3O3VA

Crystal structure of clbp peptidase domain
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPFSTLARLENPMPGSAVAQQLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKGDEIIVNKASGYKLGFGKPVLFHAPLARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ClbP x-ray structure, the prototype of a peptidase family associated to NRP production
rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords beta-lactamase
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3o3vA00
1AXBA 2DRWA 3Q07A 3M2JA 4B4XA 3QNCA 5GL9A 3ZG5A 5CTNA 4LCMA 5BOHA 1PIOA 3EQUA 4DKIA 1XP4A 3CMZA 5G18A 1GA0A 2ZC7A 4R4SA 4E6XA 1NXYA 3OZHA 1SKFA 3G31A 3Q82A 1MWSA 2XR0A 3JYIA 1LI0A 5HFOA 3O87A 3OC2A 3N8SA 4E6WA 1L0DA 4S2MA 4X55A 5HARA 3PAGA 2ZD8A 1KE4A 1LHYA 5GLBA 4UHUA 1MWUA 3E2KA 2XK1A 3WS1A 3MZEA 4S2IA 4WELA 3V3SA 3G34A 1MKIA 3UE0A 1BLHA 2JC7A 3G32A 3DTMA 3PBNA 3IWQA 4OQHA 3HBRA 4ID4A 3VP2A 3GSGA 4EBPA 4WMCA 5EVIB 3ITAA 3M2KA 4ZJ1A 4P0MA 5EVID 5A91A 5CTMA 3WRZA 1ZG6A 4P87A 4GN2A 4OLGA 2EXBA 5A92A 1HTZA 4KENB 1ERMA 5KSCA 3VSKA 2QMIA 4K91A 1W8QA 3NI9A 2WADA 4FD8A 4ZDXA 3ZG9B 1FCMA 1QMEA 4Y0TA 4JF5A 3V39A 1C3BA 3LY3A 3VFHA 4E3MA 4LV3A 1K54A 4GD6A 3Q81A 5FI2A 2G2WA 3A3EA 2IWBA 4XUZA 4RX2A 5GHZA 5GLAA 5L2FA 4EUZA 4PM8A 2H0TA 4QB8A 3IF6A 3SS5A 1L0GA 3MBZA 4S2PA 3IHAA 3ZDJA 2QZ6A 3LY4A 1NYMA 3IXHA 4YINA 3RXXA 4E3JA 4K0WA 2OLUA 4X53A 4S2NA 1XXMA 1E3UA 1G68A 2IWDA 1L0FA 1K4FA 1NZUA 4JLFA 1W8YA 3PBSA 3MKFA 1YLYA 1CEGA 3W4OA 4E3LA 3IH9A 1MBLA 4DE0A 5FQKA 3FZCA 4WMCD 1DJAA 1NRFA 2G2UA 4ZAMA 2ZQAA 2HP6A 3M6HA 5EVIA 2OSUA 2HP9A 2ZC4B 4FH4A 3UPPA 1ES5A 1ALQA 1IYQA 3ITBA 4HBTA 1YQSA 4FCFA 2EX6A 2A49A 2JE5A 3Q7VA 3PBRA 2OV5A 3BFCA 1ZG4A 1VM1A 2DCFA 1IELA 3BRMA 2ZQ9A 1J9MA 1JTGA 4KZ5A 1Z6FA 2H10A 2Y2MA 3GMWA 4K0XA 4DRTA 5CEDA 1XX2A 4BENA 5HAIA 3FYZA 1FSWA 1VQQA 1XGIA 2Y59A 5EE8A 2ZQDA 2Y2KA 1Q2QA 1RP5A 3NCKA 4IBXA 3A3FA 1FCOA 3UO9A 3V50A 3W8KA 3C7VA 1IEMA 2C5WB 2C6WB 3BFDA 4JXWA 2WAEA 3LEZA 2XFTA 4C3QA 4Y7PA 5DF8A 3TG9A 3M6BA 5FQJA 4JBFA 3IH8A 4U0TA 4MNRA 2WGIA 1MWRA 4JF4A 1FR6A 1DJBA 1O07A 4IBRA 5DF7A 3UE3A 4UAAA 1K55A 4C6YA 4QJGA 1E3UD 3HLGA 4U3TA 3FKWA 3NDGA 2BG1A 4OPRA 2XDMA 1I2WA 4QU3A 1GCEA 4L0LA 3HLWA 1JWZA 3IWOA 3LO7A 3EQVA 3ZG7B 4E3KA 3MXSA 1WE4A 1MY8A 1RGZA 3MZDA 4N9LA 3ISGA 4DE3A 2VGJA 2Y2NA 5M1AA 5FQQA 3NBLA 1EROA 4EBLA 4UA6A 3VP1A 1YLTA 4WEJA 5FAQA 1Y54A 4ZJ2A 1PWCA 1XA1A 1JWVA 1ESIA 1YLZA 3W4QA 1FCNA 3VP0A 1K6SA 1W79A 2V20A 4KZ8A 2Z2LB 1PWDA 5M18A 3HLEA 4A5RA 1E25A 2P9VB 3IXBA 4GOGA 5E2EA 3N4IA 4QD4A 1CI8A 3NC8A 1K6RA 3VP3A 5DVAA 5I94A 2WUQA 4O7DA 1BUEA 5AQBA 1L0EA 1WYBA 3GVBA 5EVIC 1HVBA 2ZM2A 3OPHA 1JWPA 3ZCZA 4KZ4A 5KSHA 4S2NC 1G6AA 1NZOA 2EX8A 5FATA 3WWXA 5IHVA 3O86A 4OVDA 4BQMA 5E43A 4Y0UA 3OPRA 5M19A 5A93A 4IVIA 1NY0A 3V3RA 2Y2IA 5JYPA 4Q8IA 1GA9A 3QHYA 3G2ZA 4E3OA 3BM6A 4GDNA 4PM6A 3HUMA 2Z2MB 3VOZA 3IF5A 4X68A 2I72A 4H8RA 4JXVA 5CHUA 1PI4A 4D2OA 5GLDA 2GDNA 3ZG8B 2WGWB 4GB7A 5EOEA 3RJUA 3IT9A 3G35A 3ZVWA 4BL3A 1BSGA 1PYYA 5CHJA 3CG5A 3FWLA 2RL3A 5FA7A 3MZFA 2P74A 3VFFA 1QMFA 3B3XA 3O3VA 5AQ7A 4EV4A 3IHBA 4GKUA 2Y55A 3WRTA 1BT5A 2XD1A 1JVJA 1KGGA 4BD1A 1HD8A 3MXRA 1BLSA 1DY6A 1PW1A 1BULA 2X01A 5DTSA 2XGNA 3WS4A 4KQRA 5GHYA 3GV9A 1TVFA 1ES2A 3BEBA 4OOMA 3SOIA 4OOLA 4JF6A 3A3IA 1E4DA 4RX3A 4BJPA 1KDSA 2XEPA 1K38A 1GHIA 4KZ9A 4S2JA 1OMEA 3BYDA 1YT4A 1K56D 1LI9A 3QNBA 2ZC5B 4E3NA 2QPNA 3CZDA 4P85A 4GDBA 5FQMA 2Y2QA 1BLCA 1M40A 4KG5A 4B4ZA 1RGYA 3ZVTA 4CPKA 4DXCA 2WK0A 2OLVA 1ERQA 3IF6C 4EBNA 3P98A 1I5QA 5FSRA 4JXGA 4N1XA 3BLSA 1K57A 4KZAA 4PM9A 3HUNA 2UWXA 3WS0A 3S4XA 4DE2A 4XUXA 2Y91A 4GNUA 1MPLA 5KMWA 2R9XA 4MBKA 3A3DA 4FSFA 1ES3A 4OP8A 3BFFA 2BLSA 4KQOA 5EECA 1L2SA 1YLPA 1SHVA 4OPZA 3GR2A 1JTDA 2ZM0A 2X71A 4S2OA 4R4RA 4CJNA 3P09A 5CECA 2JBFA 4JPMA 3SS3A 4QHCA 4EQIA 4PM7A 1MWTA 1W7FA 3HL9A 5HAQA 4B88A 1ONHA 4FH2A 4IVKA 1RCJA 1K56A 2ZJ9A 4LV1A 5D3OA 4DF6A 5F1FA 2CC1A 4R3BA 4HEFA 3BECA 4WM9A 4DDYA 4EWFA 1TDGA 3O88A 4IEDA 1YLWA 1H8YA 2J9PA 5EPHA 4OH0A 4OOYA 2RCXA 4C75A 2V2FF 3D4FA 1IYSA 2J8YA 4QY5A 3NY4A 2WZXA 1LL5A 3C7UA 3VMAA 1BTLA 1FR1A 1S6RA 3V5MA 1KE3A 1TDLA 4WZ4A 2EX2A 3C4OA 4QY6A 1CEFA 5E2GA 5GLCA 2WGWA 5CEBA 4WZ5A 3AGDA 3N8RA 3SS4A 4OPYA 1CK3A 1YLJA 4GD8A 1PZPA 1XA7A 4UA9A 2ZQCA 1EI5A 1ESUA 1KGEA 1MXOA 1IKGA 2HP5A 1K25A 2WGVA 2HDRA 5FAOA 4E3IA 5TR7A 5J8XA 4YFMA 2PBYA 1KDWA 4OQ0A 4U0XA 4WBGA 4KG2A 5TFQA 3GRJA 3UDXA 3UE1A 3VP4A 3CJMA 2X02A 3N8LA 2R9WA 1Q2PA 5EOOA 3NIAA 4WYYA 4NETA 3VSLA 3G30A 5CHMA 4Z9QA 3LCEA 1S0WA 3W4PA 4BLMA 5KZHA 2H5SA 4OP5A 4OPQA 3BFGA 5U47A 1K54C 1FOFA 2Y2GA 4KZ3A 3RXWA 1TEMA 3C4PA 1ES4A 1K55C 2EXAA 1FQGA 3S22A 2Y2JA 5JYOA 1O7EA 4KZBA 3S1YA 2XD5A 4BD0A 2VGKA 5AQAA 2WKIA 1IYOA 2XLNA 3ZNTA 3ZGAB 3IF6B 1SDEA 2FFYA 4RYEA 3HLCA 4Y0OA 4UA7A 4OLDA 4X69A 1M6KA 2Q9MA 1NJ4A 4P6BA 3MFDA 5E2FA 1KVMA 1KVLA 1EWZA 2EFXA 5FQ9A 3IWIA 3ZG0A 4F94A 1PWGA 3PBTA 5F1GA 4WEKA 4M3KA 2ZC3B 4DE1A 1H5XA 1YMSA 3G4PA 5FI7A 4N92A 4R3JA 3HREA 4KZ6A 4PPRA 4R23A 5CGXA 1I2SA 5DF9A 2Y2HA 1N4OA 1U60A 5CRFA 2ZM8A 3DWKA 3NDEA 2XH9A 3FV7A 1N9BA 3PAEA 3HUOA 4WZ5C 2XFSA 3PBOA 1XGJA 3Q7ZA 5CGWA 3FKVA 5FAPA 2WKEA 5EUAA 4RA7A 2WYXA 2J9OA 3OPLA 2ZQ7A 5DTKA 2FFFB 4GZBA 3UPOA 1ONGA 5CERA 5F83A 3N6IA 4X56A 1K4EA 4X6TA 1K57C 3N7WA 4HBUA 2HDQA 5FASA 3PBQA 4S2LA 4R0QA 3HLBA 3BFEA 2ZC6B 2Y2LA 5CXWA 4ZBEA 4PMAA 2E8IA 4XXRA 4ZJ3A 5GHXA 5HW3A 2WKHA 5FQIA 3DWZA 2HDSA 2PU4A 5HL1A 3OPPA 2Y2PA 1FSYA 2H0YA 2XF3A 3Q1FA 1XKZA 4JKTA 4ZTKA 3E2LA 4JXSA 3HVFA 1SCWA 2JCHA 4MLLA 1PW8A 5DTTA 2Y4AA 1ZC2A 3HLFA 4LV2A 2ZLYA 5EVLA 3UPNA 3GTCA 1XPBA 5TGFA 5FI6A 3WS5A 3C5AA 4DDSA 3G2YA 3HLDA 3WS2A 1YM1A 3GQZA 3IXDA 3A3JA 5F82A 3SH9A 5FDHA 3PTEA 4BL2A 4NK3A 5E2HA 3SH8A 3AGFA 2WAFA 3UDFA 1BZAA 2DNSA 3I7JA 5A90A 1BLPA 3IXGA 3IQAA 3ZFZA 1PI5A 2HPBA 1IYPA 1WYCA 4MBFA 2A3UA 2XQZA 3AGEA 1KE0A 2Q9NA 4S2KA 1LLBA 2ZQ8A 3TOIA 5HX9A 3UDIA 3ZNYA 1NYYA 2Y2OA 5CGSA 4DXBA 1H8ZA 4KZ7A 1YMXA 1HZOA 2HDUA 1SDNA 4N1HA 4OONA 3ZHHA 4LV0A 2B5RA 3DW0A 1GHMA 4KG6A 3UN7A 3SH7A 1CI9A 4KQQA 4R1GA 3VOYA 1GHPA 3TSGA 2IWCA 3OCLA 4LENA 4MBHA 2V1ZA 3UNWA 1KGFA 2EFUA 3BLMA 4MEZA 2WZZA 3MKEA 4PM5A 1LL9A 1PZOA 2EX9A 1W5DA 2PU2A 2ZMAA 1IKIA 4RVAA 3UY6A 2J7VA 5AQ9A 4HESA 3Q7VB 2P9VA 1ZKJA 4LCLA 4OQIA 5HAPA 4OKPA 3OCNA 1DJCA 4N9KA 4OQGA
chains in the Genus database with same CATH superfamily
