3O3LA

Structure of the ptp-like phytase from selenomonas ruminantium in complex with myo-inositol (1,3,4,5)tetrakisphosphate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
315
Chain Sequence
b'EQTVTEPVGSYARAERPQDFEGFVWRLDNDGKEALPRNFRTSADALRAPEKKFHLDAAYVPSREGMDALHISGSSAFTPAQLKNVAAKLREKTAGPIYDVDLRQESHGYLDGIPVSWYGERDWANLGKSQHEALADERHRLHAALHKTVYIAPLGKHKLPEGGEVRRVQKVQTEQEVAEAAGMRYFRIAATDHVWPTPENIDRFLAFYRTLPQDAWLHFHSEAGVGRTTAFMVMTDMLKNPSVSLKDILYRQHEIGGFYYGEFPIKTKDKDSWKTKYYREKIVMIEQFYRYVQENRADGYQTPWSVWLKSHPAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myo-inositol hexaphosphate phosphohydrolase
publication title Structural analysis of substrate binding in PTPLPs
rcsb
source organism Selenomonas ruminantium
molecule tags Hydrolase
total genus 109
structure length 315
sequence length 315
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14566 PTPlike_phytase Inositol hexakisphosphate
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1690 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o3lA01
3.90.190.10 Alpha Beta Alpha-Beta Complex Protein-Tyrosine Phosphatase; Chain A Protein tyrosine phosphatase superfamily 3o3lA02
4ZN5A 3O3LA 4BJOA 3O4UA 3V0FA 2CM7A 4QBEA 1MKPA 5J8RA 4D3RA 1PTYA 3H2XA 4OHDA 1YTNA 3EMUA 1T4JA 3CM3A 4NWFA 3F9AA 2Q47A 2H02A 2BGEA 3RZ2A 3QCBA 3OLRA 1G4US 2CMAA 2QBPA 1PYNA 4OHIA 2OC3A 1OEUA 1I57A 1WCHA 3BRHA 3S3EA 3QCFA 1R6HA 4OHEA 2YDUA 5KA4A 2F70A 1C88A 1NWLA 2QBSA 3EAXA 2B4SA 2JJDA 1PTVA 2PT0A 3QCNA 2M3VA 3PS5A 4D3QA 4R0TA 2QDCA 1Q6JA 4TVVA 1J4XA 1EEOA 5KABA 4J51A 2BGDA 3OMHA 4QAPA 2HCMA 1OHCA 3O4TA 2J16A 5M43A 3BLTA 2I3UA 1VHRA 2CNEA 2VEVA 2G6ZA 2CJZA 2Q05A 5K24A 1L8KA 2I6IA 5KADA 2F71A 1G7GA 2HY3A 5IBSA 2QCJA 3EB1A 2HNQA 1T49A 5K9WA 3ZV2A 4RHGA 2A3KA 3F99A 4BPCA 1PA9A 4WOHA 2VEYA 5KA8A 1C83A 3I7ZA 4MBBA 4QUMA 1QXKA 1OEVA 2I3RA 4KYQA 1PA1A 3D42A 1YFOA 2OUDA 2B4UA 1PH0A 3CWEA 5IBMA 2H04A 3ZM3A 1PTTA 2FJMA 3QKPA 1G7FA 2CNHA 2CM8A 1YGUA 4D3PA 2I4GA 2Y96A 2I5XA 1OEMX 4GRZA 2R0BA 3NMEA 1YWFA 2I4EA 1X24A 3RGOA 1RPMA 2PQ5A 3AWFA 3EU0A 1XBOA 1OESA 1L8GA 2J17A 3M4UA 1A5YA 2H4KA 2NZ6A 3ZM2A 1C87A 2WGPA 4GFVA 4JNBA 4H1OA 5KA3A 3S4EA 3QCLA 1JF7A 1M3GA 2CMBA 4JMJA 2IMGA 1V3AA 3SR9A 5BZZA 2NV5A 2NT2A 4ZRTA 4GS0A 1ECVA 1NWEA 3AWEA 1BZCA 3QKQA 2HC1A 5KA0A 2QEPA 2I6JA 2CNFA 2H4GA 2I6PA 2PI7A 2G59A 4R0SA 3RGQA 2H4VA 1AAXA 5KA9A 1ZZWA 1YPTA 2QBRA 3QCJA 3GXGA 4Y14A 2P4DA 1BZHA 1OEOX 4AZ1A 4Z6BA 1G4WR 3QCMA 2F46A 3EZZA 3GXHA 2I75A 4KI9A 4NX8A 4R30A 3F9BA 4GE2A 3D44A 4NYHA 1FPRA 4HRFA 4JBCA 4QUNA 1U24A 1EENA 2J16B 1ZCKA 5KA2A 1P15A 2GP0A 2VEUA 4GRYA 5I6VA 4Y2EA 2I1YA 3ZM0A 4DGPA 3MMJA 1YTWA 4OHHA 5GTJA 2A8BA 5KACA 1T48A 3D1QA 2I6OA 3QCIA 2HNPA 4RI4A 3S3FA 2C46A 2AHSA 5HDEA 3F41A 2OOQA 1I9TA 2OZ5A 5BUGA 2F6TA 2B49A 4YAAA 2F6WA 3MOZA 2VEWA 2GWOA 4H34A 3BM8A 3V0DA 5AWXA 2BZLA 1OHDA 2BIJA 2AZRA 1LARA 4ICZA 2ESBA 3QCCA 3O4SA 1LQFA 2HVLA 3V0GA 1I9SA 4GE6A 2QCTA 1C84A 3S4OA 2QBQA 2H03A 1C86A 2I4HA 2Y2FA 1OHEA 1XXVA 2I42A 5K22A 3B7OA 5BZXA 3V0IA 2F6YA 2CFVA 4I8NA 1YZ4A 1BZJA 4B04A 4KYRA 4RI5A 3F81A 2CNIA 1WRMA 4RH5A 5LXQB 1LYVA 2FH7A 2C7SA 1C85A 2CNGA 3QCKA 1G1GA 4PYHA 2NLKA 4GE5A 3ZMQA 1Q6TA 5KA1A 5EHRA 4RDDA 1YGRA 2I6MA 3QCDA 1KAVA 4WTYA 1GFYA 1FPZA 2DXPA 2HB1A 2ZN7A 4IKCA 2B07A 2PSZA 4ERCA 1ZC0A 1WAXA 2CM2A 3A5JA 4NNDA 2B4PA 1NO6A 4DGXA 1D5RA 1Q6PA 3V0EA 3QCEA 3BLUA 3N0AA 3SMEA 1ZCLA 5K23A 2GJTA 1YN9A 3I80A 1OETA 2BV5A 4ZI4A 1PXHA 2NT7A 4PVGA 4GFUA 3O5XA 1NZ7A 4HJQA 3S3HA 1RXDA 4HJPA 3S3KA 2NTAA 4YR8B 1NNYA 1U26A 2CM3A 2E0TA 2MBCA 3D1HA 5EHPA 3D1OA 2RF6A 4QBWA 3V0HA 5K9VA 4WU3A 1ONZA 2B3OA 2QDMA 4RKKA 4GWFA 1G1FA 2FJNA 1KAKA 3MOWA 4QAHA 4S0GA 1QZ0A 2HXPA 1Q6MA 4NWGA 1XM2A 3AWGA 4RH9A 5KAAA 1YTSA 2CMCA 5K25A 2SHPA 1NL9A 2P6XA 2QDPA 2F6ZA 3V0JA 3A5KA 4JMKA 3ZM1A 2ZMMA 1U25A 1JLNA 1Q6NA 3QCGA 2HC2A 2PA5A 2PBNA 5MMZB 5KA7A 1XXPA 2F6FA 2VEXA 1GWZA 1SUGA 3D9CA 1PTUA 4WU2A 3QCHA 3RO1A 2F6VA 1Q1MA 3ZMPA 1FQ1A 1ONYA 3I36A 1G1HA 1XRIA 3LJ8A 4OHLA 3U96A 5BX1A 2B4OA 1Q6SA
chains in the Genus database with same CATH superfamily
1KC8T 1KBRA 2Q66A 2PFFB 4NA1A 1XMQF 2A2DA 4RU2A 3VQSA 4EO8A 3H2XA 4OL8A 3KLIB 4M94A 3EDRB 2VJUA 4FXVA 1VQ9S 1BC6A 3EGWB 1JNRB 2V2VA 2EBEA 2BOAA 1R6YA 3KXDA 1PYNA 4U7UK 4WXOA 1QE1A 2Q3PA 2ZNYA 1IBLJ 3UN2A 4HI2A 4ZHRB 4QOTA 4F4WA 3C14B 3KK1A 4OI3A 5AXMA 2BGDA 4KFBA 1KP6A 1NXIA 1HHSA 3FBCA 3JTOA 1WKKA 4P52A 4LFAJ 4Y34A 4I7FB 2G6ZA 1FI4A 2KRRA 2BR0A 2I6IA 2UAGA 4NMLA 1V3SA 4JI2F 2WSFC 2CAJA 3BREA 3PXGa 1M90T 4DFKA 1IJFB 3SQOP 2VEYA 1I5OB 2WOMB 3GLJA 2ZE2B 2OFGX 4ZLPA 3PIPQ 3HFZB 2MQMA 5DJBA 2V50A 2HHVA 4RU9A 2B4UA 3PX4A 4WBFA 1E0DA 4TVAB 2P6SA 4ES1A 3NEKA 4WCEQ 2HGMA 2QLWA 3QJJA 3K7RA 2BJ9A 2CM8A 3VALA 1FJ7A 4UQTA 4D3PA 2PN6A 4A46A 4JV0A 2CVIA 4LFCJ 1T3OA 2MKYA 2VKRA 4WFYA 1MROB 2RU9A 4X4UA 2E1RA 3BO3A 3X3UA 2IMOA 1HQEB 2MHNA 2MKKA 2HRUA 4H4KA 1U1PA 5D77A 4CO2A 4L6V3 2RU3A 3QRQA 2NV5A 4ZP8A 3MEGA 3SQGA 4FF3A 1VHFA 2AX0A 5LOQA 3MPYA 2G9OA 2I0XA 1FE4A 2G59A 1RA6A 1WELA 3K2YA 1IKWB 2I8EA 1DHMA 5E2QA 2ZKTA 1Q82T 4AZ1A 1OSDA 4NPOA 3JSBA 4LSNB 2CRLA 2HBYB 2XS5A 4NLOA 4NX8A 5SUHA 3CJ2A 3R5GA 2OPSB 