3O3VA

Crystal structure of clbp peptidase domain
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
335
structure length
335
Chain Sequence
ERLSTLIHQRMQEAKVPALSVSVTIKGVRQRFVYGVADVASQKANTLDTVYELGSMSKAFTGLVVQILIQEGRLRQGDDIITYLPEMRLNYQGKPASLTVADFLYHTSGLPFSTLARLENPMPGSAVAQQLRNENLLFAPGAKFSYASANYDVLGAVIENVTGKTFTEVIAERLTQPLGMSATVAVKGDEIIVNKASGYKLGFGKPVLFHAPLARNHVPAAYIHSTLPDMEIWIDAWLHRKALPATLREAMSNSWRGNSDVPLAADNRILYASGWFIDQNQGPYISHGGQNPNFSSCIALRPDQQIGIVALANMNSNLILQLCADIDNYLRIGKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords beta-lactamase
publication title ClbP x-ray structure, the prototype of a peptidase family associated to NRP production
rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 99
structure length 335
sequence length 335
chains with identical sequence B, C
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3o3vA00
2PBYA 4WZ4A 5E2EA 3WS5A 1M40A 3LY3A 1BUEA 3W4OA 4DXCA 2EX2A 2HDRA 1W5DA 1IKGA 3ZG9B 1YMSA 2Y2IA 2ZM0A 2WGVA 3N8RA 4Y0TA 1SDNA 2Y59A 1LHYA 3IH8A 4RX3A 2Y2GA 5EVIB 4R4SA 1PZPA 1ERMA 1ES3A 4R0QA 1PI5A 1BLHA 5CGSA 1MWRA 4MEZA 1FCMA 3BLMA 3BEBA 4L0LA 2WKIA 2Y2MA 3EQUA 5AQ7A 2EXBA 1IKIA 3OPLA 4JF5A 3IXDA 3NCKA 2WGWA 3EQVA 4R3BA 4GDBA 2WKEA 1W79A 3FYZA 2C6WB 4GOGA 3E2KA 1YLYA 4N1XA 3C5AA 3OC2A 4OQIA 5HFOA 3G30A 3C7VA 3QNCA 3ZG5A 2DCFA 3OPRA 4R3JA 4WZ5C 4OOLA 2Z2LB 4OPYA 4C75A 5F1FA 3OZHA 5KSHA 3AGDA 3M6BA 3IWOA 4LCMA 1BT5A 2P74A 5F1GA 3UPNA 2WAEA 3A3JA 3B3XA 1K54A 3BM6A 3DW0A 4FD8A 4KQOA 4FH4A 5EOEA 4P87A 4D2OA 3A3FA 4ZBEA 1K6RA 2Q9MA 1MBLA 4N9KA 2IWBA 3SS4A 4BL2A 4JKTA 1L0DA 1J9MA 5CXWA 3BLSA 4UAAA 1SKFA 4GB7A 5E2HA 1BLPA 3VP1A 5GLBA 1QMEA 3E2LA 4MLLA 3IWQA 1NZUA 5JYOA 1GA0A 5GLCA 3OPHA 4GDNA 5EVIC 3HL9A 1JTGA 3VP3A 2J9OA 4PM7A 1PWCA 3PBRA 5E43A 2EFXA 3HVFA 4E3JA 1Y54A 3AGFA 3C4PA 1IELA 4B4XA 1L0EA 1BSGA 2P9VB 1MWUA 3PBNA 4MBHA 5HW3A 1O7EA 4KZ9A 4DF6A 4MNRA 1CI9A 3WS4A 3BFEA 4QU3A 5EE8A 2XQZA 4QY6A 4S2NA 5A91A 1YM1A 2ZMAA 2E8IA 5M19A 1JTDA 4RA7A 5DTTA 3UO9A 1DY6A 3VOZA 3MZEA 4YFMA 4C6YA 4U0TA 2XD5A 3Q82A 1YLTA 4Z9QA 1H5XA 4LV2A 4QB8A 3S4XA 1TEMA 4S2KA 3IQAA 1AXBA 2XD1A 1SCWA 5DF7A 4JF4A 2XFTA 5A93A 1K55A 3VP0A 1NZOA 3ITAA 4GKUA 5GL9A 4N9LA 4BL3A 3P09A 1IYQA 4OH0A 4B88A 4HESA 3FKVA 3Q81A 3UPPA 5A92A 2H0YA 3ZHHA 4JXSA 1XPBA 2Y2PA 4S2JA 1Q2QA 5EOOA 2PU2A 2HP9A 5HAQA 4YINA 4JPMA 3QHYA 4O7DA 4PM8A 4FH2A 1KDWA 2Y55A 2QPNA 2WZXA 3OPPA 3ZDJA 2ZQ8A 3CMZA 4OVDA 3N7WA 3IXBA 3NC8A 1BLSA 5HX9A 1RCJA 5DVAA 3GSGA 1ES2A 4ZJ2A 3PBSA 4S2MA 1PI4A 3DWZA 4OPRA 3IT9A 4QHCA 5F82A 2WZZA 3SS3A 4UHUA 3ZFZA 1DJBA 4S2OA 5EVLA 1ES5A 1MXOA 3IHBA 1MWSA 1YMXA 5CHUA 5G18A 3WRZA 2ZQDA 4DE3A 5HL1A 4GNUA 3SH8A 2HP6A 2XGNA 1PW8A 5F83A 3HLFA 1MY8A 1XA7A 4E3MA 3WRTA 1CEFA 3GV9A 3MKFA 4E3NA 2IWCA 5CGWA 5HARA 3Q1FA 4RYEA 4C3QA 5IHVA 4OQHA 4E3IA 1GCEA 3NDEA 1SHVA 4JXWA 2PU4A 3ZNYA 3HLEA 3N8SA 2EX8A 5A90A 1E3UD 3FWLA 4GN2A 4E3OA 2H5SA 3CZDA 5CTMA 1FR1A 2V2FF 1JWZA 3VP4A 4ZTKA 3BYDA 3ZG0A 3G4PA 4UA9A 3PBTA 1K4FA 2ZQCA 5FAPA 5FAQA 4EQIA 5EUAA 1K38A 5EVID 1KGFA 3NI9A 3TOIA 4HBUA 1MPLA 2HDQA 5DTSA 5GHZA 2V20A 2OV5A 4BD1A 4BLMA 1I5QA 4XUXA 5J8XA 4K0XA 2ZQ9A 3BRMA 3HLWA 4OPQA 4GZBA 4P6BA 3HLBA 4N1HA 4B4ZA 1ONGA 4RX2A 1LI0A 3NY4A 5TGFA 1OMEA 3G2ZA 1FQGA 3V3SA 2JC7A 1ALQA 4KZAA 4JLFA 5FI7A 5E2GA 2XLNA 2J7VA 5GLAA 3NBLA 2XR0A 1M6KA 1NYMA 3G2YA 1DJAA 1SDEA 2B5RA 1VQQA 1YLWA 3G32A 1K56A 1RGZA 2RCXA 1K57A 2Y2QA 1W8YA 5FQIA 4A5RA 1O07A 2XDMA 3VSKA 4DDSA 3FZCA 5FSRA 4LENA 4ZDXA 5FQJA 1FOFA 2EX6A 2J9PA 3MZFA 5FASA 1EROA 5CTNA 3LY4A 4X55A 3SOIA 2Y2NA 1BLCA 1K55C 4PM9A 2C5WB 4GD6A 3IXHA 3PAGA 4OLDA 4IBXA 1NJ4A 1Q2PA 3UPOA 3HUMA 4EV4A 1JWPA 3BECA 1L0FA 1JWVA 3HBRA 3OCNA 2A49A 2OLVA 4KZ6A 2ZC6B 1XA1A 3GMWA 3IXGA 1ES4A 3IF6A 4WMCA 5AQ9A 3NIAA 2G2UA 3OCLA 3W8KA 2EFUA 2WK0A 3GRJA 4R4RA 3HUNA 3TSGA 3MXRA 4OONA 1L0GA 4IVKA 1NRFA 4KZ4A 3LCEA 4M3KA 1YLJA 2WGWB 1JVJA 3WS2A 1BTLA 4WEJA 1KE3A 2HDUA 1HTZA 1ERQA 2EX9A 4CPKA 3AGEA 1ZG4A 3ZVWA 2R9WA 4BJPA 3HLDA 1PYYA 5CHJA 1GHIA 1LL5A 4BD0A 3IWIA 5EECA 5FDHA 3V50A 3WWXA 4EBNA 2X71A 2ZC5B 3UDIA 1QMFA 2X01A 4WBGA 1ESUA 3UDFA 1PZOA 1ZKJA 2WAFA 4PPRA 5GHXA 5KMWA 4UA7A 2IWDA 3MZDA 4X68A 1K56D 1XGJA 3HUOA 4NETA 3RJUA 2Y2OA 3LEZA 3HREA 4IBRA 4OQGA 2GDNA 2RL3A 3P98A 3PBQA 5BOHA 2DRWA 4P0MA 2Y2JA 3RXXA 2Q9NA 2QMIA 4GD8A 4QD4A 4FCFA 1NY0A 5FA7A 1XX2A 5GHYA 1E25A 1KE4A 2JE5A 3TG9A 1DJCA 4OQ0A 4KQQA 4NK3A 4X53A 2Y2LA 3C4OA 2G2WA 4WM9A 1FR6A 3ISGA 4KENB 5FI2A 5TR7A 3IF6B 3W4QA 3NDGA 1BULA 4DXBA 2QZ6A 5M18A 2WGIA 2XF3A 1N4OA 3FKWA 3N8LA 4KZ7A 4OP5A 4ZJ3A 3G31A 3I7JA 3PBOA 5CECA 2ZC3B 4KQRA 4N92A 3RXWA 1ONHA 1KGEA 3ZG8B 1WE4A 5DTKA 3UDXA 3UN7A 3GTCA 1ESIA 1RGYA 4JF6A 5D3OA 1K54C 2CC1A 3M2JA 3ZVTA 4LCLA 4H8RA 1GA9A 4R23A 2WADA 1ZG6A 1K57C 3DTMA 