CQGA 3QLHB 4F4AA 1YJRA 3SV3A 2Y1OA 4M8LA 1TQLA 4YB6A 4LFCF 2BABA 2ZH1A 4X62F 1DRZA 2DGXA 3H20A 3H59A 1IBLJ 4LFBF 1TP7A 1AYEA 3CC7S 1FESA 3KDOA 2HHQA 2Z2LA 4YOEA 2BR0A 5AE1A 2CNNB 5RUBA 1C0TA 2QCTA 2WOMB 2YXLA 3EJMA 3BPSP 1CULA 1KRPA 3QCHA 2JWNA 3B8HA 2GO9A 2BIJA 3R9LA 2HLUA 4TYBA 1SVDA 1ZA1B 5EHPA 1FKPA 3ZZPA 3RAMA 2KU7A 4PUOB 3M8ZA 2ZITA 4P2XA 3JSMB 5AJ3F 2PSZA 2J7WA 1TL7A 4WP9A 5C24B 4J9OA 1BZHA 4OYAA 4O3PA 5HBMB 2W4CA 1IKVB 3A13A 1UJ4A 1YLXA 4HEA9 3BGUA 4EI2A 1WEYA 1Q86T 4B9NA 1S0VA 2GP0A 3MGJA 2VDHA 1FRHA 3W8GA 5J2NA 3EAXA 3M8QB 1I94J 4CLZA 1HYSB 2A2DA 1HWIA 1E8CA 1SUQB 2IM0A 3JQJA 2VEVA 2NR0A 4ILRA 2E9RX 5I3PA 3CNQP 2UXBF 2OUDA 1M5VC 2N82B 2KI2A 1VQ9S 2GJFA 1OIAA 2FHKA 2NLWA 3WQPA 4G1IA 2B07A 5C42B 2AEJA 2RIJA 3OTCA 3QGPA 3AOBA 3AT1B 3ZTQA 1ZM4A 4CYUB 1N5QA 2J0XA 2PA5A 3CDWA 3MPDA 4MK9A 1WDDA 2MZJA 2HHSA 3DHXA 4JBCA 4I0WA 3TANA 4BCAA 5H9EK 2QBQA 2HSEB 1J5EJ 2BM1A 4TLRA 5ETNA 3BREA 3CCQS 4CYUA 4RW6A 1FFSB 3ZTRA 2E44A 2ZVSA 4BC9A 3TYTA 1F2HA 4K4SA 3LWMA 3OR1B 4XDDA 1HNVB 2N3OA 3BF4A 2QGFB 5A8WA 2KRRA 5D0GA 3CE8A 1VBZA 2N7CA 2HNZB 2AHOB 3DDKA 4KT0C 1Y5IB 1GTHA 2BJ8A 1T8EA 1G4US 3IMQJ 1S6PB 3ZM3A 3AA8A 2ZC4A 4TYAA 4Q0BA 2APOA 2LU1A 1TV6B 5GMDA 5D3GB 4A8SA 3DGPA 1UMJA 2CJ9A 3S4OA 4BPCA 1NNDA 4I68A 2PMWA 1N5YA 4ZI4A 1FKAF 3SZ2A 3CD6S 3KLIB 1BC6A 2MJUA 1SKWA 3PCOB 3MUVP 4DL4A 1CPZA 3F99A 4BWJA 2NS1B 3K58A 2HNDA 5H1SV 2H4YB 1RA7A 1Y5NB 2LYVA 2RU9A 2NSBA 1VCTA 3IM8A 1H2UX 3UD3P 5F3TA 3RRKA 1H2VZ 1NNYA 4X64F 2CJZA 2C1EB 3KLHA 2AZ1A 2FGOA 2ZH4A 2VG6A 4DLEA 4F8RA 1RTJA 3MMBA 4C11B 3RR8A 1B3TA 2B3OA 4DG1B 4F36A 2ZZMA 1EHWA 1OY6A 5KABA 1RWOB 2EBEA 1SUGA 4JI1J 3OL9A 1DTTA 1XR6A 1RAEB 4LT6A 2M8HA 2UUBJ 3DRYA 2A10A 4CLKA 4CO2A 3LF0A 3LUYA 4C6AA 4YHHJ 2OPSB 4F0MA 1X9WA 3DC2A 3I9ZA 3I0SB 4B08A 1JJCB 2IA6A 3ZMPA 3V5RA 5IXUA 2FZGB 4HH1A 4TQRA 4TY8B 4DF4A 1M90T 2J9CA 4HACA 1FXDA 1VQ4S 2UXBJ 1DTTB 1UWBA 5KA0A 2AYEA 5LXYA 1RGVA 4OZ5A 5KTQA 5DETA 1T05B 2KO1A 3BBCA 2LXFA 3GSDA 3L7UA 1RTDB 4DPWA 3T5KA 3SYZA 4HHUA 3J81j 2FVPA 2D3UA 4BDPA 4JV2A 5DO2A 1Y00A 2BKOA 4KO0A 1CBKA 4PG8A 4DR7F 4FZVA 2LVWA 4DR1F 4LRBA 5CZVA 3UR3C 4C4WA 1G7CB 2XMMA 1Q0NA 1YWXA 2KXHA 2V8GA 4P7TA 5K14A 3W62A 5LSLA 2I6OA 1HD0A 1DQ8A 2WVBA 4FBUA 2DH8A 3R5DA 4JI1F 3DOMB 4F7VA 5E0OA 