3O3VA

Crystal structure of clbp peptidase domain
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPFSTLARLENPMPGSAVAQQLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKGDEIIVNKASGYKLGFGKPVLFHAPLARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ClbP x-ray structure, the prototype of a peptidase family associated to NRP production
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3o3vA00
4HBUA 1YLTA 3SS3A 5L2FA 4UHUA 2WK0A 3QNCA 1MBLA 1NY0A 3WS4A 2Y2JA 3UPOA 3BRMA 3MBZA 2BG1A 3IH8A 1ZG6A 5KSHA 1K38A 4EBNA 3IQAA 3NCKA 3S4XA 1NYMA 5A91A 1KGFA 1RGZA 3SH7A 1IYOA 4BQMA 2XD1A 1J9MA 5TR7A 4DDYA 1W79A 3V50A 4IBXA 4BENA 5A92A 2Y2HA 2PU4A 5EVID 5FDHA 4KZ3A 1XA7A 4K0WA 4PMAA 4GKUA 5M19A 1XXMA 4XUXA 4OH0A 1BLPA 5HAQA 5F82A 1NJ4A 2ZQDA 5E2HA 5HAIA 3FKWA 3IT9A 4BL3A 4R1GA 5EVLA 4JXSA 5M1AA 1K4FA 2WGWA 3QNBA 3VMAA 3G2YA 4RA7A 5GLBA 4DF6A 2P74A 1ONHA 3NBLA 4C3QA 4U0TA 3HL9A 1HZOA 5TGFA 4R3BA 4BJPA 1XKZA 2EXAA 2Y2OA 1O7EA 2Y2LA 3PAGA 1KGGA 4GZBA 2WKIA 2ZJ9A 4IVKA 2ZC5B 4WZ5A 1K56D 5GHZA 3NC8A 1NYYA 3VSKA 5HAPA 3E2KA 3DTMA 3WS2A 2WYXA 3RXWA 4KZ9A 3CG5A 1L2SA 1VM1A 2WGWB 3G30A 4JF4A 2QMIA 2XF3A 4X69A 4ZDXA 3BEBA 2ZQ7A 1DY6A 4K0XA 5CXWA 4OLGA 1KE3A 3A3JA 1IKIA 5CTMA 3VP0A 1FQGA 1W8YA 3PBQA 4OPQA 4P85A 3Q07A 3BFCA 3N8LA 3S22A 1NZOA 2HPBA 4D2OA 4WM9A 4Y0TA 5GLDA 2BLSA 3BFGA 3AGFA 5EPHA 1PZPA 4A5RA 1GA0A 3OCLA 4OP5A 1SKFA 4PM6A 2X02A 3GSGA 4LENA 3MKFA 1QMFA 5EE8A 3NY4A 4OPZA 4GB7A 3VP1A 4E3JA 1FR1A 2ZC6B 5GHYA 1ESUA 2C5WB 3RXXA 5AQAA 3IF6C 1K54C 4OOMA 4P87A 4KG6A 3V3SA 2HDRA 4KQOA 3OPHA 4JXVA 3ZVTA 4ZJ1A 5FATA 3ZGAB 2JCHA 1GHIA 4X6TA 1I5QA 4IEDA 3ZDJA 2OSUA 3ZG9B 3DWZA 5CHMA 1BLHA 2P9VB 1MWTA 4CPKA 4LV3A 4EQIA 5F1FA 4QB8A 1LLBA 4P6BA 3UO9A 2V2FF 2WADA 1WE4A 4MBKA 4UAAA 4E6WA 2ZC3B 3C7VA 4CJNA 3IHAA 1KGEA 4H8RA 1PYYA 5DTTA 2EXBA 3BECA 3FZCA 1K55A 3BYDA 5CEDA 1FSYA 4R23A 1E3UD 1I2WA 1HTZA 3UNWA 3HBRA 3W4PA 4OKPA 5FAPA 3SOIA 1PW8A 2Y55A 1HD8A 3G34A 4WMCA 2C6WB 1ESIA 1KDSA 5E2GA 3TG9A 3SS4A 1Q2PA 2DNSA 4OQIA 4S2OA 2V1ZA 3FWLA 3M2JA 4N92A 4PPRA 3UY6A 3IXBA 3W4OA 4KG2A 2WUQA 3E2LA 1IYSA 4XXRA 5HW3A 2IWCA 1MWUA 4U0XA 3CZDA 4X53A 1G68A 4KZAA 5FAQA 4GDBA 3A3FA 4WYYA 3O87A 4R3JA 1KVLA 1MWSA 3GTCA 3MFDA 4BLMA 4NETA 4JPMA 3PBRA 1DJBA 1DJCA 3O86A 5DF9A 1FCOA 1K57C 1KE4A 5CHJA 5DVAA 2QZ6A 2OV5A 3IF6B 3OPLA 3UN7A 2Y2QA 1I2SA 2HDQA 4OOLA 1RCJA 1XX2A 4MBHA 2XLNA 3HLBA 3M2KA 4E3NA 4GDNA 2EX2A 4DDSA 4PM9A 3N6IA 2H5SA 2Q9MA 3VFFA 2RCXA 4Q8IA 3VOYA 5HARA 5AQBA 3ZHHA 2XH9A 3BFDA 4OQHA 4Y7PA 1L0DA 2XD5A 4UA9A 2IWDA 3SH9A 1KVMA 3PTEA 3V5MA 4K91A 3P09A 2JE5A 4WZ5C 4Y0UA 1EROA 1MKIA 4KZ7A 2JBFA 3GV9A 3M6BA 3UE0A 3V39A 5KZHA 3HREA 4OLDA 3HUOA 4IBRA 1ZKJA 4N9LA 3Q7ZA 1Q2QA 2X71A 3UE1A 1Y54A 5FSRA 3I7JA 3LEZA 4OP8A 4RX3A 4JLFA 3BLMA 4QY6A 4F94A 3PBSA 4GNUA 4OPYA 4WZ4A 2XK1A 2EFXA 3WS0A 1CEFA 3ZVWA 1BLCA 3UDXA 5EOOA 2A3UA 4S2NA 1TVFA 5GL9A 3MXRA 1SHVA 3VOZA 3IXDA 1ALQA 1YMSA 2Y2MA 4Y0OA 3C7UA 1K25A 2ZLYA 4MBFA 4BD0A 3W4QA 4B88A 2PU2A 2XDMA 1LI9A 5J8XA 3C4PA 4ZJ3A 4O7DA 2WAEA 5E2FA 4EWFA 5DTSA 3HLDA 1YLPA 1JWVA 4R4SA 1JWPA 3LCEA 2XR0A 4OQGA 2ZQ9A 1ES3A 4N1HA 4S2PA 1IEMA 4FCFA 1TEMA 4YFMA 5DTKA 5EVIA 3ITBA 5FI2A 3VP3A 4QHCA 4EBLA 2ZM2A 3IF6A 1K54A 1BZAA 4WEJA 5FQIA 3FV7A 4N1XA 4QY5A 3EQVA 3LY3A 5A90A 1PWGA 4EUZA 2Y2KA 3OCNA 1OMEA 3MZDA 4RX2A 3Q7VA 3P98A 1N4OA 3TOIA 2EFUA 1GHMA 1YLYA 2E8IA 1H5XA 2R9WA 4IVIA 4OOYA 2WKEA 4MLLA 4LCLA 4X55A 3GQZA 3GRJA 4RVAA 3IXHA 5FAOA 3IH9A 3UDFA 4X56A 3V3RA 3ZFZA 4UA6A 2WAFA 2Y2PA 4S2IA 4YINA 1BT5A 2HDUA 1IKGA 3N7WA 1ES4A 2R9XA 4PM5A 1NZUA 2J9PA 3MZFA 2A49A 3HLCA 4E3IA 3IWOA 5I94A 3UDIA 3VP2A 4LV1A 1S0WA 2H0TA 2Z2LB 4P0MA 5E43A 2WZXA 5GLCA 2CC1A 1LL9A 3N8RA 5EUAA 5JYPA 2HP5A 5CRFA 2Y2IA 3IHBA 4OONA 3A3DA 4N9KA 5F1GA 3O3VA 3PBTA 4JBFA 5CERA 2Y91A 1M40A 1CI8A 4PM7A 1TDGA 3LY4A 3FYZA 4GOGA 1TDLA 3UPNA 4JXWA 3NIAA 4S2LA 2WZZA 1LL5A 3NI9A 3N4IA 4DXCA 4FH2A 3WWXA 2P9VA 2ZQAA 5TFQA 1RGYA 4U3TA 1XA1A 5AQ7A 1PI5A 3WRZA 1YLWA 3ZG7B 1MXOA 2H10A 1GA9A 3MXSA 1FSWA 4EV4A 1IELA 2PBYA 3HUNA 5DF7A 1LHYA 1FCMA 4GD6A 5CGSA 2J7VA 3PAEA 1WYCA 2XQZA 1YLZA 3FKVA 3DWKA 2ZQCA 1PW1A 4JXGA 1GHPA 5JYOA 5FQJA 1ERMA 1MPLA 3ISGA 2EX6A 5FQQA 4L0LA 4ID4A 3IXGA 2OLVA 5IHVA 3HLFA 1BTLA 3AGDA 1H8ZA 2ZM8A 1JTGA 5FI7A 4WEKA 3C4OA 5DF8A 1M6KA 3A3EA 4KQRA 1FOFA 1W7FA 2GDNA 4OVDA 4ZJ2A 1K6RA 3WS5A 1E4DA 2G2UA 5CGWA 2OLUA 3UE3A 2G2WA 1GCEA 3UPPA 1IYQA 1IYPA 4LV2A 3LO7A 2V20A 2ZC7A 3OPRA 5CTNA 4KZ5A 3HUMA 5F83A 1JVJA 3IWIA 2XFTA 4GD8A 3Q81A 3ZG0A 4DE2A 4E3LA 3ITAA 1K4EA 2UWXA 4WELA 1ONGA 1NXYA 2J9OA 3G4PA 1RP5A 4ZTKA 1PIOA 3OZHA 3QHYA 5EVIB 4GN2A 1ES2A 4B4XA 1K6SA 1PWDA 1MWRA 4RYEA 1XP4A 1YM1A 1W5DA 4C75A 2WGVA 4EBPA 3PBNA 4KG5A 4E3OA 2HP9A 1ZC2A 1WYBA 3G31A 3BFFA 4DE3A 2EX8A 1YQSA 2ZM0A 5CEBA 4XUZA 3B3XA 4BD1A 1E25A 1KE0A 5M18A 4FD8A 3C5AA 1VQQA 3GR2A 4KZ6A 5FQMA 2XGNA 4FH4A 5E2EA 2J8YA 3IF5A 1K56A 4S2MA 3WRTA 4C6YA 3PBOA 4E6XA 1L0GA 1K55C 4JF6A 1W8QA 4NK3A 3O88A 5CGXA 1ERQA 2JC7A 1BSGA 1SCWA 1JWZA 3Q82A 1G6AA 2Y2NA 1L0FA 1AXBA 5CHUA 4OPRA 3SS5A 5FQ9A 3NDEA 1XPBA 3HLEA 4UA7A 4ZAMA 3D4FA 2Y59A 4R0QA 1CEGA 5KMWA 4OQ0A 1BUEA 5EVIC 4S2KA 4KZ4A 4X68A 2EX9A 3BFEA 3G2ZA 5FA7A 3HVFA 2HP6A 4BL2A 3MKEA 4DKIA 3WS1A 1N9BA 3MZEA 1SDEA 4WBGA 4R4RA 2Y2GA 1KDWA 1L0EA 1Z6FA 4JKTA 4MEZA 1NRFA 5FQKA 4HEFA 1ES5A 2DRWA 4DXBA 1CI9A 5HFOA 2X01A 1XGJA 4LV0A 3ZG8B 4Z9QA 3VP4A 3OPPA 1DJAA 1K57A 2XEPA 3EQUA 5GLAA 1FR6A 1PWCA 3NDGA 1FCNA 2RL3A 3VSLA 1ZG4A 3ZG5A 4KENB 3CJMA 5EOEA 3DW0A 2B5RA 2IWBA 4E3KA 1O07A 1BULA 5AQ9A 4JF5A 4B4ZA 2DCFA 2I72A 2Y4AA 1CK3A 2H0YA 1E3UA 4QD4A 5CECA 4FSFA 1H8YA 1EI5A 3SH8A 1LI0A 2FFFB 2VGKA 3HLWA 1YMXA 4WMCD 2FFYA 3Q1FA 1HVBA 2XFSA 4MNRA 3M6HA 5BOHA 3S1YA 3IWQA 3HLGA 3G35A 3BLSA 1C3BA 5D3OA 4QJGA 4DE0A 2VGJA 3RJUA 3A3IA 5G18A 1YLJA 1S6RA 4DE1A 2WKHA 4LCMA 2HDSA 3ZNYA 4QU3A 2WGIA 3N8SA 3AGEA 3G32A 4KQQA 3ZNTA 1PZOA 3W8KA 2Z2MB 3VFHA 3GMWA 2ZC4B 1U60A 2QPNA 5FI6A 4E3MA 4S2NC 4PM8A 5U47A 4HBTA 4HESA 4S2JA 3TSGA 2ZMAA 5GHXA 1PI4A 1XGIA 1SDNA 1EWZA 1QMEA 3ZCZA 5FASA 5KSCA 4ZBEA 4KZBA 5EECA 5HX9A 3JYIA 2Q9NA 1BLSA 2ZQ8A 5HL1A 5A93A 3CMZA 4M3KA 1YT4A 3BM6A 3GVBA 4KZ8A 1MY8A 2ZD8A 3OC2A 4DRTA 3Q7VB 1JTDA
chains in the Genus database with same CATH superfamily