1AXBA 5F69A 4LCMA 2PYRA 2V0UA 3KSGA 2ZC7A 4IHQA 3OZHA 1SKFA 3GDIA 1F5MA 3O87A 3OC2A 4S2MA 4X1LA 4HOIA 5GLBA 1AWIA 4IUKA 4Q0IA 3UE0A 1BLHA 3DTMA 2K2NA 3PBNA 3HBRA 4EBPA 3GSGA 2L1MA 4WMCA 5MC7A 5A91A 4P0MA 5CTMA 3NULA 4OLGA 2PBDP 4MN5A 3VOLA 3L7HA 3NI9A 2PR6A 2WADA 4FD8A 4JF5A 1K54A 2VGLM 3A3EA 3ICYA 3A0SA 2IWBA 5J4EA 5GLAA 5L2FA 2Y8HA 4QB8A 4DMZA 3IHAA 1NYMA 1G68A 2IWDA 4JLFA 1W8YA 3PBSA 3MKFA 4E04A 3PYPA 4IUHA 1YLYA 1CEGA 2HGVA 2JKRI 5FQKA 2ZQAA 5EVIA 2OSUA 2EA9A 4FH4A 1ES5A 3H82B 4KUKA 2PRFA 3ITBA 4HBTA 1LSVA 3MMHA 3IBRA 2KLIA 3BFCA 1N9NA 2Y2MA 3GMWA 4DRTA 4K0XA 5HAIA 3VE3A 3BQ8A 1FSWA 2Y59A 3UO9A 1RP5A 2Y2KA 4HJ4A 2WKPA 3A3FA 3V50A 1IEMA 2C5WB 3MQQA 3KYZA 1FR6A 4IBRA 4GJ4A 5F68A 4EEPA 3LR0A 2XDMA 3ZG7B 1V9ZA 1MY8A 3NBLA 3NJAA 5FEFA 5FAQA 1XA1A 1JWVA 1ESIA 5HDSA 4HHDA 2ACGA 1CQAA 2PR5A 4CQHA 1YPRA 4M4XA 1K6RA 3VP3A 2WUQA 5AQBA 1YSPA 4CLCC 2ZM2A 3ZCZA 1G6AA 2EX8A 5IHVA 4OVDA 4BQMA 5E43A 5M19A 3OBFA 4IVIA 3V3RA 2Y2IA 5JYPA 4Q8IA 3RTYA 4X68A 3KX0X 2I72A 2GDNA 3C30A 5FA7A 5FEGA 3D72A 3VFFA 5AQ7A 3IHBA 4GKUA 3WRTA 3QP1A 2J3TC 1JVJA 5J3WA 4BD1A 4EUVA 2OWHA 1PW1A 2X01A 5DTSA 3WS4A 4II7A 1JNUA 3GV9A 2BTFP 1TVFA 2V9AA 4OOMA 4OOLA 4NXFA 4RX3A 1DP9A 4AFIA 2ZC5B 1FILA 2CMNA 2L0WA 4KQDA 4EESA 3CPTA 4PAUA 4GDBA 2Y2QA 4KG5A 1M40A 4B4ZA 3FPVA 1ERQA 1G28A 1SKOB 5FSRA 4LGWA 1K57A 4KZAA 3HUNA 2UWXA 1V9YA 2O0YA 2Y91A 4GNUA 1MPLA 1L3LA 1X0OA 1H8MA 4HP4A 1L2SA 4HI4A 1YLPA 4OPZA 3DBAA 1LSXA 1VETB 1W7FA 4FOFA 1D7EA 4LV1A 1RCJA 2CC1A 4PKYA 4HEFA 3BECA 2J80A 1S4RA 5LBRA 1H8YA 5EPHA 2V2FF 2J8YA 1BTLA 3H7WA 3V5MA 3IBJA 5GLCA 4WZ5A 3AGDA 3E4PA 1G5UA 2OAP1 2HP5A 1MXOA 1IKGA 3LGOA 2J3WA 4U0XA 5TFQA 3UDXA 5EOOA 3NIAA 5CHMA 3W4PA 4OPQA 5HWTA 1N9LA 1OTAA 2PD8A 2E8JA 1TEMA 3S7OA 3JPUA 3T1SA 3SZTA 2VGKA 4NXBA 3UB9A 4B9OA 1IYOA 2EWWA 4WL9A 3HLCA 4X69A 1NJ4A 3MFDA 1KVLA 3IWIA 3ZG0A 3PBTA 2ZC3B 3NOPC 4DE1A 3HREA 5CGXA 1N4OA 1SZVA 5CRFA 3FV7A 1N9BA 3HUOA 2XFSA 3PBOA 5EUAA 4RA7A 2ZQ7A 3LIDA 2FFFB 3CUEC 3UB8A 1G6OA 5TBMA 1K4EA 5FASA 2L4RA 3LR3A 2GJ3A 3U4LP 4PMAA 4ZJ3A 3CLOA 5HW3A 5FQIA 3H82A 3DWZA 3F1PA 1FSYA 5KIZA 3T12B 2ZOIA 3TW8A 3E2LA 2J3TD 4JXSA 3QP4A 4H6JB 2V1AA 4LV2A 3UPNA 5TGFA 4DDSA 3HLDA 3IXDA 3NECA 5E2HA 3AGFA 2WAFA 3IQAA 3ZFZA 4MBFA 2QJ7A 2ZQ8A 4DXBA 2HDUA 4N1HA 4LV0A 1W63Q 4L9EA 1GHMA 2HV1A 1CI9A 4KQQA 4GHIB 1GHPA 3OCLA 2EFUA 5L10A 4DJ3A 2QWSA 4PM5A 2ZMAA 1IKIA 3BQAA 4RVAA 5AQ9A 2P9VA 1ZKJA 4OKPA 1VB6A 1PFLA 2DRWA 3PHYA 3ULFA 1GSVA 5CTNA 5BOHA 4H6JA 1PNEA 1XP4A 2VLGA 3CMZA 3F1NA 4LPZA 4E6XA 2QJ5A 3BW6A 1MWSA 1DP6A 4X55A 5HARA 1KE4A 4EETB 1MWUA 2WKRA 3MZEA 3V3SA 1MKIA 2VK3A 4JGOA 4HJ3A 3DAVA 5DKKA 4ID4A 5EVIB 3E98A 4GN2A 2W27A 4KENB 5AJGA 1W8QA 4ZDXA 1FCMA 4Y0TA 4EERA 3LY3A 4E3MA 4Q0HA 5FI2A 5GHZA 3SW1A 4EUZA 4PM8A 1T1CA 3IF6A 4UEYA 1L0GA 2QZ6A 3LY4A 4YINA 3IXHA 4X53A 1NZUA 3C2WA 1XJ2A 4E3LA 3IH9A 4DE0A 3FZCA 4WMCD 4PHTA 3UPPA 3DTIA 3T1QB 2JE5A 4FUWA 2OV5A 1ZG4A 2DCFA 1IELA 3BRMA 1JTGA 3LIAA 5CEDA 4HJ6A 4I5SA 5HPIA 1Q2QA 3NCKA 1XFNA 4IBXA 1YAXA 3C7VA 3CUEA 3BFDA 4C3QA 2WAEA 4Y7PA 3TG9A 4JF4A 3B47A 3DTEA 4KUOA 1DJBA 5DF7A 3OOVA 4HY8A 4QJGA 3R4KA 4U3TA 3IX4A 3NDGA 4QU3A 4LFUA 3EEAA 3LO7A 1WE4A 4N9LA 3MR0A 3D3OA 4UA6A 3VP1A 1YLTA 1DRMA 1Y54A 2VV7A 1YLZA 3W4QA 2EWVA 3VP0A 1W79A 4KZ8A 5TJJA 1PWDA 5M18A 2HF6A 1E25A 2UV0E 3IXBA 2W1TA 1CI8A 3NC8A 3C8CA 5I94A 4R70A 3KSHA 3GVBA 2M1CA 1NRJA 2VJWA 4WUJA 4Y0UA 4P6ZM 5A93A 2W1TB 2DMWA 1GA9A 3QHYA 2W3DA 1TS8A 3HUMA 3VOZA 4JXVA 2W0NA 5GLDA 3S7NA 5EOEA 3IT9A 3CG5A 1BYWA 2BASA 1QMFA 4EV4A 2Y55A 1BT5A 2XD1A 1KGGA 4JGPA 3MXRA 2VV6A 4O0PA 1BULA 2D01A 1H0MA 1ES2A 3A3IA 3IX8A 1E4DA 2JKRM 1TS7A 1K38A 4G3WA 4NXEA 1GHIA 1Y4OA 4KZ9A 1OMEA 1VETA 1K56D 3EEHA 1LI9A 5I5LA 3CZDA 4P85A 5A8BA 1BLCA 5FL3A 3IF6C 2JHEA 4N1XA 3EWKA 4MBKA 4ETZA 4KQOA 1TD5A 3GR2A 3CAXA 3P09A 1F2KA 5CECA 4GS9A 4EQIA 1PRQA 3HL9A 5HAQA 1ONHA 5D3OA 4R3BA 4NKPA 4DDYA 3O88A 2VZWA 4IEDA 2HZ5A 4C75A 5C5KA 2W3EA 3VMAA 1LL8A 1S6RA 4BBVA 1ODVA 1KE3A 5AVFA 1TDLA 4WZ4A 3C4OA 3FG8A 3N8RA 2YKFA 3SS4A 4OPYA 1YLJA 3HJIA 4GD8A 1PZPA 1XA7A 4X25A 4Y3IA 1XFQA 1EI5A 1KGEA 2WGVA 5J8XA 4R6LA 4YFMA 3R7WA 4OQ0A 4WBGA 3BY8A 2R9WA 4UQIM 4MN7A 4NETA 3G30A 1OJ5A 3BY9A 3LCEA 1P9RA 4OP5A 1OTEA 3IX3A 5U47A 2XRNA 2H28A 4ARZB 1ES4A 1K55C 2EXAA 1FQGA 5JYOA 1O7EA 4GS9B 2XD5A 4BD0A 5AQAA 4WN5A 2XLNA 2PYPA 3ZGAB 4Y2FA 1SDEA 4UA7A 1M6KA 5E2FA 1EWZA 1MKMA 4HH3A 2MJ6A 5F1GA 5DKLA 5FI7A 4PPRA 3S7PA 5FQMA 3Q7ZA 5CGWA 3FKVA 5HDDA 3OPLA 3LUQA 3LI8A 5F83A 5L8MA 2HDQA 3MS6A 1WA9A 1NWZA 4EEUA 2Y2LA 1XJ3A 2E8IA 5HL1A 3VV4A 3OPPA 2Y2PA 3RFBA 2PHYA 2XF3A 4JKTA 1PW8A 5DTTA 1ZC2A 4ARZA 5FI6A 1F9IA 5L07A 3A3JA 3SH9A 5FDHA 3PTEA 4NK3A 3T4LA 1BZAA 2W3FA 2V8CA 5A90A 1BLPA 3A0VA 3IXGA 2ZL1A 2XQZA 3QP8A 1LSWA 5HX9A 4JGQA 2M7UA 1NLZA 2B5RA 2JKGA 3ZQ5A 4R1GA 1N9OA 3TSGA 2IWCA 4MBHA 1W5DA 2PU2A 3CWFA 4HESA 4B93A 4OQIA 1ACFA 1DJCA 4N9KA 3CITA 3ZYTA 3M2JA 3QNCA 5GL9A 3ZG5A 4DKIA 5G18A 1GA0A 4Q0JA 1NXYA 3Q82A 1GSWA 2O9AA 2XR0A 5HFOA 5DJUA 4E6WA 4ETXA 4UHUA 4CLCA 3E2KA 3WS1A 2G7UA 4WELA 4ZRRA 3FPWA 2JC7A 3G32A 4OQHA 4LRXC 3M2KA 4ZJ1A 3MSHA 3VE4A 5A92A 1HTZA 1STZA 3VSKA 2QMIA 4F3LB 4IJGA 4K91A 2GX5A 3ZG9B 3MQ0A 3V39A 1C3BA 2B95A 4LV3A 2PDRA 4HQAA 4GD6A 3UB5P 2G2WA 5EVEA 2H0TA 4F3LA 5HDCA 3MBZA 3ZDJA 4HNBA 4P6ZS 1P97A 3TE8A 1XXMA 1E3UA 1L0FA 2ZMFA 1K4FA 3C38A 1DP8A 3W4OA 1Z09A 4EW7A 1NRFA 3M6HA 2HJEA 2A24A 2HP9A 1ALQA 1YQSA 4FCFA 2EX6A 4EQ1A 2P7JA 3Q7VA 2ZQ9A 1J9MA 1S66L 4KZ5A 1Z6FA 2H10A 1CF0A 1XX2A 2QHKA 4BENA 1OTBA 3QP6A 1VQQA 2A24B 3W8KA 4MN6A 2INWA 2XFTA 5DF8A 5FQJA 4U0TA 1O07A 4UAAA 1K55A 4C6YA 3HLGA 2BG1A 4NXGA 1TS0A 1JWZA 3EQVA 3KSFA 3MZDA 5IT5A 4DE3A 5M1AA 2XA7S 3HCYA 5FQQA 2K7SA 1EROA 1T1AA 4ZJ2A 1PWCA 2OAQ1 2P04A 1FCNA 2V20A 4BMWA 2Z2LB 4A5RA 4QD4A 3D9YA 1BUEA 5EVIC 4JGRA 3OPHA 1JWPA 5KSHA 3B33A 4S2NC 3NOTC 1NZOA 5FATA 3RH8B 1EW0A 3OPRA 4E3OA 4GDNA 2JKFA 3IF5A 4H8RA 4D2OA 4BBTA 3ZG8B 1UWPX 2Y79A 5IU1A 4Z1WA 1BSGA 4BL3A 1PYYA 4GCZA 3FWLA 2P74A 4I3JA 2XROA 3O3VA 3EGXC 2Z6DA 1BLSA 1DY6A 2XGNA 5GHYA 4JF6A 4BJPA 1KDSA 1VHMA 2PT7A 4X1MA 4S2JA 3BYDA 3TJZC 3T50A 2JKTM 1S4SA 3QNBA 4E3NA 2QPNA 2NUTC 2QYBA 4CPKA 2WK0A 2OLVA 1I5QA 4JXGA 5HWWA 3WS0A 5TBMB 3S4XA 4DE2A 4XUXA 5KMWA 1P9WA 4OP8A 5EECA 3UB6A 1SHVA 2XA7M 4CJNA 2JBFA 4JPMA 3SS3A 4QHCA 4Y5FA 4PM7A 2P08A 4B88A 1K56A 2V1BA 2VEAA 5F1FA 4YNRA 4WM9A 4EWFA 3JVVA 2J9PA 4OH0A 4O01A 1IYSA 3NY4A 3C7UA 1FR1A 5E2GA 5EM0A 2WGWA 5CEBA 2O9BA 3F1OB 1CK3A 1W63M 3CI6A 4BWIA 5FAOA 1K25A 3S7QA 2HDRA 2KOIA 3OLOA 5TR7A 4E3IA 1KDWA 1SKOA 4KG2A 3GRJA 3CJMA 4ME4A 3P7NA 3VSLA 3F1NB 4Z9QA 3KYEA 2ZMVA 3BJNA 2H5SA 5G4YA 3BFGA 4I3AA 2W1RA 1FOFA 2Y2GA 4G3KA 3RXWA 3C4PA 2Y2JA 3KO6A 4KZBA 3S1YA 3E4OA 2WKIA 3IF6B 4RYEA 1Y28A 1OT6A 2Q9MA 4P6BA 5FQ9A 1KVMA 5DFYA 1ZHHB 4F94A 5EM1A 4HH2A 4M3KA 4WEKA 4R3JA 2D02A 3LIBA 3QP2A 5DF9A 1U60A 4I3IA 2ZM8A 3DWKA 3L9KA 3NDEA 4WZ5C 2WKEA 2WYXA 2J9OA 3UPOA 5CERA 4R3AA 4X56A 4X6TA 1K57C 3N7WA 4S2LA 4R0QA 3HLBA 5CXWA 4ZBEA 3CPTB 2HDSA 3Q1FA 1XKZA 1TS6A 4ZTKA 5G4ZA 2VGLS 1SCWA 2Y4AA 3HJKA 5EVLA 3UMEA 3KYQA 3C5AA 3G2YA 2JN7A 1GSXA 1D06A 3GQZA 5F82A 5HZHA 3E4QA 4FTXA 1T1BA 3IS2B 5L09A 2GNXA 1S67L 2HPBA 1IYPA 1WYCA 2A3UA 3AGEA 3CHWP 2ZBBA 3T1RA 2Q9NA 1NYYA 2A2LA 2Y2OA 5CGSA 1H8ZA 4KZ7A 2QKPA 1SDNA 4OONA 3H7WB 3UB7A 3SH7A 3T1XA 3LEQA 3UNWA 2WKQA 2I9VA 3MKEA 2PAVP 3W2ZA 1PZOA 2ZOHA 4O8GA 3T4OA 