1YQSA 2ZC7A 1YT4A 3VMAA 4DRTA 3Q7ZA 1HZOA 1PW1A 4HBTA 4S2IA 2I72A 4LV0A 4EWFA 5AQAA 4PMAA 1N9BA 1XGIA 2XFSA 3ZNTA 1GHMA 1L2SA 1RP5A 1LLBA 3BFDA 5FQQA 3VSLA 3G35A 1W7FA 3PAEA 1HD8A 1WYBA 2XEPA 2ZM2A 4R1GA 3V5MA 4FSFA 2P9VA 3IF6C 1G6AA 5DF9A 3O88A 4U0XA 5CERA 4S2NC 4WEKA 1PIOA 3IHAA 3FV7A 2Y91A 3VFFA 3VP2A 3SH7A 1XXMA 1HVBA 4Y0OA 5FAOA 1MKIA 5KZHA 3Q07A 1FCOA 4KZ8A 4IVIA 3V39A 4OKPA 5FATA 4E6XA 4UA6A 4X69A 5I94A 2H10A 4U3TA 3UNWA 1MWTA 3VOYA 5M1AA 2ZQ7A 1E4DA 3PTEA 4P85A 5E2FA 3UE3A 5CRFA 1IYPA 1TDGA 4JBFA 1CI8A 5TFQA 4CJNA 4WELA 4DKIA 5FI6A 2Z2MB 3A3EA 3M2KA 3BFCA 2XH9A 2FFYA 3GVBA 5HAPA 3Q7VA 4LV1A 3D4FA 4EBPA 3UE0A 3MFDA 3ZG7B 4XXRA 2ZLYA 4EUZA 3QNBA 3M6HA 2OLUA 4DDYA 4MBFA 4KG6A 4Y0UA 1VM1A 3VFHA 3WS0A 3ZGAB 2UWXA 1YLZA 4Q8IA 1S6RA 5U47A 4X6TA 2Y4AA 2R9XA 2ZD8A 4KG2A 3HLGA 4OOYA 2BLSA 3LO7A 1FSYA 4MBKA 5JYPA 3BFFA 4OOMA 1K25A 4QJGA 2WYXA 4Y7PA 1NYYA 2WUQA 4RVAA 2Y2HA 3IF5A 4PM5A 2OSUA 1IYSA 3O87A 2X02A 2BG1A 3MKEA 1I2SA 3MXSA 1IYOA 1CEGA 1KGGA 4WZ5A 1ZC2A 2DNSA 2FFFB 2HP5A 5CGXA 2VGJA 2EXAA 3A3DA 3JYIA 1GHPA 1TVFA 4K91A 5CEDA 4S2LA 5L2FA 2HDSA 5FQMA 1XKZA 3BFGA 4KG5A 4KZ5A 1E3UA 1LI9A 2JBFA 4DE1A 1KDSA 5FQKA 2ZQAA 1G68A 3ITBA 3N4IA 3O3VA 3CJMA 1XP4A 1CK3A 4XUZA 1W8QA 4JXGA 5HAIA 1BZAA 1IEMA 1FSWA 1S0WA 1TDLA 2J8YA 5EVIA 4JXVA 3UY6A 1KVLA 3W4PA 1FCNA 4HEFA 1C3BA 4ZJ1A 4EBLA 3A3IA 5CEBA 4S2PA 3ZCZA 1PWGA 2ZM8A 2HPBA 3SH9A 4ID4A 2V1ZA 1WYCA 5FQ9A 3Q7VB 5EPHA 2Y2KA 3C7UA 3MBZA 1PWDA 1I2WA 5DF8A 3DWKA 3V3RA 1U60A 2H0TA 4WMCD 1H8ZA 1KE0A 3WS1A 4F94A 1EI5A 3N6IA 5AQBA 4K0WA 3HLCA 4OP8A 3SS5A 3O86A 4DE0A 3S22A 4KZBA 1H8YA 5KSCA 1EWZA 5GLDA 2ZC4B 4QY5A 1LL9A 4LV3A 3GR2A 3G34A 4WYYA 4E6WA 4ZAMA 4DE2A 3IH9A 4OPZA 4E3KA 4X56A 4OLGA 1NXYA 4BQMA 2A3UA 4IEDA 4BENA 4PM6A 2WKHA 1YLPA 2JCHA 2ZJ9A 1K4EA 5CHMA 3S1YA 1K6SA 3UE1A 3GQZA 3CG5A 1KVMA 4E3LA 4KZ3A 1Z6FA 2VGKA 2XK1A
chains in the Genus database with same CATH superfamily
1M40A 1YMSA 4Y0TA 3IH8A 3IS2A 1XJ4A 3H82A 2KX6A 3BLMA 2WKIA 2Y2MA 3VV4A 1T1CA 1W79A 3FYZA 3E2KA 2JKRM 2OWJA 4N1XA 3C5AA 4OQIA 3OPRA 4OOLA 5KSHA 3B3XA 4FH4A 4D2OA 4N9KA 1L0DA 4FOFA 4PM7A 2FZ0A 3HVFA 2JKFA 3C4PA 3KSIA 3OBFA 1BSGA 1MWUA 3IS2B 5HW3A 4R3AA 4NXBA 3WS4A 2JKRI 1YM1A 2XRNA 1JTDA 4C6YA 3Q82A 1YLTA 4Z9QA 1YSPA 4QB8A 3UB7A 1AXBA 5HL6A 4HP4A 1K55A 1NZOA 2O9AA 1MZUA 5L8MA 1IYQA 3KYQA 2W0NA 3Q81A 4KUKA 4CLCE 4EETB 1H8MA 4O7DA 2Y55A 2WZXA 3CMZA 5K5BA 4O8GA 1PI4A 3DWZA 3PR6A 3IT9A 4GS9B 4QHCA 2WZZA 1N9NA 5EVLA 5LBRA 1ES5A 5CHUA 4DE3A 5TBMA 3P7NA 1N9OA 4L9GA 3MKFA 2W1TA 5HARA 3Q1FA 4RYEA 4E3IA 1Y28A 5IHVA 1SHVA 2PU4A 3ZNYA 3HLEA 1S67L 1E3UD 3FWLA 3LICA 3CZDA 2J80A 3VP4A 3BYDA 3PBTA 1K4FA 5EUAA 3NI9A 3MFXA 3TOIA 4HBUA 4DJ2A 4BD1A 1I5QA 3HLBA 1ONGA 3IX3A 3G2ZA 3T4LA 3HJIA 2M1CA 4JLFA 5FI7A 5E2GA 2J7VA 4HQAA 3NBLA 1GSVA 1LL8A 1VQQA 1NWZA 4EW7A 2L1MA 4DMZA 2PRFA 2RCXA 3OLOA 4FTXA 4DDSA 5FSRA 4LLOB 5TBMB 1NLZA 2EWWA 3MJQA 3LY4A 2W1TB 3PAGA 4OLDA 4IBXA 1NJ4A 1PRQA 3HUMA 3R7WA 4EV4A 2A49A 3E4PA 3D72A 2ZC6B 4I38A 1XA1A 4UQIS 1T19A 3W8KA 1L0GA 3ULFA 1NRFA 4KZ4A 1D1JA 3LCEA 2WGWB 3UMEA 4CPKA 3S7PA 1ZG4A 4KQDA 4BJPA 3V50A 2X01A 2WAFA 5IS1A 1K56D 1W63Q 1S4RA 5C5KA 4G3VA 5GHYA 3R7WB 2JE5A 1KE4A 2P08A 3FG8A 3W4QA 4DXBA 2QZ6A 2XF3A 3N8LA 1TS8A 4OP5A 4N92A 5EVEA 1ONHA 3ZG8B 5DTKA 1ESIA 2Y8HA 3T4QA 1K54C 4R23A 4I39A 3C2WA 3A0VA 1SZVA 1YT4A 2PD7A 4DRTA 3LIBA 2I72A 4EWFA 3W2ZA 1N9BA 3ZNTA 1WYBA 3LFVA 2P9VA 3ICYA 3IF6C 4GLQA 4MMNA 2V1AA 2W1RA 4U0XA 5CERA 4S2NC 4NXFA 1D7EA 1PIOA 4EESA 1OT9A 3VFFA 3VP2A 3LIAA 4HJ6A 1T18A 4KZ8A 2HGVA 4WF0A 5FATA 4E6XA 4U3TA 1JNUA 1MWTA 3VOYA 4HP9A 4P85A 5E2FA 2HJEA 4HOIA 5CRFA 1TDGA 4Y2FA 4EEPA 4Y13A 2FFYA 3GVBA 2ZOHA 5HAPA 3CUEA 5DKKA 3RFBA 4Y0UA 3VFHA 1VM1A 4Q0IA 5HD3A 4Q8IA 3F1OB 2Y4AA 3OOVA 4PKYG 4OOYA 3LO7A 3NOPC 5JYPA 4Y7PA 3LI8A 4RVAA 2GX5A 3ZQ5A 3O87A 3MXSA 1G5UA 4WZ5A 5AVEA 4UEYA 2PT7A 5DFXA 5CGXA 2VGJA 2VA0A 3A3DA 3JYIA 5J7EA 1ZTUA 3F1NA 3TRCA 5CEDA 4M4XA 4EERA 2ZOIA 3ITBA 3N4IA 3O3VA 5MC7A 1FIKA 1XP4A 1CK3A 4ESPA 4JXGA 1TDLA 5EVIA 2W27A 2BASA 1FCNA 1UGUA 4HEFA 1C3BA 4ZJ1A 4EBLA 3VE3A 2ZM8A 2HPBA 5HSQA 4ID4A 5FQ9A 5EPHA 3MBZA 5DF8A 3FPVA 1P9RA 2H0TA 1H8ZA 4LPZA 4HIAA 1TS7A 4OP8A 1CJFA 4DE0A 3B47A 1ODVA 3JVVA 4QY5A 2VK3A 3LIEA 4X56A 4BQMA 2A3UA 2WKHA 3DBAA 3S1YA 2W3GA 4EQ1A 2PBYA 3LY3A 1BUEA 4DXCA 2HDRA 1IKGA 3ZG9B 1SDNA 2Y59A 3MXQA 2Y2GA 5IT5A 5EVIB 4L9FA 1PI5A 4JGQA 4L0LA 1Z09A 5AQ7A 4IHQA 2WKEA 3CAXA 3QNCA 3AGDA 4LCMA 3WS1A 1PNEA 3A3JA 3DW0A 4KQOA 4P87A 1P0ZA 3BW6A 5AJGA 1K6RA 1J9MA 3BLSA 4GB7A 3VP1A 5GLBA 3IWQA 1NZUA 4YNRA 3OPHA 3HL9A 1JTGA 2J9OA 1PWCA 2J3TC 5G4YA 5E43A 3QP5A 3EEAA 3NULA 2OAQ1 2XROA 1O7EA 4KZ9A 3UMDA 3BFEA 1YPRA 4QY6A 5J4EA 4HY8A 2ZMAA 2E8IA 5HD5A 3T1SA 2INWA 3UO9A 4U0TA 1H5XA 2YKFA 2VGLM 