2R7SA 1IKXB 5G0RA 4ZCLA 2QLFB 2RHQB 3IRXB 4CO5A 1RYRA 3H2LA 4DR4F 4S0GA 2B51A 2R9LA 1X4AA 2BRLA 3C14B 4LSNA 4B3MJ 3UDVA 4GC6A 1C0UB 3QSYB 1FJ7A 1H38A 3OL7A 4OHEA 2X3DA 3UN5A 5DM6Q 1TL7B 5C24A 2CJAA 2JEGA 2DBBA 4OZLA 3SMZA 3QCLA 4KH1B 4O3NA 4LBPA 3N9UC 4DU8A 5DDOC 1IQTA 2WTZA 3TJ8A 3PZPA 2ZE2A 1LWFA 3A8JA 3BKUA 3GTYX 1S1TA 3Q86A 5KFDA 1JLQB 2I4HA 1Q6PA 1GTEA 2CYYA 2LLZA 4F3MA 2E5HA 2F7VA 2RKIA 2V34A 4TU9A 4DV0J 2CJXB 1ZTTA 1GQQA 4OHHA 4QUNA 3BRHA 3Q8SB 4C8YA 2ZD1B 1F5CA 3HSGA 4KGMA 2C2RA 5F9NA 4PWDA 2HXPA 2X7IA 1G1XA 3EZZA 2BEFA 3PR4A 4NEYA 1IXKA 2JX2A 4M5JA 4B9TA 3Q2TC 3ZFVA 4PKDB 4OZNA 3T41A 3M8PB 3CDBA 5CABA 3FMWA 2HMIA 5DDQC 3C46A 2RD5C 4OHWA 4X66J 4G1PA 1SQFA 5KFBA 1UAGA 3GFXA 4MTPA 5HP1A 1FJCA 3TUJC 4PG5A 2NQPA 2HPUA 2DHGA 4OZ2A 3ZZRA 2HG4A 4YB7A 1YKWA 2KG0A 2CPHA 2DEIA 2MZSA 2W8LA 1XNRF 4PQUB 3S3KA 3CVKA 1T9YA 1NKEA 1R8CA 5B0BA 1J27A 3I56S 1EQ0A 1NH7A 4WKRA 4ZHRA 1U0HB 1L8GA 5KT2A 4ID5A 2YKMA 5GAGI 5CH7B 3EVOA 3H2UB 3UE2A 2LP4A 2LXIA 3FMBA 2B7CB 3PRBA 4ES2A 1Y0HA 2DR7A 2DXDA 2LFVA 1KWMA 4CLPA 5HQ8A 5F8NA 2IRUA 1YZ4A 3RAXA 4UT4A 3QCEA 5K9FA 4KPCA 1S7HA 5ETKA 1PA1A 2AJ2A 4JI5F 1E6VB 2V9KA 4ZP9A 5IT9U 3CD7A 2V94A 3OQ2A 4OYWA 2XSFA 2ZOMA 3AQPA 1S1VB 1X5TA 3LP2B 4HVZA 5D0RA 3TX0A 2B8PA 3LGMA 4MIBA 3NGDA 4PEOA 3MMAB 3HJFA 1PBAA 2FH7A 4M5GA 1M1KT 3HHLC 1JXEA 4QW8A 1IM4A 3MCOA 2E5LJ 3O4UA 1F3FA 5L8RC 2DH9A 5U47A 1XBWA 5CAAA 3G71S 4AZ1A 5A2QY 4IKCA 1S6QA 1SJRA 5HQMA 1Z2LA 2XCAA 2WTFA 4ED1A 5A8RB 1RT7B 4FF1A 2J9EA 1AZSA 1PJ7A 5I3QA 1SBRA 2I9SA 1NPKA 5HLFB 1SJ3P 4KYQA 4U67Q 1Q1MA 1RT4B 3DYAA 4Y2KA 1LW2B 3TQ1A 2Y1LB 3C2PA 2IAJA 5IQ6A 2FB0A 2MY8A 1T9VA 5ETRA 3DOLA 1MW7A 1D9DA 1FE4A 1RT1B 3P5TL 4QJVA 4DR5J 1D8YA 1JLBA 3GIRA 1BXNA 2E1RA 1V3AA 5T7LA 2AJFE 2OKQA 4RU9A 1RWVB 1Q78A 3QAEA 1YTSA 4BBYA 2PI7A 4UAGA 3HHKA 3MECB 1RLCL 2YNHA 3DRSA 5J1EA 2IM2A 2NCKL 4RBUA 3PR5B 1CVJA 2BX6A 5F0UA 4X66F 4AE5A 2HB1A 1RHUB 4ZOSA 3QAUA 1SUQA 4AXIA 3P45B 4G3IA 4JI7J 2DGVA 2Q47A 3QO9A 3PEJA 2RRAA 3S4EA 1RT6B 1NKBA 2DCLA 4ZN3A 2E9TA 4O3SA 5J2MB 2WBMA 2XNQA 4DSLA 2UU9F 3QNWB 2ATCB 4BWMA 2B6AB 2VBWA 5F3ZA 2OZ5A 3QCFA 1S1TB 2WAQD 4FF2A 3KK2B 2VORA 1YQHA 1CJVB 3MR5A 1RP5A 2R42A 3MVNA 1X7VA 3ZM0A 4ALZA 1GMWA 3KJQB 3BH7B 3SCIE 2ZBIA 4HI2A 4QWDA 1C2PA 4PG7A 3FSIA 