2J7VA 3Q7VB 2HJ9C 5HAPA 5DFXA 4PKYG 4DJ2A 3Q07A 4B4XA 1PIOA 3EQUA 4WF0A 4R4SA 2LB9A 3G31A 3JYIA 1LI0A 3N8SA 1L0DA 3PAGA 4I38A 3KSIA 2ZD8A 1LHYA 3BWLA 1J3WA 5CX7A 2XK1A 4S2IA 5HD5A 3G34A 3PR6A 1OTIA 3IWQA 4XT2B 3VP2A 3MFXA 3ITAA 5EVID 3WRZA 1ZG6A 4BBUA 4P87A 2EXBA 1ERMA 1HLUP 4HP9A 2FH5A 5KSCA 2R78A 1QMEA 1YKDA 4YOFA 4WLAA 3VFHA 1T18A 5FDSA 5DJTA 1VEUA 3Q81A 4K08A 4XUZA 4RX2A 5HWVA 3SS5A 4QWOA 4CLCD 4S2PA 2W3GA 3RXXA 4UQIS 4E3JA 4K0WA 1K0KA 2OLUA 4S2NA 3MF0A 1MBLA 3LFVA 1XJ4A 1DJAA 2G2UA 4ZAMA 2HP6A 2VV8A 2ZC4B 2K31A 3F1PB 1IYQA 4GLQA 2A49A 3PBRA 2OOLA 1VM1A 3V67A 5F5YA 3MQOA 3FYZA 1XGIA 5EE8A 2ZQDA 3B42A 1FCOA 4MMNA 2C6WB 4JXWA 3LEZA 3M6BA 4JBFA 5EFWA 3IH8A 4MNRA 2WGIA 1MWRA 1D1JA 3UE3A 2GZAA 1E3UD 3FC7A 3FKWA 4OPRA 1I2WA 1GCEA 4L0LA 3HLWA 4Y15A 3LIFA 3IWOA 4EXOA 4E3KA 3MXSA 3T4SA 1FIKA 1RGZA 2JKTI 3ISGA 2VGJA 1VEUB 2Y2NA 3LYXA 1F98A 4EBLA 4WEJA 5HD3A 2Q0OA 3PXPA 1K6SA 4G3VA 1UGUA 3HLEA 2P9VB 4GOGA 5E2EA 3N4IA 4Y13A 3K3CA 5DVAA 4O7DA 1L0EA 1WYBA 2OWJA 1HVBA 2V8FA 4ESPA 4KZ4A 4GHIA 3WWXA 3O86A 1TF1A 3GECA 1NY0A 2Z6CA 3G2ZA 3BM6A 3LICA 4NG2A 4PM6A 2Z2MB 2IA2A 1ZTUA 4L9GA 1P0ZA 5CHUA 1PI4A 2WGWB 4GB7A 3RJUA 3ZVWA 3G35A 3F1OA 5CHJA 2RL3A 3MZFA 3O5YA 3B3XA 3UE6A 1HD8A 1OTDA 4KQRA 2VKSA 3BEBA 3SOIA 3LI9A 3EOIA 3K2NA 2FZ0A 2XEPA 4YWZA 1YT4A 5HPFA 2KX6A 1OPXA 5K5BA 4LRYC 1RGYA 3T4TA 2B02A 3ZVTA 4DXCA 2ZL1B 4EBNA 3P98A 4QPRA 2KDKA 3MJQA 3BLSA 4PM9A 3T4KA 5EV0A 2R9XA 3A3DA 4FSFA 1ES3A 4EU0A 3BFFA 2BLSA 2VX8A 1YSQA 2YKHA 1MZUA 1JTDA 2ZM0A 2X71A 4S2OA 4R4RA 3LIEA 1IOUA 5IS1A 3G6OA 4RQ9A 1MWTA 4NEED 4FH2A 4IVKA 2ZJ9A 4DF6A 1MC0A 4Y17A 1S1ZA 1TDGA 3NHQA 1YLWA 1NLYA 4OOYA 2RCXA 3D4FA 2PD7A 4QY5A 2WZXA 1LL5A 1OT9A 1CJFA 2EX2A 2LB5A 4QY6A 1CEFA 3T4QA 2O99A 4UA9A 3MXQA 2NUPC 2ZQCA 1ESUA 4CLCB 4DN0A 1IFQA 2PBYA 5AVEA 3UE1A 3VP4A 2X02A 3N8LA 1Q2PA 4WYYA 3P01A 1S0WA 1A0KA 4BLMA 5KZHA 1UWNX 3K3DA 4GW9A 5F6AA 1K54C 4KZ3A 4R38A 3S22A 3EGDC 3LR5A 3TRCA 2XSSA 4XT2A 3ZNTA 1H3QA 2VA0A 2FFYA 4Y0OA 4OLDA 2EFXA 4I39A 1PWGA 2W3HA 1H5XA 1YMSA 3G4PA 4N92A 4KZ6A 4R23A 1I2SA 2Y2HA 2XH9A 3PAEA 1XGJA 5FAPA 1S1YA 3DTKA 3IS2A 5DTKA 4GZBA 2M7VA 1ONGA 3NOUC 3N6IA 3LR4A 4MDZA 4HBUA 1OJGA 3PBQA 3UMDA 3BFEA 2ZC6B 4L9FA 4MCWA 4XXRA 5GHXA 2WKHA 2PU4A 4D60A 2H0YA 3A0RA 3HVFA 2JCHA 4MLLA 3HLFA 3QP5A 2ZLYA 1LT0A 1XPBA 3GTCA 3WS5A 2B18A 3WS2A 1YM1A 2AVXA 4BL2A 3T4JA 2O9CA 3SH8A 1KOUA 3UDFA 2DNSA 3I7JA 1PI5A 1T19A 5HSQA 1KE0A 4S2KA 1LLBA 2V0WA 3TOIA 3UDIA 3ZNYA 1YMXA 1HZOA 3ZHHA 4HIAA 3E0YA 3U2AA 3DW0A 4KG6A 3UN7A 4CLCE 4LRZE 1XJ6A 3VOYA 4LENA 2V1ZA 3H9WA 1KGFA 3BLMA 4MEZA 2WZZA 4LLOB 5HL6A 5J7EA 1LL9A 2EX9A 3UY6A 3JVUA 4LCLA 3OCNA 3R7WB 4OQGA
chains in the Genus database with same CATH topology
1AXBA 2DRWA 3Q07A 3M2JA 4B4XA 3QNCA 5GL9A 3ZG5A 5CTNA 4LCMA 5BOHA 1PIOA 3EQUA 4DKIA 1XP4A 3CMZA 5G18A 1GA0A 2ZC7A 4R4SA 4E6XA 1NXYA 3OZHA 1SKFA 3G31A 3Q82A 1MWSA 2XR0A 3JYIA 1LI0A 5HFOA 3O87A 3OC2A 3N8SA 4E6WA 1L0DA 4S2MA 4X55A 5HARA 3PAGA 2ZD8A 1KE4A 1LHYA 5GLBA 4UHUA 1MWUA 3E2KA 2XK1A 3WS1A 3MZEA 4S2IA 4WELA 3V3SA 3G34A 1MKIA 3UE0A 1BLHA 2JC7A 3G32A 3DTMA 3PBNA 3IWQA 4OQHA 3HBRA 4ID4A 3VP2A 3GSGA 4EBPA 4WMCA 5EVIB 3ITAA 3M2KA 4ZJ1A 4P0MA 5EVID 5A91A 5CTMA 3WRZA 1ZG6A 4P87A 4GN2A 4OLGA 2EXBA 5A92A 1HTZA 4KENB 1ERMA 5KSCA 3VSKA 2QMIA 4K91A 1W8QA 3NI9A 2WADA 4FD8A 4ZDXA 3ZG9B 1FCMA 1QMEA 4Y0TA 4JF5A 3V39A 1C3BA 3LY3A 3VFHA 4E3MA 4LV3A 1K54A 4GD6A 3Q81A 5FI2A 2G2WA 3A3EA 2IWBA 4XUZA 4RX2A 5GHZA 5GLAA 5L2FA 4EUZA 4PM8A 2H0TA 4QB8A 3IF6A 3SS5A 1L0GA 3MBZA 4S2PA 3IHAA 3ZDJA 2QZ6A 3LY4A 1NYMA 3IXHA 4YINA 3RXXA 4E3JA 4K0WA 2OLUA 4X53A 4S2NA 1XXMA 1E3UA 1G68A 2IWDA 1L0FA 1K4FA 1NZUA 4JLFA 1W8YA 3PBSA 3MKFA 1YLYA 1CEGA 3W4OA 4E3LA 3IH9A 1MBLA 4DE0A 5FQKA 3FZCA 4WMCD 1DJAA 1NRFA 2G2UA 4ZAMA 2ZQAA 2HP6A 3M6HA 5EVIA 2OSUA 2HP9A 2ZC4B 4FH4A 3UPPA 1ES5A 1ALQA 1IYQA 3ITBA 4HBTA 1YQSA 4FCFA 2EX6A 2A49A 2JE5A 3Q7VA 3PBRA 2OV5A 3BFCA 1ZG4A 1VM1A 2DCFA 1IELA 3BRMA 2ZQ9A 1J9MA 1JTGA 4KZ5A 1Z6FA 2H10A 2Y2MA 3GMWA 4K0XA 4DRTA 5CEDA 1XX2A 4BENA 5HAIA 3FYZA 1FSWA 1VQQA 1XGIA 2Y59A 5EE8A 2ZQDA 2Y2KA 1Q2QA 1RP5A 3NCKA 4IBXA 3A3FA 1FCOA 3UO9A 3V50A 3W8KA 3C7VA 1IEMA 2C5WB 2C6WB 3BFDA 4JXWA 2WAEA 3LEZA 2XFTA 4C3QA 4Y7PA 5DF8A 3TG9A 3M6BA 5FQJA 4JBFA 3IH8A 4U0TA 4MNRA 2WGIA 1MWRA 4JF4A 1FR6A 1DJBA 1O07A 4IBRA 5DF7A 3UE3A 4UAAA 1K55A 4C6YA 4QJGA 1E3UD 3HLGA 4U3TA 3FKWA 3NDGA 2BG1A 4OPRA 2XDMA 1I2WA 4QU3A 1GCEA 4L0LA 3HLWA 1JWZA 3IWOA 3LO7A 3EQVA 3ZG7B 4E3KA 3MXSA 1WE4A 1MY8A 1RGZA 3MZDA 4N9LA 3ISGA 4DE3A 2VGJA 2Y2NA 5M1AA 5FQQA 3NBLA 1EROA 4EBLA 4UA6A 3VP1A 1YLTA 4WEJA 5FAQA 1Y54A 4ZJ2A 1PWCA 1XA1A 1JWVA 1ESIA 1YLZA 3W4QA 1FCNA 3VP0A 1K6SA 1W79A 2V20A 4KZ8A 2Z2LB 1PWDA 5M18A 3HLEA 4A5RA 1E25A 2P9VB 3IXBA 4GOGA 5E2EA 3N4IA 4QD4A 1CI8A 3NC8A 1K6RA 3VP3A 5DVAA 5I94A 2WUQA 4O7DA 1BUEA 5AQBA 1L0EA 1WYBA 3GVBA 5EVIC 1HVBA 2ZM2A 3OPHA 1JWPA 3ZCZA 4KZ4A 5KSHA 4S2NC 1G6AA 1NZOA 2EX8A 5FATA 3WWXA 5IHVA 3O86A 4OVDA 4BQMA 5E43A 4Y0UA 3OPRA 5M19A 5A93A 4IVIA 1NY0A 3V3RA 2Y2IA 5JYPA 4Q8IA 1GA9A 3QHYA 3G2ZA 4E3OA 3BM6A 4GDNA 4PM6A 3HUMA 2Z2MB 3VOZA 3IF5A 4X68A 2I72A 4H8RA 4JXVA 5CHUA 1PI4A 4D2OA 5GLDA 2GDNA 3ZG8B 2WGWB 4GB7A 5EOEA 3RJUA 3IT9A 3G35A 3ZVWA 4BL3A 1BSGA 1PYYA 5CHJA 3CG5A 3FWLA 2RL3A 5FA7A 3MZFA 2P74A 3VFFA 1QMFA 3B3XA 3O3VA 5AQ7A 4EV4A 3IHBA 4GKUA 2Y55A 3WRTA 1BT5A 2XD1A 1JVJA 1KGGA 4BD1A 1HD8A 3MXRA 1BLSA 1DY6A 1PW1A 1BULA 2X01A 5DTSA 2XGNA 3WS4A 4KQRA 5GHYA 3GV9A 1TVFA 1ES2A 3BEBA 4OOMA 3SOIA 4OOLA 4JF6A 3A3IA 1E4DA 4RX3A 4BJPA 1KDSA 2XEPA 1K38A 1GHIA 4KZ9A 4S2JA 1OMEA 3BYDA 1YT4A 1K56D 1LI9A 3QNBA 2ZC5B 4E3NA 2QPNA 3CZDA 4P85A 4GDBA 5FQMA 2Y2QA 1BLCA 1M40A 4KG5A 4B4ZA 1RGYA 3ZVTA 4CPKA 4DXCA 2WK0A 2OLVA 1ERQA 3IF6C 4EBNA 3P98A 1I5QA 5FSRA 4JXGA 4N1XA 3BLSA 1K57A 4KZAA 4PM9A 3HUNA 2UWXA 3WS0A 3S4XA 4DE2A 4XUXA 2Y91A 4GNUA 1MPLA 5KMWA 2R9XA 4MBKA 3A3DA 4FSFA 1ES3A 4OP8A 3BFFA 2BLSA 4KQOA 5EECA 1L2SA 1YLPA 1SHVA 4OPZA 3GR2A 1JTDA 2ZM0A 2X71A 4S2OA 4R4RA 4CJNA 3P09A 5CECA 2JBFA 4JPMA 3SS3A 4QHCA 4EQIA 4PM7A 1MWTA 1W7FA 3HL9A 5HAQA 4B88A 1ONHA 4FH2A 4IVKA 1RCJA 1K56A 2ZJ9A 4LV1A 5D3OA 4DF6A 5F1FA 2CC1A 4R3BA 4HEFA 3BECA 4WM9A 4DDYA 4EWFA 1TDGA 3O88A 4IEDA 1YLWA 1H8YA 2J9PA 5EPHA 4OH0A 4OOYA 2RCXA 4C75A 2V2FF 3D4FA 1IYSA 2J8YA 4QY5A 3NY4A 2WZXA 1LL5A 3C7UA 3VMAA 1BTLA 1FR1A 1S6RA 3V5MA 1KE3A 1TDLA 4WZ4A 2EX2A 3C4OA 4QY6A 1CEFA 5E2GA 5GLCA 2WGWA 5CEBA 4WZ5A 3AGDA 3N8RA 3SS4A 4OPYA 1CK3A 1YLJA 4GD8A 1PZPA 1XA7A 4UA9A 2ZQCA 1EI5A 1ESUA 1KGEA 1MXOA 1IKGA 2HP5A 1K25A 2WGVA 2HDRA 5FAOA 4E3IA 5TR7A 5J8XA 4YFMA 2PBYA 1KDWA 4OQ0A 4U0XA 4WBGA 4KG2A 5TFQA 3GRJA 3UDXA 3UE1A 3VP4A 3CJMA 2X02A 3N8LA 2R9WA 1Q2PA 5EOOA 3NIAA 4WYYA 4NETA 3VSLA 3G30A 5CHMA 4Z9QA 3LCEA 1S0WA 3W4PA 4BLMA 5KZHA 2H5SA 4OP5A 4OPQA 3BFGA 5U47A 1K54C 1FOFA 2Y2GA 4KZ3A 3RXWA 1TEMA 3C4PA 1ES4A 