1YLTA 2K7SA 4PKYA 2WK0A 4EQ1A 1MBLA 1NY0A 2KDKA 3IH8A 3QP1A 3A0VA 3IQAA 3S4XA 1YAXA 2PYPA 4DDYA 1W79A 4NXFA 1L3LA 4IBXA 4BENA 5A92A 5EVID 3A0RA 4K0WA 5M19A 4GKUA 4IUHA 2PRFA 1XXMA 3PYPA 4JGPA 4OH0A 4Y3IA 2XSSA 5EFWA 4BL3A 3FKWA 3IT9A 4JXSA 1K4FA 1OPXA 4G3WA 2ZMFA 2W27A 3TW8A 5F69A 4C3QA 1HZOA 2Y2OA 4JF5A 4IVKA 4GZBA 5HAPA 2O99A 4HP9A 1K56D 3UB8A 2WYXA 5EM1A 3MSHA 1BYWA 3G30A 4Q0IA 3H9WA 1DY6A 3ZYTA 4OLGA 3A3JA 2EWWA 4OPQA 3BFCA 2INWA 3N8LA 5IS1A 1F98A 4XT2A 2W1TA 3LI8A 2QJ7A 3AGFA 3T12B 5EPHA 1PZPA 1SKFA 2PAVP 3GSGA 4LENA 4OPZA 4GB7A 2ZC6B 1ESUA 5HPIA 3V3SA 2HDRA 4KQOA 3CAXA 4JXVA 5L10A 1I5QA 4IJGA 3S7QA 1MWTA 4CPKA 4LV3A 4QB8A 4P6BA 1UWPX 4HY8A 1FILA 4ETXA 3BECA 4MDZA 1OTAA 2XRNA 1LL8A 1HD8A 3G34A 2VA0A 3CITA 1KDSA 5E2GA 3SS4A 3NECA 2V1ZA 1PRQA 3C2WA 4N92A 4HNBA 2IWCA 4U0XA 5FAQA 4GDBA 3A3FA 2QYBA 4R3JA 3BJNA 1MWSA 3MFDA 1DJBA 1KE4A 2QZ6A 3C38A 4WN5A 3T4TA 3U2AA 5FEFA 4ME4A 1NRJA 5AQBA 2XH9A 4Y7PA 4NG2A 4UA9A 3V5MA 2W3GA 1EROA 4EW7A 4P6ZS 3HUOA 2A24A 4IBRA 2OWJA 4MN5A 5FSRA 3I7JA 4RX3A 4JLFA 3BLMA 4BBTA 1CEFA 1BLCA 3UDXA 2A3UA 4M4XA 3VOZA 1YMSA 3C7UA 5HDSA 3W4QA 2XDMA 1F2KA 5J8XA 3C4PA 2IA2A 5IU1A 1YLPA 1G5UA 3LCEA 2ZQ9A 1ES3A 5DTKA 4Z1WA 3QP2A 2ZOHA 5HW3A 4EBLA 3IF6A 4WEJA 3EQVA 5A90A 2ZBBA 1OMEA 4RX2A 1GHMA 2E8IA 2R9WA 5HDDA 4MLLA 4UA6A 3DBAA 2J3TC 4E3IA 4KUOA 3UDIA 1S0WA 2CC1A 1LL9A 2W1RA 5JYPA 4K08A 3EGXC 4N9KA 5IT5A 5F1GA 3O3VA 1UWNX 2Y91A 4PM7A 1CI8A 3FPVA 3FYZA 3E4OA 4MN6A 1VEUB 3NIAA 4S2LA 2Z6DA 4DXCA 3MS6A 2ZQAA 2M7UA 4U3TA 4Y2FA 5AQ7A 2NUTC 1MXOA 4R38A 1IELA 2PBYA 1WYCA 2XQZA 2YKHA 2Z6CA 2ZQCA 2WKPA 1ERMA 3ISGA 2EX6A 5IHVA 3AGDA 3T50A 5FI7A 1T19A 5L07A 3RTYA 3WS5A 1E4DA 1IOUA 1XJ4A 1GCEA 1IYPA 1CF0A 3OPRA 1SKOA 3HUMA 3QP4A 3IWIA 3ZG0A 2L4RA 4WELA 1T1BA 2J9OA 2LB5A 4I39A 4DJ2A 4RYEA 1XP4A 5FL3A 3S7NA 4KG5A 4UQIS 3G31A 2EX8A 1S67L 3GR2A 2J8YA 4S2MA 4C6YA 1OTDA 4BBUA 5CGXA 1ERQA 3CPTA 1BSGA 4CLCB 4BBVA 1OTIA 3Q82A 3SS5A 5F68A 3D4FA 5AVFA 5KMWA 4OQ0A 1BUEA 4S2KA 5DFYA 2EX9A 3BFEA 5FA7A 3G2ZA 4BL2A 4DKIA 3OLOA 1N9BA 4D60A 4WBGA 1FIKA 4JKTA 1XJ2A 4MEZA 5FQKA 3RH8B 4HEFA 2X01A 2UV0E 1DJAA 3O5YA 4WF0A 3LGOA 2VX8A 2FH5A 3CJMA 2B02A 5AQ9A 2DCFA 2I72A 1JNUA 4KQDA 4FSFA 1H8YA 3MR0A 2KLIA 2FFFB 2O9AA 3F1NA 3KYEA 3G35A 3BLSA 2GX5A 4LCMA 4Y13A 3CUEC 3N8SA 3ZNTA 1XFQA 5FI6A 4HESA 3TSGA 2PR5A 5GHXA 1PI4A 1QMEA 4Q0HA 4KZBA 1X0OA 5EECA 5K5BA 4R6LA 4KZ8A 1JTDA 4HBUA 4EU0A 3SS3A 4HJ6A 3UPOA 3MBZA 1T1CA 3NCKA 2KX6A 1NYMA 4I3IA 1S66L 1RGZA 1KOUA 2O9CA 1J9MA 1G6OA 1AWIA 5FDHA 4KZ3A 4PMAA 2P7JA 2JKGA 3BY8A 4HP4A 4JGQA 5F82A 1S4RA 4YOFA 5J3WA 3VMAA 3B42A 3G2YA 5GLBA 3DTEA 2P74A 3MF0A 4U0TA 3T4QA 2EXAA 4Y0TA 2Y2LA 3IX8A 5GHZA 4HJ3A 3NC8A 1NYYA 3WS2A 1L2SA 2WGWB 4JF4A 2XF3A 1V9ZA 5CXWA 4KUKA 3DAVA 4PAUA 5CTMA 1W8YA 3PBQA 4P85A 1P9WA 3TE8A 3TRCA 2BLSA 3KSGA 1P0ZA 3KSFA 2GJ3A 4PM6A 2X02A 3BQ8A 5EE8A 1FR1A 3RXXA 2JCHA 3ZDJA 3K3DA 1TS0A 2OSUA 3F1NB 4I38A 4QPRA 2XROA 1BLHA 5F1FA 3B33A 2JKRM 5CX7A 2V2FF 2WADA 1K0KA 4UAAA 3C7VA 3LYXA 1Y4OA 4HH2A 3FZCA 1K55A 3BYDA 2OAQ1 5HSQA 1E3UD 3W4PA 3UNWA 4LRYC 4OKPA 4Y5FA 3SOIA 1PW8A 2VV6A 2Y55A 5FEGA 1ESIA 4FUWA 3TG9A 4OQIA 3JPUA 5AVEA 3GDIA 1T18A 3UY6A 5TBMA 3W4OA 4XXRA 5DKKA 1MWUA 3CZDA 1V9YA 2P08A 3PBRA 3O86A 1FCOA 5CHJA 4FOFA 5DVAA 1OT6A 3OPLA 1I2SA 2HDQA 2HGVA 1RCJA 4MBHA 2XLNA 3HLBA 2EX2A 3CPTB 2H5SA 2Q9MA 4Q8IA 1GSXA 2P04A 3BFDA 4OQHA 2XD5A 2J3WA 2JKTM 1KVMA 4K91A 4X1LA 1MKIA 4KZ7A 4Q0JA 2ZOIA 1LT0A 4EEPA 2EWVA 4OP8A 4LPZA 3PBSA 2HV1A 2EFXA 2O9BA 3KYQA 1LSXA 4BD0A 4NEED 1K25A 1HLUP 4LGWA 4O7DA 2V1AA 5DTSA 3HLDA 2JKFA 4YFMA 5EVIA 1ODVA 4S2PA 1TEMA 3VP3A 2Y79A 4QHCA 1BZAA 4UQIM 2W3HA 1H3QA 3MZDA 3Q7VA 3P98A 1N4OA 2D01A 2WKEA 2JN7A 4X55A 5FAOA 3V3RA 5TBMB 3UMDA 4YWZA 4YINA 3N7WA 3P01A 5DFXA 1NZUA 3LIBA 3PHYA 3HLCA 3IWOA 4LRXC 3VP2A 3KYZA 2WZXA 1WA9A 3E98A 5EUAA 2Y2IA 2WKRA 3E4PA 1TDGA 3LY4A 3TJZC 4L9FA 4NXGA 2WZZA 3T4SA 2P9VA 2OWHA 4FTXA 3BW6A 1PI5A 3IBJA 2VZWA 1YLWA 1VHMA 2H10A 1GA9A 3MXSA 1FSWA 5DF7A 4MCWA 5AJGA 3EWKA 5CGSA 2J7VA 3DWKA 1GHPA 1NLZA 5JYOA 5FQJA 5FQQA 1BTLA 2ZM8A 5DF8A 1FOFA 1W7FA 1D7EA 2G2UA 5CGWA 3UE3A 2G2WA 3EEAA 3IS2B 2ZC7A 1CJFA 2XFTA 4GD8A 3Q81A 1K4EA 1ONGA 1ZHHB 1RP5A 1PIOA 3QHYA 4B4XA 1ES2A 3BWLA 1W5DA 1F9IA 4ZRRA 3LEQA 4DE3A 4BD1A 1OT9A 1E25A 2VLGA 3MMHA 2W3FA 1Z09A 3F1OB 4FD8A 5FQMA 2PT7A 3NOTC 5E2EA 3LFVA 3IF5A 3WRTA 1K56A 4GS9B 1PNEA 2PD8A 1SCWA 1AXBA 4WL9A 5FQ9A 3NDEA 1XPBA 3CHWP 4UA7A 4ESPA 4R0QA 1GSVA 1XJ3A 2HP6A 2OOLA 4X25A 3WS1A 1SDEA 1KDWA 1L0EA 1Z6FA 1NRFA 2DRWA 4DXBA 4WUJA 4Y15A 3S7OA 1XGJA 3ZG8B 4LLOB 3OPPA 1K57A 3IBRA 3UE6A 5GLAA 3NDGA 1ZG4A 3DW0A 2B5RA 2ZL1B 3U4LP 1BULA 3QP8A 1W63Q 4JGRA 4NXBA 4F3LA 4EESA 2D02A 3QP6A 5CECA 4WMCD 3HLWA 1YMXA 2FFYA 5FDSA 1HVBA 1A0KA 2XFSA 4MNRA 3MJQA 3IWQA 3S1YA 2R78A 4QJGA 3CWFA 3PXPA 3MFXA 2M7VA 3SW1A 3RJUA 1S6RA 2WKHA 2HDSA 3ZNYA 2V8CA 2WGIA 3AGEA 4KQQA 1PZOA 4AFIA 3GMWA 2QPNA 4CLCD 4S2JA 1J3WA 4BWIA 1XGIA 1SDNA 5KSCA 3LI9A 1YPRA 2QWSA 4M3KA 3BY9A 3LEZA 2ZD8A 4DRTA 3EEHA 5L2FA 4UHUA 2L1MA 3BRMA 5KSHA 1K38A 4YNRA 5LBRA 3SH7A 4EXOA 3LIDA 4BQMA 3JVVA 4RQ9A 4CLCA 3CUEA 1XA7A 2V0WA 2NUPC 1NJ4A 2ZQDA 5HAIA 3EGDC 3QNBA 4DF6A 1ONHA 3NBLA 5KIZA 3HL9A 4R3BA 1O7EA 2A24B 2WKIA 3VSKA 2ZC5B 3DTMA 5F6AA 3RXWA 3CG5A 3LIFA 1VM1A 4ZDXA 1H0MA 3BEBA 3BQAA 3LR5A 1KE3A 2Q0OA 3VP0A 3LUQA 3FG8A 1NZOA 2HPBA 4WM9A 3CI6A 1TS6A 4A5RA 4OP5A 1TF1A 1QMFA 3NY4A 5GHYA 5AQAA 4WLAA 1K54C 2LB9A 4HOIA 4OOMA 3ZVTA 4ZJ1A 3ZGAB 4ARZA 3ZG9B 2V8FA 5CHMA 2P9VB 3FPWA 2E8JA 3UO9A 1VEUA 4MBKA 1WE4A 4E6WA 3NOPC 2O0YA 4CJNA 3IHAA 1MZUA 1KGEA 5DTTA 1FSYA 4R23A 5DKLA 5HWTA 1I2WA 1HTZA 3HBRA 2HZ5A 3G6OA 3V67A 4I5SA 3R7WB 4WMCA 4E04A 2C6WB 4S2OA 1N9LA 3M2JA 4PPRA 3IXBA 2VJWA 4KG2A 1IYSA 3L7HA 4QWOA 4X53A 1G68A 1D1JA 4F3LB 2ACGA 4NETA 4JPMA 1DJCA 4B9OA 2K31A 1ZTUA 2Y2QA 4OOLA 3M2KA 4E3NA 3NULA 4O0PA 1MKMA 3N6IA 3VOYA 5HARA 1L0DA 3MQ0A 1NWZA 3PTEA 3P09A 2JE5A 4WZ5C 4Y0UA 2DMWA 2JBFA 3M6BA 1OJ5A 3UE0A 5J7EA 5KZHA 4OLDA 1UGUA 4G3VA 2X71A 1H8MA 4F94A 4QY6A 4GNUA 1F5MA 4WZ4A 3WS0A 5EOOA 4S2NA 3MXRA 4L9EA 4Y0OA 4MBFA 2ZLYA 4B88A 2PR6A 1MC0A 1LI9A 1TS8A 5E2FA 2WAEA 2VGLS 5FI2A 4FCFA 3ITBA 2ZM2A 1TD5A 3S7PA 4QY5A 2YKFA 5L8MA 2W0NA 2Y2KA 1SKOB 3OCNA 3KSHA 3TOIA 1YLYA 3GRJA 3NJAA 3UDFA 4X56A 2GNXA 2Y2PA 4S2IA 1BT5A 1IKGA 4PKYG 2A49A 5I94A 3KX0X 3T4LA 5G4YA 3MQOA 4P0MA 2H0TA 2Z2LB 5E43A 2HP5A 2EA9A 3IHBA 4LRZE 3A3DA 4JBFA 5CERA 1ACFA 4HJ4A 2B18A 4EETB 4JXWA 2PBDP 3N4IA 2GZAA 1G28A 1RGYA 2VV8A 1XA1A 4I3AA 1YSPA 2VKSA 3T1SA 2QHKA 3ZG7B 4EV4A 1FCMA 1YLZA 2JHEA 3FKVA 3UB5P 1MPLA 4ID4A 3IXGA 3HLFA 2W1TB 1H8ZA 4XT2B 1OTEA 3C4OA 1M6KA 4OVDA 4ZJ2A 2OLUA 3NHQA 3RFBA 3UPPA 3D72A 4LV2A 3LO7A 4HH3A 5HD3A 4KZ5A 2M1CA 1JVJA 1XJ6A 3E4QA 4CLCE 4DE2A 3ITAA 2UWXA 1EW0A 1NXYA 3G4PA 5HWWA 2QKPA 4ZTKA 3OZHA 5EVIB 1K6SA 1PWDA 1MWRA 4NXEA 1VB6A 2WGVA 3PBNA 4E3OA 3OOVA 1ZC2A 1P97A 3BFFA 2ZM0A 5HPFA 2BASA 1KE0A 3C5AA 3F1PB 4KZ6A 4FH4A 3D9YA 5MC7A 2VEAA 1L0GA 4JF6A 5HD5A 4O8GA 4NK3A 2JC7A 1JWZA 5F5YA 1L0FA 2PHYA 1S1YA 2QJ5A 3HLEA 3ICYA 4H6JB 4II7A 2VK3A 4KZ4A 3HVFA 5DJUA 2WKQA 2MJ6A 4R4RA 1ES5A 4HI4A 4LV0A 4Z9QA 3VP4A 4ETZA 4P6ZM 2XEPA 3HJIA 3VSLA 5EOEA 4E3KA 2OAP1 1N9NA 2Y4AA 4QD4A 3LR4A 1EI5A 1LI0A 2VGKA 3M6HA 3IX4A 5BOHA 2VGLM 5D3OA 4DE0A 3A3IA 1YLJA 4DE1A 1S4SA 4CLCC 1VETB 4QU3A 3W8KA 2ZC4B 4E3MA 4LFUA 4S2NC 3QP5A 4HBTA 5FASA 4ZBEA 2Q9NA 2ZQ8A 4IUKA 5HL1A 5A93A 3DTIA 1S1ZA 3CMZA 3H7WA 