3IQAA 2XD1A 5DF7A 4JF4A 3MQOA 5GL9A 2W3DA 3DAVA 3P09A 4B88A 3FKVA 3UPPA 5A92A 4JXSA 4S2JA 2HP9A 3IX4A 4JPMA 1OTIA 4IUHA 4FH2A 1KDWA 4Q0HA 3IXBA 2J3WA 1VHMA 3NC8A 5HWVA 5HX9A 5DVAA 4ZJ2A 4S2MA 4OPRA 3C8CA 3SS3A 4UHUA 3BJNA 2ZQDA 3NECA 3WRZA 5HL1A 4GNUA 3SH8A 1PW8A 1MY8A 2QYBA 3WRTA 3L9KA 1CEFA 4BBUA 4C3QA 4OQHA 1GCEA 4JXWA 3VE4A 4GN2A 4E3OA 3QP4A 3R4KA 4HHDA 5CTMA 1FR1A 1JWZA 4ZRRA 1WA9A 2HV1A 3ZG0A 2W3EA 1TS6A 4UA9A 1DRMA 1N9LA 5FAQA 2YKHA 1K38A 5EVID 1KGFA 4FUWA 3KX0X 5GHZA 2OV5A 3K3DA 4BLMA 4XUXA 5J8XA 4I5SA 2ZQ9A 3BRMA 4K0XA 4N1HA 3U4LP 3QP2A 1FQGA 2I9VA 1ALQA 4KZAA 2B18A 2XR0A 3G2YA 1SDEA 2B5RA 1K56A 1RGZA 3FZCA 5FQJA 1FOFA 2EX6A 4WUJA 1DP6A 5EFWA 5FASA 5CTNA 4X55A 3SOIA 2Y2NA 1K55C 3E98A 1ZHHB 1Q2PA 4JGOA 5L07A 1JWPA 3HBRA 1JWVA 3CI6A 2O99A 2OLVA 2AVXA 5HWTA 1Y4OA 4WMCA 5AQ9A 3NIAA 2G2UA 3H82B 3GRJA 4ARZA 4G3KA 3MXRA 2PR5A 2G7UA 3UE6A 3NOTC 4M3KA 1YLJA 3PYPA 2WKPA 1KE3A 4MDZA 1ERQA 3ZVWA 2R9WA 5HDCA 3HLDA 1PYYA 5CHJA 1LL5A 4BD0A 2Q0OA 5FDHA 2L4RA 5KMWA 1ZKJA 5GHXA 2IWDA 3MZDA 4X68A 2V8CA 3RJUA 4DN0A 4GW9A 4JGRA 2Y2JA 3T1RA 2QMIA 1G28A 5FA7A 1NLYA 3TG9A 4OQ0A 4KQQA 3C4OA 3ISGA 1G6OA 4KZ7A 3DTKA 3T4KA 3DTEA 4ARZB 3G31A 3PBOA 5CECA 2ZC3B 2CC1A 3M2JA 4LCLA 2P7JA 2P04A 3IX8A 1HZOA 4HBTA 2XA7M 4B93A 4ETXA 5KIZA 2PYRA 1L2SA 2VV8A 1HD8A 2XEPA 1G6AA 3FV7A 2Y91A 5FAOA 1MKIA 1X0OA 3CWFA 4UA6A 1OTBA 2ZQ7A 1EW0A 3FC7A 4CJNA 1T1BA 5FEFA 3M2KA 5AVFA 3D4FA 3ZG7B 4LRZE 2ZLYA 4XXRA 3CLOA 2VKSA 1DP9A 2OLUA 4KG6A 3B42A 1CQAA 2KLIA 3ZGAB 2UWXA 1YLZA 3BY9A 3HLGA 1W63M 4MBKA 1NYYA 2Y2HA 2OSUA 3MKEA 4NEED 2FFFB 1OJ5A 1GHPA 2HDSA 3BFGA 1YAXA 2OOLA 1LI9A 2JBFA 1KDSA 2ZQAA 1W8QA 5HAIA 3VOLA 2O9BA 3H7WA 2J8YA 4II7A 4JXVA 2K7SA 3HCYA 5CEBA 2V1ZA 3DTIA 3T1QB 4WMCD 1EI5A 5AQBA 4WN5A 2ZBBA 3HJKA 2ZC4B 1LL9A 2VZWA 3C30A 4I3AA 3EEHA 3GR2A 3G34A 4WYYA 1NXYA 1XJ3A 4PM6A 1DP8A 2D01A 5HPIA 3UE1A 3GQZA 4KZ3A 4Y15A 1P97A 2VGKA 2VGLS 2XK1A 2WKRA 4X25A 3CUEC 5L10A 3JPUA 2ZM0A 2WGVA 3JVUA 3N8RA 4RX3A 3H7WB 4R4SA 4EUVA 4AFIA 1PZPA 4R0QA 5CGSA 1MWRA 1GSXA 1IKIA 3E0YA 3IXDA 3NCKA 2C6WB 1YSQA 3OC2A 2V9AA 5HFOA 3G30A 3C7VA 4Z1WA 2DCFA 4R3JA 4WZ5C 1XJ6A 5DKLA 2Z2LB 3ZG5A 3CITA 1MC0A 3M6BA 3IWOA 4QWOA 2P74A 3UPNA 2WAEA 1XFNA 4FD8A 1K54A 3KSGA 4ZBEA 3K2NA 3SS4A 5CXWA 4DJ3A 4UAAA 1BLPA 1QMEA 3E2LA 1GA0A 4JGPA 5EVIC 3QP6A 3PBRA 1P9WA 2EFXA 1Y54A 1UWPX 2DMWA 1IELA 4R38A 1UWNX 2P9VB 2WKQA 5EV0A 5HDDA 4DF6A 4MNRA 4QU3A 5EE8A 4S2NA 5A91A 3EGDC 5M19A 2E8JA 3VOZA 3MZEA 4YFMA 2XD5A 2UV0E 4LV2A 4S2KA 2XFTA 2KOIA 5I5LA 4EEUA 5L09A 1GSWA 4BL3A 4OH0A 4HESA 2QWSA 3NHQA 3ZHHA 1XPBA 2HF6A 4BBTA 4PM8A 4ME4A 2QPNA 3ZDJA 3OPPA 4OVDA 1BLSA 1RCJA 3GSGA 3PBSA 5TJJA 3ZFZA 1DJBA 4S2OA 2JHEA 2IA2A 3E4QA 5G18A 3FPWA 4Y17A 4D60A 1XA7A 4E3MA 3F1NB 2GJ3A 3GV9A 1VB6A 3SZTA 2EX8A 5A90A 2H5SA 5HZHA 1YKDA 5F6AA 3IBRA 3G4PA 2ZQCA 4CLCA 2XSSA 2PHYA 3A0RA 5DTSA 2V20A 3HLWA 4GZBA 3NY4A 5TGFA 3T4SA 4NXGA 3V3SA 2MJ6A 4IUKA 2XLNA 3KYEA 1M6KA 1DJAA 1YLWA 3G32A 1OTDA 1K57A 2Y2QA 1W8YA 4A5RA 1O07A 2XDMA 3VSKA 1D06A 2J9PA 1EROA 2C5WB 4GD6A 3IXHA 3UPOA 2NUPC 1A0KA 3BECA 4HNBA 1NRJA 3CPTA 3MS6A 2XA7S 3IXGA 3OCLA 2EFUA 2WK0A 3HUNA 4CLCB 4IVKA 3MQQA 1IOUA 3TE8A 1JVJA 3WS2A 1BTLA 4WEJA 2HDUA 1HTZA 2EX9A 3AGEA 1GHIA 3IWIA 5EECA 3WWXA 4EBNA 5DFYA 3UDIA 1QMFA 4WBGA 1BYWA 1PZOA 4UA7A 4B9OA 1SKOA 2JKTI 2V0UA 1XGJA 1TF1A 3H9WA 3HUOA 1MKMA 4IBRA 5HPFA 1LSVA 2GDNA 3P98A 3PBQA 2DRWA 4P0MA 4GD8A 4QD4A 4FCFA 1NY0A 1XX2A 1OTAA 3UB9A 3MSHA 1DJCA 2Y2LA 2G2WA 1FR6A 4KENB 5FI2A 4HJ3A 1BULA 5M18A 2M7VA 3MF0A 3RH8B 1N4OA 3FKWA 3MR0A 4O0PA 1H0MA 2L0WA 2VEAA 2ZL1A 4GJ4A 3U2AA 4KQRA 4NG2A 3TW8A 1KGEA 1WE4A 3UDXA 3GTCA 1S1YA 4P6ZM 4WLAA 4H8RA 2JKGA 1ZG6A 2ZC7A 3A0SA 1F9IA 4PKYA 3Q7ZA 1PW1A 3B33A 4S2IA 4LV0A 3NOUC 4PMAA 1RP5A 1SKOB 5FQQA 4G3WA 1W7FA 3PAEA 2ZM2A 3T12B 2OWHA 2BTFP 4WEKA 1XXMA 1HVBA 3BQ8A 4Y0OA 3Q07A 1FCOA 4IVIA 2H10A 4LFUA 2ZL1B 5M1AA 2A24A 2V0WA 1LT0A 4JBFA 1CI8A 5TFQA 4DKIA 2Z2MB 3A3EA 2GZAA 4I3JA 2JN7A 3LR3A 2XH9A 4X1LA 1H3QA 3UE0A 3QNBA 3WS0A 2ZMVA 1S6RA 5U47A 2ZD8A 4KG2A 4CLCD 1FSYA 4OOMA 1K25A 4QJGA 1IFQA 4GS9A 2WUQA 4PM5A 1IYSA 2X02A 3MMHA 5DJUA 3BY8A 2DNSA 1AWIA 5A8BA 4X1MA 2HP5A 1TVFA 5L2FA 5FQMA 1XKZA 4KG5A 1OTEA 1G68A 3LGOA 3CJMA 4K08A 2A24B 1FSWA 1KVLA 2K2NA 2K31A 2H28A 3QP8A 4LRYC 3SH9A 2FH5A 2V8FA 2D02A 1PWDA 1OPXA 3DWKA 3V3RA 1V9YA 2PDRA 4H6JA 4K0WA 3TJZC 3V67A 3SS5A 1LSWA 3S22A 3O5YA 4KZBA 1H8YA 1EWZA 2O0YA 5GLDA 4KUOA 2ACGA 4PAUA 4ZAMA 4OPZA 4BENA 1YLPA 3G6OA 4O01A 5CHMA 3K3CA 1Z6FA 2B95A 4WZ4A 5E2EA 3WS5A 3W4OA 2EX2A 1W5DA 2R78A 2Y2IA 2PAVP 1LHYA 1PFLA 1ERMA 1ES3A 1BLHA 2HJ9C 4MEZA 1FCMA 3BEBA 3MQ0A 2J3TD 3EQUA 2EXBA 3OPLA 1S66L 4JF5A 3LYXA 2WGWA 3EQVA 4R3BA 4GDBA 1S1ZA 4GOGA 4H6JB 5G4ZA 1YLYA 4PHTA 4F3LA 3UB8A 2PYPA 