1K55C 2EXAA 1FQGA 3S22A 2Y2JA 5JYOA 1O7EA 4KZBA 3S1YA 2XD5A 4BD0A 2VGKA 5AQAA 2WKIA 1IYOA 2XLNA 3ZNTA 3ZGAB 3IF6B 1SDEA 2FFYA 4RYEA 3HLCA 4Y0OA 4UA7A 4OLDA 4X69A 1M6KA 2Q9MA 1NJ4A 4P6BA 3MFDA 5E2FA 1KVMA 1KVLA 1EWZA 2EFXA 5FQ9A 3IWIA 3ZG0A 4F94A 1PWGA 3PBTA 5F1GA 4WEKA 4M3KA 2ZC3B 4DE1A 1H5XA 1YMSA 3G4PA 5FI7A 4N92A 4R3JA 3HREA 4KZ6A 4PPRA 4R23A 5CGXA 1I2SA 5DF9A 2Y2HA 1N4OA 1U60A 5CRFA 2ZM8A 3DWKA 3NDEA 2XH9A 3FV7A 1N9BA 3PAEA 3HUOA 4WZ5C 2XFSA 3PBOA 1XGJA 3Q7ZA 5CGWA 3FKVA 5FAPA 2WKEA 5EUAA 4RA7A 2WYXA 2J9OA 3OPLA 2ZQ7A 5DTKA 2FFFB 4GZBA 3UPOA 1ONGA 5CERA 5F83A 3N6IA 4X56A 1K4EA 4X6TA 1K57C 3N7WA 4HBUA 2HDQA 5FASA 3PBQA 4S2LA 4R0QA 3HLBA 3BFEA 2ZC6B 2Y2LA 5CXWA 4ZBEA 4PMAA 2E8IA 4XXRA 4ZJ3A 5GHXA 5HW3A 2WKHA 5FQIA 3DWZA 2HDSA 2PU4A 5HL1A 3OPPA 2Y2PA 1FSYA 2H0YA 2XF3A 3Q1FA 1XKZA 4JKTA 4ZTKA 3E2LA 4JXSA 3HVFA 1SCWA 2JCHA 4MLLA 1PW8A 5DTTA 2Y4AA 1ZC2A 3HLFA 4LV2A 2ZLYA 5EVLA 3UPNA 3GTCA 1XPBA 5TGFA 5FI6A 3WS5A 3C5AA 4DDSA 3G2YA 3HLDA 3WS2A 1YM1A 3GQZA 3IXDA 3A3JA 5F82A 3SH9A 5FDHA 3PTEA 4BL2A 4NK3A 5E2HA 3SH8A 3AGFA 2WAFA 3UDFA 1BZAA 2DNSA 3I7JA 5A90A 1BLPA 3IXGA 3IQAA 3ZFZA 1PI5A 2HPBA 1IYPA 1WYCA 4MBFA 2A3UA 2XQZA 3AGEA 1KE0A 2Q9NA 4S2KA 1LLBA 2ZQ8A 3TOIA 5HX9A 3UDIA 3ZNYA 1NYYA 2Y2OA 5CGSA 4DXBA 1H8ZA 4KZ7A 1YMXA 1HZOA 2HDUA 1SDNA 4N1HA 4OONA 3ZHHA 4LV0A 2B5RA 3DW0A 1GHMA 4KG6A 3UN7A 3SH7A 1CI9A 4KQQA 4R1GA 3VOYA 1GHPA 3TSGA 2IWCA 3OCLA 4LENA 4MBHA 2V1ZA 3UNWA 1KGFA 2EFUA 3BLMA 4MEZA 2WZZA 3MKEA 4PM5A 1LL9A 1PZOA 2EX9A 1W5DA 2PU2A 2ZMAA 1IKIA 4RVAA 3UY6A 2J7VA 5AQ9A 4HESA 3Q7VB 2P9VA 1ZKJA 4LCLA 4OQIA 5HAPA 4OKPA 3OCNA 1DJCA 4N9KA 4OQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AXB A;  2DRW A;  3Q07 A;  3M2J A;  4B4X A;  3QNC A;  5GL9 A;  3ZG5 A;  5CTN A;  4LCM A;  5BOH A;  1PIO A;  3EQU A;  4DKI A;  1XP4 A;  3CMZ A;  5G18 A;  1GA0 A;  2ZC7 A;  4R4S A;  4E6X A;  1NXY A;  3OZH A;  1SKF A;  3G31 A;  3Q82 A;  1MWS A;  2XR0 A;  3JYI A;  1LI0 A;  5HFO A;  3O87 A;  3OC2 A;  3N8S A;  4E6W A;  1L0D A;  4S2M A;  4X55 A;  5HAR A;  3PAG A;  2ZD8 A;  1KE4 A;  1LHY A;  5GLB A;  4UHU A;  1MWU A;  3E2K A;  2XK1 A;  3WS1 A;  3MZE A;  4S2I A;  4WEL A;  3V3S A;  3G34 A;  1MKI A;  3UE0 A;  1BLH A;  2JC7 A;  3G32 A;  3DTM A;  3PBN A;  3IWQ A;  4OQH A;  3HBR A;  4ID4 A;  3VP2 A;  3GSG A;  4EBP A;  4WMC A;  5EVI B;  3ITA A;  3M2K A;  4ZJ1 A;  4P0M A;  5EVI D;  5A91 A;  5CTM A;  3WRZ A;  1ZG6 A;  4P87 A;  4GN2 A;  4OLG A;  2EXB A;  5A92 A;  1HTZ A;  4KEN B;  1ERM A;  5KSC A;  3VSK A;  2QMI A;  4K91 A;  1W8Q A;  3NI9 A;  2WAD A;  4FD8 A;  4ZDX A;  3ZG9 B;  1FCM A;  1QME A;  4Y0T A;  4JF5 A;  3V39 A;  1C3B A;  3LY3 A;  3VFH A;  4E3M A;  4LV3 A;  1K54 A;  4GD6 A;  3Q81 A;  5FI2 A;  2G2W A;  3A3E A;  2IWB A;  4XUZ A;  4RX2 A;  5GHZ A;  5GLA A;  5L2F A;  4EUZ A;  4PM8 A;  2H0T A;  4QB8 A;  3IF6 A;  3SS5 A;  1L0G A;  3MBZ A;  4S2P A;  3IHA A;  3ZDJ A;  2QZ6 A;  3LY4 A;  1NYM A;  3IXH A;  4YIN A;  3RXX A;  4E3J A;  4K0W A;  2OLU A;  4X53 A;  4S2N A;  1XXM A;  1E3U A;  1G68 A;  2IWD A;  1L0F A;  1K4F A;  1NZU A;  4JLF A;  1W8Y A;  3PBS A;  3MKF A;  1YLY A;  1CEG A;  3W4O A;  4E3L A;  3IH9 A;  1MBL A;  4DE0 A;  5FQK A;  3FZC A;  4WMC D;  1DJA A;  1NRF A;  2G2U A;  4ZAM A;  2ZQA A;  2HP6 A;  3M6H A;  5EVI A;  2OSU A;  2HP9 A;  2ZC4 B;  4FH4 A;  3UPP A;  1ES5 A;  1ALQ A;  1IYQ A;  3ITB A;  4HBT A;  1YQS A;  4FCF A;  2EX6 A;  2A49 A;  2JE5 A;  3Q7V A;  3PBR A;  2OV5 A;  3BFC A;  1ZG4 A;  1VM1 A;  2DCF A;  1IEL A;  3BRM A;  2ZQ9 A;  1J9M A;  1JTG A;  4KZ5 A;  1Z6F A;  2H10 A;  2Y2M A;  3GMW A;  4K0X A;  4DRT A;  5CED A;  1XX2 A;  4BEN A;  5HAI A;  3FYZ A;  1FSW A;  1VQQ A;  1XGI A;  2Y59 A;  5EE8 A;  2ZQD A;  2Y2K A;  1Q2Q A;  1RP5 A;  3NCK A;  4IBX A;  3A3F A;  1FCO A;  3UO9 A;  3V50 A;  3W8K A;  3C7V A;  1IEM A;  2C5W B;  2C6W B;  3BFD A;  4JXW A;  2WAE A;  3LEZ A;  2XFT A;  4C3Q A;  4Y7P A;  5DF8 A;  3TG9 A;  3M6B A;  5FQJ A;  4JBF A;  3IH8 A;  4U0T A;  4MNR A;  2WGI A;  1MWR A;  4JF4 A;  1FR6 A;  1DJB A;  1O07 A;  4IBR A;  5DF7 A;  3UE3 A;  4UAA A;  1K55 A;  4C6Y A;  4QJG A;  1E3U D;  3HLG A;  4U3T A;  3FKW A;  3NDG A;  2BG1 A;  4OPR A;  2XDM A;  1I2W A;  4QU3 A;  1GCE A;  4L0L A;  3HLW A;  1JWZ A;  3IWO A;  3LO7 A;  3EQV A;  3ZG7 B;  4E3K A;  3MXS A;  1WE4 A;  1MY8 A;  1RGZ A;  3MZD A;  4N9L A;  3ISG A;  4DE3 A;  2VGJ A;  2Y2N A;  5M1A A;  5FQQ A;  3NBL A;  1ERO A;  4EBL A;  4UA6 A;  3VP1 A;  1YLT A;  4WEJ A;  5FAQ A;  1Y54 A;  4ZJ2 A;  1PWC A;  1XA1 A;  1JWV A;  1ESI A;  1YLZ A;  3W4Q A;  1FCN A;  3VP0 A;  1K6S A;  1W79 A;  2V20 A;  4KZ8 A;  2Z2L B;  1PWD A;  5M18 A;  3HLE A;  4A5R A;  1E25 A;  2P9V B;  3IXB A;  4GOG A;  5E2E A;  3N4I A;  4QD4 A;  1CI8 A;  3NC8 A;  1K6R A;  3VP3 A;  5DVA A;  5I94 A;  2WUQ A;  4O7D A;  1BUE A;  5AQB A;  1L0E A;  1WYB A;  3GVB A;  5EVI C;  1HVB A;  2ZM2 A;  3OPH A;  1JWP A;  3ZCZ A;  4KZ4 A;  5KSH A;  4S2N C;  1G6A A;  1NZO A;  2EX8 A;  5FAT A;  3WWX A;  5IHV A;  3O86 A;  4OVD A;  4BQM A;  5E43 A;  4Y0U A;  3OPR A;  5M19 A;  5A93 A;  4IVI A;  1NY0 A;  3V3R A;  2Y2I A;  5JYP A;  4Q8I A;  1GA9 A;  3QHY A;  3G2Z A;  4E3O A;  3BM6 A;  4GDN A;  4PM6 A;  3HUM A;  2Z2M B;  3VOZ A;  3IF5 A;  4X68 A;  2I72 A;  4H8R A;  4JXV A;  5CHU A;  1PI4 A;  4D2O A;  5GLD A;  2GDN A;  3ZG8 B;  2WGW B;  4GB7 A;  5EOE A;  3RJU A;  3IT9 A;  3G35 A;  3ZVW A;  4BL3 A;  1BSG A;  1PYY A;  5CHJ A;  3CG5 A;  3FWL A;  2RL3 A;  5FA7 A;  3MZF A;  2P74 A;  3VFF A;  1QMF A;  3B3X A;  3O3V A;  5AQ7 A;  4EV4 A;  3IHB A;  4GKU A;  2Y55 A;  3WRT A;  1BT5 A;  2XD1 A;  1JVJ A;  1KGG A;  4BD1 A;  1HD8 A;  3MXR A;  1BLS A;  1DY6 A;  1PW1 A;  1BUL A;  2X01 A;  5DTS A;  2XGN A;  3WS4 A;  4KQR A;  5GHY A;  3GV9 A;  1TVF A;  1ES2 A;  3BEB A;  4OOM A;  3SOI A;  4OOL A;  4JF6 A;  3A3I A;  1E4D A;  4RX3 A;  4BJP A;  1KDS A;  2XEP A;  1K38 A;  1GHI A;  4KZ9 A;  4S2J A;  1OME A;  3BYD A;  1YT4 A;  1K56 D;  1LI9 A;  3QNB A;  2ZC5 B;  4E3N A;  2QPN A;  3CZD A;  4P85 A;  4GDB A;  5FQM A;  2Y2Q A;  1BLC A;  1M40 A;  4KG5 A;  4B4Z A;  1RGY A;  3ZVT A;  4CPK A;  4DXC A;  2WK0 A;  2OLV A;  1ERQ A;  3IF6 C;  4EBN A;  3P98 A;  1I5Q A;  5FSR A;  4JXG A;  4N1X A;  3BLS A;  1K57 A;  4KZA A;  4PM9 A;  3HUN A;  2UWX A;  3WS0 A;  3S4X A;  4DE2 A;  4XUX A;  2Y91 A;  4GNU A;  1MPL A;  5KMW A;  2R9X A;  4MBK A;  3A3D A;  4FSF A;  1ES3 A;  4OP8 A;  3BFF A;  2BLS A;  4KQO A;  5EEC A;  1L2S A;  1YLP A;  1SHV A;  4OPZ A;  3GR2 A;  1JTD A;  2ZM0 A;  2X71 A;  4S2O A;  4R4R A;  4CJN A;  3P09 A;  5CEC A;  2JBF A;  4JPM A;  3SS3 A;  4QHC A;  4EQI A;  4PM7 A;  1MWT A;  1W7F A;  3HL9 A;  5HAQ A;  4B88 A;  1ONH A;  4FH2 A;  4IVK A;  1RCJ A;  1K56 A;  2ZJ9 A;  4LV1 A;  5D3O A;  4DF6 A;  5F1F A;  2CC1 A;  4R3B A;  4HEF A;  3BEC