1BLUA 2LEPA 1FE0A 4NOHA 1Y4ZB 2V4JB 2KHDA 2I6OA 2IC3A 1TKXA 1WEXA 1UETA 4ZVPB 3HHDA 5KFEA 1DY3A 4Z2XA 1Y5IB 2A2CA 5DGBA 3OR2A 4CDIA 1HWLA 3VAKA 2DNKA 1RWKB 2W1BA 4CT8A 2DR6A 3PG9A 1WOSA 3MF5A 4NZ6A 2BACA 2V67A 4O3OA 2DJWA 3UFCX 1Q86T 3SDEA 2AT1B 1EKSA 1EP4B 3HX9A 3LUYA 1N34J 4TU8A 1RWVB 1FDAA 5CYQA 1SQEA 1WRMA 3BS9A 4OFZA 1WHWA 5GAHI 2EVZA 2PD1A 4OZNA 2NXCA 3OR1A 1RT3A 4E2FB 5HQMA 2XLIA 3W65A 2V8DA 1XR6A 2VG6A 4P9SA 1EARA 2R9LA 2RHQB 5E41A 4C6AA 1VHIA 4XK8C 4MFBA 4PG7A 3SMEA 2O5DA 2ZWOA 2WW4A 2BV5A 4GRSA 2CADA 4JYAJ 2RIJA 3M2RA 3T5KA 3NAIA 2MZRA 2FUG9 1DQAA 5EHPA 3BR9A 4YB7A 2YQ0A 3CCLS 3V6KA 4ZCMA 4W90B 1RT2A 1Q6MA 2FHMA 2IRXA 5KAAA 4HYKA 2ADCA 1MWQA 5JUMA 1PYTA 2MQLA 3C6UA 3GIRA 3MM9B 1VS3A 4HHHA 3NGKA 4RW8B 5ETQA 4N47A 3B78A 5HMZA 4DL5A 3V81A 2PBNA 3M8WA 3DHXA 2GCBA 4LF8J 3C8YA 3OXFA 1RAHB 3TARA 2EFNA 2B56A 4HH0A 4YB6A 2YNGB 5ETMA 1SXLA 3O3LA 5T7LA 2KT3A 9RUBA 2KVIA 3Q86A 5J8RA 4J9SA 1Y0HA 2NYIA 3CJ4A 2W7PA 5MLCV 1WC0A 2P9CA 4OHWA 3DRYA 4J9NA 1HPZB 2B6AA 3RZ2A 2C2ZB 3UCUP 2I5JA 2N3LA 3UCGA 2AHOB 3H2LA 2R7XA 4K4VA 4F50A 4ZVOB 1YQHA 1YK9A 2YDUA 2IDEA 5KA4A 4DV4J 4O3PA 3LQVA 1JIHA 3C16A 2R7RA 3DFEA 2E7XA 2LKZA 2OI2A 2R2RA 5KFQA 3ETMA 2OSRA 3QPIA 2H3EB 3O4TA 2FJBB 4N8OA 2I3UA 4YY3J 5KFIA 1VHRA 3GJSB 4P72A 5C5JA 2UXDF 2W9BA 3CCVS 3M32B 1APSA 2F8EX 2XS2A 3F99A 4BPCA 4V19X 2F63A 1C83A 3PJWA 2VG7B 4HEA9 2PGCA 4B9NA 4I67A 2HHWA 2BW7A 2Z57B 1X9SA 2H04A 3AHPA 1DZ5A 2GQQA 2FJMA 1VOMA 2R8JA 2E5JA 4NLWA 4C8YA 2QMWA 3MVNA 2UUOA 5A0YB 3HULA 4AQYJ 2FZCB 4ZVUB 4NLQA 2MEWA 4JI6J 4OX6A 2HNYB 2NLWA 4Y00A 3IRWP 3JS9A 3P6YC 4URQU 4WE1B 1U0SA 3AWEA 4RUCA 1AXQA 2VASA 5J2MB 4QQBA 3W1YC 3SFUA 1UTAA 4RW7A 5KA9A 2KM8B 3PDNA 2HEKA 3VAGA 2ZBCA 3AOBA 2ZBRA 4IFYA 3NS7B 2P4DA 2G1HA 1RU2A 2GQ2A 3FMBA 2FHJD 1C0UB 3DOMB 4ID8A 4FXWA 3OVBA 4KI9A 2KJVA 1L5UA 4GE2A 5F8NA 2F4VJ 1HBUA 1BGXT 3AY0A 5KT4A 3RTVA 1KD1T 2VEUA 4RPFA 1MW7A 4Y2EA 4U8YA 2XC9A 2Y1RI 2N7CA 2AWZA 3MMJA 2UU9F 3FQLA 5GTJA 1T9VA 4Y2IA 3M2VA 1S1VB 1TVRB 4FZVA 3US5A 3NP5A 1RZMA 2VL1A 3IG1B 2HVIA 2GVDA 2UUWA 3JYTB 3ZZRA 5F8HA 1NK7A 1UPPA 4NX9A 3PYZA 3GSIA 1YSJA 5K14A 4DV7F 2D3O1 3TEHB 2XHCA 2BIJA 1BQNA 1AROP 4K4ZA 2K3KA 5KFHA 2NPIA 4CWBA 4MK7A 4C8KA 2MZQA 3A8JA 3PX0A 3FCWA 3KLFB 2I1RA 1D9DA 3O2IA 1S1TA 5A2QU 2I4HA 4HT7A 4I6AA 4M5DB 1SKSA 1U0HA 3BN7A 4M5MA 1R8BA 1JLEA 2H4YB 1EETB 4QYZK 4RNFA 1YRUA 5LJ3Y 4PXDA 4OX9J 3OTCA 2VH7A 5DM7Q 1YITS 4GKJJ 4RDDA 4WKYA 3OFHA 1KLNA 4V19J 3R5DA 3GJTB 1ZYQA 5HANA 3HSGA 3NMRA 4LF6J 4LF1A 5DG7A 2JC1A 1KSPA 4LRCA 4A8WA 3MDFA 4C8OA 3SYZA 3N0AA 1UFWA 3PVXA 3UQSA 1F9FA 3MM6B 5BYSA 4NXNJ 2UVVA 4ZI4A 2AJQA 4BUCA 4EZ6A 3C14A 3S3KA 4X4TA 5THWA 2MBCA 1U26A 2FJXA 4OJHA 3QFWA 3ZNJ1 4B3TF 1G1FA 2ZJRQ 1F0XA 2K06A 1X5TA 2IM3A 4I7FA 5CD4H 2IJRA 4ZPVR 5DETA 2JFKA 1TU0B 2IM0A 3MFHA 4IRDA 2R7WA 2HWIA 3KKFA 3LAMA 3RAMA 2WOMA 3C19A 4Q8EA 2ZE2A 4K4SA 4PZVA 4KV8A 3ET6A 4RX6A 1BD6A 2UUAF 1UWBB 2KT2A 3A3NB 3SMZA 2E5LJ 2DY9A 4OJ3A 5ITHA 5I3PA 2IY5B 1M0SA 1XWLA 3H5UA 1OIAA 5KFRA 3CJ0A 5C25A 3LALA 3I5AA 4YMEA 5IV3A 1DARA 2OGUA 4ZN5A 3W61A 1QSSA 4LIRA 2F3JA 3DMJA 1FFWB 4OHVA 1NK9A 1HQEA 3GILA 3QMQA 1WD6A 2JVOA 2XMVA 3DRRB 2XI3A 4I4BA 4DS4A 1VGYA 1HNXF 2XG8A 1CC8A 1MU2B 1RTHB 3M6WA 2CG8A 2UUBF 5J1NA 3BRHA 4KHPJ 1RAIB 4WFXA 4LF5F 3HSZA 3JB9k 4PRFA 2Y1JA 4GVBA 1NWLA 1IKWA 2DIUA 4Q7AA 2VA2A 3DOLB 4GMKA 1RTJB 2M3VA 2K7KA 2DCLA 4LSNA 2R7UA 2L48A 1OWXA 2NUHA 1C1CB 1TKTA 3BBBA 3NS5A 5LMNJ 3SV4A 3HVWA 2UVRA 3OFGA 3THPA 1KQFB 2IJNA 2VEVA 2OPSA 2WONB 2AYMA 2R7VA 2DVIA 3MEDB 1G7GA 3BJYA 2E7WA 2V4JA 5IBSA 2DY1A 2M3DA 4JI3F 3RB3A 4ECXA 4ED2A 2A3KA 3TW0A 5JJBA 4KYQA 3P3DA 1T9WA 1WACA 2KG1A 1PKUA 5G0RB 4DQIA 2OUDA 3PFOA 2E29A 5C2CA 2R2UA 1OY9A 4C8MA 2X1AA 1PC5A 3FC9A 2IAJB 2BANB 2GJIA 4OI6A 2I4GA 2HVZA 4GRZA 4DFMA 2DR8A 2XPCA 5DG9A 2X51A 3UR0A 1IR1A 4J91A 4J9VA 1SCJB 4WTOB 1EP4A 2HZAA 2A6OA 1K1QA 1BUXA 5KA3A 4MH8A 4F7VA 4JMJA 5T14A 1QJHA 3ITHB 1VJWA 4C8ZA 4I0WA 4GS0A 3PX6A 2P6TA 1UPMB 3EGNA 3QKQA 2HC1A 4CH7A 2CNFA 4Y6IA 3SXLA 4AYBD 3KLEB 3FEYB 4ZVGA 3T1HJ 1GTEA 3HHLC 4DXLA 4G1QB 1CJUB 3RG6A 4N41A 3J80Y 3CJ5A 2I9SA 3ENVA 3J81Y 1T8EA 1MMDA 4K2XA 4ED7A 2G0IA 5EX0A 3FQKA 2QA4G 3TVYA 4I56A 4C3MA 4P2MA 1S5ZA 1AUDA 2BE9B 4ED1A 4CVLA 4B9MA 4AUKA 3H5YA 2C42A 2E5HA 5MAOA 3TX8A 2D69A 1S12A 3OTDA 3ZNUA 3DHWC 4N5SA 2M4MA 4FNIA 4UTGA 4ZVTB 1GQYA 5SZTA 1WI6A 3OXLA 1A7GE 3C15B 3QO9A 3GTYX 4WP3A 2B8QA 2K2PA 1NAQA 4RW8A 3DOKA 5KFFA 2CDQA 3H2VE 2MB0B 4DS5A 3EZUA 1PGZA 3BGFA 4B3SJ 3FK4A 3UN3A 3CCSS 4AL5A 3B54A 1K9MT 3MPVA 3UI3A 4QPXA 4YFUA 2J8SA 4OQJA 1O6XA 3FJ2A 2FHKA 3PV8A 4W92B 2HW3A 4U7CA 2FH7A 1FWLA 1NNDA 1R89A 3N2AA 1Z4UA 2NLKA 3ZMQA 3QATA 1T9UA 4DBQA 5KA1A 2GHPA 2YKMB 2HVDA 2NPFA 4KBIA 1KOHA 1HPZA 3GV5B 4TQSA 1F60B 4MIWA 5I3QA 2LECA 2RS2A 3I5CA 1I1GA 3CB4A 3MECA 2JDJA 3HDSA 3N6LA 2U2FA 1YN9A 4WKRA 3I0SA 3IBFB 4M1KA 3AA8A 1TMMA 4GO7X 3DRPB 3T41A 2QT7A 3TI0A 5HATA 3LPEA 2ROPA 3ULHA 2VPZB 3HZGA 1RAGB 4FYXB 4P7TA 4RBUA 4LBIA 2YWKA 1UVMA 2HYIB 1XN9A 1TZ0A 1KQGB 4RBTA 2Y1LB 3UVJB 4RL1A 2DNNA 4EBEA 1NL9A 2QDPA 2DH7A 4NLTA 1NK8A 4DEZA 4WP9A 1VI7A 3EMTA 2VG7A 3QFHA 4DPTA 1S97A 5HLFB 1S6OA 3IFEA 3ENQA 2LLZA 2ZUGA 