4C75A 2NUTC 4OPYA 5F1FA 3OZHA 4DE1A 5F1GA 1BT5A 4I3IA 1V9ZA 3BM6A 4XT2A 5EOEA 3L7HA 3A3FA 2IWBA 2Q9MA 1MBLA 4BL2A 4DE2A 4JKTA 3NJAA 1SKFA 5E2HA 4MLLA 3ZYTA 5JYOA 2PD8A 5F69A 4GDNA 5GLCA 5HDSA 4NKPA 5F68A 3VP3A 2ZMFA 4E3JA 3AGFA 4B4XA 1L0EA 3PBNA 4MBHA 1CI9A 2XQZA 2VX8A 2VJWA 1TS0A 4RA7A 5DTTA 2LB5A 1DY6A 2KDKA 1XJ2A 5FEGA 3S4XA 1TEMA 2LB9A 5A93A 1SCWA 4YWZA 4F3LB 3VP0A 3ITAA 4GKUA 3LUQA 4N9LA 4XT2B 2H0YA 2Y2PA 4BMWA 1Q2QA 5EOOA 2PU2A 1F5MA 5HAQA 4YINA 3QHYA 2ZQ8A 3N7WA 2PR6A 3LR5A 4MN6A 1ES2A 5FL3A 5HWWA 5F82A 3UB6A 1MXOA 1FILA 3IHBA 4EU0A 3BWLA 1MWSA 1YMXA 3LIDA 2HP6A 2XGNA 5F83A 3HLFA 2QHKA 4RQ9A 4MCWA 4E3NA 2IWCA 5CGWA 3NDEA 3N8SA 1KOUA 2V2FF 1J3WA 4ZTKA 3F1PA 5FAPA 4EQIA 1S4SA 3F1OA 1MPLA 2HDQA 4CQHA 3BQAA 1XFQA 4OPQA 4B4ZA 4P6BA 3KSFA 4RX2A 1LI0A 1OMEA 4HI4A 2JC7A 5GLAA 4HJ4A 1NYMA 3CHWP 3EWKA 5F5YA 2Z6CA 4GCZA 3PXPA 5EM0A 5FQIA 4E04A 2QJ7A 4ZDXA 4LENA 3EGXC 3MZFA 1BLCA 4PM9A 2VLGA 4P6ZS 3E4OA 1L0FA 4Q0JA 3OCNA 3S7NA 4KZ6A 3GMWA 1ES4A 4Y5FA 3IF6A 2O9CA 3UB5P 2QKPA 3F1PB 4R4RA 2Y79A 3TSGA 4OONA 3KYZA 3RTYA 3LR4A 2W3HA 3LEQA 3S7QA 1CF0A 2X71A 2ZC5B 3KSHA 3LIFA 1ESUA 3GECA 3UDFA 2QJ5A 4PPRA 2VV6A 5EM1A 4EXOA 4MN5A 3SW1A 4NETA 1F2KA 1VEUA 2Y2OA 3LEZA 3HREA 4OQGA 2RL3A 5BOHA 3RXXA 2Q9NA 4HH2A 3T4TA 1E25A 4CLCC 3D3OA 4HH3A 4NK3A 1ACFA 4WL9A 4X53A 4WM9A 3T1XA 5TR7A 4BWIA 3IF6B 3NDGA 2WGIA 2A2LA 4ZJ3A 3I7JA 3RXWA 3UN7A 2HZ5A 1RGYA 4JF6A 5D3OA 3ZVTA 1GA9A 3LI9A 2WADA 1K57C 3DTMA 1YQSA 3T4OA 3VMAA 1OJGA 2GNXA 4UQIM 5AQAA 1XGIA 2XFSA 1GHMA 3P01A 1LLBA 3BFDA 4R6LA 1VEUB 3VSLA 1K0KA 1L3LA 3G35A 4R1GA 3V5MA 4IJGA 1VETA 4FSFA 3C38A 5DF9A 3O88A 3IHAA 3SH7A 3S7OA 1T1AA 5KZHA 2EWVA 3V39A 4OKPA 4X69A 4LRXC 5I94A 3UNWA 1E4DA 3PTEA 3UE3A 1IYPA 2M7UA 2JKTM 4WELA 2Z6DA 5FI6A 3BFCA 4BBVA 3Q7VA 4LV1A 4EBPA 3MFDA 4EUZA 3M6HA 4DDYA 4MBFA 5DJTA 2B02A 5J3WA 1STZA 4X6TA 2R9XA 1OT6A 5IU1A 2BLSA 4GHIA 3BFFA 2WYXA 5CX7A 3EOIA 3IF5A 4L9EA 1VETB 4ETZA 1TD5A 3T4JA 2BG1A 2OAP1 1I2SA 1IYOA 1CEGA 1KGGA 4YOFA 1ZC2A 2PBDP 1HLUP 3KO6A 2EXAA 4K91A 4S2LA 4KZ5A 1E3UA 3T50A 5FQKA 4XUZA 3PHYA 1BZAA 2V1BA 1IEMA 1S0WA 3UY6A 4NXEA 3W4PA 3LR0A 3A3IA 4S2PA 3ZCZA 1PWGA 3CPTB 1LSXA 3IBJA 1WYCA 3Q7VB 2VV7A 2EA9A 2Y2KA 3C7UA 4QPRA 1I2WA 1U60A 3D9YA 4F94A 1KE0A 3N6IA 1F98A 3HLCA 3O86A 5KSCA 4GHIB 4LGWA 5FDSA 4LV3A 4R70A 4E6WA 3IH9A 3GDIA 4E3KA 4OLGA 4MN7A 4IEDA 2JCHA 2ZJ9A 1K4EA 3QP1A 1K6SA 3CG5A 1KVMA 4E3LA 2CMNA 2W3FA 4Y3IA
chains in the Genus database with same CATH topology
2PBYA 4WZ4A 5E2EA 3WS5A 1M40A 3LY3A 1BUEA 3W4OA 4DXCA 2EX2A 2HDRA 1W5DA 1IKGA 3ZG9B 1YMSA 2Y2IA 2ZM0A 2WGVA 3N8RA 4Y0TA 1SDNA 2Y59A 1LHYA 3IH8A 4RX3A 2Y2GA 5EVIB 4R4SA 1PZPA 1ERMA 1ES3A 4R0QA 1PI5A 1BLHA 5CGSA 1MWRA 4MEZA 1FCMA 3BLMA 3BEBA 4L0LA 2WKIA 2Y2MA 3EQUA 5AQ7A 2EXBA 1IKIA 3OPLA 4JF5A 3IXDA 3NCKA 2WGWA 3EQVA 4R3BA 4GDBA 2WKEA 1W79A 3FYZA 2C6WB 4GOGA 3E2KA 1YLYA 4N1XA 3C5AA 3OC2A 4OQIA 5HFOA 3G30A 3C7VA 3QNCA 3ZG5A 2DCFA 3OPRA 4R3JA 4WZ5C 4OOLA 2Z2LB 4OPYA 4C75A 5F1FA 3OZHA 5KSHA 3AGDA 3M6BA 3IWOA 4LCMA 1BT5A 2P74A 5F1GA 3UPNA 2WAEA 3A3JA 3B3XA 1K54A 3BM6A 3DW0A 4FD8A 4KQOA 4FH4A 5EOEA 4P87A 4D2OA 3A3FA 4ZBEA 1K6RA 2Q9MA 1MBLA 4N9KA 2IWBA 3SS4A 4BL2A 4JKTA 1L0DA 1J9MA 5CXWA 3BLSA 4UAAA 1SKFA 4GB7A 5E2HA 1BLPA 3VP1A 5GLBA 1QMEA 3E2LA 4MLLA 3IWQA 1NZUA 5JYOA 1GA0A 5GLCA 3OPHA 4GDNA 5EVIC 3HL9A 1JTGA 3VP3A 2J9OA 4PM7A 1PWCA 3PBRA 5E43A 2EFXA 3HVFA 4E3JA 1Y54A 3AGFA 3C4PA 1IELA 4B4XA 1L0EA 1BSGA 2P9VB 1MWUA 3PBNA 4MBHA 5HW3A 1O7EA 4KZ9A 4DF6A 4MNRA 1CI9A 3WS4A 3BFEA 4QU3A 5EE8A 2XQZA 4QY6A 4S2NA 5A91A 1YM1A 2ZMAA 2E8IA 5M19A 1JTDA 4RA7A 5DTTA 3UO9A 1DY6A 3VOZA 3MZEA 4YFMA 4C6YA 4U0TA 2XD5A 3Q82A 1YLTA 4Z9QA 1H5XA 4LV2A 4QB8A 3S4XA 1TEMA 4S2KA 3IQAA 1AXBA 2XD1A 1SCWA 5DF7A 4JF4A 2XFTA 5A93A 1K55A 3VP0A 1NZOA 3ITAA 4GKUA 5GL9A 4N9LA 4BL3A 3P09A 1IYQA 4OH0A 4B88A 4HESA 3FKVA 3Q81A 3UPPA 5A92A 2H0YA 3ZHHA 4JXSA 1XPBA 2Y2PA 4S2JA 1Q2QA 5EOOA 2PU2A 2HP9A 5HAQA 4YINA 4JPMA 3QHYA 4O7DA 4PM8A 4FH2A 1KDWA 2Y55A 2QPNA 2WZXA 3OPPA 3ZDJA 2ZQ8A 3CMZA 4OVDA 3N7WA 3IXBA 3NC8A 1BLSA 5HX9A 1RCJA 5DVAA 3GSGA 1ES2A 4ZJ2A 3PBSA 4S2MA 1PI4A 3DWZA 4OPRA 3IT9A 4QHCA 5F82A 2WZZA 3SS3A 4UHUA 3ZFZA 1DJBA 4S2OA 5EVLA 1ES5A 1MXOA 3IHBA 1MWSA 1YMXA 5CHUA 5G18A 3WRZA 2ZQDA 4DE3A 5HL1A 4GNUA 3SH8A 2HP6A 2XGNA 1PW8A 5F83A 3HLFA 1MY8A 1XA7A 4E3MA 3WRTA 1CEFA 3GV9A 3MKFA 4E3NA 2IWCA 5CGWA 5HARA 3Q1FA 4RYEA 4C3QA 5IHVA 4OQHA 4E3IA 1GCEA 3NDEA 1SHVA 4JXWA 2PU4A 3ZNYA 3HLEA 3N8SA 2EX8A 5A90A 1E3UD 3FWLA 4GN2A 4E3OA 2H5SA 3CZDA 5CTMA 1FR1A 2V2FF 1JWZA 3VP4A 4ZTKA 3BYDA 3ZG0A 3G4PA 4UA9A 3PBTA 1K4FA 2ZQCA 5FAPA 5FAQA 4EQIA 5EUAA 1K38A 5EVID 1KGFA 3NI9A 3TOIA 4HBUA 1MPLA 2HDQA 5DTSA 5GHZA 2V20A 2OV5A 4BD1A 4BLMA 1I5QA 4XUXA 5J8XA 4K0XA 2ZQ9A 3BRMA 