1TS7A 1DP6A 3BM6A 3GVBA 2A2LA 3OC2A 1LSVA 3LIEA 3QNCA 3WS4A 2Y2JA 2BG1A 1ZG6A 4EBNA 3E0YA 4HHDA 5A91A 2L0WA 1KGFA 1IYOA 2XD1A 3LIAA 5TR7A 5A8BA 1PFLA 3V50A 2Y2HA 2PU4A 3UMEA 4XUXA 3NOUC 2W3DA 4MN7A 5EV0A 3VE4A 1BLPA 2JKTI 3H82B 5HAQA 5E2HA 4R1GA 5HDCA 5EVLA 3ZQ5A 5M1AA 2WGWA 3L9KA 4RA7A 3K3CA 3K2NA 2K2NA 1LSWA 4BJPA 5TGFA 2H28A 5EM0A 4GJ4A 1XKZA 3PAGA 4WZ5A 1KGGA 2ZJ9A 3E2KA 4KZ9A 4DJ3A 2PYRA 4R70A 2QMIA 4X69A 5I5LA 2ZQ7A 4K0XA 3VOLA 1IKIA 3DTKA 2HJ9C 1FQGA 1GSWA 3Q07A 3S22A 4D2OA 5GLDA 3BFGA 1DRMA 1GA0A 3OCLA 3PR6A 2XA7M 3MKFA 3HCYA 3VP1A 4E3JA 2C5WB 3IF6C 5G4ZA 4P87A 4KG6A 3OPHA 2V0UA 5FATA 4X6TA 1GHIA 4IEDA 3EOIA 3B47A 3DWZA 4GLQA 1NLYA 3A0SA 4EQIA 1LLBA 3D3OA 2ZC3B 4H8RA 5TJJA 1PYYA 2EXBA 1YKDA 5CEDA 1OTBA 3CLOA 5FAPA 5J4EA 3T4KA 3UB6A 1Q2PA 2DNSA 1YSQA 3FWLA 2WUQA 3E2LA 4GHIB 2KOIA 4PHTA 2J3TD 4KZAA 1P9RA 4I3JA 4WYYA 3O87A 1KVLA 3C30A 3GTCA 4GCZA 4H6JA 4BLMA 1W63M 5DF9A 1K57C 3LICA 2OV5A 3IF6B 3UN7A 2J80A 1N9OA 1XX2A 4Y17A 4GDNA 4DDSA 4GS9A 4PM9A 3VFFA 5DJTA 2RCXA 4NKPA 4R3AA 3ZHHA 3KO6A 3F1OA 2IWDA 3SH9A 3GV9A 3V39A 3HREA 1ZKJA 4N9LA 4CQHA 2W3EA 3Q7ZA 1Q2QA 3UE1A 1Y54A 4O01A 4OPYA 2XK1A 3ZVWA 5L09A 2XA7S 1TVFA 5GL9A 3H82A 1SHVA 3IXDA 1ALQA 2Y2MA 2PU2A 2VV7A 4ZJ3A 4HIAA 4EWFA 3T4OA 1JWVA 4R4SA 1JWPA 4OQGA 2XR0A 4N1HA 1IEMA 3FC7A 1K54A 3UB9A 5FQIA 3FV7A 4N1XA 3LY3A 1PWGA 3ULFA 4EUZA 3W2ZA 2I9VA 2EFUA 2HJEA 1H5XA 4IVIA 4OOYA 1STZA 4LCLA 3GQZA 3H7WB 4RVAA 3IXHA 3IH9A 3KSIA 3ZFZA 2WAFA 2HDUA 1ES4A 2R9XA 4PM5A 2J9PA 3MZFA 3P7NA 3T1XA 3LR3A 4LV1A 4IHQA 5GLCA 3N8RA 5CRFA 1VETA 4OONA 1XFNA 5HWVA 3PBTA 1M40A 4GOGA 3UPNA 1TDLA 1LL5A 3NI9A 4EEUA 4EERA 4FH2A 3WWXA 4EUVA 5TFQA 4DMZA 2AVXA 3WRZA 2BTFP 3HUNA 1LHYA 4GD6A 2ZL1A 3PAEA 2G7UA 2B95A 1PW1A 4JXGA 4BMWA 4L0LA 2JKRI 2OLVA 3OBFA 1JTGA 2V9AA 4WEKA 3GECA 1DP8A 5HZHA 3A3EA 4KQRA 2GDNA 1K6RA 3T1RA 2ZMVA 1IYQA 3JVUA 2V20A 5CTNA 5F83A 4E3LA 1DP9A 2PDRA 4GN2A 1YM1A 3LR0A 4C75A 4EBPA 2HP9A 3UB7A 1WYBA 1YQSA 5CEBA 3F1PA 4XUZA 3B3XA 3C8CA 5M18A 1VQQA 2XGNA 3MXQA 4E6XA 3PBOA 1K55C 1W8QA 3O88A 4DN0A 1G6AA 2Y2NA 5CHUA 4OPRA 4ZAMA 2Y59A 1IFQA 1CEGA 5EVIC 4X68A 3IS2A 2FZ0A 3VV4A 3MKEA 2HF6A 3MQQA 3HJKA 3MZEA 2Y2GA 4G3KA 1CI9A 5HFOA 3T1QB 5C5KA 4X1MA 3R7WA 3EQUA 1FR6A 1PWCA 2Y8HA 1FCNA 2RL3A 3ZG5A 4KENB 1D06A 3T4JA 2IWBA 4HQAA 1O07A 4B4ZA 4B93A 4L9GA 1T1AA 1SZVA 1CK3A 2H0YA 1E3UA 3IX3A 4GHIA 3SH8A 2V1BA 3R4KA 1Y28A 3Q1FA 3VE3A 1OJGA 3HLGA 4JGOA 1C3BA 1CQAA 4ARZB 2VGJA 3SZTA 5G18A 3G32A 4UEYA 2Z2MB 3VFHA 1U60A 4PM8A 5U47A 4MMNA 2ZMAA 4GW9A 1EWZA 5HL6A 3ZCZA 5HX9A 3JYIA 1BLSA 1YT4A 2CMNA 2PD7A 1MY8A 5EVEA 3Q7VB
chains in the Genus database with same CATH topology
4HBUA 1YLTA 3SS3A 5L2FA 4UHUA 2WK0A 3QNCA 1MBLA 1NY0A 3WS4A 2Y2JA 3UPOA 3BRMA 3MBZA 2BG1A 3IH8A 1ZG6A 5KSHA 1K38A 4EBNA 3IQAA 3NCKA 3S4XA 1NYMA 5A91A 1KGFA 1RGZA 3SH7A 1IYOA 4BQMA 2XD1A 1J9MA 5TR7A 4DDYA 1W79A 3V50A 4IBXA 4BENA 5A92A 2Y2HA 2PU4A 5EVID 5FDHA 4KZ3A 1XA7A 4K0WA 4PMAA 4GKUA 5M19A 1XXMA 4XUXA 4OH0A 1BLPA 5HAQA 5F82A 1NJ4A 2ZQDA 5E2HA 5HAIA 3FKWA 3IT9A 4BL3A 4R1GA 5EVLA 4JXSA 5M1AA 1K4FA 2WGWA 3QNBA 3VMAA 3G2YA 4RA7A 5GLBA 4DF6A 2P74A 1ONHA 3NBLA 4C3QA 4U0TA 3HL9A 1HZOA 5TGFA 4R3BA 4BJPA 1XKZA 2EXAA 2Y2OA 1O7EA 2Y2LA 3PAGA 1KGGA 4GZBA 2WKIA 2ZJ9A 4IVKA 2ZC5B 4WZ5A 1K56D 5GHZA 3NC8A 1NYYA 3VSKA 5HAPA 3E2KA 3DTMA 3WS2A 2WYXA 3RXWA 4KZ9A 3CG5A 1L2SA 1VM1A 2WGWB 3G30A 4JF4A 2QMIA 2XF3A 4X69A 4ZDXA 3BEBA 2ZQ7A 1DY6A 4K0XA 5CXWA 4OLGA 1KE3A 3A3JA 1IKIA 5CTMA 3VP0A 1FQGA 1W8YA 3PBQA 4OPQA 4P85A 3Q07A 3BFCA 3N8LA 3S22A 1NZOA 2HPBA 4D2OA 4WM9A 4Y0TA 5GLDA 2BLSA 3BFGA 3AGFA 5EPHA 1PZPA 4A5RA 1GA0A 3OCLA 4OP5A 1SKFA 4PM6A 2X02A 3GSGA 4LENA 3MKFA 1QMFA 5EE8A 3NY4A 4OPZA 4GB7A 3VP1A 4E3JA 1FR1A 2ZC6B 5GHYA 1ESUA 2C5WB 3RXXA 5AQAA 3IF6C 1K54C 4OOMA 4P87A 4KG6A 3V3SA 2HDRA 4KQOA 3OPHA 4JXVA 3ZVTA 4ZJ1A 5FATA 3ZGAB 2JCHA 1GHIA 4X6TA 1I5QA 4IEDA 3ZDJA 2OSUA 3ZG9B 3DWZA 5CHMA 1BLHA 2P9VB 1MWTA 4CPKA 4LV3A 4EQIA 5F1FA 4QB8A 1LLBA 4P6BA 3UO9A 2V2FF 2WADA 1WE4A 4MBKA 4UAAA 4E6WA 2ZC3B 3C7VA 4CJNA 3IHAA 1KGEA 4H8RA 1PYYA 5DTTA 2EXBA 3BECA 3FZCA 1K55A 3BYDA 5CEDA 1FSYA 4R23A 1E3UD 1I2WA 1HTZA 3UNWA 3HBRA 3W4PA 4OKPA 5FAPA 3SOIA 1PW8A 2Y55A 1HD8A 3G34A 4WMCA 2C6WB 1ESIA 1KDSA 5E2GA 3TG9A 3SS4A 1Q2PA 2DNSA 4OQIA 4S2OA 2V1ZA 3FWLA 3M2JA 4N92A 4PPRA 3UY6A 3IXBA 3W4OA 4KG2A 2WUQA 3E2LA 1IYSA 4XXRA 5HW3A 2IWCA 1MWUA 4U0XA 3CZDA 4X53A 1G68A 4KZAA 5FAQA 4GDBA 3A3FA 4WYYA 3O87A 4R3JA 1KVLA 1MWSA 3GTCA 3MFDA 4BLMA 4NETA 4JPMA 3PBRA 1DJBA 1DJCA 3O86A 5DF9A 1FCOA 1K57C 1KE4A 5CHJA 5DVAA 2QZ6A 2OV5A 3IF6B 3OPLA 3UN7A 2Y2QA 1I2SA 2HDQA 4OOLA 1RCJA 1XX2A 4MBHA 2XLNA 3HLBA 3M2KA 4E3NA 4GDNA 2EX2A 4DDSA 4PM9A 3N6IA 2H5SA 2Q9MA 3VFFA 2RCXA 4Q8IA 3VOYA 5HARA 5AQBA 3ZHHA 2XH9A 3BFDA 4OQHA 4Y7PA 1L0DA 2XD5A 4UA9A 2IWDA 3SH9A 1KVMA 3PTEA 3V5MA 4K91A 3P09A 2JE5A 4WZ5C 4Y0UA 1EROA 1MKIA 4KZ7A 2JBFA 3GV9A 3M6BA 3UE0A 3V39A 5KZHA 3HREA 4OLDA 3HUOA 4IBRA 1ZKJA 4N9LA 3Q7ZA 1Q2QA 2X71A 3UE1A 1Y54A 5FSRA 3I7JA 3LEZA 4OP8A 4RX3A 4JLFA 3BLMA 4QY6A 4F94A 3PBSA 4GNUA 4OPYA 4WZ4A 2XK1A 2EFXA 3WS0A 1CEFA 3ZVWA 1BLCA 3UDXA 5EOOA 2A3UA 4S2NA 1TVFA 5GL9A 3MXRA 1SHVA 3VOZA 3IXDA 1ALQA 1YMSA 2Y2MA 4Y0OA 3C7UA 1K25A 2ZLYA 4MBFA 4BD0A 3W4QA 4B88A 2PU2A 2XDMA 1LI9A 5J8XA 3C4PA 4ZJ3A 4O7DA 2WAEA 5E2FA 4EWFA 5DTSA 3HLDA 1YLPA 1JWVA 4R4SA 1JWPA 3LCEA 2XR0A 4OQGA 2ZQ9A 1ES3A 4N1HA 4S2PA 1IEMA 4FCFA 1TEMA 4YFMA 5DTKA 5EVIA 3ITBA 5FI2A 3VP3A 4QHCA 4EBLA 2ZM2A 3IF6A 1K54A 1BZAA 4WEJA 5FQIA 3FV7A 4N1XA 4QY5A 3EQVA 3LY3A 5A90A 1PWGA 4EUZA 2Y2KA 3OCNA 1OMEA 3MZDA 4RX2A 3Q7VA 3P98A 1N4OA 3TOIA 2EFUA 1GHMA 1YLYA 2E8IA 1H5XA 2R9WA 4IVIA 4OOYA 2WKEA 4MLLA 4LCLA 4X55A 3GQZA 3GRJA 4RVAA 3IXHA 5FAOA 3IH9A 3UDFA 4X56A 3V3RA 3ZFZA 4UA6A 2WAFA 2Y2PA 4S2IA 4YINA 1BT5A 2HDUA 1IKGA 3N7WA 1ES4A 2R9XA 4PM5A 1NZUA 2J9PA 3MZFA 2A49A 3HLCA 4E3IA 3IWOA 5I94A 3UDIA 3VP2A 4LV1A 1S0WA 2H0TA 2Z2LB 4P0MA 5E43A 2WZXA 5GLCA 2CC1A 1LL9A 3N8RA 5EUAA 5JYPA 2HP5A 5CRFA 2Y2IA 3IHBA 4OONA 3A3DA 4N9KA 5F1GA 3O3VA 3PBTA 4JBFA 5CERA 2Y91A 1M40A 1CI8A 4PM7A 1TDGA 3LY4A 3FYZA 4GOGA 1TDLA 3UPNA 4JXWA 3NIAA 4S2LA 2WZZA 1LL5A 3NI9A 3N4IA 4DXCA 4FH2A 3WWXA 2P9VA 2ZQAA 5TFQA 1RGYA 4U3TA 1XA1A 5AQ7A 1PI5A 3WRZA 1YLWA 3ZG7B 1MXOA 2H10A 1GA9A 3MXSA 1FSWA 4EV4A 1IELA 2PBYA 3HUNA 5DF7A 1LHYA 1FCMA 4GD6A 5CGSA 2J7VA 3PAEA 1WYCA 2XQZA 1YLZA 3FKVA 3DWKA 2ZQCA 1PW1A 4JXGA 1GHPA 5JYOA 5FQJA 1ERMA 1MPLA 3ISGA 2EX6A 5FQQA 4L0LA 4ID4A 3IXGA 2OLVA 5IHVA 3HLFA 1BTLA 3AGDA 1H8ZA 2ZM8A 1JTGA 5FI7A 4WEKA 3C4OA 5DF8A 1M6KA 3A3EA 4KQRA 1FOFA 1W7FA 2GDNA 4OVDA 4ZJ2A 1K6RA 3WS5A 1E4DA 2G2UA 5CGWA 2OLUA 3UE3A 2G2WA 1GCEA 3UPPA 1IYQA 1IYPA 4LV2A 3LO7A 2V20A 2ZC7A 3OPRA 5CTNA 4KZ5A 3HUMA 5F83A 1JVJA 3IWIA 2XFTA 4GD8A 3Q81A 3ZG0A 4DE2A 4E3LA 3ITAA 1K4EA 2UWXA 4WELA 1ONGA 1NXYA 2J9OA 3G4PA 1RP5A 