3W8GA 5HQ8A 4NLXA 2ASYA 1T0TV 2CUYA 1G1HA 4E8UA 3KLHB 5A0YA 2KXNB 4DR2J 3PYGA 2QN6B 3R8YA 2RQCA 3MR3A 3DCAA 1CJVB 3T5JA 1NPPA 1R0AA 2JL9A 1DQ8A 4LSLB 4L3NA 3I87A 5GADU 3IR5B 3MR5A 3WBZA 4UW2A 5A8WB 8RUCA 3OLAA 3MM7B 3AOCA 1RHMB 1TV6A 2FZGB 3CJSA 3K89A 2CWXA 3A12A 3CC2S 3SZ2A 7FD1A 3S3EA 1PBAA 3QCFA 4EK2A 5J2MA 3I0RA 5M2PA 4JI4J 4GVLA 3IWXA 1R43A 4QZVB 4ZVFA 1IQTA 3CCZA 4Q0BB 4BDPA 1C0UA 1O5JA 3DOMA 1NK5A 4TN2A 4RR5A 3DLHA 4HVZA 4LF8F 3DU5A 1WTFA 4L75A 4QYZJ 2GX8A 2Q05A 4PKDB 4USTA 2CYYA 2E9ZA 2QCJA 4ILRA 3LTOA 2VKZG 1FRMA 2AP6A 3EJMA 1AA1B 3M9NB 3FCHA 3HPOA 1SJ1A 1YRXA 4X66F 4O4RA 2EI5A 2Y3YA 1QTNB 3CWEA 5IBMA 5D8HB 2HURA 3NAHA 3NXZA 3A4TA 4EMDA 2V2ZA 3TANA 3NMEA 2WTZA 2A3JA 2OP5A 2QYGA 2NSBA 4MKYA 1WHYA 6FDRA 2JSXA 4MKVA 4BBYA 4NRTA 1GMWD 4RW9B 1REVA 2A18A 3OUYB 1AUSL 1SJ4P 3CD5A 1HBNA 1EETA 5KFTA 3R7NB 2QEPA 3JXOA 3RB4A 1L3UA 2FIUA 3A8EA 3N6MA 3RRKA 2HK3A 4I68A 2NXNA 3OHBA 2IIHA 3VAMA 3BGRB 2CQ3A 4WYLA 1YKWA 1FKOB 4P74A 1RWNB 5ETKA 3UCZP 5AXLA 1VRQC 4CLWA 2ASLA 4JI5F 1U24A 1P8GA 2ZZMA 5J1EB 3DGVA 1JLBA 3U1LA 1HR0F 3I31A 1F9EB 2I1YA 2J0XA 1LXNA 1Y9OA 3MM6A 4X4SA 3M9OB 1N32J 4LFBJ 5CCLA 3WIVA 1R8PA 4OHYA 1RE1B 5IS2A 2VD3A 3MI7X 2XEXA 2C2KB 2ZH5A 4C0OC 4ANDA 4DR6F 4ZDNA 4YDXA 3IRXB 4P2SA 2B49A 2F6WA 3MPWA 3AD7C 3W64A 3VQTA 3KHRA 1GMVA 1ZAVA 4B9VA 1CVJA 2LFVA 5LSRA 3EUNA 3QNWB 4C8LA 3D6HB 3PM9A 3NGDA 1URRA 1HI0P 1HNVA 4PCQA 1HA1A 3EVWA 1X4GA 4FNHA 1UWBA 2CJXB 3PRBA 2DB1A 1KFSA 3RRGA 3B7OA 2EEYA 1MSWD 3DI6B 2F4VF 4LRBA 4NE9C 4LRDA 2YNHB 4KPCA 3ZZZA 4YR2A 3M6UA 3BR8A 1H0HB 4I2QB 2Q6CA 1PIEA 1VC6A 3VGUA 1YGRA 3DRRA 1DLOB 3PJXA 3QCDA 1KAVA 4EFAC 2MKSA 5GAGI 4IKCA 3P8BB 1RTIB 3KTQA 4NYPA 1V3RA 2NZCA 1MU2A 3GJQB 1RTHA 4NNDA 3JTPA 3MUMP 3J7YI 1K0VA 3HO1A 4M5GA 5AJ3F 4KYZA 3BB5A 3HVTB 2QL7B 4TXSA 1OETA 2MQOA 1IN0A 4HLBA 4ED4A 2VODA 3HHNB 1PXHA 4JV2A 4PUOB 4HJPA 2F8HA 1KHWA 4CT9A 3H5SA 2J6TA 3D1OA 4QBWA 3V0HA 3NGUA 3D7SB 4PG8A 1WG5A 2NUUG 2F8MA 5DLGA 4NWGA 5A8KA 2RD5C 2IRYA 5LXYA 3CE8A 2HNZA 4ZPDA 2B9WA 3MEEB 2ZM6J 2GS8A 3FBBA 4OX9F 4U95A 3MWBA 4C0BA 3QGGA 2OHDA 2RS8A 5G0RA 2PO4A 4HI1A 2KVQE 2R8GA 2YWFA 4LR8A 1BXNA 1S1WB 4ZVHA 2BANA 3W9HA 3OSPA 5K9FA 1XRIA 4F3QA 4LF6F 2Z8QA 1DRZA 5BX1A 2IHR1 2XLKA 3CDAA 4AFFA 4RW6B 3V0FA 3KMSA 1BWEA 3EGVA 3AAWB 4QBEA 1U2FA 3SSSA 4OZJA 3DGPB 4K4WA 2YNFA 1ZOTA 2LA6A 3CM3A 2V69A 4HR2A 3ITHA 3W3SA 2HMIA 5HK4A 3THVA 2DGXA 1VBXA 3OW2R 4DPWA 1IKXB 2J7UA 1FDNA 4JOUA 1LW0B 1RSCA 1S6QB 3DLEB 4O4GB 4BS2A 2EPIA 1DFDA 1RBOB 4OIXA 2QMUB 4BC9A 1HD1A 5J2QB 4G1QA 1WF1A 3KLGA 5EX3A 3I82A 1OHCA 2IPOB 1S79A 1YTYA 5M43A 4B9SA 5IQQA 2E5LF 1HL6A 1VRTB 4CYUB 3GE9A 4OZ1A 1OPZA 4A8KA 1EZZB 1W26A 1H7WA 3EB1A 4OYIA 4PPZA 1ZA2B 2DHAA 2V8VA 2EKNA 3TAQA 1A6LA 2NREA 2QMXA 3QZ7A 2RILA 4ZCKA 1R8HA 4DR5J 5DS7A 2CQPA 1RDRA 4WZMA 2WSCC 4DQRA 3HXMA 2DHHA 1NDKA 3C15A 3MM8B 4OV6A 3LK7A 4KHPF 2FHJA 5KFDA 2D9PA 4C13A 3ZXWA 3D2WA 2H65B 3M4UA 3BM7A 4JNBA 2X1GA 1B70B 3A13A 1LWEB 1M3GA 1VDHA 1E8CA 2HQIA 2IMGA 2WVCA 2RF2B 2DGSA 2KH9A 4Z37A 4ZRTA 3CWJA 5LMNF 2XLJA 3RW7A 2CNOB 5DRKA 1Z2ZA 4KH1B 1ACMB 4ED8A 2R2SA 4OI4A 1F5CA 4YR3A 1S59A 4QIVA 4JUZA 2A0FB 2HSEB 1HARA 2MPUA 4KQZA 1Q53A 1E6YB 1QDUB 3X1LB 4FF2A 2DGUA 4DR1J 1OQ6A 1WC3A 4PABA 1K0TA 3T19A 4AD6A 1YRTA 1IBKF 1ZCKA 4OX8A 3JAMU 3R9LA 5I6VA 3ZM0A 1XMQJ 5KT7A 1Y3KA 2RB7A 4RI4A 4DG1B 2ZITA 4G6VB 2CQ1A 3PZPA 1SH0A 2OOQA 3D6FB 3B4MA 2LDIA 3SSQA 5BUGA 1FGSA 1Q4RA 4ZS6A 3DU6A 4KIAA 3WC2A 3UVJA 2XY5A 3GWCA 2HBZB 2C28A 2NQPA 2XSJB 3MD3A 5D3GB 1NSAA 2GVZB 1JLAB 2P9GA 2VA3A 4LF4F 2FC8A 2SXLA 2DNQA 4DR7F 3PW5A 2AD9A 5HLFA 3VGSA 3LH2S 3R2CJ 2WVBA 1FJGF 1HI8A 3ZTPA 4BCAA 2PE8A 1ZZFA 3B82A 3QQCD 4JI2J 2D7SA 3H40A 1LW2B 3UAGA 5ETVA 1S72S 2X5OA 3M1VB 2C7SA 1DTQA 4DLGA 4F67A 1P31A 2GJ2A 3ILOA 1Y10A 2W9CB 5EHRA 3BSCA 1GX6A 2B9YA 4BWMA 4C9DA 1AFIA 4ER8A 3ISNC 3R5AA 3BYRA 2DYAA 3CGIA 4DV3F 2V5HG 3PRDA 3QIDA 5A8WA 4USJC 2HHUA 1FX2A 2CQDA 3GIIA 1YJUA 3TR5A 4CLFA 1KQSR 1FK9B 1U8WA 5A2QY 4CO1A 2XY6A 4OYXA 3MAAA 4PQUB 2B9EA 4U67Q 3WDOA 3HT0A 4Q0BA 3NGTA 4TLQA 4ZN3A 1B7FA 3L4BC 1QVGR 2RF6A 1JMTA 4O3RA 2YKOA 1HQUB 2F40A 2X3GA 4NCGB 3AWGA 1CULB 1RWXB 4DUTA 3C66A 4X4RA 2C22A 2GMLA 3CD0A 5D78A 1RLCL 4ECZA 2ZMMA 1L3VA 1LOUA 2KI2A 4LVNP 4WK1A 4DSKA 1M1HA 1E6VB 1SUQB 1F1BB 2CJAA 1RT4A 1PTUA 2BYCA 3EM1A 1S0NA 5U47A 5C2GA 3CCRS 3ZMPA 1LWFB 5ETOA 1XNQF 2H1YA 2CJKA 1UMJA 2W2OP 2ZVIA 1TK8A 2E44A 1JBWA 5AXNA 2E5GA 3D3CJ 2RJZA 2XMMA 3R7SB 3OLBA 2A6MA 2YWWA 4X2BA 1K47A 4PXEA 4OHDA 3QSYB 2W24A 3QLHB 1XEZA 2ZEJA 2POKA 2XZDB 3BPSP 1RTZA 2OEKA 4K2JA 1NK4A 4ECUA 2NSCA 4RW9A 1G4US 5KFJA 3OUYA 3LP0B 2C3PA 1U02A 3TJAA 2YTCA 3O8WA 1U1OA 1WDDA 5KTQA 2BVZA 5B0GA 1W2BR 1X7VA 2EC0A 1B0TA 2QBSA 5A5FA 3BGRA 2BQRA 1JJHA 1FKOA 2DCUB 1KFDA 1O51A 3QGPA 2BKNA 3LF0A 3OMHA 3D66A 2LA4A 3AD9C 5F9NA 2BJDA 1Q81T 4NWBA 1VQMS 1XR5A 1VMBA 2JEGA 4F3MA 3Q24A 4K7QA 2Z2LA 5K20B 2CPFA 1SV5B 3QT7A 2PI4A 2VFTA 1NU4A 3NKYA 4DR2F 1QXKA 4UOGA 3BGOP 1OEVA 1V3ZA 2HFSA 1FTCA 3IGVA 2EFGA 4OJGA 3FBFA 3IRXA 3KG4A 3UNYA 3AJDA 1YGUA 3DLKB 4PWDB 1S9FA 1O8BA 5D0GA 3QT5A 2I4EA 1FXRA 1S1XA 1RT1A 3M8QB 1VCTA 4B9TA 1UCNA 2H4KA 3NLCA 2YY3A 3OT9A 1C87A 4DN9A 4UY8T 3ENWA 2ZH4A 