3HLWA 4OPQA 4GZBA 4P6BA 3HLBA 4N1HA 4B4ZA 1ONGA 4RX2A 1LI0A 3NY4A 5TGFA 1OMEA 3G2ZA 1FQGA 3V3SA 2JC7A 1ALQA 4KZAA 4JLFA 5FI7A 5E2GA 2XLNA 2J7VA 5GLAA 3NBLA 2XR0A 1M6KA 1NYMA 3G2YA 1DJAA 1SDEA 2B5RA 1VQQA 1YLWA 3G32A 1K56A 1RGZA 2RCXA 1K57A 2Y2QA 1W8YA 5FQIA 4A5RA 1O07A 2XDMA 3VSKA 4DDSA 3FZCA 5FSRA 4LENA 4ZDXA 5FQJA 1FOFA 2EX6A 2J9PA 3MZFA 5FASA 1EROA 5CTNA 3LY4A 4X55A 3SOIA 2Y2NA 1BLCA 1K55C 4PM9A 2C5WB 4GD6A 3IXHA 3PAGA 4OLDA 4IBXA 1NJ4A 1Q2PA 3UPOA 3HUMA 4EV4A 1JWPA 3BECA 1L0FA 1JWVA 3HBRA 3OCNA 2A49A 2OLVA 4KZ6A 2ZC6B 1XA1A 3GMWA 3IXGA 1ES4A 3IF6A 4WMCA 5AQ9A 3NIAA 2G2UA 3OCLA 3W8KA 2EFUA 2WK0A 3GRJA 4R4RA 3HUNA 3TSGA 3MXRA 4OONA 1L0GA 4IVKA 1NRFA 4KZ4A 3LCEA 4M3KA 1YLJA 2WGWB 1JVJA 3WS2A 1BTLA 4WEJA 1KE3A 2HDUA 1HTZA 1ERQA 2EX9A 4CPKA 3AGEA 1ZG4A 3ZVWA 2R9WA 4BJPA 3HLDA 1PYYA 5CHJA 1GHIA 1LL5A 4BD0A 3IWIA 5EECA 5FDHA 3V50A 3WWXA 4EBNA 2X71A 2ZC5B 3UDIA 1QMFA 2X01A 4WBGA 1ESUA 3UDFA 1PZOA 1ZKJA 2WAFA 4PPRA 5GHXA 5KMWA 4UA7A 2IWDA 3MZDA 4X68A 1K56D 1XGJA 3HUOA 4NETA 3RJUA 2Y2OA 3LEZA 3HREA 4IBRA 4OQGA 2GDNA 2RL3A 3P98A 3PBQA 5BOHA 2DRWA 4P0MA 2Y2JA 3RXXA 2Q9NA 2QMIA 4GD8A 4QD4A 4FCFA 1NY0A 5FA7A 1XX2A 5GHYA 1E25A 1KE4A 2JE5A 3TG9A 1DJCA 4OQ0A 4KQQA 4NK3A 4X53A 2Y2LA 3C4OA 2G2WA 4WM9A 1FR6A 3ISGA 4KENB 5FI2A 5TR7A 3IF6B 3W4QA 3NDGA 1BULA 4DXBA 2QZ6A 5M18A 2WGIA 2XF3A 1N4OA 3FKWA 3N8LA 4KZ7A 4OP5A 4ZJ3A 3G31A 3I7JA 3PBOA 5CECA 2ZC3B 4KQRA 4N92A 3RXWA 1ONHA 1KGEA 3ZG8B 1WE4A 5DTKA 3UDXA 3UN7A 3GTCA 1ESIA 1RGYA 4JF6A 5D3OA 1K54C 2CC1A 3M2JA 3ZVTA 4LCLA 4H8RA 1GA9A 4R23A 2WADA 1ZG6A 1K57C 3DTMA 1YQSA 2ZC7A 1YT4A 3VMAA 4DRTA 3Q7ZA 1HZOA 1PW1A 4HBTA 4S2IA 2I72A 4LV0A 4EWFA 5AQAA 4PMAA 1N9BA 1XGIA 2XFSA 3ZNTA 1GHMA 1L2SA 1RP5A 1LLBA 3BFDA 5FQQA 3VSLA 3G35A 1W7FA 3PAEA 1HD8A 1WYBA 2XEPA 2ZM2A 4R1GA 3V5MA 4FSFA 2P9VA 3IF6C 1G6AA 5DF9A 3O88A 4U0XA 5CERA 4S2NC 4WEKA 1PIOA 3IHAA 3FV7A 2Y91A 3VFFA 3VP2A 3SH7A 1XXMA 1HVBA 4Y0OA 5FAOA 1MKIA 5KZHA 3Q07A 1FCOA 4KZ8A 4IVIA 3V39A 4OKPA 5FATA 4E6XA 4UA6A 4X69A 5I94A 2H10A 4U3TA 3UNWA 1MWTA 3VOYA 5M1AA 2ZQ7A 1E4DA 3PTEA 4P85A 5E2FA 3UE3A 5CRFA 1IYPA 1TDGA 4JBFA 1CI8A 5TFQA 4CJNA 4WELA 4DKIA 5FI6A 2Z2MB 3A3EA 3M2KA 3BFCA 2XH9A 2FFYA 3GVBA 5HAPA 3Q7VA 4LV1A 3D4FA 4EBPA 3UE0A 3MFDA 3ZG7B 4XXRA 2ZLYA 4EUZA 3QNBA 3M6HA 2OLUA 4DDYA 4MBFA 4KG6A 4Y0UA 1VM1A 3VFHA 3WS0A 3ZGAB 2UWXA 1YLZA 4Q8IA 1S6RA 5U47A 4X6TA 2Y4AA 2R9XA 2ZD8A 4KG2A 3HLGA 4OOYA 2BLSA 3LO7A 1FSYA 4MBKA 5JYPA 3BFFA 4OOMA 1K25A 4QJGA 2WYXA 4Y7PA 1NYYA 2WUQA 4RVAA 2Y2HA 3IF5A 4PM5A 2OSUA 1IYSA 3O87A 2X02A 2BG1A 3MKEA 1I2SA 3MXSA 1IYOA 1CEGA 1KGGA 4WZ5A 1ZC2A 2DNSA 2FFFB 2HP5A 5CGXA 2VGJA 2EXAA 3A3DA 3JYIA 1GHPA 1TVFA 4K91A 5CEDA 4S2LA 5L2FA 2HDSA 5FQMA 1XKZA 3BFGA 4KG5A 4KZ5A 1E3UA 1LI9A 2JBFA 4DE1A 1KDSA 5FQKA 2ZQAA 1G68A 3ITBA 3N4IA 3O3VA 3CJMA 1XP4A 1CK3A 4XUZA 1W8QA 4JXGA 5HAIA 1BZAA 1IEMA 1FSWA 1S0WA 1TDLA 2J8YA 5EVIA 4JXVA 3UY6A 1KVLA 3W4PA 1FCNA 4HEFA 1C3BA 4ZJ1A 4EBLA 3A3IA 5CEBA 4S2PA 3ZCZA 1PWGA 2ZM8A 2HPBA 3SH9A 4ID4A 2V1ZA 1WYCA 5FQ9A 3Q7VB 5EPHA 2Y2KA 3C7UA 3MBZA 1PWDA 1I2WA 5DF8A 3DWKA 3V3RA 1U60A 2H0TA 4WMCD 1H8ZA 1KE0A 3WS1A 4F94A 1EI5A 3N6IA 5AQBA 4K0WA 3HLCA 4OP8A 3SS5A 3O86A 4DE0A 3S22A 4KZBA 1H8YA 5KSCA 1EWZA 5GLDA 2ZC4B 4QY5A 1LL9A 4LV3A 3GR2A 3G34A 4WYYA 4E6WA 4ZAMA 4DE2A 3IH9A 4OPZA 4E3KA 4X56A 4OLGA 1NXYA 4BQMA 2A3UA 4IEDA 4BENA 4PM6A 2WKHA 1YLPA 2JCHA 2ZJ9A 1K4EA 5CHMA 3S1YA 1K6SA 3UE1A 3GQZA 3CG5A 1KVMA 4E3LA 4KZ3A 1Z6FA 2VGKA 2XK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBY A;  4WZ4 A;  5E2E A;  3WS5 A;  1M40 A;  3LY3 A;  1BUE A;  3W4O A;  4DXC A;  2EX2 A;  2HDR A;  1W5D A;  1IKG A;  3ZG9 B;  1YMS A;  2Y2I A;  2ZM0 A;  2WGV A;  3N8R A;  4Y0T A;  1SDN A;  2Y59 A;  1LHY A;  3IH8 A;  4RX3 A;  2Y2G A;  5EVI B;  4R4S A;  1PZP A;  1ERM A;  1ES3 A;  4R0Q A;  1PI5 A;  1BLH A;  5CGS A;  1MWR A;  4MEZ A;  1FCM A;  3BLM A;  3BEB A;  4L0L A;  2WKI A;  2Y2M A;  3EQU A;  5AQ7 A;  2EXB A;  1IKI A;  3OPL A;  4JF5 A;  3IXD A;  3NCK A;  2WGW A;  3EQV A;  4R3B A;  4GDB A;  2WKE A;  1W79 A;  3FYZ A;  2C6W B;  4GOG A;  3E2K A;  1YLY A;  4N1X A;  3C5A A;  3OC2 A;  4OQI A;  5HFO A;  3G30 A;  3C7V A;  3QNC A;  3ZG5 A;  2DCF A;  3OPR A;  4R3J A;  4WZ5 C;  4OOL A;  2Z2L B;  4OPY A;  4C75 A;  5F1F A;  3OZH A;  5KSH A;  3AGD A;  3M6B A;  3IWO A;  4LCM A;  1BT5 A;  2P74 A;  5F1G A;  3UPN A;  2WAE A;  3A3J A;  3B3X A;  1K54 A;  3BM6 A;  3DW0 A;  4FD8 A;  4KQO A;  4FH4 A;  5EOE A;  4P87 A;  4D2O A;  3A3F A;  4ZBE A;  1K6R A;  2Q9M A;  1MBL A;  4N9K A;  2IWB A;  3SS4 A;  4BL2 A;  4JKT A;  1L0D A;  1J9M A;  5CXW A;  3BLS A;  4UAA A;  1SKF A;  4GB7 A;  5E2H A;  1BLP A;  3VP1 A;  5GLB A;  1QME A;  3E2L A;  4MLL A;  3IWQ A;  1NZU A;  5JYO A;  