4ZTKA 1PIOA 3OZHA 3QHYA 5EVIB 4GN2A 1ES2A 4B4XA 1K6SA 1PWDA 1MWRA 4RYEA 1XP4A 1YM1A 1W5DA 4C75A 2WGVA 4EBPA 3PBNA 4KG5A 4E3OA 2HP9A 1ZC2A 1WYBA 3G31A 3BFFA 4DE3A 2EX8A 1YQSA 2ZM0A 5CEBA 4XUZA 3B3XA 4BD1A 1E25A 1KE0A 5M18A 4FD8A 3C5AA 1VQQA 3GR2A 4KZ6A 5FQMA 2XGNA 4FH4A 5E2EA 2J8YA 3IF5A 1K56A 4S2MA 3WRTA 4C6YA 3PBOA 4E6XA 1L0GA 1K55C 4JF6A 1W8QA 4NK3A 3O88A 5CGXA 1ERQA 2JC7A 1BSGA 1SCWA 1JWZA 3Q82A 1G6AA 2Y2NA 1L0FA 1AXBA 5CHUA 4OPRA 3SS5A 5FQ9A 3NDEA 1XPBA 3HLEA 4UA7A 4ZAMA 3D4FA 2Y59A 4R0QA 1CEGA 5KMWA 4OQ0A 1BUEA 5EVIC 4S2KA 4KZ4A 4X68A 2EX9A 3BFEA 3G2ZA 5FA7A 3HVFA 2HP6A 4BL2A 3MKEA 4DKIA 3WS1A 1N9BA 3MZEA 1SDEA 4WBGA 4R4RA 2Y2GA 1KDWA 1L0EA 1Z6FA 4JKTA 4MEZA 1NRFA 5FQKA 4HEFA 1ES5A 2DRWA 4DXBA 1CI9A 5HFOA 2X01A 1XGJA 4LV0A 3ZG8B 4Z9QA 3VP4A 3OPPA 1DJAA 1K57A 2XEPA 3EQUA 5GLAA 1FR6A 1PWCA 3NDGA 1FCNA 2RL3A 3VSLA 1ZG4A 3ZG5A 4KENB 3CJMA 5EOEA 3DW0A 2B5RA 2IWBA 4E3KA 1O07A 1BULA 5AQ9A 4JF5A 4B4ZA 2DCFA 2I72A 2Y4AA 1CK3A 2H0YA 1E3UA 4QD4A 5CECA 4FSFA 1H8YA 1EI5A 3SH8A 1LI0A 2FFFB 2VGKA 3HLWA 1YMXA 4WMCD 2FFYA 3Q1FA 1HVBA 2XFSA 4MNRA 3M6HA 5BOHA 3S1YA 3IWQA 3HLGA 3G35A 3BLSA 1C3BA 5D3OA 4QJGA 4DE0A 2VGJA 3RJUA 3A3IA 5G18A 1YLJA 1S6RA 4DE1A 2WKHA 4LCMA 2HDSA 3ZNYA 4QU3A 2WGIA 3N8SA 3AGEA 3G32A 4KQQA 3ZNTA 1PZOA 3W8KA 2Z2MB 3VFHA 3GMWA 2ZC4B 1U60A 2QPNA 5FI6A 4E3MA 4S2NC 4PM8A 5U47A 4HBTA 4HESA 4S2JA 3TSGA 2ZMAA 5GHXA 1PI4A 1XGIA 1SDNA 1EWZA 1QMEA 3ZCZA 5FASA 5KSCA 4ZBEA 4KZBA 5EECA 5HX9A 3JYIA 2Q9NA 1BLSA 2ZQ8A 5HL1A 5A93A 3CMZA 4M3KA 1YT4A 3BM6A 3GVBA 4KZ8A 1MY8A 2ZD8A 3OC2A 4DRTA 3Q7VB 1JTDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HBU A;  1YLT A;  3SS3 A;  5L2F A;  4UHU A;  2WK0 A;  3QNC A;  1MBL A;  1NY0 A;  3WS4 A;  2Y2J A;  3UPO A;  3BRM A;  3MBZ A;  2BG1 A;  3IH8 A;  1ZG6 A;  5KSH A;  1K38 A;  4EBN A;  3IQA A;  3NCK A;  3S4X A;  1NYM A;  5A91 A;  1KGF A;  1RGZ A;  3SH7 A;  1IYO A;  4BQM A;  2XD1 A;  1J9M A;  5TR7 A;  4DDY A;  1W79 A;  3V50 A;  4IBX A;  4BEN A;  5A92 A;  2Y2H A;  2PU4 A;  5EVI D;  5FDH A;  4KZ3 A;  1XA7 A;  4K0W A;  4PMA A;  4GKU A;  5M19 A;  1XXM A;  4XUX A;  4OH0 A;  1BLP A;  5HAQ A;  5F82 A;  1NJ4 A;  2ZQD A;  5E2H A;  5HAI A;  3FKW A;  3IT9 A;  4BL3 A;  4R1G A;  5EVL A;  4JXS A;  5M1A A;  1K4F A;  2WGW A;  3QNB A;  3VMA A;  3G2Y A;  4RA7 A;  5GLB A;  4DF6 A;  2P74 A;  1ONH A;  3NBL A;  4C3Q A;  4U0T A;  3HL9 A;  1HZO A;  5TGF A;  4R3B A;  4BJP A;  1XKZ A;  2EXA A;  2Y2O A;  1O7E A;  2Y2L A;  3PAG A;  1KGG A;  4GZB A;  2WKI A;  2ZJ9 A;  4IVK A;  2ZC5 B;  4WZ5 A;  1K56 D;  5GHZ A;  3NC8 A;  1NYY A;  3VSK A;  5HAP A;  3E2K A;  3DTM A;  3WS2 A;  2WYX A;  3RXW A;  4KZ9 A;  3CG5 A;  1L2S A;  1VM1 A;  2WGW B;  3G30 A;  4JF4 A;  2QMI A;  2XF3 A;  4X69 A;  4ZDX A;  3BEB A;  2ZQ7 A;  1DY6 A;  4K0X A;  5CXW A;  4OLG A;  1KE3 A;  3A3J A;  1IKI A;  5CTM A;  3VP0 A;  1FQG A;  1W8Y A;  3PBQ A;  4OPQ A;  4P85 A;  3Q07 A;  3BFC A;  3N8L A;  3S22 A;  1NZO A;  2HPB A;  4D2O A;  4WM9 A;  4Y0T A;  5GLD A;  2BLS A;  3BFG A;  3AGF A;  5EPH A;  1PZP A;  4A5R A;  1GA0 A;  3OCL A;  4OP5 A;  1SKF A;  4PM6 A;  2X02 A;  3GSG A;  4LEN A;  3MKF A;  1QMF A;  5EE8 A;  3NY4 A;  4OPZ A;  4GB7 A;  3VP1 A;  4E3J A;  1FR1 A;  2ZC6 B;  5GHY A;  1ESU A;  2C5W B;  3RXX A;  5AQA A;  3IF6 C;  1K54 C;  4OOM A;  4P87 A;  4KG6 A;  3V3S A;  2HDR A;  4KQO A;  3OPH A;  4JXV A;  3ZVT A;  4ZJ1 A;  5FAT A;  3ZGA B;  2JCH A;  1GHI A;  4X6T A;  1I5Q A;  4IED A;  3ZDJ A;  2OSU A;  3ZG9 B;  3DWZ A;  5CHM A;  1BLH A;  2P9V B;  1MWT A;  4CPK A;  4LV3 A;  4EQI A;  5F1F A;  4QB8 A;  1LLB A;  4P6B A;  3UO9 A;  2V2F F;  2WAD A;  1WE4 A;  4MBK A;  4UAA A;  4E6W A;  2ZC3 B;  3C7V A;  4CJN A;  3IHA A;  1KGE A;  4H8R A;  1PYY A;  5DTT A;  2EXB A;  3BEC A;  3FZC A;  1K55 A;  3BYD A;  5CED A;  1FSY A;  4R23 A;  1E3U D;  1I2W A;  1HTZ A;  3UNW A;  3HBR A;  3W4P A;  4OKP A;  5FAP A;  3SOI A;  1PW8 A;  2Y55 A;  1HD8 A;  3G34 A;  4WMC A;  2C6W B;  1ESI A;  1KDS A;  5E2G A;  3TG9 A;  3SS4 A;  1Q2P A;  2DNS A;  4OQI A;  4S2O A;  2V1Z A;  3FWL A;  3M2J A;  4N92 A;  4PPR A;  3UY6 A;  3IXB A;  3W4O A;  4KG2 A;  2WUQ A;  3E2L A;  1IYS A;  4XXR A;  5HW3 A;  2IWC A;  1MWU A;  4U0X A;  3CZD A;  4X53 A;  1G68 A;  4KZA A;  5FAQ A;  4GDB A;  3A3F A;  4WYY A;  3O87 A;  4R3J A;  1KVL A;  1MWS A;  3GTC A;  3MFD A;  4BLM A;  4NET A;  4JPM A;  3PBR A;  1DJB A;  1DJC A;  3O86 A;  5DF9 A;  1FCO A;  1K57 C;  1KE4 A;  5CHJ A;  5DVA A;  2QZ6 A;  2OV5 A;  3IF6 B;  3OPL A;  3UN7 A;  2Y2Q A;  1I2S A;  2HDQ A;  4OOL A;  1RCJ A;  1XX2 A;  4MBH A;  2XLN A;  3HLB A;  3M2K A;  4E3N A;  4GDN A;  2EX2 A;  4DDS A;  4PM9 A;  3N6I A;  2H5S A;  2Q9M A;  3VFF A;  2RCX A;  4Q8I A;  3VOY A;  5HAR A;  5AQB A;  3ZHH A;  2XH9 A;  3BFD A;  4OQH A;  4Y7P A;  1L0D A;  2XD5 A;  4UA9 A;  2IWD A;  3SH9 A;  1KVM A;  3PTE A;  3V5M A;  4K91 A;  3P09 A;  2JE5 A;  4WZ5 C;  4Y0U A;  1ERO A;  1MKI A;  4KZ7 A;  2JBF A;  3GV9 A;  3M6B A;  3UE0 A;  3V39 A;  5KZH A;  3HRE A;  4OLD A;  3HUO A;  4IBR A;  1ZKJ A;  4N9L A;  3Q7Z A;  1Q2Q A;  2X71 A;  3UE1 A;  1Y54 A;  5FSR A;  3I7J A;  3LEZ A;  4OP8 A;  4RX3 A;  4JLF A;  3BLM A;  4QY6 A;  4F94 A;  3PBS A;  4GNU A;  4OPY A;  4WZ4 A;  2XK1 A;  2EFX A;  3WS0 A;  1CEF A;  3ZVW A;  1BLC A;  3UDX A;  5EOO A;  2A3U A;  4S2N A;  1TVF A;  5GL9 A;  3MXR A;  1SHV A;  3VOZ A;  3IXD A;  1ALQ A;  1YMS A;  2Y2M A;  4Y0O A;  3C7U A;  1K25 A;  2ZLY A;  4MBF A;  4BD0 A;  3W4Q A;  4B88 A;  2PU2 A;  2XDM A;  1LI9 A;  5J8X A;  3C4P A;  4ZJ3 A;  4O7D A;  2WAE A;  5E2F A;  4EWF A;  5DTS A;  3HLD A;  1YLP A;  1JWV A;  4R4S A;  1JWP A;  3LCE A;  2XR0 A;  4OQG A;  2ZQ9 A;  1ES3 A;  4N1H A;  4S2P A;  1IEM A;  4FCF A;  1TEM A;  4YFM A;  5DTK A;  5EVI A;  3ITB A;  5FI2 A;  3VP3 A;  4QHC A;  4EBL A;  2ZM2 A;  3IF6 A;  1K54 A;  1BZA A;  4WEJ A;  5FQI A;  3FV7 A;  4N1X A;  4QY5 A;  3EQV A;  3LY3 A;  5A90 A;  1PWG A;  4EUZ A;  2Y2K A;  3OCN A;  1OME A;  3MZD A;  4RX2 A;  3Q7V A;  3P98 A;  1N4O A;  3TOI A;  2EFU A;  1GHM A;  1YLY A;  2E8I A;  1H5X A;  2R9W A;  4IVI A;  4OOY A;  2WKE A;  4MLL A;  4LCL A;  4X55 A;  3GQZ A;  3GRJ A;  4RVA A;  3IXH A;  5FAO A;  3IH9 A;  3UDF A;  4X56 A;  3V3R A;  3ZFZ A;  4UA6 A;  2WAF A;  2Y2P A;  4S2I A;  4YIN A;  1BT5 A;  2HDU A;  1IKG A;  3N7W A;  1ES4 A;  2R9X A;  4PM5 A;  1NZU A;  2J9P A;  3MZF A;  2A49 A;  3HLC A;  4E3I A;  3IWO A;  5I94 A;  3UDI A;  3VP2 A;  4LV1 A;  1S0W A;  2H0T A;  2Z2L B;  4P0M A;  5E43 A;  2WZX A;  5GLC A;  2CC1 A;  1LL9 A;  3N8R A;  5EUA A;  5JYP A;  2HP5 A;  5CRF A;  2Y2I A;  3IHB A;  4OON A;  3A3D A;  4N9K A;  5F1G A;  3O3V A;  3PBT A;  4JBF A;  5CER A;  2Y91 A;  1M40 A;  1CI8 A;  4PM7 A;  1TDG A;  3LY4 A;  3FYZ A;  4GOG A;  1TDL A;  3UPN A;  4JXW A;  3NIA A;  4S2L