2XS2A 2HY3A 3D5MA 2CJYB 4DV7F 5J2PA 2ZKTA 4NLWA 3KJVA 1J5OA 4JI8J 2XHWA 1Q79A 3VGVA 3I7ZA 2FJBB 1SPBP 1R0AA 3PKYA 3QJJA 4QIEA 5HMZA 3MFIA 3HHDA 3B7OA 3N0AA 2C2ZB 5HATA 1A9NB 5AXNA 2XZTB 4LF7J 2DY1A 2VDIA 3UN3A 4LMZA 4ZVQB 2OH2A 2ROEA 3OVSA 5DRKA 1TZ0A 1Y11A 4YY3J 2VHGA 2ZBCA 1EX8A 5T14A 3RB0A 1ONZA 1IUJA 4QR1A 5LXRA 3RZ2A 1C4CA 2PEHA 3D66A 5KFYA 1RJJA 1MWZA 1NK8A 2J6TA 1S76D 4XAKA 5KG5A 2WOMA 4WFYA 4Q45A 4DZ6A 2YVSA 3W1YC 4OI3A 3RTVA 2JFGA 4ZHRB 5DS7A 5HSPA 1A7GE 5L1JA 2XB2D 4D3RA 2K1RA 1W25A 1FO1A 2GVZA 2QYCA 3BM7A 4ICLB 4OX6A 3T1YJ 5H9FK 3RO1A 2E29A 4CH7A 4WP8A 2OMLA 2ZOFA 2W1BA 2GX8A 5C5JA 4XIUA 4P71A 3V0IA 1VI7A 4ZLLA 1FWLA 1Y5LB 1X8DA 3LOUA 3TAMB 4O4GB 3D54A 2OFHX 1CC8A 5BR8J 2C2EA 1LW0A 5IBSA 2QCJA 3F9BA 4DR2F 1OETA 5KAAA 4MIWA 4NLRA 3QRPA 1N5SA 3GYGA 1UEKA 1RT4A 2GNKA 1AUSL 3DYAB 3AY0A 3IA0A 3M8PA 4ZP8A 5LOQA 4UUXA 5M2UA 3DLBA 3LP1B 1PJ5A 2AWZA 4RO0A 4RW9B 3BN7A 3DI6B 2IDEA 2Z2ZA 1KHVA 4AL5A 4GE5A 1OQ3A 2LA6A 2PA3A 2VJVA 1ZPVA 4NCGB 5KG6A 4NCAA 5KFQA 1PBUA 2CNEA 1L3KA 3IS9A 4WP3A 2EEYA 1CULB 1OS5A 3C19A 4NLGA 1VQNS 5FJ4A 2C3MA 3RG6A 1GT8A 2NPFA 1BHNA 3MAAB 3TO8A 5K23A 3DCAA 3GV8B 3ZZYA 5B0DA 5KT5A 5LXQB 2JDJA 2NZ6A 1OYDA 1ZOTA 3OBIA 1KKHA 2QYGA 4ZJOA 3FCWA 4LF8J 4PVGA 1BUXA 4U7UK 4GWFA 4I1TA 3S8SA 2XWYA 1JB0C 2ROPA 4LBHA 4DXLA 4ZN1A 4QOTA 1XMQF 4KJIA 1JXLA 1JNZB 3RU0A 4CP5A 1VRQC 1UL3A 4FNIA 1D5RA 5F41A 3S3HA 1B99A 3W7BA 3OJSA 2ZNZA 4DUZF 2DNHA 2LECA 3AWFA 5A5EA 2CFXA 5B0CA 1HNZJ 3JAMU 2M3VA 4QIVA 4MK7A 3LAKA 1FKPB 1OEOX 2KT3A 2KT2A 4IDKA 3A5JA 3N79A 3JYTA 5BX1A 4KIAA 2ERRA 2LXUA 2C28A 2HW3A 1B7YB 3P49B 4DLGA 4U7UD 4R0EA 2MLYA 4D3HA 3T5LA 3AWGA 2ZVIA 3THVA 3GIJA 1RWWB 2XULA 3W9HA 5FLXY 3I4PA 1WJ9A 4IFYB 4RH5A 4OIXA 2XPCA 2CG4A 4F67A 3ELHA 1NO8A 3CD5A 3QIDA 4OJ1A 1KQKA 2GCBA 4USVA 2CNLB 2K2PA 3R2DJ 1PJ6A 3H5SA 1KN6A 2Y8YA 3NNHA 4J9RA 2IC3A 3FBCA 2X1AA 1N32J 1WDTA 5C42A 3T1YF 4KKOB 3N5BA 5DQIA 1VQ6S 2G4BA 4GS0A 1HI8A 1OY9A 3C6UB 2FJEB 1NWLA 4X4SA 3N28A 4OYMA 4JOUA 3OVBA 4NXMF 1UP1A 5J8RA 4PWDB 2K1RB 2FJNA 2UVUA 1ZAVA 1QSSA 1UEVA 3TA0A 2ZUGA 4E2FB 1S79A 2W9BA 3VAKA 2DHAA 1GWZA 2IMWP 1YRUA 1ACMB 3CCMS 3I55S 2ZH2A 4KHPJ 2Z4PA 1FD8A 2FHOB 2HS4A 3LP0A 3M2UA 3QFWA 1T9UA 4CDIA 3FEZA 3PW2A 1Q6TA 4GE6A 2ALYB 2QLXA 3ZMQA 2UVVA 4P73A 