1GA0 A;  5GLC A;  3OPH A;  4GDN A;  5EVI C;  3HL9 A;  1JTG A;  3VP3 A;  2J9O A;  4PM7 A;  1PWC A;  3PBR A;  5E43 A;  2EFX A;  3HVF A;  4E3J A;  1Y54 A;  3AGF A;  3C4P A;  1IEL A;  4B4X A;  1L0E A;  1BSG A;  2P9V B;  1MWU A;  3PBN A;  4MBH A;  5HW3 A;  1O7E A;  4KZ9 A;  4DF6 A;  4MNR A;  1CI9 A;  3WS4 A;  3BFE A;  4QU3 A;  5EE8 A;  2XQZ A;  4QY6 A;  4S2N A;  5A91 A;  1YM1 A;  2ZMA A;  2E8I A;  5M19 A;  1JTD A;  4RA7 A;  5DTT A;  3UO9 A;  1DY6 A;  3VOZ A;  3MZE A;  4YFM A;  4C6Y A;  4U0T A;  2XD5 A;  3Q82 A;  1YLT A;  4Z9Q A;  1H5X A;  4LV2 A;  4QB8 A;  3S4X A;  1TEM A;  4S2K A;  3IQA A;  1AXB A;  2XD1 A;  1SCW A;  5DF7 A;  4JF4 A;  2XFT A;  5A93 A;  1K55 A;  3VP0 A;  1NZO A;  3ITA A;  4GKU A;  5GL9 A;  4N9L A;  4BL3 A;  3P09 A;  1IYQ A;  4OH0 A;  4B88 A;  4HES A;  3FKV A;  3Q81 A;  3UPP A;  5A92 A;  2H0Y A;  3ZHH A;  4JXS A;  1XPB A;  2Y2P A;  4S2J A;  1Q2Q A;  5EOO A;  2PU2 A;  2HP9 A;  5HAQ A;  4YIN A;  4JPM A;  3QHY A;  4O7D A;  4PM8 A;  4FH2 A;  1KDW A;  2Y55 A;  2QPN A;  2WZX A;  3OPP A;  3ZDJ A;  2ZQ8 A;  3CMZ A;  4OVD A;  3N7W A;  3IXB A;  3NC8 A;  1BLS A;  5HX9 A;  1RCJ A;  5DVA A;  3GSG A;  1ES2 A;  4ZJ2 A;  3PBS A;  4S2M A;  1PI4 A;  3DWZ A;  4OPR A;  3IT9 A;  4QHC A;  5F82 A;  2WZZ A;  3SS3 A;  4UHU A;  3ZFZ A;  1DJB A;  4S2O A;  5EVL A;  1ES5 A;  1MXO A;  3IHB A;  1MWS A;  1YMX A;  5CHU A;  5G18 A;  3WRZ A;  2ZQD A;  4DE3 A;  5HL1 A;  4GNU A;  3SH8 A;  2HP6 A;  2XGN A;  1PW8 A;  5F83 A;  3HLF A;  1MY8 A;  1XA7 A;  4E3M A;  3WRT A;  1CEF A;  3GV9 A;  3MKF A;  4E3N A;  2IWC A;  5CGW A;  5HAR A;  3Q1F A;  4RYE A;  4C3Q A;  5IHV A;  4OQH A;  4E3I A;  1GCE A;  3NDE A;  1SHV A;  4JXW A;  2PU4 A;  3ZNY A;  3HLE A;  3N8S A;  2EX8 A;  5A90 A;  1E3U D;  3FWL A;  4GN2 A;  4E3O A;  2H5S A;  3CZD A;  5CTM A;  1FR1 A;  2V2F F;  1JWZ A;  3VP4 A;  4ZTK A;  3BYD A;  3ZG0 A;  3G4P A;  4UA9 A;  3PBT A;  1K4F A;  2ZQC A;  5FAP A;  5FAQ A;  4EQI A;  5EUA A;  1K38 A;  5EVI D;  1KGF A;  3NI9 A;  3TOI A;  4HBU A;  1MPL A;  2HDQ A;  5DTS A;  5GHZ A;  2V20 A;  2OV5 A;  4BD1 A;  4BLM A;  1I5Q A;  4XUX A;  5J8X A;  4K0X A;  2ZQ9 A;  3BRM A;  3HLW A;  4OPQ A;  4GZB A;  4P6B A;  3HLB A;  4N1H A;  4B4Z A;  1ONG A;  4RX2 A;  1LI0 A;  3NY4 A;  5TGF A;  1OME A;  3G2Z A;  1FQG A;  3V3S A;  2JC7 A;  1ALQ A;  4KZA A;  4JLF A;  5FI7 A;  5E2G A;  2XLN A;  2J7V A;  5GLA A;  3NBL A;  2XR0 A;  1M6K A;  1NYM A;  3G2Y A;  1DJA A;  1SDE A;  2B5R A;  1VQQ A;  1YLW A;  3G32 A;  1K56 A;  1RGZ A;  2RCX A;  1K57 A;  2Y2Q A;  1W8Y A;  5FQI A;  4A5R A;  1O07 A;  2XDM A;  3VSK A;  4DDS A;  3FZC A;  5FSR A;  4LEN A;  4ZDX A;  5FQJ A;  1FOF A;  2EX6 A;  2J9P A;  3MZF A;  5FAS A;  1ERO A;  5CTN A;  3LY4 A;  4X55 A;  3SOI A;  2Y2N A;  1BLC A;  1K55 C;  4PM9 A;  2C5W B;  4GD6 A;  3IXH A;  3PAG A;  4OLD A;  4IBX A;  1NJ4 A;  1Q2P A;  3UPO A;  3HUM A;  4EV4 A;  1JWP A;  3BEC A;  1L0F A;  1JWV A;  3HBR A;  3OCN A;  2A49 A;  2OLV A;  4KZ6 A;  2ZC6 B;  1XA1 A;  3GMW A;  3IXG A;  1ES4 A;  3IF6 A;  4WMC A;  5AQ9 A;  3NIA A;  2G2U A;  3OCL A;  3W8K A;  2EFU A;  2WK0 A;  3GRJ A;  4R4R A;  3HUN A;  3TSG A;  3MXR A;  4OON A;  1L0G A;  4IVK A;  1NRF A;  4KZ4 A;  3LCE A;  4M3K A;  1YLJ A;  2WGW B;  1JVJ A;  3WS2 A;  1BTL A;  4WEJ A;  1KE3 A;  2HDU A;  1HTZ A;  1ERQ A;  2EX9 A;  4CPK A;  3AGE A;  1ZG4 A;  3ZVW A;  2R9W A;  4BJP A;  3HLD A;  1PYY A;  5CHJ A;  1GHI A;  1LL5 A;  4BD0 A;  3IWI A;  5EEC A;  5FDH A;  3V50 A;  3WWX A;  4EBN A;  2X71 A;  2ZC5 B;  3UDI A;  1QMF A;  2X01 A;  4WBG A;  1ESU A;  3UDF A;  1PZO A;  1ZKJ A;  2WAF A;  4PPR A;  5GHX A;  5KMW A;  4UA7 A;  2IWD A;  3MZD A;  4X68 A;  1K56 D;  1XGJ A;  3HUO A;  4NET A;  3RJU A;  2Y2O A;  3LEZ A;  3HRE A;  4IBR A;  4OQG A;  2GDN A;  2RL3 A;  3P98 A;  3PBQ A;  5BOH A;  2DRW A;  4P0M A;  2Y2J A;  3RXX A;  2Q9N A;  2QMI A;  4GD8 A;  4QD4 A;  4FCF A;  1NY0 A;  5FA7 A;  1XX2 A;  5GHY A;  1E25 A;  1KE4 A;  2JE5 A;  3TG9 A;  1DJC A;  4OQ0 A;  4KQQ A;  4NK3 A;  4X53 A;  2Y2L A;  3C4O A;  2G2W A;  4WM9 A;  1FR6 A;  3ISG A;  4KEN B;  5FI2 A;  5TR7 A;  3IF6 B;  3W4Q A;  3NDG A;  1BUL A;  4DXB A;  2QZ6 A;  5M18 A;  2WGI A;  2XF3 A;  1N4O A;  3FKW A;  3N8L A;  4KZ7 A;  4OP5 A;  4ZJ3 A;  3G31 A;  3I7J A;  3PBO A;  5CEC A;  2ZC3 B;  4KQR A;  4N92 A;  3RXW A;  1ONH A;  1KGE A;  3ZG8 B;  1WE4 A;  5DTK A;  3UDX A;  3UN7 A;  3GTC A;  1ESI A;  1RGY A;  4JF6 A;  5D3O A;  1K54 C;  2CC1 A;  3M2J A;  3ZVT A;  4LCL A;  4H8R A;  1GA9 A;  4R23 A;  2WAD A;  1ZG6 A;  1K57 C;  3DTM A;  1YQS A;  2ZC7 A;  1YT4 A;  3VMA A;  4DRT A;  3Q7Z A;  1HZO A;  1PW1 A;  4HBT A;  4S2I A;  2I72 A;  4LV0 A;  4EWF A;  5AQA A;  4PMA A;  1N9B A;  1XGI A;  2XFS A;  3ZNT A;  1GHM A;  