2R7SA 5D6GA 2CMBA 1IWGA 1T05A 1ZM3A 1V6HA 3DI6A 2NT2A 1FCAA 4A47A 1RHUB 2HZVA 3R5CA 5B0EA 4J9UE 5KG5A 3NBPA 3HVRA 4R0EA 1VQNS 1HYSA 4I2QA 3TQ1A 2M8DB 1KVKA 4ZLJA 2QLJB 3SI8A 1DTTB 1UJ6A 2YWGA 1C4CA 1GK8A 1VQ7S 3FFIA 4Z6BA 1U1QA 1DLOA 3JQJA 4LQ3A 2BKPA 4L3KA 1T95A 4FS2A 5KFWA 2NS1B 4NYHA 1RTIA 2CJ9A 2WB1D 1TK5A 2L3MA 1D9AA 2EFVA 3M6VA 4DOZA 3PW4A 1G1XA 5EDWA 3HVTA 1QTMA 1SC3B 2CPHA 4M95A 2F1FA 3KHHA 1RWWB 3TEGA 3GR0A 4OYBA 2ALYB 2IM1A 1B99A 2BJ3A 3ZZUA 3GIJA 2QLXA 4FYDA 2YH0A 1TR0A 3IC1A 3BGLA 4LF9J 4M5KA 1OMSA 4H34A 1UWAA 2CQGA 4ES3A 3V0DA 1UVNA 2QA1A 3E01B 1WTBA 1X60A 1XMOF 1U8SA 2HKEA 4N8NA 3BQ2A 1VYAA 4FPIA 1HWIA 1I9SA 4ELUA 3ZFVA 2XCAA 3S4OA 3T3FA 4HKQA 3ELHA 4ECVA 2I42A 1S1WA 2UXDJ 2XM3A 2VORA 2C3MA 2BJ8A 1IQZA 3FKBA 2K7JA 3B8HA 2CNIA 1FDBA 1Z1ZA 1PILA 2FQQB 3F44A 5C24B 3M30B 2KYXA 4RW6A 1URNA 1KOOA 3EYZA 3DGPA 4Y65A 1YG0A 1VQ8S 2Z0GA 1PJ7A 2VDHA 1RUSA 2VOPA 4ILMA 3L3CA 5AE1A 3A5JA 2KFYA 1IKXA 4OX7A 1F6TA 4DCPB 3QCEA 2YKAA 1LW0A 2OUGA 1S6QA 2VB6A 3DLEA 1VJQA 4O4GA 2WBRA 4RJVA 4X64F 4PVGA 1YJWS 3QT8A 4USWA 5BR8F 2QX0A 3W66A 1FERA 2CQCA 4FDFA 3QRRA 2CZ9A 1H3DA 3ZTQA 4ZK7M 1IKVA 1XM2A 1VRTA 4CYUA 4CLPA 2N4CA 2OSQA 1M5VC 3OTBA 3V0JA 3HHLD 3VZIA 1NK6A 4Q45A 2OPPB 5MMZB 4NMXA 3D28A 2E66A 3CMAS 4KTQA 1AYEA 4QW9A 2UU9J 1RJJA 4WXWA 3OTEA 4ZITA 3K8WA 2B9XA 3NGSA 4ECWA 3H0PA 5LSLA 3HP6A 1M1GA 5H1SV 3RB6A 4BJOA 3VF0B 2CM7A 2MDAA 3GFHA 1PTYA 2DO0A 3GCXP 2ZH1A 1T4JA 1LWEA 1Y11A 4P6QA 4TLRA 1PAEX 3GYXB 4A48A 1F3VA 2VBZA 1Q7YT 2RKIB 4DV7J 1PCAA 2RF2A 3AH6A 2DPIA 5GAEI 1NMEB 3DLBA 2BE2A 3KWMA 4DR4J 1C88A 2AV5A 1LWXA 1TTHB 1YIJS 3RGIA 2M2BA 2DNPA 1U1NA 4ED6A 1M1KT 2ZM6F 2MQQA 1IVZA 1M5HA 3S6EA 3HF5A 1E6YA 3ZO7A 2GC8A 5DM6Q 1SKWA 5F0UA 1X9WA 3UPFA 3EVMA 1X4BA 4C98A 1M5OC 3TRGA 5C42B 4DQSA 1EIYB 4WFNQ 4RNMA 2J8AA 2HPUA 3NL0A 2ABYA 4QIFA 2QLFB 3CUNA 1KNZA 1VIOA 4PAAA 5HMXA 1FD8A 1SIZA 3KK2B 2RDDA 1U6ZA 4XIUA 1MLAA 1PA9A 1NRKA 2EWHA 1D8YA 4LF7F 4DQQA 3E2EA 1SC1B 2WB4A 3LAKA 2HK2A 1J5OB 1XQIA 5K5MA 5KFZA 4YP3A 4O3NA 2FLPA 2CNHA 4RKUC 2MLZA 1WKJA 4AL6A 2W7AA 5GAHU 1W25A 2RQ4A 1PBUA 3K5PA 1HBMB 5D3GA 1ZM9A 2GVZA 1JLAA 4IH7A 4B3TJ 2BQUA 5F3TA 3KUEA 2ZC3A 2JVRA 4PWWA 3CCMS 5ETTA 4Y2AA 1FJEB 4PYAA 4JB8B 2HFZA 2JC0A 1V3AA 4DJBA 2Y68A 1LW2A 5BZZA 4QR1A 1MNEA 3KG1A 3BDEA 1FRLA 1NWEA 3V6DB 3M1VA 2YWEA 3PO5A 3J7AN 3WX4A 2I6PA 3HT3A 1AAXA 2W9CA 4Q8FA 3BQ1A 4FP9A 3HVAA 2QBRA 3TUPA 5L1KA 2FTRA 3W5ZA 4NL5A 2W8KA 3DXBA 4CH0S 3U1NA 3AA9A 5E5NA 4DV5F 2DNHA 4R30A 1HQ2A 3CC7S 1CJKB 3GSDA 3NOCA 2WSEC 1R0CB 1P9YA 3NOGA 4M63A 4BUBA 5HSPA 5EWFA 2VQFF 3DM2B 4PQUA 2JFGA 3S3FA 1TUWA 3T1YF 1ZAWA 5A8RB 3NCQA 3TA2A 2UUBJ 3H98A 3LA0A 1HQUA 4LF5J 3MD1A 4YAAA 1F3FA 4ZVRB 2GWOA 3TYTA 4NCGA 1CULA 5AWXA 1OHDA 4R5PA 3O44A 1H7XA 1UW4A 3G6ES 4I64A 2ESBA 1VQ6S 3E3XA 3OHAA 1HFEL 1SQFA 3OBIA 2YH1A 1VRUB 1SUQA 4PXBA 3TA0A 4TU9A 1CS4B 4DSEA 3HHEA 2ALZA 3H4DA 1OHEA 4A8QA 1XXVA 4L72B 1FFSB 4DU8A 2CFVA 4JI3J 4PXCA 2CPDA 4K8RA 4K5RA 4CO0A 5GMKa 2QGFB 4RH5A 4JI8J 1TAQA 1OO0B 3V6HA 4O44A 4YQWA 4OZ3A 4DL0C 3P96A 2BBEA 4Q44A 2F4FA 2UXBF 1WEYA 3MPDA 3TZWA 3MEKA 1NJWA 2XCPA 1ZA1B 3QLHA 3IBWA 1N56A 1WHVA 1QAYA 2F9JA 4A8SA 1FPZA 2DHSA 2VBYA 2BOPA 3PW7A 2GMHA 2PMWA 5ETLA 4DGXA 2OH2A 2CQIA 1VISA 2CVEA 4A8XA 3FNNA 3U1MA 3TVKA 4B3RF 2V34A 2G13A 4WPAA 4FN5A 1J6UA 2DNYA 2VPXB 1ZAXA 2VOOA 3D1HA 1UEKA 4FBUA 2QEXS 1VBKA 1UVIA 4QAHA 2AGPA 1X4AA 1NLKL 3N01A 1S6PA 5A6PA 4EEYA 2EXUA 2W2PP 2WCXA 4RNHA 1SV5A 3A5KA 2VFUA 2C2EA 3PW2A 1WG1A 1KWMA 2VEXA 1GWZA 1SUGA 2ACYA 3M8PB 4ZJOA 2JLFA 1VC0A 2V8HA 2F7VA 5CA5A 5FDLA 2GCAA 1JLCA 5HL7Q 2YKPA 1SH2A 3I36A 2VIHA 2GJFA 2WVEA 2DD8S 2WZ1A 4IUFA 3M8QA 2CQ4A 2WK4A 4DCJB 4DL4A 3O4UA 1NO8A 2ZH9A 1R6VA 1BQMB 1WG4A 2D3ZA 4HTIA 4D3RA 1TKZA 5IXUA 4WIIA 4KGZB 4DPXA 2V4RA 2DIVA 2QJ3A 2ZHAA 2Q1LA 2V94A 3JSMB 3CF5Q 2CJBA 2MGZB 1NHUA 3HHLB 2KHCA 1S6UA 2AJ1A 1MWYA 4LREA 4MJKA 3RU0A 4QPTA 3U7JA 4FVMA 4DI6A 3EAXA 2VZ9A 2DNGA 3WX8A 2YQ1A 4CLYA 4CTAA 1RWMB 1RAAB 1S7HA 2OMLA 1RT6B 2GMJA 2HCMA 2FGOA 4OYAA 3TJ9A 4KR0B 2XMAA 4NI2B 2XWXA 3QIPA 3BQ0A 3ZTOA 3LP2B 1X4EA 2HAIA 2XBPA 3TJ8A 5JVGQ 1UEUA 1ZPWX 3ZV2A 4RHGA 4BHQA 1GAOA 4YHHF 4MBBA 2PDAA 3BKUA 2DBBA 1UEVA 5E3CA 4QR0A 2H4WB 1PA1A 1O5ZA 1YFOA 4AE5A 3W63A 5HJYA 1B3TA 2P8IA 1LFPA 1H6KX 2GIQA 3KFWX 3V5RA 2Q79A 2VTEA 5B0AA 4CNZA 2BE7D 1NKBA 1G7FA 3MMCB 1SH3A 4F36A 2FJEB 3E01A 1X5SA 2HGLA 3TX0A 3HFKA 1JLQA 3EU0A 1XTZA 1ZS6A 4JV1A 4O3QA 1PYOB 1TQLA 1NBEB 3CDUA 4QW8A 2FVRA 1G2EA 1K1SA 2WGPA 3KDNA 2M9KA 2M88A 4H1OA 4PG4A 1GMUA 1SC6A 3MCSA 2ILZA 4ZVEA 3O6QA 2VFVA 3M8RA 1F2GA 3PJ9A 3BN4A 4PR6A 1W7WA 1RABB 2JFHA 4DR3F 2COLA 1FXDA 1RYRA 2AZ3A 2E1PA 3CSKA 4FF4A 2DH9A 3GXGA 3EX7B 1X9MA 5K8PA 1QAJA 4G1IA 4HACA 2QE5A 4X65J 1G4WR 1D1UA 1R31A 3QCMA 2PFDA 3V4IB 1WSRA 4F2SA 1MMLA 4UF4A 1N5VA 1S77D 4K0KF 1S0MA 2QIFA 1RHJB 2ZHOA 2BMBA 4NYOA 1N88A 5D0RA 2BZ2A 2FD2A 3MTJA 2ZOMA 2A8BA 3ONQA 2ZBQA 1CC7A 2AHSA 1LV5A 1OYEA 1YJVA 3QBCA 3UO0A 3N4WA 5KFXA 4ZMMA 4ZIVA 1TL7B 1EX8A 2DRAA 4FS1A 5B0DA 2BZLA 5H9EK 3QGIA 3SCJE 4ICZA 1EHWA 2J0QD 3TUZC 1HLWA 4X4QA 2M5YA 2QCTA 4J9KA 3VR1A 1HBOA 4QU7A 5EN1A 2HHPA 2UVWA 5JVHQ 3BBCA 1FKPA 1VQ4S 4R0JA 4J7CA 2BRLA 