4KGXB 1XNQF 1HQUA 3VAJA 1C4AA 1I5OB 4X64J 3I0RB 2XC9A 4LVNP 1OPIA 1KNZA 4KE5A 4OYXA 3LP1A 4RW9A 2R7QA 3B4DA 4DCJB 1VK8A 3KMSA 2VUGA 3CIZA 1TL1B 2ZDPA 2DVIA 2DNMA 4ED5A 5F8MA 3GYNA 2BV5A 3CPWR 3DGPB 3VALA 1L3VA 1Q5VA 1HNWF 4ZVEA 3HN7A 1YG0A 1WG5A 2QLBB 2HHUA 1H0HB 3JSYA 2OSQA 3VVTA 1HBUA 1HWKA 2FTRA 5DZ7A 4YDDB 4ZIVA 5CA5A 3D0GE 2BYCA 2BMBA 3MM8A 4ERCA 1VISA 5CD4H 1G2EA 3W5YA 1SJFA 4N76A 1C1BA 3PHEA 2ZMMA 1NK6A 4YR8B 1UA0A 3UCGA 2VTEA 1Z1ZA 3M1VB 4TKTA 3JSRA 1X4GA 5M2RA 1FGSA 1HBMB 4LF4J 4KTQA 3SR9A 1M1GA 1EKRA 4I56A 3WC2A 4Q0BB 2CNHA 1UFWA 1HNZF 4L76A 4DGXA 2Y1IA 2CPJA 2W7OA 1TMJA 2FLLA 5KA2A 2J8SA 5CCLA 1E6YA 1OO0B 2JVOA 4OV1A 2KZMA 4V1Ak 4ZVUB 4JI3F 1RT3B 2HK2A 4NA2A 4Y00A 2HIQA 4AD6A 1JLQA 4XO0A 1SC3B 3NGSA 4FYXB 3WC0A 4QAHA 4EUVA 4M95A 2DRDA 2B56A 4IFVA 4U9RA 1EARA 3DRXA 1N33F 2G59A 1VQLS 3IM9A 3FC9A 4DN0A 1S0MA 1MNEA 1VJWA 2C3UA 3SSQA 1QJHA 5C25A 3K5MA 4DV3J 1KC8T 2R8GA 4D3PA 1U6ZA 1O6XA 4ANDA 1N32F 1HARA 4N8OA 2CRLA 1FTCA 3HFVA 2GIQA 3GYXB 4H4MA 3R2CJ 2UUOA 1D9FA 1M3GA 3MM7A 2MLZA 2HZCA 9ATCB 2LQ5A 1U4BA 4NXMJ 4I7FA 1MWYA 3GJQB 3OFFA 4GVLA 3TZWA 3DHWC 4Y65A 2JC0A 2H5IB 4RW8A 1UFKA 2AT1B 4C0BA 5BZXA 2RDIA 3CJ3A 3HDSA 4JUZA 4FXVA 3G96A 4KHPF 1QY7A 5ADZA 3MF5A 3M8SA 2NUHA 2DXPA 4C0OC 2NYHA 3K59A 5KFXA 3CC4S 1P9YA 4DX7A 3PFOA 4UZBA 1G1FA 2VIHA 3IS9B 4DSFA 3ZM6A 3AXKA 1RU1A 1RHQB 3BGLA 4LSNB 1NH8A 1T02A 1S6PA 1FWKA 2DGTA 3MEEA 4PR6A 5KFTA 1RWKB 3FBFA 3PYDA 4NWGA 5KAKA 5D4PA 1RHRB 2F63A 3PJ9A 5THWA 1PILA 2IRYA 3JTOA 2BW7A 3FNNA 3OXLA 3KLVA 4JYAF 3I36A 4YUDA 3D68A 4EYIB 4DCOB 1TUGB 1FVQA 3VAMA 3IP0A 2DNPA 4K4WA 2F8HA 2DEJA 3EWGA 4QBEA 3P5BP 1S72S 2HFSA 1TK0A 3A5KA 3ISND 3MFHA 2MDAA 4LRDA 3RUBL 2YX7A 2OSRA 5GADI 4X4PA 2EG1A 3HT3A 3H25A 1N56A 3A1YG 2CQ2A 1QVFR 5HAOA 3D1QA 1YN9A 1LWXA 1ZCLA 3QCJA 1G1HA 5A0YB 2HCMA 1TK8A 2GA7A 3KG0A 3ZZUA 1U1LA 2HHHF 3PEHA 3HHLD 5KFOA 1X31C 4JP8A 3ET6B 2F9DA 3HF5A 4K8RA 1YHQS 3TARA 4C8MA 3NWGA 7FDRA 1D9AA 1OSDA 2BM0A 4UY8T 1NSKL 3TW0A 4X4TA 3CJKB 3CWEA 4RDDA 4AL7A 1F2GA 2XO7A 3V0JA 4NLUA 1QSYA 3OL6A 3KNGA 4GO7X 5ETPA 4DFPA 1MG7A 1C87A 4C8KA 2G0IA 2JJ4D 5DG7A 5KG1A 3QCKA 2A3KA 2K3KA 2I5XA 3TQEA 5M43A 5I42A 1N8RT 5E41A 2O67A 2OMOA 5KFHA 4FVMA 5DDRC 2VODA 4RI4A 1VIXA 3HD1A 3NAIA 4OHYA 3W2WA 4R5PB 