A;  4WM9 A;  4DDY A;  4EWF A;  1TDG A;  3O88 A;  4IED A;  1YLW A;  1H8Y A;  2J9P A;  5EPH A;  4OH0 A;  4OOY A;  2RCX A;  4C75 A;  2V2F F;  3D4F A;  1IYS A;  2J8Y A;  4QY5 A;  3NY4 A;  2WZX A;  1LL5 A;  3C7U A;  3VMA A;  1BTL A;  1FR1 A;  1S6R A;  3V5M A;  1KE3 A;  1TDL A;  4WZ4 A;  2EX2 A;  3C4O A;  4QY6 A;  1CEF A;  5E2G A;  5GLC A;  2WGW A;  5CEB A;  4WZ5 A;  3AGD A;  3N8R A;  3SS4 A;  4OPY A;  1CK3 A;  1YLJ A;  4GD8 A;  1PZP A;  1XA7 A;  4UA9 A;  2ZQC A;  1EI5 A;  1ESU A;  1KGE A;  1MXO A;  1IKG A;  2HP5 A;  1K25 A;  2WGV A;  2HDR A;  5FAO A;  4E3I A;  5TR7 A;  5J8X A;  4YFM A;  2PBY A;  1KDW A;  4OQ0 A;  4U0X A;  4WBG A;  4KG2 A;  5TFQ A;  3GRJ A;  3UDX A;  3UE1 A;  3VP4 A;  3CJM A;  2X02 A;  3N8L A;  2R9W A;  1Q2P A;  5EOO A;  3NIA A;  4WYY A;  4NET A;  3VSL A;  3G30 A;  5CHM A;  4Z9Q A;  3LCE A;  1S0W A;  3W4P A;  4BLM A;  5KZH A;  2H5S A;  4OP5 A;  4OPQ A;  3BFG A;  5U47 A;  1K54 C;  1FOF A;  2Y2G A;  4KZ3 A;  3RXW A;  1TEM A;  3C4P A;  1ES4 A;  1K55 C;  2EXA A;  1FQG A;  3S22 A;  2Y2J A;  5JYO A;  1O7E A;  4KZB A;  3S1Y A;  2XD5 A;  4BD0 A;  2VGK A;  5AQA A;  2WKI A;  1IYO A;  2XLN A;  3ZNT A;  3ZGA B;  3IF6 B;  1SDE A;  2FFY A;  4RYE A;  3HLC A;  4Y0O A;  4UA7 A;  4OLD A;  4X69 A;  1M6K A;  2Q9M A;  1NJ4 A;  4P6B A;  3MFD A;  5E2F A;  1KVM A;  1KVL A;  1EWZ A;  2EFX A;  5FQ9 A;  3IWI A;  3ZG0 A;  4F94 A;  1PWG A;  3PBT A;  5F1G A;  4WEK A;  4M3K A;  2ZC3 B;  4DE1 A;  1H5X A;  1YMS A;  3G4P A;  5FI7 A;  4N92 A;  4R3J A;  3HRE A;  4KZ6 A;  4PPR A;  4R23 A;  5CGX A;  1I2S A;  5DF9 A;  2Y2H A;  1N4O A;  1U60 A;  5CRF A;  2ZM8 A;  3DWK A;  3NDE A;  2XH9 A;  3FV7 A;  1N9B A;  3PAE A;  3HUO A;  4WZ5 C;  2XFS A;  3PBO A;  1XGJ A;  3Q7Z A;  5CGW A;  3FKV A;  5FAP A;  2WKE A;  5EUA A;  4RA7 A;  2WYX A;  2J9O A;  3OPL A;  2ZQ7 A;  5DTK A;  2FFF B;  4GZB A;  3UPO A;  1ONG A;  5CER A;  5F83 A;  3N6I A;  4X56 A;  1K4E A;  4X6T A;  1K57 C;  3N7W A;  4HBU A;  2HDQ A;  5FAS A;  3PBQ A;  4S2L A;  4R0Q A;  3HLB A;  3BFE A;  2ZC6 B;  2Y2L A;  5CXW A;  4ZBE A;  4PMA A;  2E8I A;  4XXR A;  4ZJ3 A;  5GHX A;  5HW3 A;  2WKH A;  5FQI A;  3DWZ A;  2HDS A;  2PU4 A;  5HL1 A;  3OPP A;  2Y2P A;  1FSY A;  2H0Y A;  2XF3 A;  3Q1F A;  1XKZ A;  4JKT A;  4ZTK A;  3E2L A;  4JXS A;  3HVF A;  1SCW A;  2JCH A;  4MLL A;  1PW8 A;  5DTT A;  2Y4A A;  1ZC2 A;  3HLF A;  4LV2 A;  2ZLY A;  5EVL A;  3UPN A;  3GTC A;  1XPB A;  5TGF A;  5FI6 A;  3WS5 A;  3C5A A;  4DDS A;  3G2Y A;  3HLD A;  3WS2 A;  1YM1 A;  3GQZ A;  3IXD A;  3A3J A;  5F82 A;  3SH9 A;  5FDH A;  3PTE A;  4BL2 A;  4NK3 A;  5E2H A;  3SH8 A;  3AGF A;  2WAF A;  3UDF A;  1BZA A;  2DNS A;  3I7J A;  5A90 A;  1BLP A;  3IXG A;  3IQA A;  3ZFZ A;  1PI5 A;  2HPB A;  1IYP A;  1WYC A;  4MBF A;  2A3U A;  2XQZ A;  3AGE A;  1KE0 A;  2Q9N A;  4S2K A;  1LLB A;  2ZQ8 A;  3TOI A;  5HX9 A;  3UDI A;  3ZNY A;  1NYY A;  2Y2O A;  5CGS A;  4DXB A;  1H8Z A;  4KZ7 A;  1YMX A;  1HZO A;  2HDU A;  1SDN A;  4N1H A;  4OON A;  3ZHH A;  4LV0 A;  2B5R A;  3DW0 A;  1GHM A;  4KG6 A;  3UN7 A;  3SH7 A;  1CI9 A;  4KQQ A;  4R1G A;  3VOY A;  1GHP A;  3TSG A;  2IWC A;  3OCL A;  4LEN A;  4MBH A;  2V1Z A;  3UNW A;  1KGF A;  2EFU A;  3BLM A;  4MEZ A;  2WZZ A;  3MKE A;  4PM5 A;  1LL9 A;  1PZO A;  2EX9 A;  1W5D A;  2PU2 A;  2ZMA A;  1IKI A;  4RVA A;  3UY6 A;  2J7V A;  5AQ9 A;  4HES A;  3Q7V B;  2P9V A;  1ZKJ A;  4LCL A;  4OQI A;  5HAP A;  4OKP A;  3OCN A;  1DJC A;  4N9K A;  4OQG A; 
#chains in the Genus database with same CATH topology
 1AXB A;  5F69 A;  4LCM A;  2PYR A;  2V0U A;  3KSG A;  2ZC7 A;  4IHQ A;  3OZH A;  1SKF A;  3GDI A;  1F5M A;  3O87 A;  3OC2 A;  4S2M A;  4X1L A;  4HOI A;  5GLB A;  1AWI A;  4IUK A;  4Q0I A;  3UE0 A;  1BLH A;  3DTM A;  2K2N A;  3PBN A;  3HBR A;  4EBP A;  3GSG A;  2L1M A;  4WMC A;  5MC7 A;  5A91 A;  4P0M A;  5CTM A;  3NUL A;  4OLG A;  2PBD P;  4MN5 A;  3VOL A;  3L7H A;  3NI9 A;  2PR6 A;  2WAD A;  4FD8 A;  4JF5 A;  1K54 A;  2VGL M;  3A3E A;  3ICY A;  3A0S A;  2IWB A;  5J4E A;  5GLA A;  5L2F A;  2Y8H A;  4QB8 A;  4DMZ A;  3IHA A;  1NYM A;  1G68 A;  2IWD A;  4JLF A;  1W8Y A;  3PBS A;  3MKF A;  4E04 A;  3PYP A;  4IUH A;  1YLY A;  1CEG A;  2HGV A;  2JKR I;  5FQK A;  2ZQA A;  5EVI A;  2OSU A;  2EA9 A;  4FH4 A;  1ES5 A;  3H82 B;  4KUK A;  2PRF A;  3ITB A;  4HBT A;  1LSV A;  3MMH A;  3IBR A;  2KLI A;  3BFC A;  1N9N A;  2Y2M A;  3GMW A;  4DRT A;  4K0X A;  5HAI A;  3VE3 A;  3BQ8 A;  1FSW A;  2Y59 A;  3UO9 A;  1RP5 A;  2Y2K A;  4HJ4 A;  2WKP A;  3A3F A;  3V50 A;  1IEM A;  2C5W B;  3MQQ A;  3KYZ A;  1FR6 A;  4IBR A;  4GJ4 A;  5F68 A;  4EEP A;  3LR0 A;  2XDM A;  3ZG7 B;  1V9Z A;  1MY8 A;  3NBL A;  3NJA A;  5FEF A;  5FAQ A;  1XA1 A;  1JWV A;  1ESI A;  5HDS A;  4HHD A;  2ACG A;  1CQA A;  2PR5 A;  4CQH A;  1YPR A;  4M4X A;  1K6R A;  3VP3 A;  2WUQ A;  5AQB A;  1YSP A;  4CLC C;  2ZM2 A;  3ZCZ A;  1G6A A;  2EX8 A;  5IHV A;  4OVD A;  4BQM A;  5E43 A;  5M19 A;  3OBF A;  4IVI A;  3V3R A;  2Y2I A;  5JYP A;  4Q8I A;  3RTY A;  4X68 A;  3KX0 X;  2I72 A;  2GDN A;  3C30 A;  5FA7 A;  5FEG A;  3D72 A;  3VFF A;  5AQ7 A;  3IHB A;  4GKU A;  3WRT A;  3QP1 A;  2J3T C;  1JVJ A;  5J3W A;  4BD1 A;  4EUV A;  2OWH A;  1PW1 A;  2X01 A;  5DTS A;  3WS4 A;  4II7 A;  1JNU A;  3GV9 A;  2BTF P;  1TVF A;  2V9A A;  4OOM A;  4OOL A;  4NXF A;  4RX3 A;  1DP9 A;  4AFI A;  2ZC5 B;  1FIL A;  2CMN A;  2L0W A;  4KQD A;  4EES A;  3CPT A;  4PAU A;  4GDB A;  2Y2Q A;  4KG5 A;  1M40 A;  4B4Z A;  3FPV A;  1ERQ A;  1G28 A;  1SKO B;  5FSR A;  4LGW A;  1K57 A;  4KZA A;  3HUN A;  2UWX A;  1V9Y A;  2O0Y A;  2Y91 A;  4GNU A;  1MPL A;  1L3L A;  1X0O A;  1H8M A;  4HP4 A;  1L2S A;  4HI4 A;  1YLP A;  4OPZ A;  3DBA A;  1LSX A;  1VET B;  1W7F A;  4FOF A;  1D7E A;  4LV1 A;  1RCJ A;  2CC1 A;  4PKY A;  4HEF A;  3BEC A;  2J80 A;  1S4R A;  5LBR A;  1H8Y A;  5EPH A;  2V2F F;  2J8Y A;  1BTL A;  3H7W A;  3V5M A;  3IBJ A;  5GLC A;  4WZ5 A;  3AGD A;  3E4P A;  1G5U A;  2OAP 1;  2HP5 A;  1MXO A;  1IKG A;  3LGO A;  2J3W A;  4U0X A;  5TFQ A;  3UDX A;  5EOO A;  3NIA A;  5CHM A;  3W4P A;  4OPQ A;  5HWT A;  1N9L A;  1OTA A;  2PD8 A;  2E8J A;  1TEM A;  3S7O A;  3JPU A;  3T1S A;  3SZT A;  2VGK A;  4NXB A;  3UB9 A;  4B9O A;  1IYO A;  2EWW A;  4WL9 A;  3HLC A;  4X69 A;  1NJ4 A;  3MFD A;  1KVL A;  3IWI A;  3ZG0 A;  3PBT A;  2ZC3 B;  3NOP C;  4DE1 A;  3HRE A;  5CGX A;  1N4O A;  1SZV A;  5CRF A;  3FV7 A;  1N9B A;  3HUO A;  2XFS A;  3PBO A;  5EUA A;  4RA7 A;  2ZQ7 A;  3LID A;  2FFF B;  3CUE C;  3UB8 A;  1G6O A;  5TBM A;  1K4E A;  5FAS A;  2L4R A;  3LR3 A;  2GJ3 A;  3U4L P;  4PMA A;  4ZJ3 A;  3CLO A;  5HW3 A;  5FQI A;  3H82 A;  3DWZ A;  3F1P A;  1FSY A;  5KIZ A;  3T12 B;  2ZOI A;  3TW8 A;  3E2L A;  2J3T D;  4JXS A;  3QP4 A;  4H6J B;  2V1A A;  4LV2 A;  3UPN