1L2S A;  1RP5 A;  1LLB A;  3BFD A;  5FQQ A;  3VSL A;  3G35 A;  1W7F A;  3PAE A;  1HD8 A;  1WYB A;  2XEP A;  2ZM2 A;  4R1G A;  3V5M A;  4FSF A;  2P9V A;  3IF6 C;  1G6A A;  5DF9 A;  3O88 A;  4U0X A;  5CER A;  4S2N C;  4WEK A;  1PIO A;  3IHA A;  3FV7 A;  2Y91 A;  3VFF A;  3VP2 A;  3SH7 A;  1XXM A;  1HVB A;  4Y0O A;  5FAO A;  1MKI A;  5KZH A;  3Q07 A;  1FCO A;  4KZ8 A;  4IVI A;  3V39 A;  4OKP A;  5FAT A;  4E6X A;  4UA6 A;  4X69 A;  5I94 A;  2H10 A;  4U3T A;  3UNW A;  1MWT A;  3VOY A;  5M1A A;  2ZQ7 A;  1E4D A;  3PTE A;  4P85 A;  5E2F A;  3UE3 A;  5CRF A;  1IYP A;  1TDG A;  4JBF A;  1CI8 A;  5TFQ A;  4CJN A;  4WEL A;  4DKI A;  5FI6 A;  2Z2M B;  3A3E A;  3M2K A;  3BFC A;  2XH9 A;  2FFY A;  3GVB A;  5HAP A;  3Q7V A;  4LV1 A;  3D4F A;  4EBP A;  3UE0 A;  3MFD A;  3ZG7 B;  4XXR A;  2ZLY A;  4EUZ A;  3QNB A;  3M6H A;  2OLU A;  4DDY A;  4MBF A;  4KG6 A;  4Y0U A;  1VM1 A;  3VFH A;  3WS0 A;  3ZGA B;  2UWX A;  1YLZ A;  4Q8I A;  1S6R A;  5U47 A;  4X6T A;  2Y4A A;  2R9X A;  2ZD8 A;  4KG2 A;  3HLG A;  4OOY A;  2BLS A;  3LO7 A;  1FSY A;  4MBK A;  5JYP A;  3BFF A;  4OOM A;  1K25 A;  4QJG A;  2WYX A;  4Y7P A;  1NYY A;  2WUQ A;  4RVA A;  2Y2H A;  3IF5 A;  4PM5 A;  2OSU A;  1IYS A;  3O87 A;  2X02 A;  2BG1 A;  3MKE A;  1I2S A;  3MXS A;  1IYO A;  1CEG A;  1KGG A;  4WZ5 A;  1ZC2 A;  2DNS A;  2FFF B;  2HP5 A;  5CGX A;  2VGJ A;  2EXA A;  3A3D A;  3JYI A;  1GHP A;  1TVF A;  4K91 A;  5CED A;  4S2L A;  5L2F A;  2HDS A;  5FQM A;  1XKZ A;  3BFG A;  4KG5 A;  4KZ5 A;  1E3U A;  1LI9 A;  2JBF A;  4DE1 A;  1KDS A;  5FQK A;  2ZQA A;  1G68 A;  3ITB A;  3N4I A;  3O3V A;  3CJM A;  1XP4 A;  1CK3 A;  4XUZ A;  1W8Q A;  4JXG A;  5HAI A;  1BZA A;  1IEM A;  1FSW A;  1S0W A;  1TDL A;  2J8Y A;  5EVI A;  4JXV A;  3UY6 A;  1KVL A;  3W4P A;  1FCN A;  4HEF A;  1C3B A;  4ZJ1 A;  4EBL A;  3A3I A;  5CEB A;  4S2P A;  3ZCZ A;  1PWG A;  2ZM8 A;  2HPB A;  3SH9 A;  4ID4 A;  2V1Z A;  1WYC A;  5FQ9 A;  3Q7V B;  5EPH A;  2Y2K A;  3C7U A;  3MBZ A;  1PWD A;  1I2W A;  5DF8 A;  3DWK A;  3V3R A;  1U60 A;  2H0T A;  4WMC D;  1H8Z A;  1KE0 A;  3WS1 A;  4F94 A;  1EI5 A;  3N6I A;  5AQB A;  4K0W A;  3HLC A;  4OP8 A;  3SS5 A;  3O86 A;  4DE0 A;  3S22 A;  4KZB A;  1H8Y A;  5KSC A;  1EWZ A;  5GLD A;  2ZC4 B;  4QY5 A;  1LL9 A;  4LV3 A;  3GR2 A;  3G34 A;  4WYY A;  4E6W A;  4ZAM A;  4DE2 A;  3IH9 A;  4OPZ A;  4E3K A;  4X56 A;  4OLG A;  1NXY A;  4BQM A;  2A3U A;  4IED A;  4BEN A;  4PM6 A;  2WKH A;  1YLP A;  2JCH A;  2ZJ9 A;  1K4E A;  5CHM A;  3S1Y A;  1K6S A;  3UE1 A;  3GQZ A;  3CG5 A;  1KVM A;  4E3L A;  4KZ3 A;  1Z6F A;  2VGK A;  2XK1 A; 
#chains in the Genus database with same CATH topology
 1M40 A;  1YMS A;  4Y0T A;  3IH8 A;  3IS2 A;  1XJ4 A;  3H82 A;  2KX6 A;  3BLM A;  2WKI A;  2Y2M A;  3VV4 A;  1T1C A;  1W79 A;  3FYZ A;  3E2K A;  2JKR M;  2OWJ A;  4N1X A;  3C5A A;  4OQI A;  3OPR A;  4OOL A;  5KSH A;  3B3X A;  4FH4 A;  4D2O A;  4N9K A;  1L0D A;  4FOF A;  4PM7 A;  2FZ0 A;  3HVF A;  2JKF A;  3C4P A;  3KSI A;  3OBF A;  1BSG A;  1MWU A;  3IS2 B;  5HW3 A;  4R3A A;  4NXB A;  3WS4 A;  2JKR I;  1YM1 A;  2XRN A;  1JTD A;  4C6Y A;  3Q82 A;  1YLT A;  4Z9Q A;  1YSP A;  4QB8 A;  3UB7 A;  1AXB A;  5HL6 A;  4HP4 A;  1K55 A;  1NZO A;  2O9A A;  1MZU A;  5L8M A;  1IYQ A;  3KYQ A;  2W0N A;  3Q81 A;  4KUK A;  4CLC E;  4EET B;  1H8M A;  4O7D A;  2Y55 A;  2WZX A;  3CMZ A;  5K5B A;  4O8G A;  1PI4 A;  3DWZ A;  3PR6 A;  3IT9 A;  4GS9 B;  4QHC A;  2WZZ A;  1N9N A;  5EVL A;  5LBR A;  1ES5 A;  5CHU A;  4DE3 A;  5TBM A;  3P7N A;  1N9O A;  4L9G A;  3MKF A;  2W1T A;  5HAR A;  3Q1F A;  4RYE A;  4E3I A;  1Y28 A;  5IHV A;  1SHV A;  2PU4 A;  3ZNY A;  3HLE A;  1S67 L;  1E3U D;  3FWL A;  3LIC A;  3CZD A;  2J80 A;  3VP4 A;  3BYD A;  3PBT A;  1K4F A;  5EUA A;  3NI9 A;  3MFX A;  3TOI A;  4HBU A;  4DJ2 A;  4BD1 A;  1I5Q A;  3HLB A;  1ONG A;  3IX3 A;  3G2Z A;  3T4L A;  3HJI A;  2M1C A;  4JLF A;  5FI7 A;  5E2G A;  2J7V A;  4HQA A;  3NBL A;  1GSV A;  1LL8 A;  1VQQ A;  1NWZ A;  4EW7 A;  2L1M A;  4DMZ A;  2PRF A;  2RCX A;  3OLO A;  4FTX A;  4DDS A;  5FSR A;  4LLO B;  5TBM B;  1NLZ A;  2EWW A;  3MJQ A;  3LY4 A;  2W1T B;  3PAG A;  4OLD A;  4IBX A;  1NJ4 A;  1PRQ A;  3HUM A;  3R7W A;  4EV4 A;  2A49 A;  3E4P A;  3D72 A;  2ZC6 B;  4I38 A;  1XA1 A;  4UQI S;  1T19 A;  3W8K A;  1L0G A;  3ULF A;  1NRF A;  4KZ4 A;  1D1J A;  3LCE A;  2WGW B;  3UME A;  4CPK A;  3S7P A;  1ZG4 A;  4KQD A;  4BJP A;  3V50 A;  2X01 A;  2WAF A;  5IS1 A;  1K56 D;  1W63 Q;  1S4R A;  5C5K A;  4G3V A;  5GHY A;  3R7W B;  2JE5 A;  1KE4 A;  2P08 A;  3FG8 A;  3W4Q A;  4DXB A;  2QZ6 A;  2XF3 A;  3N8L A;  1TS8 A;  4OP5 A;  4N92 A;  5EVE A;  1ONH A;  3ZG8 B;  5DTK A;  1ESI A;  2Y8H A;  3T4Q A;  1K54 C;  