4Q2LA 4OX9J 2UXCJ 4B3OA 3CJ4A 3PW0A 2DHHA 2HRTA 1HI1A 5B08A 3SI8A 4KYRA 1SKUB 1DZ5A 2ZBPA 4CLSA 1N0UA 3DI6A 1VYAA 3MM7B 2NZ4A 5KOWA 1JF7A 1TL3A 1X4CA 2VFUA 3OFHA 4HH0A 5KFGA 1PYTA 1P31A 2DIVA 2E1AA 3CT9A 3EMTA 4NCGA 2FJDB 4I6YA 4UQTA 4CO0A 3MEKA 5HVHA 3AJ1A 3IRXA 1VRUA 2F00A 3C16A 1NLKL 1P8GA 1PCAA 8ATCB 3UAGA 1ECVA 3EVWA 3KFWX 4WYWA 5ETQA 2IY5B 2BUNA 1H7XA 2PA8D 2V63A 4JV1A 1YFOA 4YS2A 2JFFA 4BJOA 1U1NA 3K7RA 4NRTA 4R25A 2R7WA 2OEJA 1B0VA 1S9EB 1O51A 2I6IA 3OTDA 1S0NA 3T9ZA 3B6BA 3MPYA 3D1HA 3MM9B 4DWIA 4EYHB 1I57A 3RGQA 4UOHA 4ES1A 2QV6A 1FWPA 1CQNA 1H3DA 1MMDA 2GMJA 4HLBA 5D4NA 5DM7Q 1VHIA 4O44B 4DV4F 3PJWA 2R2UA 3DOKB 4ED0A 1FQ1A 4E98A 2RF6A 3VGSA 1S1WA 3KJNB 3R7BB 5D15A 3PYZA 2LMIA 2MXYA 2J16A 3D0IE 1VGYA 2VBZA 5LSRA 4IDKB 1LYVA 1NPPA 4OJHA 1RAHB 3DRRB 3QT6A 3A12A 4LJMA 1SC4B 1RCXB 4MT1A 3MR6A 4RH9A 5KADA 3BH6B 1U1KA 3BSOA 2L9NA 3G6YA 2H65B 4H4KA 1UJ6A 3BJYA 3NEKA 1WD6A 2Z0GA 1K1SA 1KLMB 3Q83A 1FVSA 3DFEA 1IKXA 1RAJA 3HSJA 4P2FA 1X4EA 5G0RB 4EEYA 4EBEA 4LSZB 5DZ6A 3KJVB 2OD6A 1J5OB 4J9PA 2RQKA 3O2IA 1FT8A 3SDEB 1IKVA 2G1DA 1WF2A 2B7BB 3FSXA 3N0VA 3NS5A 1S59A 1TL3B 1WOSA 2CQ1A 2RB7A 4I2QA 1R0AB 2MGZB 1V6HA 1RADB 2XYPB 1BQMA 3LPEA 2MKKA 1KQSR 2I3UA 1S10A 1FNOA 1XMOF 3MTKA 5ITHA 3FZBA 1IKYB 2R8IA 2BQUA 1UW9A 1N5VA 2OD4A 4FN5A 2UP1A 3TEHB 4ERDA 2NUUG 1U0SA 2MKSA 2CPIA 4LRCA 1SL2A 3NRSA 1ZZFA 3HVTB 5J1PA 1WC4A 4OX9F 3UWTA 3OTBA 3ILOA 4X4VA 4GFVA 1LK5A 1AFIA 5I42B 4GKKF 5D8HB 2Z56B 1FHTA 1QUPA 1F9EB 4UOFA 4HKQA 3EM1A 2HHWA 3EICA 1TELA 1U25A 3NG8A 2EI5A 2HKEA 2HIYA 2KYXA 1FRXA 4F4YA 1B0TA 1RI7A 2CWKA 1SV5B 2XMJA 3KK1B 3DLHA 4KKOA 5GVQA 2OHDA 1QAXA 4A47A 5IT4A 2QRRA 3ZZOA 4WTOB 4Q5VA 1MU2A 1BLUA 1O5JA 2N7YA 2YNHB 4F4ZA 2RH3A 2XLKA 2VEWA 3MEEB 2HQIA 3RR7A 2F6ZA 3TX8A 3PYEA 3L7OA 1F9HA 1S4EA 3BBBA 2IM3A 2BANB 3M32B 2RKIB 3RRHA 4DV5J 1PTVA 2JZ5A 2NSCA 1JLAA 5KOXA 2MHEA 1YTNA 2NT2A 2QBPA 3D44A 1Y3JA 4OYBA 4DPUA 1N48A 2WK4A 2IYIA 2BDPA 3ZL8A 2W9CB 3TP2A 2X51A 4DV1F 1F5AA 1KLNA 2VC0A 4LF6J 4B3OB 2GAHC 4RW8B 2QE5A 2JNJA 4LBIA 2CJBA 3MURP 2ZJRQ 4RW7B 1NJIT 1R6HA 3K5PA 4H4OB 4DV4J 1VFJA 4A46A 4USTA 4AQYJ 1BQMB 2ZHAA 2BJ9A 1XMQJ 2E7WA 4RWXA 4NA3A 1AW0A 3PFEA 2VQFF 3GMGA 1IVZA 3I9V9 3DRPA 3R27A 1O0PA 3TZZA 1XTZA 2EW9A 2DNGA 1SH2A 2M9KA 3FFIA 