A;  2WZZ A;  1LL5 A;  3NI9 A;  3N4I A;  4DXC A;  4FH2 A;  3WWX A;  2P9V A;  2ZQA A;  5TFQ A;  1RGY A;  4U3T A;  1XA1 A;  5AQ7 A;  1PI5 A;  3WRZ A;  1YLW A;  3ZG7 B;  1MXO A;  2H10 A;  1GA9 A;  3MXS A;  1FSW A;  4EV4 A;  1IEL A;  2PBY A;  3HUN A;  5DF7 A;  1LHY A;  1FCM A;  4GD6 A;  5CGS A;  2J7V A;  3PAE A;  1WYC A;  2XQZ A;  1YLZ A;  3FKV A;  3DWK A;  2ZQC A;  1PW1 A;  4JXG A;  1GHP A;  5JYO A;  5FQJ A;  1ERM A;  1MPL A;  3ISG A;  2EX6 A;  5FQQ A;  4L0L A;  4ID4 A;  3IXG A;  2OLV A;  5IHV A;  3HLF A;  1BTL A;  3AGD A;  1H8Z A;  2ZM8 A;  1JTG A;  5FI7 A;  4WEK A;  3C4O A;  5DF8 A;  1M6K A;  3A3E A;  4KQR A;  1FOF A;  1W7F A;  2GDN A;  4OVD A;  4ZJ2 A;  1K6R A;  3WS5 A;  1E4D A;  2G2U A;  5CGW A;  2OLU A;  3UE3 A;  2G2W A;  1GCE A;  3UPP A;  1IYQ A;  1IYP A;  4LV2 A;  3LO7 A;  2V20 A;  2ZC7 A;  3OPR A;  5CTN A;  4KZ5 A;  3HUM A;  5F83 A;  1JVJ A;  3IWI A;  2XFT A;  4GD8 A;  3Q81 A;  3ZG0 A;  4DE2 A;  4E3L A;  3ITA A;  1K4E A;  2UWX A;  4WEL A;  1ONG A;  1NXY A;  2J9O A;  3G4P A;  1RP5 A;  4ZTK A;  1PIO A;  3OZH A;  3QHY A;  5EVI B;  4GN2 A;  1ES2 A;  4B4X A;  1K6S A;  1PWD A;  1MWR A;  4RYE A;  1XP4 A;  1YM1 A;  1W5D A;  4C75 A;  2WGV A;  4EBP A;  3PBN A;  4KG5 A;  4E3O A;  2HP9 A;  1ZC2 A;  1WYB A;  3G31 A;  3BFF A;  4DE3 A;  2EX8 A;  1YQS A;  2ZM0 A;  5CEB A;  4XUZ A;  3B3X A;  4BD1 A;  1E25 A;  1KE0 A;  5M18 A;  4FD8 A;  3C5A A;  1VQQ A;  3GR2 A;  4KZ6 A;  5FQM A;  2XGN A;  4FH4 A;  5E2E A;  2J8Y A;  3IF5 A;  1K56 A;  4S2M A;  3WRT A;  4C6Y A;  3PBO A;  4E6X A;  1L0G A;  1K55 C;  4JF6 A;  1W8Q A;  4NK3 A;  3O88 A;  5CGX A;  1ERQ A;  2JC7 A;  1BSG A;  1SCW A;  1JWZ A;  3Q82 A;  1G6A A;  2Y2N A;  1L0F A;  1AXB A;  5CHU A;  4OPR A;  3SS5 A;  5FQ9 A;  3NDE A;  1XPB A;  3HLE A;  4UA7 A;  4ZAM A;  3D4F A;  2Y59 A;  4R0Q A;  1CEG A;  5KMW A;  4OQ0 A;  1BUE A;  5EVI C;  4S2K A;  4KZ4 A;  4X68 A;  2EX9 A;  3BFE A;  3G2Z A;  5FA7 A;  3HVF A;  2HP6 A;  4BL2 A;  3MKE A;  4DKI A;  3WS1 A;  1N9B A;  3MZE A;  1SDE A;  4WBG A;  4R4R A;  2Y2G A;  1KDW A;  1L0E A;  1Z6F A;  4JKT A;  4MEZ A;  1NRF A;  5FQK A;  4HEF A;  1ES5 A;  2DRW A;  4DXB A;  1CI9 A;  5HFO A;  2X01 A;  1XGJ A;  4LV0 A;  3ZG8 B;  4Z9Q A;  3VP4 A;  3OPP A;  1DJA A;  1K57 A;  2XEP A;  3EQU A;  5GLA A;  1FR6 A;  1PWC A;  3NDG A;  1FCN A;  2RL3 A;  3VSL A;  1ZG4 A;  3ZG5 A;  4KEN B;  3CJM A;  5EOE A;  3DW0 A;  2B5R A;  2IWB A;  4E3K A;  1O07 A;  1BUL A;  5AQ9 A;  4JF5 A;  4B4Z A;  2DCF A;  2I72 A;  2Y4A A;  1CK3 A;  2H0Y A;  1E3U A;  4QD4 A;  5CEC A;  4FSF A;  1H8Y A;  1EI5 A;  3SH8 A;  1LI0 A;  2FFF B;  2VGK A;  3HLW A;  1YMX A;  4WMC D;  2FFY A;  3Q1F A;  1HVB A;  2XFS A;  4MNR A;  3M6H A;  5BOH A;  3S1Y A;  3IWQ A;  3HLG A;  3G35 A;  3BLS A;  1C3B A;  5D3O A;  4QJG A;  4DE0 A;  2VGJ A;  3RJU A;  3A3I A;  5G18 A;  1YLJ A;  1S6R A;  4DE1 A;  2WKH A;  4LCM A;  2HDS A;  3ZNY A;  4QU3 A;  2WGI A;  3N8S A;  3AGE A;  3G32 A;  4KQQ A;  3ZNT A;  1PZO A;  3W8K A;  2Z2M B;  3VFH A;  3GMW A;  2ZC4 B;  1U60 A;  2QPN A;  5FI6 A;  4E3M A;  4S2N C;  4PM8 A;  5U47 A;  4HBT A;  4HES A;  4S2J A;  3TSG A;  2ZMA A;  5GHX A;  1PI4 A;  1XGI A;  1SDN A;  1EWZ A;  1QME A;  3ZCZ A;  5FAS A;  5KSC A;  4ZBE A;  4KZB A;  5EEC A;  5HX9 A;  3JYI A;  2Q9N A;  1BLS A;  2ZQ8 A;  5HL1 A;  5A93 A;  3CMZ A;  4M3K A;  1YT4 A;  3BM6 A;  3GVB A;  4KZ8 A;  1MY8 A;  2ZD8 A;  3OC2 A;  4DRT A;  3Q7V B;  1JTD A; 
#chains in the Genus database with same CATH topology
 1YLT A;  2K7S A;  4PKY A;  2WK0 A;  4EQ1 A;  1MBL A;  1NY0 A;  2KDK A;  3IH8 A;  3QP1 A;  3A0V A;  3IQA A;  3S4X A;  1YAX A;  2PYP A;  4DDY A;  1W79 A;  4NXF A;  1L3L A;  4IBX A;  4BEN A;  5A92 A;  5EVI D;  3A0R A;  4K0W A;  5M19 A;  4GKU A;  4IUH A;  2PRF A;  1XXM A;  3PYP A;  4JGP A;  4OH0 A;  4Y3I A;  2XSS A;  5EFW A;  4BL3 A;  3FKW A;  3IT9 A;  4JXS A;  1K4F A;  1OPX A;  4G3W A;  2ZMF A;  2W27 A;  3TW8 A;  5F69 A;  4C3Q A;  1HZO A;  2Y2O A;  4JF5 A;  4IVK A;  4GZB A;  5HAP A;  2O99 A;  4HP9 A;  1K56 D;  3UB8 A;  2WYX A;  5EM1 A;  3MSH A;  1BYW A;  3G30 A;  4Q0I A;  3H9W A;  1DY6 A;  3ZYT A;  4OLG A;  3A3J A;  2EWW A;  4OPQ A;  3BFC A;  2INW A;  3N8L A;  5IS1 A;  1F98 A;  4XT2 A;  2W1T A;  3LI8 A;  2QJ7 A;  3AGF A;  3T12 B;  5EPH A;  1PZP A;  1SKF A;  2PAV P;  3GSG A;  4LEN A;  4OPZ A;  4GB7 A;  2ZC6 B;  1ESU A;  5HPI A;  3V3S A;  2HDR A;  4KQO A;  3CAX A;  4JXV A;  5L10 A;  1I5Q A;  4IJG A;  3S7Q A;  1MWT A;  4CPK A;  4LV3 A;  4QB8 A;  4P6B A;  1UWP X;  4HY8 A;  1FIL A;  4ETX A;  3BEC A;  4MDZ A;  1OTA A;  2XRN A;  1LL8 A;  1HD8 A;  3G34 A;  2VA0 A;  3CIT A;  1KDS A;  5E2G A;  3SS4 A;  3NEC A;  2V1Z A;  1PRQ A;  3C2W A;  4N92 A;  4HNB A;  2IWC A;  4U0X A;  5FAQ A;  4GDB A;  3A3F A;  2QYB A;  4R3J A;  3BJN A;  1MWS A;  3MFD A;  1DJB A;  1KE4 A;  2QZ6 A;  3C38 A;  4WN5 A;  3T4T A;  3U2A A;  5FEF A;  4ME4 A;  1NRJ A;  5AQB A;  2XH9 A;  4Y7P A;  4NG2 A;  4UA9 A;  3V5M A;  2W3G A;  1ERO A;  4EW7 A;  4P6Z S;  3HUO A;  2A24 A;  4IBR A;  2OWJ A;  4MN5 A;  5FSR A;  3I7J A;  4RX3 A;  4JLF A;  3BLM A;  4BBT A;  1CEF A;  1BLC A;  3UDX A;  2A3U A;  4M4X A;  3VOZ A;  1YMS A;  3C7U A;  5HDS A;  3W4Q A;  2XDM A;  1F2K A;  5J8X A;  3C4P A;  2IA2 A;  5IU1 A;  1YLP A;  1G5U A;  3LCE A;  2ZQ9 A;  1ES3 A;  5DTK A;  4Z1W A;  3QP2 A;  2ZOH A;  5HW3 A;  4EBL A;  3IF6 A;  4WEJ A;  3EQV A;  5A90 A;  2ZBB A;  1OME A;  4RX2 A;  1GHM A;  2E8I A;  2R9W A;  5HDD A;  4MLL A;  4UA6 A;  3DBA A;  2J3T C;  4E3I A;  4KUO A;  3UDI A;  1S0W A;  2CC1 A;  1LL9 A;  2W1R A;  5JYP A;  4K08 A;  3EGX C;  4N9K A;  5IT5 A;  5F1G A;  3O3V A;  1UWN X;  2Y91 A;  4PM7 A;  1CI8 A;  3FPV A;  3FYZ A;  3E4O A;  4MN6 A;  1VEU B;  3NIA A;  4S2L A;  2Z6D A;  4DXC A;  3MS6 A;  2ZQA A;  2M7U A;  4U3T A;  4Y2F A;  5AQ7 A;  2NUT C;  1MXO A;  4R38 A;  1IEL A;  2PBY A;  1WYC A;  2XQZ A;  2YKH A;  2Z6C A;  2ZQC A;  2WKP A;  1ERM A;  3ISG A;  2EX6 A;  5IHV A;  3AGD A;  3T50 A;  5FI7 A;  1T19 A;  5L07 A;  3RTY A;  3WS5 A;  1E4D A;  1IOU A;  1XJ4 A;  1GCE A;  1IYP A;  1CF0 A;  3OPR A;  1SKO A;  3HUM A;  3QP4 A;  3IWI A;  3ZG0 A;  2L4R A;  4WEL A;  1T1B A;  2J9O A;  2LB5 A;  4I39 A;  4DJ2 A;  4RYE A;  1XP4 A;  5FL3 A;  3S7N A;  4KG5 A;  4UQI S;  3G31 A;  2EX8 A;  1S67 L;  3GR2 A;  2J8Y A;  4S2M A;  4C6Y A;  1OTD A;  4BBU A;  5CGX A;  1ERQ A;  3CPT A;  1BSG A;  4CLC B;  4BBV A;  1OTI A;  3Q82 A;  3SS5 A;  5F68 A;  3D4F A;  5AVF A;  5KMW A;  4OQ0 A;  1BUE A;  4S2K A;  5DFY A;  2EX9 A;  3BFE A;  5FA7 A;  3G2Z A;  4BL2 A;  4DKI A;  3OLO A;  1N9B A;  4D60 A;  4WBG A;  1FIK A;  4JKT A;  1XJ2 A;  4MEZ A;  5FQK A;  3RH8 B;  4HEF A;  2X01 A;  2UV0 E;  1DJA A;  3O5Y A;  4WF0 A;  3LGO A;  2VX8 A;  2FH5 A;  3CJM A;  2B02 A;  5AQ9 A;  2DCF A;  2I72 A;  1JNU