A;  5TGF A;  4DDS A;  3HLD A;  3IXD A;  3NEC A;  5E2H A;  3AGF A;  2WAF A;  3IQA A;  3ZFZ A;  4MBF A;  2QJ7 A;  2ZQ8 A;  4DXB A;  2HDU A;  4N1H A;  4LV0 A;  1W63 Q;  4L9E A;  1GHM A;  2HV1 A;  1CI9 A;  4KQQ A;  4GHI B;  1GHP A;  3OCL A;  2EFU A;  5L10 A;  4DJ3 A;  2QWS A;  4PM5 A;  2ZMA A;  1IKI A;  3BQA A;  4RVA A;  5AQ9 A;  2P9V A;  1ZKJ A;  4OKP A;  1VB6 A;  1PFL A;  2DRW A;  3PHY A;  3ULF A;  1GSV A;  5CTN A;  5BOH A;  4H6J A;  1PNE A;  1XP4 A;  2VLG A;  3CMZ A;  3F1N A;  4LPZ A;  4E6X A;  2QJ5 A;  3BW6 A;  1MWS A;  1DP6 A;  4X55 A;  5HAR A;  1KE4 A;  4EET B;  1MWU A;  2WKR A;  3MZE A;  3V3S A;  1MKI A;  2VK3 A;  4JGO A;  4HJ3 A;  3DAV A;  5DKK A;  4ID4 A;  5EVI B;  3E98 A;  4GN2 A;  2W27 A;  4KEN B;  5AJG A;  1W8Q A;  4ZDX A;  1FCM A;  4Y0T A;  4EER A;  3LY3 A;  4E3M A;  4Q0H A;  5FI2 A;  5GHZ A;  3SW1 A;  4EUZ A;  4PM8 A;  1T1C A;  3IF6 A;  4UEY A;  1L0G A;  2QZ6 A;  3LY4 A;  4YIN A;  3IXH A;  4X53 A;  1NZU A;  3C2W A;  1XJ2 A;  4E3L A;  3IH9 A;  4DE0 A;  3FZC A;  4WMC D;  4PHT A;  3UPP A;  3DTI A;  3T1Q B;  2JE5 A;  4FUW A;  2OV5 A;  1ZG4 A;  2DCF A;  1IEL A;  3BRM A;  1JTG A;  3LIA A;  5CED A;  4HJ6 A;  4I5S A;  5HPI A;  1Q2Q A;  3NCK A;  1XFN A;  4IBX A;  1YAX A;  3C7V A;  3CUE A;  3BFD A;  4C3Q A;  2WAE A;  4Y7P A;  3TG9 A;  4JF4 A;  3B47 A;  3DTE A;  4KUO A;  1DJB A;  5DF7 A;  3OOV A;  4HY8 A;  4QJG A;  3R4K A;  4U3T A;  3IX4 A;  3NDG A;  4QU3 A;  4LFU A;  3EEA A;  3LO7 A;  1WE4 A;  4N9L A;  3MR0 A;  3D3O A;  4UA6 A;  3VP1 A;  1YLT A;  1DRM A;  1Y54 A;  2VV7 A;  1YLZ A;  3W4Q A;  2EWV A;  3VP0 A;  1W79 A;  4KZ8 A;  5TJJ A;  1PWD A;  5M18 A;  2HF6 A;  1E25 A;  2UV0 E;  3IXB A;  2W1T A;  1CI8 A;  3NC8 A;  3C8C A;  5I94 A;  4R70 A;  3KSH A;  3GVB A;  2M1C A;  1NRJ A;  2VJW A;  4WUJ A;  4Y0U A;  4P6Z M;  5A93 A;  2W1T B;  2DMW A;  1GA9 A;  3QHY A;  2W3D A;  1TS8 A;  3HUM A;  3VOZ A;  4JXV A;  2W0N A;  5GLD A;  3S7N A;  5EOE A;  3IT9 A;  3CG5 A;  1BYW A;  2BAS A;  1QMF A;  4EV4 A;  2Y55 A;  1BT5 A;  2XD1 A;  1KGG A;  4JGP A;  3MXR A;  2VV6 A;  4O0P A;  1BUL A;  2D01 A;  1H0M A;  1ES2 A;  3A3I A;  3IX8 A;  1E4D A;  2JKR M;  1TS7 A;  1K38 A;  4G3W A;  4NXE A;  1GHI A;  1Y4O A;  4KZ9 A;  1OME A;  1VET A;  1K56 D;  3EEH A;  1LI9 A;  5I5L A;  3CZD A;  4P85 A;  5A8B A;  1BLC A;  5FL3 A;  3IF6 C;  2JHE A;  4N1X A;  3EWK A;  4MBK A;  4ETZ A;  4KQO A;  1TD5 A;  3GR2 A;  3CAX A;  3P09 A;  1F2K A;  5CEC A;  4GS9 A;  4EQI A;  1PRQ A;  3HL9 A;  5HAQ A;  1ONH A;  5D3O A;  4R3B A;  4NKP A;  4DDY A;  3O88 A;  2VZW A;  4IED A;  2HZ5 A;  4C75 A;  5C5K A;  2W3E A;  3VMA A;  1LL8 A;  1S6R A;  4BBV A;  1ODV A;  1KE3 A;  5AVF A;  1TDL A;  4WZ4 A;  3C4O A;  3FG8 A;  3N8R A;  2YKF A;  3SS4 A;  4OPY A;  1YLJ A;  3HJI A;  4GD8 A;  1PZP A;  1XA7 A;  4X25 A;  4Y3I A;  1XFQ A;  1EI5 A;  1KGE A;  2WGV A;  5J8X A;  4R6L A;  4YFM A;  3R7W A;  4OQ0 A;  4WBG A;  3BY8 A;  2R9W A;  4UQI M;  4MN7 A;  4NET A;  3G30 A;  1OJ5 A;  3BY9 A;  3LCE A;  1P9R A;  4OP5 A;  1OTE A;  3IX3 A;  5U47 A;  2XRN A;  2H28 A;  4ARZ B;  1ES4 A;  1K55 C;  2EXA A;  1FQG A;  5JYO A;  1O7E A;  4GS9 B;  2XD5 A;  4BD0 A;  5AQA A;  4WN5 A;  2XLN A;  2PYP A;  3ZGA B;  4Y2F A;  1SDE A;  4UA7 A;  1M6K A;  5E2F A;  1EWZ A;  1MKM A;  4HH3 A;  2MJ6 A;  5F1G A;  5DKL A;  5FI7 A;  4PPR A;  3S7P A;  5FQM A;  3Q7Z A;  5CGW A;  3FKV A;  5HDD A;  3OPL A;  3LUQ A;  3LI8 A;  5F83 A;  5L8M A;  2HDQ A;  3MS6 A;  1WA9 A;  1NWZ A;  4EEU A;  2Y2L A;  1XJ3 A;  2E8I A;  5HL1 A;  3VV4 A;  3OPP A;  2Y2P A;  3RFB A;  2PHY A;  2XF3 A;  4JKT A;  1PW8 A;  5DTT A;  1ZC2 A;  4ARZ A;  5FI6 A;  1F9I A;  5L07 A;  3A3J A;  3SH9 A;  5FDH A;  3PTE A;  4NK3 A;  3T4L A;  1BZA A;  2W3F A;  2V8C A;  5A90 A;  1BLP A;  3A0V A;  3IXG A;  2ZL1 A;  2XQZ A;  3QP8 A;  1LSW A;  5HX9 A;  4JGQ A;  2M7U A;  1NLZ A;  2B5R A;  2JKG A;  3ZQ5 A;  4R1G A;  1N9O A;  3TSG A;  2IWC A;  4MBH A;  1W5D A;  2PU2 A;  3CWF A;  4HES A;  4B93 A;  4OQI A;  1ACF A;  1DJC A;  4N9K A;  3CIT A;  3ZYT A;  3M2J A;  3QNC A;  5GL9 A;  3ZG5 A;  4DKI A;  5G18 A;  1GA0 A;  4Q0J A;  1NXY A;  3Q82 A;  1GSW A;  2O9A A;  2XR0 A;  5HFO A;  5DJU A;  4E6W A;  4ETX A;  4UHU A;  4CLC A;  3E2K A;  3WS1 A;  2G7U A;  4WEL A;  4ZRR A;  3FPW A;  2JC7 A;  3G32 A;  4OQH A;  4LRX C;  3M2K A;  4ZJ1 A;  3MSH A;  3VE4 A;  5A92 A;  1HTZ A;  1STZ A;  3VSK A;  2QMI A;  4F3L B;  4IJG A;  4K91 A;  2GX5 A;  3ZG9 B;  3MQ0 A;  3V39 A;  1C3B A;  2B95 A;  4LV3 A;  2PDR A;  4HQA A;  4GD6 A;  3UB5 P;  2G2W A;  5EVE A;  2H0T A;  4F3L A;  5HDC A;  3MBZ A;  3ZDJ A;  4HNB A;  4P6Z S;  1P97 A;  3TE8 A;  1XXM A;  1E3U A;  1L0F A;  2ZMF A;  1K4F A;  3C38 A;  1DP8 A;  3W4O A;  1Z09 A;  4EW7 A;  1NRF A;  3M6H A;  2HJE A;  2A24 A;  2HP9 A;  1ALQ A;  1YQS A;  4FCF A;  2EX6 A;  4EQ1 A;  2P7J A;  3Q7V A;  2ZQ9 A;  1J9M A;  1S66 L;  4KZ5 A;  1Z6F A;  2H10 A;  1CF0 A;  1XX2 A;  2QHK A;  4BEN A;  1OTB A;  3QP6 A;  1VQQ A;  2A24 B;  3W8K A;  4MN6 A;  2INW A;  2XFT A;  5DF8 A;  5FQJ A;  4U0T A;  1O07 A;  4UAA A;  1K55 A;  4C6Y A;  3HLG A;  2BG1 A;  4NXG A;  1TS0 A;  1JWZ A;  3EQV A;  3KSF A;  3MZD A;  5IT5 A;  4DE3 A;  5M1A A;  2XA7 S;  3HCY A;  5FQQ A;  2K7S A;  1ERO A;  1T1A A;  4ZJ2 A;  1PWC A;  2OAQ 1;  2P04 A;  1FCN A;  2V20 A;  4BMW A;  2Z2L B;  4A5R A;  4QD4 A;  3D9Y A;  1BUE A;  5EVI C;  4JGR A;  3OPH A;  1JWP A;  5KSH A;  3B33 A;  4S2N C;  3NOT C;  1NZO A;  5FAT A;  3RH8 B;  1EW0 A;  3OPR A;  4E3O A;  4GDN A;  2JKF A;  3IF5 A;  4H8R A;  4D2O A;  4BBT A;  3ZG8 B;  1UWP X;  2Y79 A;  5IU1 A;  4Z1W A;  1BSG A;  4BL3 A;  1PYY A;  4GCZ A;  3FWL A;  2P74 A;  4I3J A;  2XRO A;  3O3V A;  3EGX C;  2Z6D A;  1BLS A;  1DY6 A;  2XGN A;  5GHY A;  4JF6 A;  4BJP A;  1KDS A;  1VHM A;  2PT7 A;  4X1M A;  4S2J A;  3BYD A;  3TJZ C;  3T50 A;  2JKT M;  1S4S A;  3QNB A;  4E3N A;  2QPN A;  2NUT C;  2QYB A;  4CPK A;  2WK0 A;  2OLV A;  1I5Q A;  4JXG A;  5HWW A;  3WS0 A;  5TBM B;  3S4X A;  4DE2 A;  4XUX A;  5KMW A;  1P9W A;  4OP8 A;  5EEC A;  3UB6 A;  1SHV A;  2XA7 M;  4CJN A;  2JBF A;  4JPM A;  3SS3 A;  4QHC A;  4Y5F A;  4PM7 A;  2P08 A;  4B88 A;  1K56 A;  2V1B A;  2VEA A;  5F1F A;  4YNR A;  4WM9 A;  4EWF A;  3JVV A;  2J9P A;  4OH0 A;  4O01 A;  1IYS A;  3NY4 A;  3C7U A;  1FR1 A;  5E2G A;  5EM0 A;  2WGW A;  5CEB A;  2O9B A;  3F1O B;  1CK3 A;  1W63 M;  3CI6 A;  4BWI A;  5FAO A;  1K25 A;  3S7Q A;  2HDR A;  2KOI A;  3OLO A;  5TR7 A;  4E3I A;  1KDW A;  1SKO A;  4KG2 A;  3GRJ A;  3CJM A;  4ME4 A;  3P7N A;  3VSL A;  3F1N B;  4Z9Q A;  3KYE A;  2ZMV A;  3BJN A;  2H5S A;  5G4Y A;  3BFG A;  4I3A A;  2W1R A;  1FOF A;  2Y2G A;  4G3K A;  3RXW A;  3C4P A;  2Y2J A;  3KO6 A;  4KZB A;  3S1Y A;  3E4O A;  2WKI A;  3IF6 B;  4RYE A;  1Y28 A;  1OT6 A;  2Q9M A;  4P6B A;  5FQ9 A;  1KVM