4DUZJ 1G3OA 2C42A 2X5OA 4N77A 2ZZTA 2B4SA 1YBAA 3U1NA 1S1UA 3ETOA 3M6UA 4NZ7A 4DL2A 3A4TA 2H4GA 4I6AA 3CJTA 2VG6B 4JV0A 3HP6A 4WU3A 2FPHX 1NB2A 3EVMA 2HVDA 1C88A 2QN6B 3A8KA 1A5YA 3OR1A 4J7CA 3VF0B 2IIHA 1Q6MA 4I69A 5E2QA 4R8UB 4GVBA 3MR7A 1CJKA 5CHCB 4C3KA 4MYTA 3BB5A 3HFKA 3W2VB 2YTCA 3ZZ0A 1S49A 1R3NA 3W9IA 3M8YA 2PMZD 2NREA 1X0FA 4MKYA 3DDIA 2EFOA 2EWHA 4AXJA 3CCLS 2MBCA 1FK9A 5M2PA 3M9MB 4JI6J 1K0TA 2IMGA 4P10A 6FD1A 1CS4B 1WG4A 1P1LA 2C3PA 3GR0A 3Q24A 3Q23A 3CC2S 4R0TA 1F5BA 4Y6IA 1RAAB 1UWBB 2EVZA 3NS7B 3UN2A 2FC9A 4IYQA 5HK4A 2BANA 2C2MB 3TZXA 2V4RA 2H4VA 2CNGA 2WGPA 4O3OA 5BYRA 1XMBA 5FD1A 3UDLA 3VHQA 2GCFA 5D0EA 4B3SF 3N4WA 3F44A 3CEDA 4KH0B 1YJ9S 3P6YC 2G2ZA 3AB4B 3MM5A 4F25A 3QCNA 4HHJA 2CA9A 5CXTA 2HS3A 1DTQB 4DX8H 3L9ZA 1M1HA 4IOBA 1ZAXA 5E3QA 3BQ1A 4J51A 1OESA 2FDNA 3C15B 2NXJA 2HWHA 2WW8A 3CIMA 4KQZA 4USHA 5FLXU 4NE9C 2L41A 5J2QB 2PI4A 1FXLA 1WCHA 5B0FA 4Y2MA 1ZM3A 2SHPA 2B5JB 4TU8A 2W9AA 3MI7X 4KPYA 4DU7A 2CQ0A 2Y3YA 3QZ7A 1U1PA 3H90A 3GSIA 3KXDA 2FVRA 1CJTA 2YQ3A 1YWFA 2DRBA 3V0HA 5JJBA 3D9CA 4NEZA 1LK7A 2QMWA 3N6LA 2PGCA 2JEFA 3J7ZT 4X4RA 4B04A 4WIIA 2V9WA 3RB4A 4V19X 1VQ8S 2RJZA 1SCJB 4DV1J 1RWXB 4X62J 3J7YU 1VLOA 2VFRA 3I31A 4G1QA 4M5HA 1ELOA 3BKTA 2GFFA 5L39A 2V6AA 1LOUA 1UPPA 2XYHB 4FBTA 2AJ1A 4CTAB 3KMQA 1UVMA 3HLUA 4DFKA 1ZPWX 2VQFJ 4IO9Q 3X1LB 2PFFB 4ZPAA 2IBOA 7FD1A 2UV8A 2YWEA 4ZVSB 4O23A 2IDLA 3KLGA 2F5GA 3OUYA 5JVGQ 5LMNF 1Q53A 1A6LA 2YNIB 4J9QA 4A8KA 4CNZA 3MUMP 1RYSA 1C83A 5KACA 4RW6B 2EXUA 2YKNA 2IPOB 4ELTA 5K20B 4YP3A 1BZJA 1WRMA 4Y2EA 5BZZA 4PXCA 4L3KA 3Q8RB 1U47A 3MEDB 4NLTA 1AT1B 4HDGA 1FFWB 2V69A 1RBLA 4UQGA 4JI3J 2DO4A 3V4MA 5A2QU 2E9ZA 3UR0A 2DNOA 3V6KA 3NCQA 2DXFA 4DR3F 1RBOB 2BA9A 1APSA 1ZA2B 1D0EA 3O5TB 3KNAA 2VC1A 1VOMA 2RF2A 3V81B 3M2VA 4ITSA 4PG6A 1WAXA 4TY8A 3S01A 3LO3A 2JLEA 4IR9A 4B3RJ 1T05A 1VHRA 1VK3A 2DNYA 1GAOA 1IR1A 1IWAA 3W9JA 3PG9A 5L1LA 1TKZA 2PT0A 3MD1A 4URSA 3R7NB 3I5BA 3G9CA 1U1MA 2XMVA 3SQGB 2FC8A 3DLLQ 3CO9A 4EZ6A 1KR4A 4ED2A 4W90B 2KG1A 1F1BB 2PQ5A 2XO6A 2WVCA 3GFHA 3KKFA 3LA0A 3MOZA 2R2SA 2WVDA 4UTGA 4GO5X 4CIOA 2F4VJ 1XN9A 4RZRA 2A6OA 4FP9A 3M05A 4IQMA 2IVMA 4DCPB 4LQ9A 1RXDA 4HR2A 4X65J 3PVXA 1X24A 3AHPA 3GFYA 1NSQA 2MKHA 2OO4A 5I3UB 3RGOA 1X5PA 3L4BC 2W25A 2MQOA 