4NEZA 3J81j 3VV2B 3N0VA 4CH1A 3T5LA 4A8MP 2IFXA 1LXJA 1QE1B 3RZAA 4DL7A 2I2YA 4A8FA 4PYHA 4LJMA 3GP9A 3DRSA 4X66J 2K1RA 1RGVA 5KFMA 4DPUA 5F3ZA 2OO4A 5IT0A 1H98A 1RXOB 2UUTA 1I6JA 2LXUA 1I51B 2HB1A 3G8SA 1NDLA 3GIMA 4C3LA 3RYLA 4BLGA 4S0MA 5HP1A 2FY8A 4LF9F 3VVUA 4L74A 4TQRA 2KTQA 5KT6A 1ZETA 3SCIE 2J9DA 4UY85 2NT7A 3F0NA 5FLXY 2MMYA 2RQMA 1T03B 3D9BA 1TK0A 5J1PA 5CABA 3PCOB 1AB8A 2L41A 1W2IA 2O1PA 1ONZA 4RKKA 5C42A 2CKWA 3QWPA 1QZ0A 1SL0A 2RAQA 2HVEA 4UUXA 1OPIA 1H38A 3KK2A 2Q6BA 2C2DA 2BJ7A 2CQ2A 1Q6NA 5KFCA 2AYEA 3W7BA 1U1KA 2OKQA 4JI5J 4TYAA 5KA7A 5AT1B 1N5TA 3Q2SC 2F6FA 1SJ3P 1HR0J 2J6SA 4NZ7A 3CCWA 4LRFA 1M5SA 1GH8A 2FB0A 2CQBA 1J5OA 2J5AA 3MMAB 2JWNA 2MXYA 4OYMA 2W25A 1M5KC 4RW4A 1ONYA 1SKRA 4G1PA 3LP1B 4CQ1A 1IJEB 1IR2A 4LT6A 1RBLA 4NASA 1WNEA 3U27A 1ZBTA 1HBMA 4OI2A 1LNQA 4WWSA 4DR6J 4K5SA 3QCZA 1MKPA 1TFYA 4QF5A 2LU1A 4TY9A 4NWFA 2Q47A 3LANA 2J6UA 3IGNA 4J9MA 1N48A 2QBPA 1PAUB 2GA7A 2ADBA 1CQNA 1R6HA 2YPZA 4OHEA 3IP0A 3WQPA 2J7KA 5KFGA 3LWLA 1HI1A 4ETZA 1N33F 3VZHA 4CIOA 2RNEA 2VU5A 3OJUA 4Q5VA 2IC3B 2PT0A 1SL2A 1TFWA 2W7OA 5L1IA 4R25A 2XY7A 5DO2A 2IBKA 4ZVSB 2M70A 4ELTA 1A0OB 2DITA 4B3OA 1FHTA 4C4WA 2V9KA 4I1TA 2KU7A 2RRNA 4TY8A 1FDDA 2MY7A 2MZJA 2ILYA 5IZHA 3MMBB 4CO4A 3G9CA 2HNQA 4IFVA 3ISND 1IWAA 4F0HA 4X4VA 3MCMA 3SDEB 2HLTA 3D42A 3VVTA 4LUBA 2R3VA 1N36F 2HVHA 2B0GA 1S49A 3CEDA 2B43A 3GYNA 4U6PA 1BMQB 5AJ3J 2AQ4A 2FLNA 2BM0A 2W2NP 3WZ0A 3MR2A 4LSZB 1HHTP 3EPGA 3IAS9 2I5XA 2EG1A 2DGWA 1W78A 4ZP6A 3A3PB 1XMBA 2CXEA 1UJ4A 4QWEA 4DR4F 3BH7B 3KNAA 2UUCJ 1H72C 1FO1A 1Q8KA 1CS4A 2J9EA 1RT3B 2FYXA 1SL1A 2YX4A 1U7LA 2R42A 2VG6B 1XJWB 3RBDA 3MUTP 2ZBPA 5EUHA 4USMA 5LMUF 5IWAJ 3PTWA 3Q8UA 2B3TB 2BW2A 3P49B 4DL6A 2PI7A 3SBMA 2OAUA 3PACA 3KLIA 3K8VA 1OY6A 1MMNA 3BBFA 3KUHA 4C7QA 1WWHA 2F46A 5E7OB 3M2RB 3QGHA 3VGVA 3MAHA 4KB7A 2M7SA 4MKAA 4IKAA 4JBCA 3PYDA 2JOQA 3H59A 2KFZA 2K3IA 3M05A 5E3QA 4ZHRA 3R3TA 4D3GA 2HGNA 4QJVA 3QWUA 1RT2B 4B17A 5E3AA 3MZIA 1FD2A 4MT1A 1TELA 3UDVA 1G6BA 4IH6A 3MGJA 1GFWB 2VG5B 4U8VA 5JXSA 3TP2A 1ITPA 1YHQS 3N5FA 3NWGA 1S9EB 4FBTA 2VUGA 5HJXA 3BM8A 5EWEA 3AJ1A 5M2RA 2H9ZA 3GQCA 1TL4A 1H2UX 2E9TA 2E5IA 1Q5YA 5E33A 2YKQA 3M4XA 2Y0SD 2PA3A 4K4UA 3AB2B 4URSA 1UKUA 3NMAA 5T7LB 2R8IA 3NS6A 4KH0B 4GE6A 2KN4A 4ED5A 2AGQA 1RWOB 4H4MB 3J81U 5A6WA 3R5BA 2XTJP 2MKIA 2HAFA 2ZUAA 3WIUA 1TL3B 2B6AB 3BKTA 5CHCB 1OYDA 2GAGC 1BQXA 4ICLB 5HMYA 1YJRA 3NCRA 1V5IB 4F02A 2XI2A 1MROA 1YI2S 3M8ZA 5I42B 2XNQA 4CI0B 3H8YA 4WK3A 1DJ0A 1VLOA 3RBEA 3JSRA 1GTHA 5L9NA 2MGZA 3EZ5A 1KRPA 4ERCA 2KKHA 3PEJA 2HHTA 3HHLA 4DPYA 1YLXA 5LM7E 1NO6A 3G96A 3V0EA 3IR7B 1MWZA 2FGCA 1MG7A 1EEHA 1Q78A 5KG1A 3NGRA 4J5OA 1XNRF 2XYHB 2W9BB 3BO2A 2D74B 3O5XA 1XC9A 4HJQA 3HJFA 2A10A 2CM3A 1RT6A 4Z7CA 3D6TB 3W9IA 4J9PA 3J7ZT 4IG0B 4NI2A 1YTSA 1U2RA 2FVQA 2DGOA 2ZDOA 3LP2A 2DHXA 3M6XA 2E1MC 4C8NA 4F4KA 4JI8F 3HK2A 3CCES 3H90A 3DC2A 4CO3A 1HNWJ 5KFOA 2OD4A 1IBKJ 3DYAB 2V0NA 1XXPA 5KFPA 1Q0NA 3N6NA 4ECQA 4X4PA 2MZSA 5HVHA 3QSIA 1FQ1A 1ZZNA 1U47A 4WFAQ 3GYGA 2IMWP 1UZHA 2VPWB 2DISA 3TQEA 4CCHA 2G4BA 2B4OA 4U7UD 1V9OA 2HIYA 1GEHA 3BSNA 3I6PA 3CT9A 3CTRA 2BUNA 4RW7B 4U9RA 2BJ1A 2JFDA 3UD3P 3DDNA 4OYWA 2FJWA 3VAHA 2BGEA 1KDNA 1Y5LB 1DBDA 3S1TA 2CMAA 4F8RA 4ZJQA 1HIYA 1G4CA 2Z2YB 2IYIA 5H9EJ 2UV8G 4LF4J 2F70A 4WIQA 4EI2A 2QO3A 4ANCA 4DR7J 3KJFB 2HZCA 2B4SA 1IBMF 3M2VB 4NA2A 2XJAA 3TUJC 1RAFB 4PG5A 3P5TL 1T7PA 4N76A 1FJGJ 3LPYA 4CRJA 3PS5A 2VDIA 3TOQA 1EEOA 2HBQB 4USUA 2RUSA 4QAPA 1I94J 2ATCB 2KYZA 2JEIA 3PW0A 3CDWA 2VQEJ 5AE3A 3GG0A 4ZIWA 2QA2A 2CNEA 2V63A 2YXLA 2BA9A 2RQKA 4OZ2A 1YWXA 3GPAA 3VGTA 3BZQA 5KADA 2HY3A 4RLEA 3IXQA 5K14B 2NXUA 1WI8A 3OPKA 4DV3J 3A8IA 1BQNB 2GV1A 3EICA 4NLSA 5J2PB 4H54A 3MAQA 2OTLS 3QKPA 1TL7A 2AW0A 2VC1A 3MM9A 3TA1A 4Q2MA 3TO8A 1YWFA 4FF1A 3RGOA 3T9ZA 1HWJA 3GG1A 4F04B 1JLEB 4A4JA 2HFOA 2W01A 1OESA 4XAKA 1N54B 2D9OA 2J17A 3E51A 2UXCJ 2NZ6A 1JB0C 2PIIA 3QCLA 2JHEA 1X0PA 5GAGU 3OXGA 3OV7A 1JJ4A 3J7YU 2YNGA 1ECVA 5CAAA 3TWZA 5KA0A 2I6JA 3S8SA 4Q43A 4RUAA 3RGQA 3CJKB 1P3DA 4EO6A 2ZH8A 3PKMA 5F8LA 1XNQJ 2W2MP 3RAQA 2BQ3A 1NSPA 3M8YA 1CLFA 3FMWA 1YGYA 3VAJA 2OD6A 1Q95G 3W9JA 4TYBA 2X1FA 2GP0A 3MR7A 1AW0A 2XGQA 1UVLA 2JLGA 1S4EA 6AT1B 2GZOA 3D1QA 2AU0A 4UZCA 2RSQA 2LQJA 1T03A 2C46A 4USHA 1X8DA 5HDEA 3W60A 2AF6A 2X7IA 3UNGC 3D0HE 3W62A 2BJEA 2Q43A 4KV8B 1S57A 4YEAA 3ET6B 5J2NB 3TUIC 2NYHA 1R7IA 2XYGB 1OS5A 1XBWA 4QWCA 3H5XA 1CBKA 5A5EA 4Y3CA 2GHWA 3M32A 3OJSA 4I2PB 5A76A 2AJ2A 3CCUS 3FEXB 4HHJA 2CPEA 2MY8A 2AZRA 1WC6A 5C25B 1AZSB 4EYHB 1REGX 2QFIA 3I4PA 1VFJA 3GMGA 2HVLA 3RR8A 1NH8A 3DMJB 3IBCB 1P1TA 2ZDPA 4MIBA 2MHEA 3R6LB 2U1AA 4OLOA 5IFMA 4X65F 3MMAA 4ZOSA 4AXIA 5BZXA 4DV2F 2NCKL 2F6YA 1G7CB 4E0DA 1YZ4A 3AJ2A 1ZM4A 3LP1A 4PEOA 1HWKA 2MJNA 2DGTA 2RDIA 4RUHA 2C2MB 4WYWA 4HDHA 2FHOB 2Y9HA 4GVBB 4R8UB 4EZ9A 2HNYA 4LVOP 1OY8A 4PWUA 3IAM9 3HSJA 2DNLA 2DXPA 4YS2A 3AT1B 4WE1A 2BV3A 2D41A 1TKTB 2L9NA 4HTJA 2JH3A 1Q79A 3QRPA 1SVDA 3CJ8A 1NHKL 2AM2A 3D67A 2WVFA 4JI1F 2LXIA 1NK0A 2W9AA 5DDRC 1D0EA 2OPRB 1T11A 5KFUA 1NNYA 4ZJLA 4FKXA 4WU3A 3RAXA 2QDMA 4ECTA 3M7VA 3THTA 3FSIA 1KAKA 3J7A1 3ZZPA 4O0NA 2HXPA 1BY9A 3Q8SB 1HNZJ 2BABA 