A;  4KQD A;  4FSF A;  1H8Y A;  3MR0 A;  2KLI A;  2FFF B;  2O9A A;  3F1N A;  3KYE A;  3G35 A;  3BLS A;  2GX5 A;  4LCM A;  4Y13 A;  3CUE C;  3N8S A;  3ZNT A;  1XFQ A;  5FI6 A;  4HES A;  3TSG A;  2PR5 A;  5GHX A;  1PI4 A;  1QME A;  4Q0H A;  4KZB A;  1X0O A;  5EEC A;  5K5B A;  4R6L A;  4KZ8 A;  1JTD A;  4HBU A;  4EU0 A;  3SS3 A;  4HJ6 A;  3UPO A;  3MBZ A;  1T1C A;  3NCK A;  2KX6 A;  1NYM A;  4I3I A;  1S66 L;  1RGZ A;  1KOU A;  2O9C A;  1J9M A;  1G6O A;  1AWI A;  5FDH A;  4KZ3 A;  4PMA A;  2P7J A;  2JKG A;  3BY8 A;  4HP4 A;  4JGQ A;  5F82 A;  1S4R A;  4YOF A;  5J3W A;  3VMA A;  3B42 A;  3G2Y A;  5GLB A;  3DTE A;  2P74 A;  3MF0 A;  4U0T A;  3T4Q A;  2EXA A;  4Y0T A;  2Y2L A;  3IX8 A;  5GHZ A;  4HJ3 A;  3NC8 A;  1NYY A;  3WS2 A;  1L2S A;  2WGW B;  4JF4 A;  2XF3 A;  1V9Z A;  5CXW A;  4KUK A;  3DAV A;  4PAU A;  5CTM A;  1W8Y A;  3PBQ A;  4P85 A;  1P9W A;  3TE8 A;  3TRC A;  2BLS A;  3KSG A;  1P0Z A;  3KSF A;  2GJ3 A;  4PM6 A;  2X02 A;  3BQ8 A;  5EE8 A;  1FR1 A;  3RXX A;  2JCH A;  3ZDJ A;  3K3D A;  1TS0 A;  2OSU A;  3F1N B;  4I38 A;  4QPR A;  2XRO A;  1BLH A;  5F1F A;  3B33 A;  2JKR M;  5CX7 A;  2V2F F;  2WAD A;  1K0K A;  4UAA A;  3C7V A;  3LYX A;  1Y4O A;  4HH2 A;  3FZC A;  1K55 A;  3BYD A;  2OAQ 1;  5HSQ A;  1E3U D;  3W4P A;  3UNW A;  4LRY C;  4OKP A;  4Y5F A;  3SOI A;  1PW8 A;  2VV6 A;  2Y55 A;  5FEG A;  1ESI A;  4FUW A;  3TG9 A;  4OQI A;  3JPU A;  5AVE A;  3GDI A;  1T18 A;  3UY6 A;  5TBM A;  3W4O A;  4XXR A;  5DKK A;  1MWU A;  3CZD A;  1V9Y A;  2P08 A;  3PBR A;  3O86 A;  1FCO A;  5CHJ A;  4FOF A;  5DVA A;  1OT6 A;  3OPL A;  1I2S A;  2HDQ A;  2HGV A;  1RCJ A;  4MBH A;  2XLN A;  3HLB A;  2EX2 A;  3CPT B;  2H5S A;  2Q9M A;  4Q8I A;  1GSX A;  2P04 A;  3BFD A;  4OQH A;  2XD5 A;  2J3W A;  2JKT M;  1KVM A;  4K91 A;  4X1L A;  1MKI A;  4KZ7 A;  4Q0J A;  2ZOI A;  1LT0 A;  4EEP A;  2EWV A;  4OP8 A;  4LPZ A;  3PBS A;  2HV1 A;  2EFX A;  2O9B A;  3KYQ A;  1LSX A;  4BD0 A;  4NEE D;  1K25 A;  1HLU P;  4LGW A;  4O7D A;  2V1A A;  5DTS A;  3HLD A;  2JKF A;  4YFM A;  5EVI A;  1ODV A;  4S2P A;  1TEM A;  3VP3 A;  2Y79 A;  4QHC A;  1BZA A;  4UQI M;  2W3H A;  1H3Q A;  3MZD A;  3Q7V A;  3P98 A;  1N4O A;  2D01 A;  2WKE A;  2JN7 A;  4X55 A;  5FAO A;  3V3R A;  5TBM B;  3UMD A;  4YWZ A;  4YIN A;  3N7W A;  3P01 A;  5DFX A;  1NZU A;  3LIB A;  3PHY A;  3HLC A;  3IWO A;  4LRX C;  3VP2 A;  3KYZ A;  2WZX A;  1WA9 A;  3E98 A;  5EUA A;  2Y2I A;  2WKR A;  3E4P A;  1TDG A;  3LY4 A;  3TJZ C;  4L9F A;  4NXG A;  2WZZ A;  3T4S A;  2P9V A;  2OWH A;  4FTX A;  3BW6 A;  1PI5 A;  3IBJ A;  2VZW A;  1YLW A;  1VHM A;  2H10 A;  1GA9 A;  3MXS A;  1FSW A;  5DF7 A;  4MCW A;  5AJG A;  3EWK A;  5CGS A;  2J7V A;  3DWK A;  1GHP A;  1NLZ A;  5JYO A;  5FQJ A;  5FQQ A;  1BTL A;  2ZM8 A;  5DF8 A;  1FOF A;  1W7F A;  1D7E A;  2G2U A;  5CGW A;  3UE3 A;  2G2W A;  3EEA A;  3IS2 B;  2ZC7 A;  1CJF A;  2XFT A;  4GD8 A;  3Q81 A;  1K4E A;  1ONG A;  1ZHH B;  1RP5 A;  1PIO A;  3QHY A;  4B4X A;  1ES2 A;  3BWL A;  1W5D A;  1F9I A;  4ZRR A;  3LEQ A;  4DE3 A;  4BD1 A;  1OT9 A;  1E25 A;  2VLG A;  3MMH A;  2W3F A;  1Z09 A;  3F1O B;  4FD8 A;  5FQM A;  2PT7 A;  3NOT C;  5E2E A;  3LFV A;  3IF5 A;  3WRT A;  1K56 A;  4GS9 B;  1PNE A;  2PD8 A;  1SCW A;  1AXB A;  4WL9 A;  5FQ9 A;  3NDE A;  1XPB A;  3CHW P;  4UA7 A;  4ESP A;  4R0Q A;  1GSV A;  1XJ3 A;  2HP6 A;  2OOL A;  4X25 A;  3WS1 A;  1SDE A;  1KDW A;  1L0E A;  1Z6F A;  1NRF A;  2DRW A;  4DXB A;  4WUJ A;  4Y15 A;  3S7O A;  1XGJ A;  3ZG8 B;  4LLO B;  3OPP A;  1K57 A;  3IBR A;  3UE6 A;  5GLA A;  3NDG A;  1ZG4 A;  3DW0 A;  2B5R A;  2ZL1 B;  3U4L P;  1BUL A;  3QP8 A;  1W63 Q;  4JGR A;  4NXB A;  4F3L A;  4EES A;  2D02 A;  3QP6 A;  5CEC A;  4WMC D;  3HLW A;  1YMX A;  2FFY A;  5FDS A;  1HVB A;  1A0K A;  2XFS A;  4MNR A;  3MJQ A;  3IWQ A;  3S1Y A;  2R78 A;  4QJG A;  3CWF A;  3PXP A;  3MFX A;  2M7V A;  3SW1 A;  3RJU A;  1S6R A;  2WKH A;  2HDS A;  3ZNY A;  2V8C A;  2WGI A;  3AGE A;  4KQQ A;  1PZO A;  4AFI A;  3GMW A;  2QPN A;  4CLC D;  4S2J A;  1J3W A;  4BWI A;  1XGI A;  1SDN A;  5KSC A;  3LI9 A;  1YPR A;  2QWS A;  4M3K A;  3BY9 A;  3LEZ A;  2ZD8 A;  4DRT A;  3EEH A;  5L2F A;  4UHU A;  2L1M A;  3BRM A;  5KSH A;  1K38 A;  4YNR A;  5LBR A;  3SH7 A;  4EXO A;  3LID A;  4BQM A;  3JVV A;  4RQ9 A;  4CLC A;  3CUE A;  1XA7 A;  2V0W A;  2NUP C;  1NJ4 A;  2ZQD A;  5HAI A;  3EGD C;  3QNB A;  4DF6 A;  1ONH A;  3NBL A;  5KIZ A;  3HL9 A;  4R3B A;  1O7E A;  2A24 B;  2WKI A;  3VSK A;  2ZC5 B;  3DTM A;  5F6A A;  3RXW A;  3CG5 A;  3LIF A;  1VM1 A;  4ZDX A;  1H0M A;  3BEB A;  3BQA A;  3LR5 A;  1KE3 A;  2Q0O A;  3VP0 A;  3LUQ A;  3FG8 A;  1NZO A;  2HPB A;  4WM9 A;  3CI6 A;  1TS6 A;  4A5R A;  4OP5 A;  1TF1 A;  1QMF A;  3NY4 A;  5GHY A;  5AQA A;  4WLA A;  1K54 C;  2LB9 A;  4HOI A;  4OOM A;  3ZVT A;  4ZJ1 A;  3ZGA B;  4ARZ A;  3ZG9 B;  2V8F A;  5CHM A;  2P9V B;  3FPW A;  2E8J A;  3UO9 A;  1VEU A;  4MBK A;  1WE4 A;  4E6W A;  3NOP C;  2O0Y A;  4CJN A;  3IHA A;  1MZU A;  1KGE A;  5DTT A;  1FSY A;  4R23 A;  5DKL A;  5HWT A;  1I2W A;  1HTZ A;  3HBR A;  2HZ5 A;  3G6O A;  3V67 A;  4I5S A;  3R7W B;  4WMC A;  4E04 A;  2C6W B;  4S2O A;  1N9L A;  3M2J A;  4PPR A;  3IXB A;  2VJW A;  4KG2 A;  1IYS A;  3L7H A;  4QWO A;  4X53 A;  1G68 A;  1D1J A;  4F3L B;  2ACG A;  4NET A;  4JPM A;  1DJC A;  4B9O A;  2K31 A;  1ZTU A;  2Y2Q A;  4OOL A;  3M2K A;  4E3N A;  3NUL A;  4O0P A;  1MKM A;  3N6I A;  3VOY A;  5HAR A;  1L0D A;  3MQ0 A;  1NWZ A;  3PTE A;  3P09 A;  2JE5 A;  4WZ5 C;  4Y0U A;  2DMW A;  2JBF A;  3M6B A;  1OJ5 A;  3UE0 A;  5J7E A;  5KZH A;  4OLD A;  1UGU A;  4G3V A;  2X71 A;  1H8M A;  4F94 A;  4QY6 A;  4GNU A;  1F5M A;  4WZ4 A;  3WS0 A;  5EOO A;  4S2N A;  3MXR A;  4L9E A;  4Y0O A;  4MBF A;  2ZLY A;  4B88 A;  2PR6 A;  1MC0 A;  1LI9 A;  1TS8 A;  5E2F A;  2WAE A;  2VGL S;  5FI2 A;  4FCF A;  3ITB A;  2ZM2 A;  1TD5 A;  3S7P A;  4QY5 A;  2YKF A;  5L8M A;  2W0N A;  2Y2K A;  1SKO B;  3OCN A;  3KSH A;  3TOI A;  1YLY A;  3GRJ A;  3NJA A;  3UDF A;  4X56 A;  2GNX A;  2Y2P A;  4S2I A;  1BT5 A;  1IKG A;  4PKY G;  2A49 A;  5I94 A;  3KX0 X;  3T4L A;  5G4Y A;  3MQO A;  4P0M A;  2H0T A;  2Z2L B;  5E43 A;  2HP5 A;  2EA9 A;  3IHB A;  4LRZ E;  3A3D A;  4JBF A;  5CER A;  1ACF A;  4HJ4 A;  2B18 A;  4EET B;  4JXW A;  2PBD P;  3N4I A;  2GZA A;  1G28 A;  1RGY A;  2VV8 A;  1XA1 A;  4I3A A;  1YSP A;  2VKS A;  3T1S A;  2QHK A;  3ZG7 B;  4EV4 A;  1FCM A;  1YLZ A;  2JHE A;  3FKV A;  3UB5 P;  1MPL A;  4ID4 A;  3IXG A;  3HLF A;  2W1T B;  1H8Z A;  4XT2 B;  1OTE A;  3C4O A;  1M6K A;  4OVD A;  4ZJ2 A;  2OLU A;  3NHQ A;  3RFB A;  3UPP A;  3D72 A;  4LV2 A;  3LO7 A;  4HH3 A;  5HD3 A;  4KZ5 A;  2M1C A;  1JVJ A;  1XJ6 A;  3E4Q A;  4CLC E;  4DE2 A;  3ITA A;  2UWX A;  1EW0 A;  1NXY