2DH7A 2EFNA 2MKIA 4ZCKA 5FDLB 5B0EA 3D6TB 3K2YA 4JYAJ 4QUMA 2QEXS 2V4JA 2C3YA 2QA1A 1M5PC 3GZ7A 2HYIB 2VD3A 3GG0A 3AODA 1FF2A 4ZMMA 1PH0A 3H4BA 2HQFA 1R8HA 2F3JA 1F6TA 2EFPA 4F3QA 2F40A 1K47A 2Q1LA 3TA1A 1CEZA 3EUNA 2KJVA 1RSCA 3I80A 3QCBA 4G1QB 4L73A 5F9LA 3BPDA 5MLCV 1IBLF 2J7UA 3UDEA 1L3TA 2HHXA 2ILYA 3OSNA 2ZOGA 4S0MA 1SL1A 1FJGJ 4CLYA 3NNAA 5LMNJ 2Y67A 1RWMB 2QL9B 3K8VA 1E6YB 1U8WA 4YB5A 4DL0C 1YTWA 1RAFB 1VLYA 5LL6d 2G0CA 1S48A 3ONQA 2PBNA 3T5HA 2XZWA 2K8GA 1RTDA 1YGYA 3V2UC 3GR1A 4WK1A 4TN2A 2VZ9A 3O6QA 3ZNJ1 2OI2A 5HVGA 5KFKA 5CD4A 4QPXA 1KQGB 3RBXA 3CXCR 3UPFA 4FVCA 1XJWB 2V4QA 1WNEA 4U8VA 2B4PA 4W4MA 4F3OA 2V8VA 2B9WA 4GKJF 4Y2AA 1VRUB 2DHXA 4J37A 2B4UA 4B17A 1RTJB 1RT7A 3MMBB 3FUYA 4C11A 2J6UA 2Z30B 4DG1A 4CVLA 5ETOA 3ENVA 4U7CA 2QT7A 2UZAA 2I0XA 2E5GA 2MEWA 4MFBB 3WIUA 2GCAA 1DARA 1KAVA 2P5VA 2WJPA 5GAEU 3RRGA 3M8RA 2EBGA 3H42A 3R5BA 4Q7AA 5B0GA 2FD2A 4WFBQ 2GO8A 1M0SA 2DNKA 4NZ6A 2C2DA 3OLRA 2PE8A 4UOCA 4Q44A 2HAIA 2NXCA 3N01A 3QBCA 1QSLA 1MMLA 4DR4J 5B09A 1TAQA 1FDAA 1PC4A 2JH3A 2FUG9 2GJ2A 2B43A 2HQ3A 2HRYA 2CJQA 3H7HB 3OD2A 3Q8VA 3NL0A 1WEZA 1R8PA 2D69A 2F4FA 2YWGA 4ED8A 2XS5A 3NBPA 3V0FA 2CNKB 4M5DB 4WU2A 2PMHA 1WSVA 3L95X 4GC7A 2W01A 1IQZA 2JLFA 2VG5B 2GS8A 5ETTA 3KK3B 4O3RA 1MU2B 4I4BA 1Q6NA 4K2JA 4MKBA 1OPZA 3MM6B 2M88A 1YBTA 2J76E 1WTBA 3BSNA 1S9GB 1LW2A 5CYMB 2CJKA 3NOCA 2VQEF 4LFAF 2RF2B 3LGNA 1WC0A 2OPQB 1NB7A 2VEYA 4IO1A 2XY6A 3ZTOA 4MJKA 4FYDA 2ESBA 2AMCB 4KGKA 2WHOA 4IKAA 2G2YA 3EGVA 4UW2A 3DLKB 1RWNB 4LIRA 1WC1A 2XY7A 1FJGF 4QBWA 3N2AA 1K44A 3H2XA 1NDLA 2I1YA 4ELVA 1LNQA 3GFZA 3HI9A 1R8AA 2LU2A 1WI8A 3QFHA 4QIFA 4EK2A 1SH0A 2A18A 4R8UA 1BQNA 1X9SA 2RQ4A 2AYBA 3DLEB 3CCUS 1FKOA 4NLSA 2VEUA 4J9UE 3PKMA 4D3QA 1EENA 3VAHA 4J9VA 2EG2A 3Q0AA 2IJRA 4GRYA 2V4JB 5IZHA
chains in the Genus database with same CATH topology
2FLPA 3M8QA 3CUNA 4IRCA 4Y34A 1NJZA 1HYSA 2QDMA 3HHEA 3TOQA 2N3LA 1RISA 5AE2A 4OX7A 4EO8A 2RDJA 2MSTA 2DD8S 4IH6A 2YWFA 5G4DA 3KLGB 1UA1A 5KA4A 1Q8BA 4RUHA 3K5OA 1ZYQA 2IVYA 2VEXA 4DSIA 2RS8A 2AGOA 2AX0A 3IC1A 2YY3A 1VRTB 2PN6A 3GILA 1R7IA 2AYMA 2XY5A 1WACA 1VBXA 3MEGA 1W2BR 2HNYB 4XPCA 5HROB 3HHLA 2BGDA 3S3EA 3PIPQ 2XGPA 1QLNA 1XEZA 2FVSA 2FVCA 1AAXA 2AU0A 1ZCKA 4DR6F 3M2RA 3H40A 4DV5F 3DLEA 