1S1VA 1YJTA 1TVRA 4G3IA 4ILLA 4WP8A 3MMBA 2I38A 2CPYA 3BGUA 2CPXA 3IG1A 3ZM1A 2OPQB 3DKDA 2J9DE 3I96A 1S9GB 4WJBA 3JYTA 5KAKA 4ITSA 5IT4A 3P5BP 2DRDA 1JLFB 4OHLA 3U96A 2Z30B 4FKYA 2RDJA 1I3OB 2RVJA 2UV8A 2KO1A 2IRUA 1VIXA 4H4KC 3KLFA 4A8YA 3ZM6A 2FY1A 2V4QA 2D1CA 2V9WA 4CLTA 3EMUA 4N7TA 3RW6A 2G0CA 4AXJA 4M5DA 3HJVA 2ZC4A 3QCBA 2BM1A 1XMOJ 1JXVA 4O0IA 1K8AT 2DTJA 2KDOA 2GC6A 4B3MF 5IM0B 1WF2A 1K73T 2QDCA 1J4XA 3ZM5A 2C3OA 2FC9A 5GMDA 4ZPBA 2CJZA 1O0PA 1CSJA 1FRJA 5CZVA 4QWDA 4MAKA 2F71A 1UVJA 2G2ZA 5FJ4A 3KHGA 2JFFA 2JX2A 3QO9B 2BX6A 1RLDA 2VG5A 3OTOJ 3PFEA 2I3RA 5L38A 2H5JB 5DQHA 3Q8QB 4M5NA 3DOKB 4DUYF 3RRHA 3I55S 1FF2A 5KT2A 1S9EA 3G87A 3L7UA 1R0BG 1QD1A 1EB0A 2XZTB 1RU1A 4LR7A 4X64J 3MM5B 2N82B 3PHTA 4ATNA 3P45B 4C48A 3SSRA 5BR8J 4NZ0A 4PQAA 4DV6F 1PSDA 2ERRA 1RT5B 1J27A 2KZMA 2R8KA 3CCQS 3EVOA 4GC6A 2WW8A 4JI0F 3FRZA 3KLVA 4J90A 4YDDB 4Q2LA 3ILJA 4WFZA 1RB0A 4H4MA 1QUPA 2LEBA 1UAWA 1U48A 3V6JA 1BE4A 3R27A 1TL3A 3AB4B 3SR9A 1N6QB 4JI7F 3POTB 5G4DA 2F65A 4ICLA 3O5TB 4DWIA 3MECB 5I42A 2DT9A 2H4VA 1TKDA 4OYPA 1YPTA 1JKHB 3QCJA 4TKTA 2F9DA 2X3DA 1VLYA 3I0SB 3CCJS 1OEOX 1AT1B 3WHIA 2VBWA 2GNKA 5ETPA 1J2VA 3SCKE 3BH6B 3D44A 2QC3A 3KK3B 2YBVA 3HKZD 4QDIA 1FEHA 4GRYA 3BF4A 3BPDA 5L46A 3NNHA 3D0GE 3DOLA 3QT6A 2HNPA 1RTJA 1C2PA 2CFXA 4FVCA 5KOWA 2AMCB 3MPUB 2Y66A 4UZBA 1C1CA 1YDLA 2UUCF 5E3RA 2EK1A 2CZ4A 4RNOA 1K44A 2WONA 2W4PA 4O23A 1JXEA 2BXJA 1TUGB 1B64A 3MEDA 3FSXA 3FBEA 4IG0A 1KR4A 5EWGA 4XDCA 1U1RA 5IWAF 3AOAA 5KFBA 4N56A 2AEMA 5HO4A 3SFGA 4CLSA 1LQFA 1UZDA 3GV8B 2W8LA 3DYAA 3KJVB 1JJ2R 4ZP7A 1T94A 3UD4P 2VPYB 1LQ9A 3DDKA 2FLOA 4C11B 2IAJA 1R0AB 1C4AA 3Q2TC 4QIGA 2GIRA 2Z2MA 4P10A 1KHVA 5KG7A 1TV6B 1VC5A 2HHSA 2L9WA 1VQLS 4LF7J 2UVUA 4M5JA 1X31C 3I0RB 1FEEA 3NNCA 4HHUA 3R5JB 4XO0A 3JQMA 2L08A 3R1HA 2R2TA 3CO0P 4X4OA 4YB1P 2G2OA 2B07A 5D4OA 1NJIT 1ZC0A 4F26A 3EE3A 1SBRA 1S76D 3I9ZA 5T41A 2KL8A 5K23A 1ZCLA 3KLEA 2QFJA 4NEYA 3FZ2A 2ZNZA 4LMZA 5I4MA 3AXMA 1CJUA 1EKRA 1WC4A 2E0TA 4IQXA 3BDPA 2FJNA 1FNXH 2G0JA 1RAOA 2HRTA 2DXDA 5DG8A 2VC0A 2ZH7A 2FVSA 4QU6A 3BKFA 1RP5A 5KG4A 1NUEA 2MZTA 1NZ8A 3IN5A 1DQ9A 1U25A 4DV5J 3FCVA 1TL1B 1C0TB 2PA5A 2V8PA 3UDCA 2HBRB 1PC4A 3ZL8A 3QAUA 1CG2A 1VK3A 4O3SA 3D9CA 2W4DA 5BXIA 3RO1A 3H42A 2EC2A 5J2PA 3LGNA 1T3NA 1VBYA 4KGXB 2VQFJ 3LO3A 1OQ3A 2N4DA 4QYRA 2RHSB 1REVB 4KAIA 3T1YJ 1Q6SA 2DH8A 2CNLB 3MFIA 2B8PA 1HBNB 1Q8LA 5KFYA 2APOA 3LGMA 1VQSA 1YTNA 2B5JB 4QIWD 3GV7B 4F4ZA 3TNVA 2H02A 2YPYA 4DSIA 4L73A 3IO1A 1UA1A 1NPRA 1U4BA 3EGZA 3RB0A 2OC3A 2LQ5A 1UA0A 2AGOA 4DX7A 1S10A 5CH7B 1JLBB 4MYTA 4ES2A 1JBVA 2LQ8A 4K59A 3CJKA 2YKMA 1X0FA 2W2QP 4CM2A 4DSJA 2CIMA 2JJDA 2Y1OA 1RHKB 3EPIA 3G6VA 1HNWF 1R8AA 4ZPWR 4DSFA 2JLEA 4C2MA 1RACB 4P71A 4DV1F 3FVYA 2QSWA 1N4LA 2C1EB 3VAFA 2P5VA 2J76E 2UXBJ 3Q83A 1S1UB 4FYVB 3NWRA 4DSLA 2LVWA 1MN9A 1T49A 3DRPA 1P9QC 1N5SA 5E0OA 4F4XA 2OEMA 1VR6A 3QAEA 2HHHF 2C2NA 1HNVB 3AQPA 4QCLA 5C7PA 4X84A 5J2NA 3CULA 2ASDA 3HHKA 1NJZA 2ZZNA 5CCMA 4B3RJ 2AYGA 1QUVA 4I2PA 4TU7A 2HG4A 3OL7A 4DZDA 2OEJA 3GFXA 3TZYA 2VICA 1D8ZA 3EXCX 3CNQP 4CLKA 3Q8YA 1AZSA 2HS0A 1DAXA 1JX4A 3IS9B 3TAMB 1ELOA 2LQ9A 3G8QA 3J7Z5 1JJCB 2GGPB 4DLEA 1YBUA 1KLMB 1WUUA 3FSYA 2AJ4A 1RWUA 1I94F 1CJTB 3KLHA 2GC5A 1AFJA 3HD1A 4DCOB 2VQEF 3VAIA 2XNRA 1UFLA 1JLGB 5D4PA 4AL7A 1CJVA 3QYYA 4R0SA 1NSQA 3PR4A 5B08A 4R8UA 4LSLA 2FJAB 5L1LA 4EBCA 4Y14A 2PEBA 1H74A 4OYOA 3MM7A 3EZZA 2H54B 4BC7A 3F9BA 4HRFA 1RQ0A 2Z56B 3I5BA 2J16B 3HD2A 1A9NB 4MK8A 2WAQD 3K58A 3D5MA 3AXKA 4DGPA 3ZC4A 5A8KB 4OHHA 4ECSA 5KG3A 2HNZB 2WRMA 2HIQA 3C6TB 4EBDA 3BSAA 3CCTA 2OPRA 2O66A 2AX1A 3C46A 3L7PA 5HN0A 2UXCF 4X4NA 2OZ5A 1Y5NB 3V4MA 1QLNA 3K5MA 1IKYB 2LXFA 2B51A 1C1BB 2M52A 4KKOB 1LFWA 1F9HA 2OPQA 2G1DA 5KFNA 1S9GA 3G82B 2YQ3A 3SCLE 3V0GA 1IBLF 3IR6B 3K17A 1C84A 3CMQA 2YNFB 4Y2KA 1Q16B 1RKJA 2HHXA 1JLFA 5GAEU 2ZD1B 2MKCA 4OHXA 2HMIB 4YHHJ 1C85A 2CNGA 2HQGA 3L09A 4LFAF 3ADAC 4GE5A 3T5HA 1FRHA 3CD6S 5KFSA 4K4TA 1RAEB 4CO5A 3Q0AA 4LR9A 3DN9A 4WTYA 2LDYA 2XMWA 1RK8A 1J5EJ 3KLGB 2L9DA 2XWYA 4DU7A 3NRSA 1UL3A 1FWKA 3ZTSA 5IT9U 2XB2D 4ZPTR 3I80A 4V1Ak 3KHLA 2CPJA 3W2WB 5IM0A 4XDDA 4GFUA 3ILLA 1N52B 3IMQJ 3S3HA 4YR8B 4LFCF 3AQOA 4W98A 1N5YB 3M8SA 2NR0A 3RR7A 2B3OA 3FDSA 4GWFA 5J1EA 5KFVA 4DR3J 4LRAA 4L76A 2QL5B 2R8HA 3W5XA 5K25A 1NKCA 2P6XA 1NEEA 2F6ZA 2AJ0A 4XPEA 2O67A 1GT8A 2XMKA 4CP5A 1XK8A 2ZH3A 1ZM2A 4K0KJ 4Y0FA 4DL3A 3TZXA 3ZZ0A 1RISA 2JJ4D 3L7OA 2PI5A 5FD1A 1Q1MA 4IDKB 4KO0B 5H9FK 4DFJA 3MM5A 4LQ9A 3CIZA 3LJ8A 4NCBA 3UDEA 1LEOA 1U49A 1BWVA 2ZOFA 1RT5A 1PJ6A 2DHGA 1RBAA 2BKOA 4ECYA 4DF4A 3Q8VA 3SV3A 2DXFA 2V8GA 2UP1A 4X62J 1FRKA 5K8NA 3GFYA 4IO1A 2YNHA 1N6QA 3POTA 2LMIA 2MJUA 5D0HA 3ICLA 5IOLA 2A1BA 2C3YA 5ETRA 1HNZF 2IBOA 2ACMA 1RT7B 5F8JA 1SIWB 2AYBA 4HL9A 3SIPB 1RCOB 1JKHA 1G3OA 4LBHA 3CDBA 3U02A 5HVFA 2HLUA 3GZ7A 2XS7A 3HM9A 4M5LA 4MKBA 2MLXA 2WJPA 2HQDA 4C12A 2AZ1A 4B9UA 1X4FA 1N34F 2D3OR 3KK3A 3NY0A 2FVPA 5K24A 5IC4B 1M5PC 4DL2A 1VQPS 4PUOA 1FRXA 1LK5A 3CC4S 4WOHA 3W2VB 1X4DA 2XSFA 3HLUA 4B02A 2LEAA 2H5EA 5KT5A 1FX4A 1HNIB 2HFVA 1PH0A 4JV5J 3OQ2A 5CYMB 1XERA 1YBAA 1JQGA 3I56S 3MEEA 1P6TA 2CPZA 2XMUA 2FLLA 2RT3A 4NLPA 1X24A 1S0VA 