A;  3G4P A;  5HWW A;  2QKP A;  4ZTK A;  3OZH A;  5EVI B;  1K6S A;  1PWD A;  1MWR A;  4NXE A;  1VB6 A;  2WGV A;  3PBN A;  4E3O A;  3OOV A;  1ZC2 A;  1P97 A;  3BFF A;  2ZM0 A;  5HPF A;  2BAS A;  1KE0 A;  3C5A A;  3F1P B;  4KZ6 A;  4FH4 A;  3D9Y A;  5MC7 A;  2VEA A;  1L0G A;  4JF6 A;  5HD5 A;  4O8G A;  4NK3 A;  2JC7 A;  1JWZ A;  5F5Y A;  1L0F A;  2PHY A;  1S1Y A;  2QJ5 A;  3HLE A;  3ICY A;  4H6J B;  4II7 A;  2VK3 A;  4KZ4 A;  3HVF A;  5DJU A;  2WKQ A;  2MJ6 A;  4R4R A;  1ES5 A;  4HI4 A;  4LV0 A;  4Z9Q A;  3VP4 A;  4ETZ A;  4P6Z M;  2XEP A;  3HJI A;  3VSL A;  5EOE A;  4E3K A;  2OAP 1;  1N9N A;  2Y4A A;  4QD4 A;  3LR4 A;  1EI5 A;  1LI0 A;  2VGK A;  3M6H A;  3IX4 A;  5BOH A;  2VGL M;  5D3O A;  4DE0 A;  3A3I A;  1YLJ A;  4DE1 A;  1S4S A;  4CLC C;  1VET B;  4QU3 A;  3W8K A;  2ZC4 B;  4E3M A;  4LFU A;  4S2N C;  3QP5 A;  4HBT A;  5FAS A;  4ZBE A;  2Q9N A;  2ZQ8 A;  4IUK A;  5HL1 A;  5A93 A;  3DTI A;  1S1Z A;  3CMZ A;  3H7W A;  1TS7 A;  1DP6 A;  3BM6 A;  3GVB A;  2A2L A;  3OC2 A;  1LSV A;  3LIE A;  3QNC A;  3WS4 A;  2Y2J A;  2BG1 A;  1ZG6 A;  4EBN A;  3E0Y A;  4HHD A;  5A91 A;  2L0W A;  1KGF A;  1IYO A;  2XD1 A;  3LIA A;  5TR7 A;  5A8B A;  1PFL A;  3V50 A;  2Y2H A;  2PU4 A;  3UME A;  4XUX A;  3NOU C;  2W3D A;  4MN7 A;  5EV0 A;  3VE4 A;  1BLP A;  2JKT I;  3H82 B;  5HAQ A;  5E2H A;  4R1G A;  5HDC A;  5EVL A;  3ZQ5 A;  5M1A A;  2WGW A;  3L9K A;  4RA7 A;  3K3C A;  3K2N A;  2K2N A;  1LSW A;  4BJP A;  5TGF A;  2H28 A;  5EM0 A;  4GJ4 A;  1XKZ A;  3PAG A;  4WZ5 A;  1KGG A;  2ZJ9 A;  3E2K A;  4KZ9 A;  4DJ3 A;  2PYR A;  4R70 A;  2QMI A;  4X69 A;  5I5L A;  2ZQ7 A;  4K0X A;  3VOL A;  1IKI A;  3DTK A;  2HJ9 C;  1FQG A;  1GSW A;  3Q07 A;  3S22 A;  4D2O A;  5GLD A;  3BFG A;  1DRM A;  1GA0 A;  3OCL A;  3PR6 A;  2XA7 M;  3MKF A;  3HCY A;  3VP1 A;  4E3J A;  2C5W B;  3IF6 C;  5G4Z A;  4P87 A;  4KG6 A;  3OPH A;  2V0U A;  5FAT A;  4X6T A;  1GHI A;  4IED A;  3EOI A;  3B47 A;  3DWZ A;  4GLQ A;  1NLY A;  3A0S A;  4EQI A;  1LLB A;  3D3O A;  2ZC3 B;  4H8R A;  5TJJ A;  1PYY A;  2EXB A;  1YKD A;  5CED A;  1OTB A;  3CLO A;  5FAP A;  5J4E A;  3T4K A;  3UB6 A;  1Q2P A;  2DNS A;  1YSQ A;  3FWL A;  2WUQ A;  3E2L A;  4GHI B;  2KOI A;  4PHT A;  2J3T D;  4KZA A;  1P9R A;  4I3J A;  4WYY A;  3O87 A;  1KVL A;  3C30 A;  3GTC A;  4GCZ A;  4H6J A;  4BLM A;  1W63 M;  5DF9 A;  1K57 C;  3LIC A;  2OV5 A;  3IF6 B;  3UN7 A;  2J80 A;  1N9O A;  1XX2 A;  4Y17 A;  4GDN A;  4DDS A;  4GS9 A;  4PM9 A;  3VFF A;  5DJT A;  2RCX A;  4NKP A;  4R3A A;  3ZHH A;  3KO6 A;  3F1O A;  2IWD A;  3SH9 A;  3GV9 A;  3V39 A;  3HRE A;  1ZKJ A;  4N9L A;  4CQH A;  2W3E A;  3Q7Z A;  1Q2Q A;  3UE1 A;  1Y54 A;  4O01 A;  4OPY A;  2XK1 A;  3ZVW A;  5L09 A;  2XA7 S;  1TVF A;  5GL9 A;  3H82 A;  1SHV A;  3IXD A;  1ALQ A;  2Y2M A;  2PU2 A;  2VV7 A;  4ZJ3 A;  4HIA A;  4EWF A;  3T4O A;  1JWV A;  4R4S A;  1JWP A;  4OQG A;  2XR0 A;  4N1H A;  1IEM A;  3FC7 A;  1K54 A;  3UB9 A;  5FQI A;  3FV7 A;  4N1X A;  3LY3 A;  1PWG A;  3ULF A;  4EUZ A;  3W2Z A;  2I9V A;  2EFU A;  2HJE A;  1H5X A;  4IVI A;  4OOY A;  1STZ A;  4LCL A;  3GQZ A;  3H7W B;  4RVA A;  3IXH A;  3IH9 A;  3KSI A;  3ZFZ A;  2WAF A;  2HDU A;  1ES4 A;  2R9X A;  4PM5 A;  2J9P A;  3MZF A;  3P7N A;  3T1X A;  3LR3 A;  4LV1 A;  4IHQ A;  5GLC A;  3N8R A;  5CRF A;  1VET A;  4OON A;  1XFN A;  5HWV A;  3PBT A;  1M40 A;  4GOG A;  3UPN A;  1TDL A;  1LL5 A;  3NI9 A;  4EEU A;  4EER A;  4FH2 A;  3WWX A;  4EUV A;  5TFQ A;  4DMZ A;  2AVX A;  3WRZ A;  2BTF P;  3HUN A;  1LHY A;  4GD6 A;  2ZL1 A;  3PAE A;  2G7U A;  2B95 A;  1PW1 A;  4JXG A;  4BMW A;  4L0L A;  2JKR I;  2OLV A;  3OBF A;  1JTG A;  2V9A A;  4WEK A;  3GEC A;  1DP8 A;  5HZH A;  3A3E A;  4KQR A;  2GDN A;  1K6R A;  3T1R A;  2ZMV A;  1IYQ A;  3JVU A;  2V20 A;  5CTN A;  5F83 A;  4E3L A;  1DP9 A;  2PDR A;  4GN2 A;  1YM1 A;  3LR0 A;  4C75 A;  4EBP A;  2HP9 A;  3UB7 A;  1WYB A;  1YQS A;  5CEB A;  3F1P A;  4XUZ A;  3B3X A;  3C8C A;  5M18 A;  1VQQ A;  2XGN A;  3MXQ A;  4E6X A;  3PBO A;  1K55 C;  1W8Q A;  3O88 A;  4DN0 A;  1G6A A;  2Y2N A;  5CHU A;  4OPR A;  4ZAM A;  2Y59 A;  1IFQ A;  1CEG A;  5EVI C;  4X68 A;  3IS2 A;  2FZ0 A;  3VV4 A;  3MKE A;  2HF6 A;  3MQQ A;  3HJK A;  3MZE A;  2Y2G A;  4G3K A;  1CI9 A;  5HFO A;  3T1Q B;  5C5K A;  4X1M A;  3R7W A;  3EQU A;  1FR6 A;  1PWC A;  2Y8H A;  1FCN A;  2RL3 A;  3ZG5 A;  4KEN B;  1D06 A;  3T4J A;  2IWB A;  4HQA A;  1O07 A;  4B4Z A;  4B93 A;  4L9G A;  1T1A A;  1SZV A;  1CK3 A;  2H0Y A;  1E3U A;  3IX3 A;  4GHI A;  3SH8 A;  2V1B A;  3R4K A;  1Y28 A;  3Q1F A;  3VE3 A;  1OJG A;  3HLG A;  4JGO A;  1C3B A;  1CQA A;  4ARZ B;  2VGJ A;  3SZT A;  5G18 A;  3G32 A;  4UEY A;  2Z2M B;  3VFH A;  1U60 A;  4PM8 A;  5U47 A;  4MMN A;  2ZMA A;  4GW9 A;  1EWZ A;  5HL6 A;  3ZCZ A;  5HX9 A;  3JYI A;  1BLS A;  1YT4 A;  2CMN A;  2PD7 A;  1MY8 A;  5EVE A;  3Q7V B; 
#chains in the Genus database with same CATH homology
 4HBU A;  1YLT A;  3SS3 A;  5L2F A;  4UHU A;  2WK0 A;  3QNC A;  1MBL A;  1NY0 A;  3WS4 A;  2Y2J A;  3UPO A;  3BRM A;  3MBZ A;  2BG1 A;  3IH8 A;  1ZG6 A;  5KSH A;  1K38 A;  4EBN A;  3IQA A;  3NCK A;  3S4X A;  1NYM A;  5A91 A;  1KGF A;  1RGZ A;  3SH7 A;  1IYO A;  4BQM A;  2XD1 A;  1J9M A;  5TR7 A;  4DDY A;  1W79 A;  3V50 A;  4IBX A;  4BEN A;  5A92 A;  2Y2H A;  2PU4 A;  5EVI D;  5FDH A;  4KZ3 A;  1XA7 A;  4K0W A;  4PMA A;  4GKU A;  5M19 A;  1XXM A;  4XUX A;  4OH0 A;  1BLP A;  5HAQ A;  5F82 A;  1NJ4 A;  2ZQD A;  5E2H A;  5HAI A;  3FKW A;  3IT9 A;  4BL3 A;  4R1G A;  5EVL A;  4JXS A;  5M1A A;  1K4F A;  2WGW A;  3QNB A;  3VMA A;  3G2Y A;  4RA7 A;  5GLB A;  4DF6 A;  2P74 A;  1ONH A;  3NBL A;  4C3Q A;  4U0T A;  3HL9 A;  1HZO A;  5TGF A;  4R3B A;  4BJP A;  1XKZ A;  2EXA A;  2Y2O A;  1O7E A;  2Y2L A;  3PAG A;  1KGG A;  4GZB A;  2WKI A;  2ZJ9 A;  4IVK A;  2ZC5 B;  4WZ5 A;  1K56 D;  5GHZ A;  3NC8 A;  1NYY A;  3VSK A;  5HAP A;  3E2K A;  3DTM A;  3WS2 A;  2WYX A;  3RXW A;  4KZ9 A;  3CG5 A;  1L2S A;  1VM1 A;  2WGW B;  3G30 A;  4JF4 A;  2QMI A;  2XF3 A;  4X69 A;  4ZDX A;  3BEB A;  2ZQ7 A;  1DY6 A;  4K0X A;  5CXW A;  4OLG A;  1KE3 A;  3A3J A;  1IKI A;  5CTM A;  3VP0 A;  1FQG A;  1W8Y A;  3PBQ A;  4OPQ A;  4P85 A;  3Q07 A;  3BFC A;  3N8L A;  3S22 A;  1NZO A;  2HPB A;  4D2O A;  4WM9 A;  4Y0T A;  5GLD A;  2BLS A;  3BFG A;  3AGF A;  5EPH A;  1PZP A;  4A5R A;  1GA0 A;  3OCL A;  4OP5 A;  1SKF A;  4PM6 A;  2X02 A;  3GSG A;  4LEN A;  3MKF A;  1QMF A;  5EE8 A;  3NY4 A;  4OPZ A;  4GB7 A;  3VP1 A;  4E3J A;  1FR1 A;  2ZC6 B;  5GHY A;  1ESU A;  2C5W B;  3RXX A;  5AQA A;  3IF6 C;  1K54 C;  4OOM A;  4P87 A;  4KG6 A;  3V3S A;  2HDR A;  4KQO A;  3OPH A;  4JXV A;  3ZVT A;  4ZJ1 A;  5FAT A;  3ZGA B;  2JCH A;  1GHI A;  4X6T A;  1I5Q A;  4IED A;  3ZDJ A;  2OSU A;  3ZG9 