2ZD1A 4BC7A 4O4RA 3R1HA 1JLBB 2RILA 3LH2S 1HMVA 3NS6A 1FPZA 1YI2S 3AJ2A 3CJ5A 2QFJA 4DMZA 3DOKA 4WK3A 1RTIA 5KFNA 1VQYA 1Q16B 2JSXA 2MZRA 4NNDA 1I6JA 3WDOA 1X4DA 2QDPA 5KA8A 3BSAA 4F50A 2ASYA 2HLTA 1TK5A 3QJLA 4EO6A 1Q8IA 2HWTA 2VPXB 3HKWA 2OAUA 2O66A 4ATNA 4Z37A 4OZJA 1VQSA 1HWUA 1H98A 2E1CA 1H2TZ 4M5DA 4RUCA 4RNMA 2HC1A 2Y2FA 2WCXA 4ETZA 2FJWA 2VL1A 2KZZA 4LQ3A 1CQMA 1U1QA 1S97A 2FJMA 3IO1A 3FEYB 4QIGA 1KFDA 3UFCX 2J8AA 3PW4A 4C97A 1TL1A 1L8KA 4EBDA 3C6TB 4WXOA 1UFLA 4DDFA 3QKPA 1U6FA 1NZAA 5F0WA 5BYQA 1FDNA 1FRLA 1TUVA 3QGGA 4AFFA 2YWHA 2DGQA 2O01C 4NPOA 3ZZZA 4H34A 1REVA 4JI0F 4RW7A 1BY9A 4X4UA 4ZPDA 1XXVA 4ECUA 4XDCA 1F60B 4H1OA 5KFPA 1NU4A 1GNKA 3IR5B 1TL4A 2XMUA 4KB7A 4NLVA 2VFSA 4J9MA 1FRMA 2W4DA 2DISA 2W4PA 2VPYB 2KT5A 2Q3PA 4OHZA 1S9GA 3K5NA 2ACYA 2DO0A 2FY1A 2WSFC 4ZP7A 5AXKA 4TXSA 1FPRA 4URQU 1GXLA 4KV8A 4NL5A 4RNHA 1JWWA 1RT3A 2R2RA 2LA4A 2HRUA 3IAS9 1UVIA 2M7SA 1FD2A 1YRTA 3FZ2A 3QPIA 1TR0A 4ZVGA 2F6YA 2V5HG 1DQAA 2IAJB 3SCJE 3BR8A 5KFMA 3RYLA 5DGBA 5B0AA 3AQOA 2HC2A 3TVZA 5KA9A 2C46A 2EPIA 4RHGA 1FCAA 2GV1A 3M6WA 4NX8A 5DGAA 4DL7A 5EN1A 5KFFA 1U2FA 4ETXA 4RW4B 4U6PA 1FERA 1GH8A 4W92B 3CTRA 5EGYA 2PI5A 5E7OB 4ZDNA 2XCPA 2I6JA 5K5MA 2IMOA 3FFIB 2GQQA 1M5OC 3DXSX 1HNIB 1FDDA 3E8OA 3EZ5A 1S1UB 2DT9A 1KAKA 3AAWB 5H9FJ 1VIOA 5KFZA 4DV2F 5A8KA 5KG2A 3G8SA 3EGZA 2V2KA 2JVRA 1KQFB 2LQJA 1TKTB 1PSDA 2DR8A 3BLUA 3G86A 4PUOA 3QIPA 5KT6A 4B9LA 3PJXA 1HPZB 1N52B 3LANA 4HT7A 2AJ0A 1V3SA 2CZ4A 4OI2A 4DS4A 1RT6A 2ATLA 4M1KA 2OFGX 3TAPA 3QCDA 3I6PA 2WB1D 2JLGA 1JJ2R 1X4FA 4PQUA 1UKUA 4ID8A 5GTJA 3T6JA 1WELA 2R7RA 3OPKA 3CMAS 1R6YA 2GWOA 3V0GA 3V6DB 3DLGB 3M1VA 1YVFA 1ULRA 2Y1JA 1HFEL 5K24A 3I5AA 3WZ0A 2A1BA 3E2EA 2CPYA 2KHCA 1BQNB 3OW2R 4PXDA 2HNZA 4NRUA 3DM2A 3MAQA 1LQ9A 3T6BA 5HROA 4TU7A 1LWCA 2YX4A 3EPIA 2J6SA 2RRBA 2N4CA 2ZH8A 1Z4UA 2CQ4A 3JB9k 4B3MF 2BE2A 2M2BA 4LUBA 2KJWA 2IBKA 4IRDA 4O3QA 4HT5A 4NXNF 4QW9A 2DGOA 2ZE2B 3CWJA 3OL8A 3G8QA 3CCSS 2H04A 2YKAA 5F8JA 5A8KB 1FRIA 2R0BA 3MUTP 1LXNA 4CT9A 3DXBA 1C85A 4NYZA 1WF0A 2Q79A 1RKJA 3V0DA 2WRMA 3FRZA 3C6TA 4K4UA 2PD1A 2E5JA 3HHNB 2JOQA 3DRPB 4L6V3 3NCRA 1URNA 4QBUA 5IQQA 2XMKA 2MJNA 3POTB 1KOHA 5KFUA 4QZVB 4PXBA 2BZ2A 1XR5A 4PCQA 1NK5A 2FIUA 3D1OA 1UEUA 4NLXA 3TI0A 3F81A 1I9SA