A;  5DFY A;  1ZHH B;  4F94 A;  5EM1 A;  4HH2 A;  4M3K A;  4WEK A;  4R3J A;  2D02 A;  3LIB A;  3QP2 A;  5DF9 A;  1U60 A;  4I3I A;  2ZM8 A;  3DWK A;  3L9K A;  3NDE A;  4WZ5 C;  2WKE A;  2WYX A;  2J9O A;  3UPO A;  5CER A;  4R3A A;  4X56 A;  4X6T A;  1K57 C;  3N7W A;  4S2L A;  4R0Q A;  3HLB A;  5CXW A;  4ZBE A;  3CPT B;  2HDS A;  3Q1F A;  1XKZ A;  1TS6 A;  4ZTK A;  5G4Z A;  2VGL S;  1SCW A;  2Y4A A;  3HJK A;  5EVL A;  3UME A;  3KYQ A;  3C5A A;  3G2Y A;  2JN7 A;  1GSX A;  1D06 A;  3GQZ A;  5F82 A;  5HZH A;  3E4Q A;  4FTX A;  1T1B A;  3IS2 B;  5L09 A;  2GNX A;  1S67 L;  2HPB A;  1IYP A;  1WYC A;  2A3U A;  3AGE A;  3CHW P;  2ZBB A;  3T1R A;  2Q9N A;  1NYY A;  2A2L A;  2Y2O A;  5CGS A;  1H8Z A;  4KZ7 A;  2QKP A;  1SDN A;  4OON A;  3H7W B;  3UB7 A;  3SH7 A;  3T1X A;  3LEQ A;  3UNW A;  2WKQ A;  2I9V A;  3MKE A;  2PAV P;  3W2Z A;  1PZO A;  2ZOH A;  4O8G A;  3T4O A;  2J7V A;  3Q7V B;  2HJ9 C;  5HAP A;  5DFX A;  4PKY G;  4DJ2 A;  3Q07 A;  4B4X A;  1PIO A;  3EQU A;  4WF0 A;  4R4S A;  2LB9 A;  3G31 A;  3JYI A;  1LI0 A;  3N8S A;  1L0D A;  3PAG A;  4I38 A;  3KSI A;  2ZD8 A;  1LHY A;  3BWL A;  1J3W A;  5CX7 A;  2XK1 A;  4S2I A;  5HD5 A;  3G34 A;  3PR6 A;  1OTI A;  3IWQ A;  4XT2 B;  3VP2 A;  3MFX A;  3ITA A;  5EVI D;  3WRZ A;  1ZG6 A;  4BBU A;  4P87 A;  2EXB A;  1ERM A;  1HLU P;  4HP9 A;  2FH5 A;  5KSC A;  2R78 A;  1QME A;  1YKD A;  4YOF A;  4WLA A;  3VFH A;  1T18 A;  5FDS A;  5DJT A;  1VEU A;  3Q81 A;  4K08 A;  4XUZ A;  4RX2 A;  5HWV A;  3SS5 A;  4QWO A;  4CLC D;  4S2P A;  2W3G A;  3RXX A;  4UQI S;  4E3J A;  4K0W A;  1K0K A;  2OLU A;  4S2N A;  3MF0 A;  1MBL A;  3LFV A;  1XJ4 A;  1DJA A;  2G2U A;  4ZAM A;  2HP6 A;  2VV8 A;  2ZC4 B;  2K31 A;  3F1P B;  1IYQ A;  4GLQ A;  2A49 A;  3PBR A;  2OOL A;  1VM1 A;  3V67 A;  5F5Y A;  3MQO A;  3FYZ A;  1XGI A;  5EE8 A;  2ZQD A;  3B42 A;  1FCO A;  4MMN A;  2C6W B;  4JXW A;  3LEZ A;  3M6B A;  4JBF A;  5EFW A;  3IH8 A;  4MNR A;  2WGI A;  1MWR A;  1D1J A;  3UE3 A;  2GZA A;  1E3U D;  3FC7 A;  3FKW A;  4OPR A;  1I2W A;  1GCE A;  4L0L A;  3HLW A;  4Y15 A;  3LIF A;  3IWO A;  4EXO A;  4E3K A;  3MXS A;  3T4S A;  1FIK A;  1RGZ A;  2JKT I;  3ISG A;  2VGJ A;  1VEU B;  2Y2N A;  3LYX A;  1F98 A;  4EBL A;  4WEJ A;  5HD3 A;  2Q0O A;  3PXP A;  1K6S A;  4G3V A;  1UGU A;  3HLE A;  2P9V B;  4GOG A;  5E2E A;  3N4I A;  4Y13 A;  3K3C A;  5DVA A;  4O7D A;  1L0E A;  1WYB A;  2OWJ A;  1HVB A;  2V8F A;  4ESP A;  4KZ4 A;  4GHI A;  3WWX A;  3O86 A;  1TF1 A;  3GEC A;  1NY0 A;  2Z6C A;  3G2Z A;  3BM6 A;  3LIC A;  4NG2 A;  4PM6 A;  2Z2M B;  2IA2 A;  1ZTU A;  4L9G A;  1P0Z A;  5CHU A;  1PI4 A;  2WGW B;  4GB7 A;  3RJU A;  3ZVW A;  3G35 A;  3F1O A;  5CHJ A;  2RL3 A;  3MZF A;  3O5Y A;  3B3X A;  3UE6 A;  1HD8 A;  1OTD A;  4KQR A;  2VKS A;  3BEB A;  3SOI A;  3LI9 A;  3EOI A;  3K2N A;  2FZ0 A;  2XEP A;  4YWZ A;  1YT4 A;  5HPF A;  2KX6 A;  1OPX A;  5K5B A;  4LRY C;  1RGY A;  3T4T A;  2B02 A;  3ZVT A;  4DXC A;  2ZL1 B;  4EBN A;  3P98 A;  4QPR A;  2KDK A;  3MJQ A;  3BLS A;  4PM9 A;  3T4K A;  5EV0 A;  2R9X A;  3A3D A;  4FSF A;  1ES3 A;  4EU0 A;  3BFF A;  2BLS A;  2VX8 A;  1YSQ A;  2YKH A;  1MZU A;  1JTD A;  2ZM0 A;  2X71 A;  4S2O A;  4R4R A;  3LIE A;  1IOU A;  5IS1 A;  3G6O A;  4RQ9 A;  1MWT A;  4NEE D;  4FH2 A;  4IVK A;  2ZJ9 A;  4DF6 A;  1MC0 A;  4Y17 A;  1S1Z A;  1TDG A;  3NHQ A;  1YLW A;  1NLY A;  4OOY A;  2RCX A;  3D4F A;  2PD7 A;  4QY5 A;  2WZX A;  1LL5 A;  1OT9 A;  1CJF A;  2EX2 A;  2LB5 A;  4QY6 A;  1CEF A;  3T4Q A;  2O99 A;  4UA9 A;  3MXQ A;  2NUP C;  2ZQC A;  1ESU A;  4CLC B;  4DN0 A;  1IFQ A;  2PBY A;  5AVE A;  3UE1 A;  3VP4 A;  2X02 A;  3N8L A;  1Q2P A;  4WYY A;  3P01 A;  1S0W A;  1A0K A;  4BLM A;  5KZH A;  1UWN X;  3K3D A;  4GW9 A;  5F6A A;  1K54 C;  4KZ3 A;  4R38 A;  3S22 A;  3EGD C;  3LR5 A;  3TRC A;  2XSS A;  4XT2 A;  3ZNT A;  1H3Q A;  2VA0 A;  2FFY A;  4Y0O A;  4OLD A;  2EFX A;  4I39 A;  1PWG A;  2W3H A;  1H5X A;  1YMS A;  3G4P A;  4N92 A;  4KZ6 A;  4R23 A;  1I2S A;  2Y2H A;  2XH9 A;  3PAE A;  1XGJ A;  5FAP A;  1S1Y A;  3DTK A;  3IS2 A;  5DTK A;  4GZB A;  2M7V A;  1ONG A;  3NOU C;  3N6I A;  3LR4 A;  4MDZ A;  4HBU A;  1OJG A;  3PBQ A;  3UMD A;  3BFE A;  2ZC6 B;  4L9F A;  4MCW A;  4XXR A;  5GHX A;  2WKH A;  2PU4 A;  4D60 A;  2H0Y A;  3A0R A;  3HVF A;  2JCH A;  4MLL A;  3HLF A;  3QP5 A;  2ZLY A;  1LT0 A;  1XPB A;  3GTC A;  3WS5 A;  2B18 A;  3WS2 A;  1YM1 A;  2AVX A;  4BL2 A;  3T4J A;  2O9C A;  3SH8 A;  1KOU A;  3UDF A;  2DNS A;  3I7J A;  1PI5 A;  1T19 A;  5HSQ A;  1KE0 A;  4S2K A;  1LLB A;  2V0W A;  3TOI A;  3UDI A;  3ZNY A;  1YMX A;  1HZO A;  3ZHH A;  4HIA A;  3E0Y A;  3U2A A;  3DW0 A;  4KG6 A;  3UN7 A;  4CLC E;  4LRZ E;  1XJ6 A;  3VOY A;  4LEN A;  2V1Z A;  3H9W A;  1KGF A;  3BLM A;  4MEZ A;  2WZZ A;  4LLO B;  5HL6 A;  5J7E A;  1LL9 A;  2EX9 A;  3UY6 A;  3JVU A;  4LCL A;  3OCN A;  3R7W B;  4OQG A; 
#chains in the Genus database with same CATH homology
 1AXB A;  2DRW A;  3Q07 A;  3M2J A;  4B4X A;  3QNC A;  5GL9 A;  3ZG5 A;  5CTN A;  4LCM A;  5BOH A;  1PIO A;  3EQU A;  4DKI A;  1XP4 A;  3CMZ A;  5G18 A;  1GA0 A;  2ZC7 A;  4R4S A;  4E6X A;  1NXY A;  3OZH A;  1SKF A;  3G31 A;  3Q82 A;  1MWS A;  2XR0 A;  3JYI A;  1LI0 A;  5HFO A;  3O87 A;  3OC2 A;  3N8S A;  4E6W A;  1L0D A;  4S2M A;  4X55 A;  5HAR A;  3PAG A;  2ZD8 A;  1KE4 A;  1LHY A;  5GLB A;  4UHU A;  1MWU A;  3E2K A;  2XK1 A;  3WS1 A;  3MZE A;  4S2I A;  4WEL A;  3V3S A;  3G34 A;  1MKI A;  3UE0 A;  1BLH A;  2JC7 A;  3G32 A;  3DTM A;  3PBN A;  3IWQ A;  4OQH A;  3HBR A;  4ID4 A;  3VP2 A;  3GSG A;  4EBP A;  4WMC A;  5EVI B;  3ITA A;  3M2K A;  4ZJ1 A;  4P0M A;  5EVI D;  5A91 A;  5CTM A;  3WRZ A;  1ZG6 A;  4P87 A;  4GN2 A;  4OLG A;  2EXB A;  5A92 A;  1HTZ A;  4KEN B;  1ERM A;  5KSC A;  3VSK A;  2QMI A;  4K91 A;  1W8Q A;  3NI9 A;  2WAD A;  4FD8 A;  4ZDX A;  3ZG9 B;  1FCM A;  1QME A;  4Y0T A;  4JF5 A;  3V39 A;  1C3B A;  3LY3 A;  3VFH A;  4E3M A;  4LV3 A;  1K54 A;  4GD6 A;  3Q81 A;  5FI2 A;  2G2W A;  3A3E A;  2IWB A;  4XUZ A;  4RX2 A;  5GHZ A;  5GLA A;  5L2F A;  4EUZ A;  4PM8 A;  2H0T A;  4QB8 A;  3IF6 A;  3SS5 A;  1L0G A;  3MBZ A;  4S2P A;  3IHA A;  3ZDJ A;  2QZ6 A;  3LY4 A;  1NYM A;  3IXH A;  4YIN A;  3RXX A;  4E3J A;  4K0W A;  2OLU A;  4X53 A;  4S2N A;  1XXM A;  1E3U A;  1G68 A;  2IWD A;  1L0F A;  1K4F A;  1NZU A;  4JLF A;  1W8Y A;  3PBS A;  3MKF A;  1YLY A;  1CEG A;  3W4O A;  4E3L A;  3IH9 A;  1MBL A;  4DE0 A;  5FQK A;  3FZC A;  4WMC D;  1DJA A;  1NRF A;  2G2U A;  4ZAM A;  2ZQA A;  2HP6 A;  3M6H A;  5EVI A;  2OSU A;  2HP9 A;  2ZC4 B;  4FH4 A;  3UPP A;  1ES5 A;  1ALQ A;  1IYQ A;  3ITB A;  4HBT A;  1YQS A;  4FCF A;  2EX6 A;  2A49 A;  2JE5 A;  3Q7V A;  3PBR A;  2OV5 A;  3BFC A;  1ZG4 A;  1VM1 A;  2DCF A;  1IEL A;  3BRM A;  2ZQ9 