2Y1IA 4IOBA 1DTQB 2VHGA 2R4FA 5KFLA 1L8GA 5HROB 1UVKA 5F8GA 3ZM2A 4EU0A 3KJVA 4GFVA 3S4EA 3MXHP 1JF7A 4JYAF 4C11A 3DNCA 4ZA1A 2FZKB 2QV6A 1H2TZ 2XO6A 4UQGA 3JQKA 3LW5C 1PJ5A 4ETXA 2PEHA 1QY7A 2BRKA 3K5NA 4MK9A 2MTLA 5CQGA 2JRSA 2VF3A 3MAAB 3OTOF 1UJ5A 2K8GA 2I75A 2C3UA 2F00A 3H20A 3RBXA 4QUNA 4IOAQ 5KA2A 1P15A 3M9MB 3ZTRA 1VBZA 5EGYA 2Z58B 1YTWA 5KACA 4KGVB 1T48A 1WOOA 1RADB 4RWXA 2GHVC 5J2QA 1SJRA 1GX5A 3K0JA 1TMJA 2MKHA 3MHYA 2LQBA 3DLLQ 1YBTA 2I6WA 2R7QA 3W8PA 2IVFB 3E8OA 3G2XA 1RT4B 2MQNA 1EJ7L 4KJIA 2EKYA 3CJRA 4OLPA 1N33J 4I6WA 1B4SA 4QWAA 1UW9A 1GXUA 1RTDB 4F0MA 2OTJS 3M2UB 1EAYC 2MKJA 3OL8A 1TL1A 1C0TA 5EHHA 2BDPA 1NCLA 2H03A 4C3KA 4DV4F 1S7IA 1IM4A 1U09A 2LU2A 1NB2A 1IM6A 1Y3JA 3N9UC 5K22A 1FFGB 2X1BA 4JP8A 3V0IA 1GQEA 3OD2A 4I8NA 1S0OA 3CD7A 3MM8A 2DEJA 4RI5A 5LXQB 4F4AA 3QCKA 2QL9B 4KC5A 4YY3F 2J7WA 1G1GA 3LGHA 4IOCQ 1N36J 1DURA 1F2HA 2VJVA 1Q6TA 3G71S 2MSTA 3I4HX 2B5JA 2HHQA 2ZBIA 2I6MA 3FZBA 1WHXA 5F41A 4KHRA 1JWWA 2YKNB 2ZN7A 2MZ1A 2F5GA 3RUBL 3TAPA 2CNNB 5F8IA 4DZ6A 2KM8C 2AEFA 4Y2MA 3OSNA 3BLUA 2XGPA 3CPWR 2EFPA 5DLFA 8AT1B 4WFBQ 4FYWB 3PYEA 3CJ3A 4M5IA 4AQYF 5LMUJ 3MOWA 4S0GA 3SEOA 2KXHA 4JI6F 4P2XA 4DF8A 1NDPA 2AM1A 1KTQA 1S1UA 4DG1A 2FJDB 4IO9Q 1GMWA 1KS2A 2ZJQQ 4K4YA 2KG0A 1YJ7A 2OMOA 1N0UA 1S1XB 3BO4A 1RT1B 2GCFA 1D9FA 3OVAA 4WU2A 3QCHA 1U2CA 1RA7A 4ZCLA 1SJQA 3R1LA 5DZ7A 2C2RA 4DX6A 4PG6A 2XSJA 1T05B 1T9YA 2MQ8A 4MTPA 3CJQA 4KRWA 2ATLA 5HVGA 2H5IB 3NBPB 1LWCB 3IS9A 3TAMA 2GAHC 4ZP9A 3Q8PB 4CLZA 1HYSB 1LKZA 3PEHA 4DV0J 1GG4A 4M8LA 4UAGA 4QWBA 4P73A 5IC6B 2GGPA 1VQKS 5KFKA 3FFIB 4DDFA 1HMVB 1MN7A 1KLMA 3HMJG 1KQKA 1CJTA 1HW9A 2DR9A 4LBPA 4OZLA 4OJ1A 4ED0A 1JLGA 1FA0A 1F5BA 1YJ9S 1LK7A 2CJYB 1UFKA 3QCNA 4J9OA 4G65A 5I3UB 1RHRB 4J51A 3TVZA 4IRKA 4F4YA 2HS3A 1U6FA 3BEGB 4I69A 1FK9A 2BEFA 2J16A 4CLUA 3I32A 3G6XA 3OL9A 1HWUA 3G4SS 3PY8A 4CVMA 2R7TA 2IA0A 1B0VA 3ZZOA 1HHQA 2DO4A 1U1LA 1WC1A 3C6TA 1WEZA 5KA8A 3I7ZA 4GKKJ 1KVJA 5DDOC 2JEJA 2QZ8A 2IVMA 4E98A 4GKJF 1NDCA 3EDQB 4DUZJ 1PTTA 1OJ4A 2J9CA 1XNRJ 1IKYA 1U6BA 1C1BA 4KKOA 1OEMX 2R0BA 3K59A 3OL6A 3MUVP 1X4CA 2PQ5A 9ATCB 4D3HA 5HQLA 1E6VA 3G82A 3RJMB 4CNYA 4EGLA 3CXCR 3BYPA 5ETSA 1SPBP 1WSVA 2ROGA 2PMHA 1HD0A 4ECRA 4NXNF 5B09A 3DDIA 4IQMA 1LWFA 3UDLA 5DQGA 1EQMA 5HAOA 2B4VA 4NLYA 2QSFA 1Q8IA 4WZQA 5D4NA 2XMTA 3OFEA 2ZD1A 1FESA 4OV1A 4NXMJ 1WORA 3HSDA 3T1AA 3VHQA 1BZCA 2CZVC 4IG3B 1Z2LA 2YNIB 1R8CA 2PA8D 2UZAA 1N8RT 5HBMB 2WBMA 3MURP 3B4DA 3QJPA 2VTDA 1VQ5S 1L3SA 3O1LA 5GADI 3GXHA 3LP0A 2DXEA 2DGQA 5H9FJ 4J9QA 4RNNA 5LL6d 1TP7A 1IKVB 2YX1A 1WC5A 1SQGA 3PRVA 1FJCA 3W2WA 2P9EA 5GMEA 3R2DJ 4ZVQB 3T9NA 3IWNC 5F0WA 1SKUB 3N79A 2DKOB 1N5YA 2N7YA 1HW8A 2GO9A 1H73A 5AXKA 1FNOA 4CM0A 2N3OA 2HQ3A 2F6TA 2DR5A 3MOZA 1VQYA 2QYCA 3K5OA 3KJNB 1IBMJ 5BYQA 4PYDA 1LARA 3IWLA 1WKLA 2NZ4A 1N5QA 2DGVA 3LOUA 1W7KA 3H4BA 2QBQA 4DQPA 2KB2A 2HWTA 3DLGB 5KG2A 4ERDA 4IDKA 1QAIA 3DLKA 4PWDA 2DK2A 1YZ6A 4KO0A 4B04A 4AT1B 3F81A 1PG5B 2ZH6A 5FIIA 1PO6A 1R3NA 2BE2B 3HZEA 3KJQB 4UOFA 3DLJA 3CDEA 3PR5B 3H25A 4Y28C 3D68A 3EXYA 4ZN1A 2V68A 3L9ZA 5LJ5Y 1Q1KA 2B4PA 2EFQA 3GB0A 2FPHX 2EBGA 1RT7A 2GFFA 4ENOA 3KMQA 1DTTA 1NJXA 5KG6A 1IXKA 7FDRA 1FT8A 1Q8BA 1RWPB 2XULA 2Z4PA 3D54A 3KG0A 3GU0A 2ZOGA 3VCDA 4RH9A 2IDLA 1NKEA 1UAGA 4IR1A 2MYFA 4H4OB 4ID5B 2IM2A 3HFVA 4JMKA 4QR2A 3W2VA 3QCGA 2HNDB 2HC2A 2EK6A 3QZ8A 2VV5A 3Q23A 2E7VA 1HNIA 5CYMA 1Y00A 3DRXA 2HS4A 3T1HF 1V5VA 2QLBB 1J5EF 4ZPCA 1P1LA 4C97A 2DNMA 3UD5A 1QM9A 3ILIA 5FLXU 3MCNA 3C2PA 4KY3A 2CG4A 2VBXA 1ROFA 5HROA 1YZ7A 2RUGA 3QJLA 1GXLA 2WVDA 2MSSA 3F9AA 2JEFA 4ED3A 5LSOA 2VFSA 4KGKA 1OEUA 1I57A 3PNIA 1WCHA 1QVFR 1L3KA 5DGAA 3G86A 2EFOA 5C24A 3M30A 1YVFA 2Z2ZA 4LF2A 1FNMA 1NSKL 3K5LA 3Q22A 4OZ5A 1PTVA 4DV2J 3MCOA 4D3QA 4R0TA 1Q6JA 4TVVA 4RWWA 1SB6A 1NHVA 4MIAA 1SI9A 2DR7A 2AJFE 4OYZA 2RH3A 4B3SF 4OMFG 4OI0A 2C2OB 3ETOA 3S7RA 5L8RC 2OJ3A 4R5PB 1RHQB 4QUMA 2VOSA 4NCAA 2CWKA 4DN0A 2OIHA 2Y8WA 2IVYA 3ZM3A 4ZLLA 4X62F 1X4HA 4JI1J 3NCPA 2CQHA 3MOJB 3A1YG 4F0KA 2HQCA 3JAMY 1RTDA 3BV8A 1SJFA 3S01A 2IYGA 2G2YA 3M2UA 4ZIYA 5RUBA 2OPPA 3KNGA 3P4UB 1A5YA 3GJRB 4O44B 3G8TA 3CMES 5DDPC 1KEKA 4IYQA 1TL5A 5DZ6A 1RKIA 1IR0A 1RYSA 5KFAA 2YVSA 2YWHA 2B7BB 1P27B 2CJQA 4BWJA 1IUJA 3JSYA 2HRYA 4DX8H 4DPOA 2UUPA 3T6BA 1GQQA 1WDTA 4J37A 3KYLA 3UE2A 2H51B 2ZZTA 3CIMA 3NG8A 3CO9A 4GO5X 3KK1B 5KT3A 2Y8YA 2RKIA 4KFBB 1S99A 3CW2C 2YKNA 4ZPAA 2VONA 3D3BJ 3T6JA 4JV5F 3N28A 1N0VC 4B9LA 1L3TA 3FGVA 2ZKUA 1S6PB 2XHWA 4UT4A 3PHEA 3TZZA 1JK9B 5CYJA 1FKAF 3VWSA 3F41A 3G6YA 4NLGA 1I9TA 6FD1A 1WF0A 1PYSB 1B7YB 1FXLA 3N5BA 2W4CA 3R97A 4B3MJ 2AIRB 5FDLB 1JLCB 3HN7A 3R6GB 1U1MA 2JNJA 2NXEA 3KUGA 3ISZA 4ZKAA 3C3LA 3UWTA 3QCCA 3ZZTA 2ASJA 4JI4F 5KG0A 1RCXB 5IQ6A 1C86A 1TKZB 2M0GB 4EWTA 2LCWA 2P2CB 4XTTA 3MEGB 3SQGB 2FJVA 1FVSA 1LYVA 4K50A 3UN5A 1QSLA 1KONA 3RBZA 4IRCA 4DUYJ 2XO7A 1LWCA 2O3DA 2GW8A 4ZLNA 4USKA 5CD4A 4M5HA 4CZCA 4RBVA 1GFYA 2KZZA 4CTAB 1HMVA 4DV6J 4P7VA 3BSOA 3V6DA 5K8OA 1WAXA 4NLUA 4JI0J 1D5RA 1Q6PA 1NZAA 3HI9A 3A8KA 2GJTA 3D4JA 2QTWA 4NLRA 1T9XA 3QIPB 1TKXB 2OLWA 3NNAA 3MTKA 3HCXA 1FWPA 1FTRA 2NTAA 4JI7J 5I3UA 3OR2B 5L9XA 4MYUA 1CJKA 2CPIA 4KE5A 2XQCA 