B;  3DWZ A;  5CHM A;  1BLH A;  2P9V B;  1MWT A;  4CPK A;  4LV3 A;  4EQI A;  5F1F A;  4QB8 A;  1LLB A;  4P6B A;  3UO9 A;  2V2F F;  2WAD A;  1WE4 A;  4MBK A;  4UAA A;  4E6W A;  2ZC3 B;  3C7V A;  4CJN A;  3IHA A;  1KGE A;  4H8R A;  1PYY A;  5DTT A;  2EXB A;  3BEC A;  3FZC A;  1K55 A;  3BYD A;  5CED A;  1FSY A;  4R23 A;  1E3U D;  1I2W A;  1HTZ A;  3UNW A;  3HBR A;  3W4P A;  4OKP A;  5FAP A;  3SOI A;  1PW8 A;  2Y55 A;  1HD8 A;  3G34 A;  4WMC A;  2C6W B;  1ESI A;  1KDS A;  5E2G A;  3TG9 A;  3SS4 A;  1Q2P A;  2DNS A;  4OQI A;  4S2O A;  2V1Z A;  3FWL A;  3M2J A;  4N92 A;  4PPR A;  3UY6 A;  3IXB A;  3W4O A;  4KG2 A;  2WUQ A;  3E2L A;  1IYS A;  4XXR A;  5HW3 A;  2IWC A;  1MWU A;  4U0X A;  3CZD A;  4X53 A;  1G68 A;  4KZA A;  5FAQ A;  4GDB A;  3A3F A;  4WYY A;  3O87 A;  4R3J A;  1KVL A;  1MWS A;  3GTC A;  3MFD A;  4BLM A;  4NET A;  4JPM A;  3PBR A;  1DJB A;  1DJC A;  3O86 A;  5DF9 A;  1FCO A;  1K57 C;  1KE4 A;  5CHJ A;  5DVA A;  2QZ6 A;  2OV5 A;  3IF6 B;  3OPL A;  3UN7 A;  2Y2Q A;  1I2S A;  2HDQ A;  4OOL A;  1RCJ A;  1XX2 A;  4MBH A;  2XLN A;  3HLB A;  3M2K A;  4E3N A;  4GDN A;  2EX2 A;  4DDS A;  4PM9 A;  3N6I A;  2H5S A;  2Q9M A;  3VFF A;  2RCX A;  4Q8I A;  3VOY A;  5HAR A;  5AQB A;  3ZHH A;  2XH9 A;  3BFD A;  4OQH A;  4Y7P A;  1L0D A;  2XD5 A;  4UA9 A;  2IWD A;  3SH9 A;  1KVM A;  3PTE A;  3V5M A;  4K91 A;  3P09 A;  2JE5 A;  4WZ5 C;  4Y0U A;  1ERO A;  1MKI A;  4KZ7 A;  2JBF A;  3GV9 A;  3M6B A;  3UE0 A;  3V39 A;  5KZH A;  3HRE A;  4OLD A;  3HUO A;  4IBR A;  1ZKJ A;  4N9L A;  3Q7Z A;  1Q2Q A;  2X71 A;  3UE1 A;  1Y54 A;  5FSR A;  3I7J A;  3LEZ A;  4OP8 A;  4RX3 A;  4JLF A;  3BLM A;  4QY6 A;  4F94 A;  3PBS A;  4GNU A;  4OPY A;  4WZ4 A;  2XK1 A;  2EFX A;  3WS0 A;  1CEF A;  3ZVW A;  1BLC A;  3UDX A;  5EOO A;  2A3U A;  4S2N A;  1TVF A;  5GL9 A;  3MXR A;  1SHV A;  3VOZ A;  3IXD A;  1ALQ A;  1YMS A;  2Y2M A;  4Y0O A;  3C7U A;  1K25 A;  2ZLY A;  4MBF A;  4BD0 A;  3W4Q A;  4B88 A;  2PU2 A;  2XDM A;  1LI9 A;  5J8X A;  3C4P A;  4ZJ3 A;  4O7D A;  2WAE A;  5E2F A;  4EWF A;  5DTS A;  3HLD A;  1YLP A;  1JWV A;  4R4S A;  1JWP A;  3LCE A;  2XR0 A;  4OQG A;  2ZQ9 A;  1ES3 A;  4N1H A;  4S2P A;  1IEM A;  4FCF A;  1TEM A;  4YFM A;  5DTK A;  5EVI A;  3ITB A;  5FI2 A;  3VP3 A;  4QHC A;  4EBL A;  2ZM2 A;  3IF6 A;  1K54 A;  1BZA A;  4WEJ A;  5FQI A;  3FV7 A;  4N1X A;  4QY5 A;  3EQV A;  3LY3 A;  5A90 A;  1PWG A;  4EUZ A;  2Y2K A;  3OCN A;  1OME A;  3MZD A;  4RX2 A;  3Q7V A;  3P98 A;  1N4O A;  3TOI A;  2EFU A;  1GHM A;  1YLY A;  2E8I A;  1H5X A;  2R9W A;  4IVI A;  4OOY A;  2WKE A;  4MLL A;  4LCL A;  4X55 A;  3GQZ A;  3GRJ A;  4RVA A;  3IXH A;  5FAO A;  3IH9 A;  3UDF A;  4X56 A;  3V3R A;  3ZFZ A;  4UA6 A;  2WAF A;  2Y2P A;  4S2I A;  4YIN A;  1BT5 A;  2HDU A;  1IKG A;  3N7W A;  1ES4 A;  2R9X A;  4PM5 A;  1NZU A;  2J9P A;  3MZF A;  2A49 A;  3HLC A;  4E3I A;  3IWO A;  5I94 A;  3UDI A;  3VP2 A;  4LV1 A;  1S0W A;  2H0T A;  2Z2L B;  4P0M A;  5E43 A;  2WZX A;  5GLC A;  2CC1 A;  1LL9 A;  3N8R A;  5EUA A;  5JYP A;  2HP5 A;  5CRF A;  2Y2I A;  3IHB A;  4OON A;  3A3D A;  4N9K A;  5F1G A;  3O3V A;  3PBT A;  4JBF A;  5CER A;  2Y91 A;  1M40 A;  1CI8 A;  4PM7 A;  1TDG A;  3LY4 A;  3FYZ A;  4GOG A;  1TDL A;  3UPN A;  4JXW A;  3NIA A;  4S2L A;  2WZZ A;  1LL5 A;  3NI9 A;  3N4I A;  4DXC A;  4FH2 A;  3WWX A;  2P9V A;  2ZQA A;  5TFQ A;  1RGY A;  4U3T A;  1XA1 A;  5AQ7 A;  1PI5 A;  3WRZ A;  1YLW A;  3ZG7 B;  1MXO A;  2H10 A;  1GA9 A;  3MXS A;  1FSW A;  4EV4 A;  1IEL A;  2PBY A;  3HUN A;  5DF7 A;  1LHY A;  1FCM A;  4GD6 A;  5CGS A;  2J7V A;  3PAE A;  1WYC A;  2XQZ A;  1YLZ A;  3FKV A;  3DWK A;  2ZQC A;  1PW1 A;  4JXG A;  1GHP A;  5JYO A;  5FQJ A;  1ERM A;  1MPL A;  3ISG A;  2EX6 A;  5FQQ A;  4L0L A;  4ID4 A;  3IXG A;  2OLV A;  5IHV A;  3HLF A;  1BTL A;  3AGD A;  1H8Z A;  2ZM8 A;  1JTG A;  5FI7 A;  4WEK A;  3C4O A;  5DF8 A;  1M6K A;  3A3E A;  4KQR A;  1FOF A;  1W7F A;  2GDN A;  4OVD A;  4ZJ2 A;  1K6R A;  3WS5 A;  1E4D A;  2G2U A;  5CGW A;  2OLU A;  3UE3 A;  2G2W A;  1GCE A;  3UPP A;  1IYQ A;  1IYP A;  4LV2 A;  3LO7 A;  2V20 A;  2ZC7 A;  3OPR A;  5CTN A;  4KZ5 A;  3HUM A;  5F83 A;  1JVJ A;  3IWI A;  2XFT A;  4GD8 A;  3Q81 A;  3ZG0 A;  4DE2 A;  4E3L A;  3ITA A;  1K4E A;  2UWX A;  4WEL A;  1ONG A;  1NXY A;  2J9O A;  3G4P A;  1RP5 A;  4ZTK A;  1PIO A;  3OZH A;  3QHY A;  5EVI B;  4GN2 A;  1ES2 A;  4B4X A;  1K6S A;  1PWD A;  1MWR A;  4RYE A;  1XP4 A;  1YM1 A;  1W5D A;  4C75 A;  2WGV A;  4EBP A;  3PBN A;  4KG5 A;  4E3O A;  2HP9 A;  1ZC2 A;  1WYB A;  3G31 A;  3BFF A;  4DE3 A;  2EX8 A;  1YQS A;  2ZM0 A;  5CEB A;  4XUZ A;  3B3X A;  4BD1 A;  1E25 A;  1KE0 A;  5M18 A;  4FD8 A;  3C5A A;  1VQQ A;  3GR2 A;  4KZ6 A;  5FQM A;  2XGN A;  4FH4 A;  5E2E A;  2J8Y A;  3IF5 A;  1K56 A;  4S2M A;  3WRT A;  4C6Y A;  3PBO A;  4E6X A;  1L0G A;  1K55 C;  4JF6 A;  1W8Q A;  4NK3 A;  3O88 A;  5CGX A;  1ERQ A;  2JC7 A;  1BSG A;  1SCW A;  1JWZ A;  3Q82 A;  1G6A A;  2Y2N A;  1L0F A;  1AXB A;  5CHU A;  4OPR A;  3SS5 A;  5FQ9 A;  3NDE A;  1XPB A;  3HLE A;  4UA7 A;  4ZAM A;  3D4F A;  2Y59 A;  4R0Q A;  1CEG A;  5KMW A;  4OQ0 A;  1BUE A;  5EVI C;  4S2K A;  4KZ4 A;  4X68 A;  2EX9 A;  3BFE A;  3G2Z A;  5FA7 A;  3HVF A;  2HP6 A;  4BL2 A;  3MKE A;  4DKI A;  3WS1 A;  1N9B A;  3MZE A;  1SDE A;  4WBG A;  4R4R A;  2Y2G A;  1KDW A;  1L0E A;  1Z6F A;  4JKT A;  4MEZ A;  1NRF A;  5FQK A;  4HEF A;  1ES5 A;  2DRW A;  4DXB A;  1CI9 A;  5HFO A;  2X01 A;  1XGJ A;  4LV0 A;  3ZG8 B;  4Z9Q A;  3VP4 A;  3OPP A;  1DJA A;  1K57 A;  2XEP A;  3EQU A;  5GLA A;  1FR6 A;  1PWC A;  3NDG A;  1FCN A;  2RL3 A;  3VSL A;  1ZG4 A;  3ZG5 A;  4KEN B;  3CJM A;  5EOE A;  3DW0 A;  2B5R A;  2IWB A;  4E3K A;  1O07 A;  1BUL A;  5AQ9 A;  4JF5 A;  4B4Z A;  2DCF A;  2I72 A;  2Y4A A;  1CK3 A;  2H0Y A;  1E3U A;  4QD4 A;  5CEC A;  4FSF A;  1H8Y A;  1EI5 A;  3SH8 A;  1LI0 A;  2FFF B;  2VGK A;  3HLW A;  1YMX A;  4WMC D;  2FFY A;  3Q1F A;  1HVB A;  2XFS A;  4MNR A;  3M6H A;  5BOH A;  3S1Y A;  3IWQ A;  3HLG A;  3G35 A;  3BLS A;  1C3B A;  5D3O A;  4QJG A;  4DE0 A;  2VGJ A;  3RJU A;  3A3I A;  5G18 A;  1YLJ A;  1S6R A;  4DE1 A;  2WKH A;  4LCM A;  2HDS A;  3ZNY A;  4QU3 A;  2WGI A;  3N8S A;  3AGE A;  3G32 A;  4KQQ A;  3ZNT A;  1PZO A;  3W8K A;  2Z2M B;  3VFH A;  3GMW A;  2ZC4 B;  1U60 A;  2QPN A;  5FI6 A;  4E3M A;  4S2N C;  4PM8 A;  5U47 A;  4HBT A;  4HES A;  4S2J A;  3TSG A;  2ZMA A;  5GHX A;  1PI4 A;  1XGI A;  1SDN A;  1EWZ A;  1QME A;  3ZCZ A;  5FAS A;  5KSC A;  4ZBE A;  4KZB A;  5EEC A;  5HX9 A;  3JYI A;  2Q9N A;  1BLS A;  2ZQ8 A;  5HL1 A;  5A93 A;  3CMZ A;  4M3K A;  1YT4 A;  3BM6 A;  3GVB A;  4KZ8 A;  1MY8 A;  2ZD8 A;  3OC2 A;  4DRT A;  3Q7V B;  1JTD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...