A;  1J9M A;  1JTG A;  4KZ5 A;  1Z6F A;  2H10 A;  2Y2M A;  3GMW A;  4K0X A;  4DRT A;  5CED A;  1XX2 A;  4BEN A;  5HAI A;  3FYZ A;  1FSW A;  1VQQ A;  1XGI A;  2Y59 A;  5EE8 A;  2ZQD A;  2Y2K A;  1Q2Q A;  1RP5 A;  3NCK A;  4IBX A;  3A3F A;  1FCO A;  3UO9 A;  3V50 A;  3W8K A;  3C7V A;  1IEM A;  2C5W B;  2C6W B;  3BFD A;  4JXW A;  2WAE A;  3LEZ A;  2XFT A;  4C3Q A;  4Y7P A;  5DF8 A;  3TG9 A;  3M6B A;  5FQJ A;  4JBF A;  3IH8 A;  4U0T A;  4MNR A;  2WGI A;  1MWR A;  4JF4 A;  1FR6 A;  1DJB A;  1O07 A;  4IBR A;  5DF7 A;  3UE3 A;  4UAA A;  1K55 A;  4C6Y A;  4QJG A;  1E3U D;  3HLG A;  4U3T A;  3FKW A;  3NDG A;  2BG1 A;  4OPR A;  2XDM A;  1I2W A;  4QU3 A;  1GCE A;  4L0L A;  3HLW A;  1JWZ A;  3IWO A;  3LO7 A;  3EQV A;  3ZG7 B;  4E3K A;  3MXS A;  1WE4 A;  1MY8 A;  1RGZ A;  3MZD A;  4N9L A;  3ISG A;  4DE3 A;  2VGJ A;  2Y2N A;  5M1A A;  5FQQ A;  3NBL A;  1ERO A;  4EBL A;  4UA6 A;  3VP1 A;  1YLT A;  4WEJ A;  5FAQ A;  1Y54 A;  4ZJ2 A;  1PWC A;  1XA1 A;  1JWV A;  1ESI A;  1YLZ A;  3W4Q A;  1FCN A;  3VP0 A;  1K6S A;  1W79 A;  2V20 A;  4KZ8 A;  2Z2L B;  1PWD A;  5M18 A;  3HLE A;  4A5R A;  1E25 A;  2P9V B;  3IXB A;  4GOG A;  5E2E A;  3N4I A;  4QD4 A;  1CI8 A;  3NC8 A;  1K6R A;  3VP3 A;  5DVA A;  5I94 A;  2WUQ A;  4O7D A;  1BUE A;  5AQB A;  1L0E A;  1WYB A;  3GVB A;  5EVI C;  1HVB A;  2ZM2 A;  3OPH A;  1JWP A;  3ZCZ A;  4KZ4 A;  5KSH A;  4S2N C;  1G6A A;  1NZO A;  2EX8 A;  5FAT A;  3WWX A;  5IHV A;  3O86 A;  4OVD A;  4BQM A;  5E43 A;  4Y0U A;  3OPR A;  5M19 A;  5A93 A;  4IVI A;  1NY0 A;  3V3R A;  2Y2I A;  5JYP A;  4Q8I A;  1GA9 A;  3QHY A;  3G2Z A;  4E3O A;  3BM6 A;  4GDN A;  4PM6 A;  3HUM A;  2Z2M B;  3VOZ A;  3IF5 A;  4X68 A;  2I72 A;  4H8R A;  4JXV A;  5CHU A;  1PI4 A;  4D2O A;  5GLD A;  2GDN A;  3ZG8 B;  2WGW B;  4GB7 A;  5EOE A;  3RJU A;  3IT9 A;  3G35 A;  3ZVW A;  4BL3 A;  1BSG A;  1PYY A;  5CHJ A;  3CG5 A;  3FWL A;  2RL3 A;  5FA7 A;  3MZF A;  2P74 A;  3VFF A;  1QMF A;  3B3X A;  3O3V A;  5AQ7 A;  4EV4 A;  3IHB A;  4GKU A;  2Y55 A;  3WRT A;  1BT5 A;  2XD1 A;  1JVJ A;  1KGG A;  4BD1 A;  1HD8 A;  3MXR A;  1BLS A;  1DY6 A;  1PW1 A;  1BUL A;  2X01 A;  5DTS A;  2XGN A;  3WS4 A;  4KQR A;  5GHY A;  3GV9 A;  1TVF A;  1ES2 A;  3BEB A;  4OOM A;  3SOI A;  4OOL A;  4JF6 A;  3A3I A;  1E4D A;  4RX3 A;  4BJP A;  1KDS A;  2XEP A;  1K38 A;  1GHI A;  4KZ9 A;  4S2J A;  1OME A;  3BYD A;  1YT4 A;  1K56 D;  1LI9 A;  3QNB A;  2ZC5 B;  4E3N A;  2QPN A;  3CZD A;  4P85 A;  4GDB A;  5FQM A;  2Y2Q A;  1BLC A;  1M40 A;  4KG5 A;  4B4Z A;  1RGY A;  3ZVT A;  4CPK A;  4DXC A;  2WK0 A;  2OLV A;  1ERQ A;  3IF6 C;  4EBN A;  3P98 A;  1I5Q A;  5FSR A;  4JXG A;  4N1X A;  3BLS A;  1K57 A;  4KZA A;  4PM9 A;  3HUN A;  2UWX A;  3WS0 A;  3S4X A;  4DE2 A;  4XUX A;  2Y91 A;  4GNU A;  1MPL A;  5KMW A;  2R9X A;  4MBK A;  3A3D A;  4FSF A;  1ES3 A;  4OP8 A;  3BFF A;  2BLS A;  4KQO A;  5EEC A;  1L2S A;  1YLP A;  1SHV A;  4OPZ A;  3GR2 A;  1JTD A;  2ZM0 A;  2X71 A;  4S2O A;  4R4R A;  4CJN A;  3P09 A;  5CEC A;  2JBF A;  4JPM A;  3SS3 A;  4QHC A;  4EQI A;  4PM7 A;  1MWT A;  1W7F A;  3HL9 A;  5HAQ A;  4B88 A;  1ONH A;  4FH2 A;  4IVK A;  1RCJ A;  1K56 A;  2ZJ9 A;  4LV1 A;  5D3O A;  4DF6 A;  5F1F A;  2CC1 A;  4R3B A;  4HEF A;  3BEC A;  4WM9 A;  4DDY A;  4EWF A;  1TDG A;  3O88 A;  4IED A;  1YLW A;  1H8Y A;  2J9P A;  5EPH A;  4OH0 A;  4OOY A;  2RCX A;  4C75 A;  2V2F F;  3D4F A;  1IYS A;  2J8Y A;  4QY5 A;  3NY4 A;  2WZX A;  1LL5 A;  3C7U A;  3VMA A;  1BTL A;  1FR1 A;  1S6R A;  3V5M A;  1KE3 A;  1TDL A;  4WZ4 A;  2EX2 A;  3C4O A;  4QY6 A;  1CEF A;  5E2G A;  5GLC A;  2WGW A;  5CEB A;  4WZ5 A;  3AGD A;  3N8R A;  3SS4 A;  4OPY A;  1CK3 A;  1YLJ A;  4GD8 A;  1PZP A;  1XA7 A;  4UA9 A;  2ZQC A;  1EI5 A;  1ESU A;  1KGE A;  1MXO A;  1IKG A;  2HP5 A;  1K25 A;  2WGV A;  2HDR A;  5FAO A;  4E3I A;  5TR7 A;  5J8X A;  4YFM A;  2PBY A;  1KDW A;  4OQ0 A;  4U0X A;  4WBG A;  4KG2 A;  5TFQ A;  3GRJ A;  3UDX A;  3UE1 A;  3VP4 A;  3CJM A;  2X02 A;  3N8L A;  2R9W A;  1Q2P A;  5EOO A;  3NIA A;  4WYY A;  4NET A;  3VSL A;  3G30 A;  5CHM A;  4Z9Q A;  3LCE A;  1S0W A;  3W4P A;  4BLM A;  5KZH A;  2H5S A;  4OP5 A;  4OPQ A;  3BFG A;  5U47 A;  1K54 C;  1FOF A;  2Y2G A;  4KZ3 A;  3RXW A;  1TEM A;  3C4P A;  1ES4 A;  1K55 C;  2EXA A;  1FQG A;  3S22 A;  2Y2J A;  5JYO A;  1O7E A;  4KZB A;  3S1Y A;  2XD5 A;  4BD0 A;  2VGK A;  5AQA A;  2WKI A;  1IYO A;  2XLN A;  3ZNT A;  3ZGA B;  3IF6 B;  1SDE A;  2FFY A;  4RYE A;  3HLC A;  4Y0O A;  4UA7 A;  4OLD A;  4X69 A;  1M6K A;  2Q9M A;  1NJ4 A;  4P6B A;  3MFD A;  5E2F A;  1KVM A;  1KVL A;  1EWZ A;  2EFX A;  5FQ9 A;  3IWI A;  3ZG0 A;  4F94 A;  1PWG A;  3PBT A;  5F1G A;  4WEK A;  4M3K A;  2ZC3 B;  4DE1 A;  1H5X A;  1YMS A;  3G4P A;  5FI7 A;  4N92 A;  4R3J A;  3HRE A;  4KZ6 A;  4PPR A;  4R23 A;  5CGX A;  1I2S A;  5DF9 A;  2Y2H A;  1N4O A;  1U60 A;  5CRF A;  2ZM8 A;  3DWK A;  3NDE A;  2XH9 A;  3FV7 A;  1N9B A;  3PAE A;  3HUO A;  4WZ5 C;  2XFS A;  3PBO A;  1XGJ A;  3Q7Z A;  5CGW A;  3FKV A;  5FAP A;  2WKE A;  5EUA A;  4RA7 A;  2WYX A;  2J9O A;  3OPL A;  2ZQ7 A;  5DTK A;  2FFF B;  4GZB A;  3UPO A;  1ONG A;  5CER A;  5F83 A;  3N6I A;  4X56 A;  1K4E A;  4X6T A;  1K57 C;  3N7W A;  4HBU A;  2HDQ A;  5FAS A;  3PBQ A;  4S2L A;  4R0Q A;  3HLB A;  3BFE A;  2ZC6 B;  2Y2L A;  5CXW A;  4ZBE A;  4PMA A;  2E8I A;  4XXR A;  4ZJ3 A;  5GHX A;  5HW3 A;  2WKH A;  5FQI A;  3DWZ A;  2HDS A;  2PU4 A;  5HL1 A;  3OPP A;  2Y2P A;  1FSY A;  2H0Y A;  2XF3 A;  3Q1F A;  1XKZ A;  4JKT A;  4ZTK A;  3E2L A;  4JXS A;  3HVF A;  1SCW A;  2JCH A;  4MLL A;  1PW8 A;  5DTT A;  2Y4A A;  1ZC2 A;  3HLF A;  4LV2 A;  2ZLY A;  5EVL A;  3UPN A;  3GTC A;  1XPB A;  5TGF A;  5FI6 A;  3WS5 A;  3C5A A;  4DDS A;  3G2Y A;  3HLD A;  3WS2 A;  1YM1 A;  3GQZ A;  3IXD A;  3A3J A;  5F82 A;  3SH9 A;  5FDH A;  3PTE A;  4BL2 A;  4NK3 A;  5E2H A;  3SH8 A;  3AGF A;  2WAF A;  3UDF A;  1BZA A;  2DNS A;  3I7J A;  5A90 A;  1BLP A;  3IXG A;  3IQA A;  3ZFZ A;  1PI5 A;  2HPB A;  1IYP A;  1WYC A;  4MBF A;  2A3U A;  2XQZ A;  3AGE A;  1KE0 A;  2Q9N A;  4S2K A;  1LLB A;  2ZQ8 A;  3TOI A;  5HX9 A;  3UDI A;  3ZNY A;  1NYY A;  2Y2O A;  5CGS A;  4DXB A;  1H8Z A;  4KZ7 A;  1YMX A;  1HZO A;  2HDU A;  1SDN A;  4N1H A;  4OON A;  3ZHH A;  4LV0 A;  2B5R A;  3DW0 A;  1GHM A;  4KG6 A;  3UN7 A;  3SH7 A;  1CI9 A;  4KQQ A;  4R1G A;  3VOY A;  1GHP A;  3TSG A;  2IWC A;  3OCL A;  4LEN A;  4MBH A;  2V1Z A;  3UNW A;  1KGF A;  2EFU A;  3BLM A;  4MEZ A;  2WZZ A;  3MKE A;  4PM5 A;  1LL9 A;  1PZO A;  2EX9 A;  1W5D A;  2PU2 A;  2ZMA A;  1IKI A;  4RVA A;  3UY6 A;  2J7V A;  5AQ9 A;  4HES A;  3Q7V B;  2P9V A;  1ZKJ A;  4LCL A;  4OQI A;  5HAP A;  4OKP A;  3OCN A;  1DJC A;  4N9K A;  4OQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...