1KN6A 3JTNA 3ZZYA 1FVQA 5IV4A 4QBUA 4DX5A 3ENAA 1NPKA 5B0CA 2EG2A 3DM2A 2ZJPQ 4XPCA 1XR7A 4YUDA 4RZRA 4I6YA 5B0FA 2EW9A 1JLQB 3EWGA 5A8RA 5IT9Y 4NYZA 1GXTA 1EQ0A 4HDGA 5CZXA 2ZFHA 4ELVA 5CYQB 5LXRA 3IA0A 3L95X 2B7CB 3AFGA 5L39A 2ZVSA 1VRUA 5BJRA 1JNZB 3H7HB 1ZTWA 2RRBA 1R27B 1ULRA 3OR1B 1N32F 4YR0A 4LFBF 3FRYA 5D15A 4RO0A 2DNZA 1NM2A 4HT5A 2PC6A 4HACB 1RI7A 2ZHBA 3OLRA 4FPRA 2GIFA 4PPDA 4OHIA 1KVIA 5DQIA 1QAXA 1NJYA 1T9TA 4IG3A 4P75A 2V2QA 1Q5VA 1X5OA 4MFBB 4N77A 2YNIA 3VTIA 2WHOA 1BHNA 4KHMA 1XIQA 5D4LA 2RRAA 1HKAA 3H2UB 4EUVA 1NH7A 2NXJA 5HBMA 4F25A 3NRBA 2PMZD 3GIKA 4DFPA 3FEZA 3UW1A 5KABA 4DMZA 2H48B 1ICEB 2DRBA 5B0BA 3BLTA 4FYYB 1VQOS 1L8KA 1WOPA 4C0HA 3C6UB 2IA6A 1TAUA 5K9WA 1JXLA 1UP1A 1ZPVA 3V81B 4F3OA 2DNRA 2YX7A 4DV0F 3F73A 2AEJA 1ZH5A 3CVKA 1TUVA 2QRRA 8ATCB 1HBOB 2KFNA 1Q7LB 5L1JA 4IR9A 2Y96A 1T02A 5HI7A 1FKPB 1S48A 1RPMA 2FVCA 3I9V9 3AWFA 5DDQC 1XBOA 3GR1A 4GC7A 1RAJA 3J80U 1KKHA 1IBCB 2CA9A 3DRSB 2GO8A 3M8PA 3EZOA 4NLVA 2K1RB 1F5AA 1QSYA 1VK8A 4UOCA 2HFNA 7AT1B 3DLGA 1YJNS 2I5JB 5ADZA 1X5PA 4HH1A 4NA3A 4Z7YA 5E3PA 2HFUA 1U45A 5HP1B 1D09B 2H4GA 4UOHA 1BQMA 2J0SD 1ZZWA 2KXFA 1BZHA 3C16B 3KOAA 3JSMA 2DPJA 1Y7PA 4URGA 5K8MA 4GKKF 1FPRA 3B6BA 1EENA 1WJ9A 3DXSX 5KOXA 2AKWB 4DUZF 3W5YA 5B7WA 4KGMA 2DNOA 3V2UC 3QCIA 2DEIA 2OFHX 4TNOA 5AE2A 4EYIB 2V2KA 4B08A 3IM8A 4YB5A 1ZTTA 2LP4A 1B0PA 1KTVA 2XZWA 4ALZA 3K57A 4OI1A 2VEWA 4DHVA 2ROEA 3F56A 4UUWA 4ZCIA 4RW4B 3D6MB 4NXMF 4H4OA 2FDNA 4ID5A 5JMNA 2WTFA 4IH5A 2HNDA 4DV1J 3KDOA 3O4SA 4KT0C 2XYPB 2Y0BB 5CXTA 3D0IE 4Y2CA 4OZ0A 5BYRA 3Q8RB 2Y2FA 2ZH2A 4KSEB 3GONA 2JZ5A 3HKWA 3MMCA 1H2VZ 5GVQA 2R7OA 1BZJA 4YOEA 4KYRA 2KT5A 2KRBA 4J9RA 2M8HA 3A3OB 3OFFA 2HHHJ 3GCWP 2CQ0A 4OHZA 4P2FA 4W4MA 3Q89A 3PKYA 1CPZA 2CDRB 2LYVA 2UUAJ 2MQPA 3FUYA 4IFYB 1NB7A 3PYFA 4YN3B 5LT5A 2OELA 2RMLA 2E9RX 5HMWA 3PIOQ 2E1CA 2QA4S 4QIEA 2QG9B 1HBUB 3PO4A 4WF9Q 2PSZA 2V6AA 2D3UA 2CM2A 4NLDA 4LIWA 4B3OB 5F8MA 4U96A 4DR5F 4TY8B 2O01C 3AD8C 1FRIA 2GQCA 4RUBA 4USVA 1NZ7A 3V4IA 3GFZA 1RXDA 4IFVB 1YX2A 4K4XA 2HWHA 4F2RA 1D3WA 5M2UA 4J9LA 2GVDB 2MLYA 1CQMA 3WC0A 5K9VA 2E1AA 1GNKA 3IM9A 1HNXJ 4KPYA 4USIA 4A8OA 1SC4B 3LWMA 2CMCA 2SHPA 2VFRA 4CLLA 2HQFA 4FXDA 5F9LA 1OSCA 2Y67A 1JLNA 3CJTA 3AODA 2ZWPA 2XMJA 3MR6A 2IJFA 4MMOA 5D0EA 1S1TB 2RE1A 3R7BB 1S4FA 2F6VA 4HV4A 2J0WA 2CNKB 1U0HB 2KJWA 4DR1F 5ETNA 4ANEA 4CVKA 1CEZA 3UR3C 3OVSA 4NRUA
chains in the Genus database with same CATH topology
1RT5A 4AFFA 1KC8T 1ZBTA 2DHGA 1HBMA 4OI2A 2Q66A 2PFFB 4NA1A 4RW6B 3V0FA 3KMSA 1BWEA 4K5SA 4ECYA 3AAWB 1XMQF 2A2DA 1MKPA 4DF4A 3VQSA 4RU2A 4EO8A 4QBEA 1TFYA 1U2FA 1YTNA 3SV3A 3SSSA 4OZJA 4K4WA 3H2XA 2YNFA 3KLIB 4OL8A 4M94A 1ZOTA 2V8GA 2LA6A 3CM3A 2LU1A 4TY9A 4NWFA 4FXVA 1VQ9S 2UP1A 2Q47A 3LANA 1BC6A 3EGWB 2J6UA 1FRKA 5K8NA 1JNRB 3GFYA 4IO1A 2EBEA 2YNHA 3ITHA 3W3SA 1N6QA 3IGNA 3POTA 4J9MA 1R6YA 2LMIA 2MJUA 1N48A 3THVA 2HMIA 1PYNA 2QBPA 2DGXA 1VBXA 3ICLA 3OW2R 2A1BA 1IKXB 2J7UA 2C3YA 4U7UK 4WXOA 1QE1A 2GA7A 2Q3PA 2ZNYA 2ADBA 1CQNA 1HNZF 1R6HA 1FDNA 4JOUA 2IBOA 1LW0B 4OHEA 1RT7B 1S6QB 3DLEB 4HI2A 4ZHRB 2J7KA 5KFGA 3LWLA 1HI1A 4QOTA 4O4GB 4ETZA 1N33F 5F8JA 1SIWB 4BS2A 4F4WA 2AYBA 3VZHA 4HL9A 2EPIA 1DFDA 1JKHA 4CIOA 1G3OA 4OIXA 2RNEA 4BC9A 3OJUA 4Q5VA 2IC3B 2PT0A 1HD1A 3CDBA 5J2QB 3U02A 1SL2A 1TFWA 3KK1A 2W7OA 5L1IA 2HLUA 4R25A 3GZ7A 4OI3A 2XY7A 5AXMA 4G1QA 1WF1A 2XS7A 2BGDA 3HM9A 4KFBA 3KLGA 5EX3A 5DO2A 2IBKA 4MKBA 3I82A 2M70A 4ELTA 1OHCA 1HHSA 4B9UA 1X4FA 1S79A 1YTYA 5M43A 4B9SA 1N34F 3JTOA 2DITA 4B3OA 1FHTA 5IQQA 4C4WA 2E5LF 4Y34A 2V9KA 3KK3A 2D3OR 4I1TA 4I7FB 2KU7A 2RRNA 2G6ZA 1HL6A 4TY8A 1VRTB 1FDDA 2KRRA 2BR0A 2MY7A 2MZJA 2FVPA 5K24A 2I6IA 2ILYA 1M5PC 4DL2A 3GE9A 4NMLA 4OZ1A 1V3SA 4JI2F 2WSFC 1OPZA 3MMBB 3PXGa 3BREA 4A8KA 1VQPS 4CO4A 1M90T 4PUOA 1FRXA 1H7WA 1LK5A 3G9CA 4DFKA 2HNQA 3EB1A 3CC4S 1IJFB 4IFVA 3ISND 4PPZA 3W2VB 4WOHA 2VEYA 4X4VA 2DHAA 2WOMB 2ZE2B 2OFGX 1X4DA 4ZLPA 3PIPQ 1AW0A 3SDEB 2HLTA 2XSFA 3HLUA 4B02A 2LEAA 2MQMA 2V8VA 2H5EA 5DJBA 4LUBA 3D42A 2HHVA 4RU9A 3TAQA 1N36F 2B4UA 1A6LA 2B0GA 5KT5A 3PX4A 2NREA 1S49A 2HVHA 3CEDA 2QMXA 1HNIB 1PH0A 3OQ2A 2P6SA 5CYMB 2B43A 3QZ7A 2RILA 3GYNA 4ZCKA 4ES1A 4U6PA 4WCEQ 1R8HA 2HGMA 2QLWA 3QJJA 1XERA 1YBAA 3K7RA 5DS7A 2AQ4A 2FLNA 2CQPA 3I56S 2CM8A 1RDRA 4WZMA 3VALA 2BM0A 1P6TA 3MEEA 3WZ0A 3MR2A 4UQTA 1HHTP 3EPGA 1FJ7A 4D3PA 2CPZA 3IAS9 2WSCC 2PN6A 2EG1A 2I5XA 4DQRA 2DGWA 4A46A 2XMUA 3HXMA 2FLLA 4JV0A 2RT3A 3MM8B 4NLPA 4ZP6A 1X24A 2CVIA 1S0VA 1XMBA 4KHPF 2FHJA 2Y1IA 5KFDA 2D9PA 1UJ4A 1T3OA 4QWEA 4DR4F 4IOBA 1DTQB 2R4FA 5KFLA 1L8GA 2VKRA 5HROB 3D2WA 4WFYA 3KNAA 1MROB 2RU9A 3M4UA 1UVKA 4X4UA 2E1RA 3BO3A 3X3UA 1FO1A 2IMOA 5F8GA 3ZM2A 3BM7A 1HQEB 4EU0A 2J9EA 3KJVA 4GFVA 2MHNA 4JNBA 2X1GA 2MKKA 2HRUA 4H4KA 1RT3B 1SL1A 1LWEB 3S4EA 2YX4A 1U7LA 3MXHP 4JYAF 1JF7A 1M3GA 4C11A 3DNCA 4ZA1A 2HQIA 2VG6B 2IMGA 2RF2B 1U1PA 2QV6A 1H2TZ 2DGSA 5D77A 4CO2A 4L6V3 2KH9A 3RBDA 2RU3A 4Z37A 4UQGA 3MUTP 3CWJA 2NV5A 4ZRTA 5LMNF 4ZP8A 5EUHA 3MEGA 3SQGA 2XLJA 3LW5C 5LMUF 4FF3A 1VHFA 2PEHA 1QY7A 4ETXA 2AX0A 3MPYA 2G9OA 3RW7A 2I0XA 2BRKA 5DRKA 1FE4A 3K5NA 2B3TB 2BW2A 1Z2ZA 3P49B 4DL6A 2PI7A 4ED8A 2G59A