4R23 A;  4I39 A;  3C2W A;  3A0V A;  1SZV A;  1YT4 A;  2PD7 A;  4DRT A;  3LIB A;  2I72 A;  4EWF A;  3W2Z A;  1N9B A;  3ZNT A;  1WYB A;  3LFV A;  2P9V A;  3ICY A;  3IF6 C;  4GLQ A;  4MMN A;  2V1A A;  2W1R A;  4U0X A;  5CER A;  4S2N C;  4NXF A;  1D7E A;  1PIO A;  4EES A;  1OT9 A;  3VFF A;  3VP2 A;  3LIA A;  4HJ6 A;  1T18 A;  4KZ8 A;  2HGV A;  4WF0 A;  5FAT A;  4E6X A;  4U3T A;  1JNU A;  1MWT A;  3VOY A;  4HP9 A;  4P85 A;  5E2F A;  2HJE A;  4HOI A;  5CRF A;  1TDG A;  4Y2F A;  4EEP A;  4Y13 A;  2FFY A;  3GVB A;  2ZOH A;  5HAP A;  3CUE A;  5DKK A;  3RFB A;  4Y0U A;  3VFH A;  1VM1 A;  4Q0I A;  5HD3 A;  4Q8I A;  3F1O B;  2Y4A A;  3OOV A;  4PKY G;  4OOY A;  3LO7 A;  3NOP C;  5JYP A;  4Y7P A;  3LI8 A;  4RVA A;  2GX5 A;  3ZQ5 A;  3O87 A;  3MXS A;  1G5U A;  4WZ5 A;  5AVE A;  4UEY A;  2PT7 A;  5DFX A;  5CGX A;  2VGJ A;  2VA0 A;  3A3D A;  3JYI A;  5J7E A;  1ZTU A;  3F1N A;  3TRC A;  5CED A;  4M4X A;  4EER A;  2ZOI A;  3ITB A;  3N4I A;  3O3V A;  5MC7 A;  1FIK A;  1XP4 A;  1CK3 A;  4ESP A;  4JXG A;  1TDL A;  5EVI A;  2W27 A;  2BAS A;  1FCN A;  1UGU A;  4HEF A;  1C3B A;  4ZJ1 A;  4EBL A;  3VE3 A;  2ZM8 A;  2HPB A;  5HSQ A;  4ID4 A;  5FQ9 A;  5EPH A;  3MBZ A;  5DF8 A;  3FPV A;  1P9R A;  2H0T A;  1H8Z A;  4LPZ A;  4HIA A;  1TS7 A;  4OP8 A;  1CJF A;  4DE0 A;  3B47 A;  1ODV A;  3JVV A;  4QY5 A;  2VK3 A;  3LIE A;  4X56 A;  4BQM A;  2A3U A;  2WKH A;  3DBA A;  3S1Y A;  2W3G A;  4EQ1 A;  2PBY A;  3LY3 A;  1BUE A;  4DXC A;  2HDR A;  1IKG A;  3ZG9 B;  1SDN A;  2Y59 A;  3MXQ A;  2Y2G A;  5IT5 A;  5EVI B;  4L9F A;  1PI5 A;  4JGQ A;  4L0L A;  1Z09 A;  5AQ7 A;  4IHQ A;  2WKE A;  3CAX A;  3QNC A;  3AGD A;  4LCM A;  3WS1 A;  1PNE A;  3A3J A;  3DW0 A;  4KQO A;  4P87 A;  1P0Z A;  3BW6 A;  5AJG A;  1K6R A;  1J9M A;  3BLS A;  4GB7 A;  3VP1 A;  5GLB A;  3IWQ A;  1NZU A;  4YNR A;  3OPH A;  3HL9 A;  1JTG A;  2J9O A;  1PWC A;  2J3T C;  5G4Y A;  5E43 A;  3QP5 A;  3EEA A;  3NUL A;  2OAQ 1;  2XRO A;  1O7E A;  4KZ9 A;  3UMD A;  3BFE A;  1YPR A;  4QY6 A;  5J4E A;  4HY8 A;  2ZMA A;  2E8I A;  5HD5 A;  3T1S A;  2INW A;  3UO9 A;  4U0T A;  1H5X A;  2YKF A;  2VGL M;  3IQA A;  2XD1 A;  5DF7 A;  4JF4 A;  3MQO A;  5GL9 A;  2W3D A;  3DAV A;  3P09 A;  4B88 A;  3FKV A;  3UPP A;  5A92 A;  4JXS A;  4S2J A;  2HP9 A;  3IX4 A;  4JPM A;  1OTI A;  4IUH A;  4FH2 A;  1KDW A;  4Q0H A;  3IXB A;  2J3W A;  1VHM A;  3NC8 A;  5HWV A;  5HX9 A;  5DVA A;  4ZJ2 A;  4S2M A;  4OPR A;  3C8C A;  3SS3 A;  4UHU A;  3BJN A;  2ZQD A;  3NEC A;  3WRZ A;  5HL1 A;  4GNU A;  3SH8 A;  1PW8 A;  1MY8 A;  2QYB A;  3WRT A;  3L9K A;  1CEF A;  4BBU A;  4C3Q A;  4OQH A;  1GCE A;  4JXW A;  3VE4 A;  4GN2 A;  4E3O A;  3QP4 A;  3R4K A;  4HHD A;  5CTM A;  1FR1 A;  1JWZ A;  4ZRR A;  1WA9 A;  2HV1 A;  3ZG0 A;  2W3E A;  1TS6 A;  4UA9 A;  1DRM A;  1N9L A;  5FAQ A;  2YKH A;  1K38 A;  5EVI D;  1KGF A;  4FUW A;  3KX0 X;  5GHZ A;  2OV5 A;  3K3D A;  4BLM A;  4XUX A;  5J8X A;  4I5S A;  2ZQ9 A;  3BRM A;  4K0X A;  4N1H A;  3U4L P;  3QP2 A;  1FQG A;  2I9V A;  1ALQ A;  4KZA A;  2B18 A;  2XR0 A;  3G2Y A;  1SDE A;  2B5R A;  1K56 A;  1RGZ A;  3FZC A;  5FQJ A;  1FOF A;  2EX6 A;  4WUJ A;  1DP6 A;  5EFW A;  5FAS A;  5CTN A;  4X55 A;  3SOI A;  2Y2N A;  1K55 C;  3E98 A;  1ZHH B;  1Q2P A;  4JGO A;  5L07 A;  1JWP A;  3HBR A;  1JWV A;  3CI6 A;  2O99 A;  2OLV A;  2AVX A;  5HWT A;  1Y4O A;  4WMC A;  5AQ9 A;  3NIA A;  2G2U A;  3H82 B;  3GRJ A;  4ARZ A;  4G3K A;  3MXR A;  2PR5 A;  2G7U A;  3UE6 A;  3NOT C;  4M3K A;  1YLJ A;  3PYP A;  2WKP A;  1KE3 A;  4MDZ A;  1ERQ A;  3ZVW A;  2R9W A;  5HDC A;  3HLD A;  1PYY A;  5CHJ A;  1LL5 A;  4BD0 A;  2Q0O A;  5FDH A;  2L4R A;  5KMW A;  1ZKJ A;  5GHX A;  2IWD A;  3MZD A;  4X68 A;  2V8C A;  3RJU A;  4DN0 A;  4GW9 A;  4JGR A;  2Y2J A;  3T1R A;  2QMI A;  1G28 A;  5FA7 A;  1NLY A;  3TG9 A;  4OQ0 A;  4KQQ A;  3C4O A;  3ISG A;  1G6O A;  4KZ7 A;  3DTK A;  3T4K A;  3DTE A;  4ARZ B;  3G31 A;  3PBO A;  5CEC A;  2ZC3 B;  2CC1 A;  3M2J A;  4LCL A;  2P7J A;  2P04 A;  3IX8 A;  1HZO A;  4HBT A;  2XA7 M;  4B93 A;  4ETX A;  5KIZ A;  2PYR A;  1L2S A;  2VV8 A;  1HD8 A;  2XEP A;  1G6A A;  3FV7 A;  2Y91 A;  5FAO A;  1MKI A;  1X0O A;  3CWF A;  4UA6 A;  1OTB A;  2ZQ7 A;  1EW0 A;  3FC7 A;  4CJN A;  1T1B A;  5FEF A;  3M2K A;  5AVF A;  3D4F A;  3ZG7 B;  4LRZ E;  2ZLY A;  4XXR A;  3CLO A;  2VKS A;  1DP9 A;  2OLU A;  4KG6 A;  3B42 A;  1CQA A;  2KLI A;  3ZGA B;  2UWX A;  1YLZ A;  3BY9 A;  3HLG A;  1W63 M;  4MBK A;  1NYY A;  2Y2H A;  2OSU A;  3MKE A;  4NEE D;  2FFF B;  1OJ5 A;  1GHP A;  2HDS A;  3BFG A;  1YAX A;  2OOL A;  1LI9 A;  2JBF A;  1KDS A;  2ZQA A;  1W8Q A;  5HAI A;  3VOL A;  2O9B A;  3H7W A;  2J8Y A;  4II7 A;  4JXV A;  2K7S A;  3HCY A;  5CEB A;  2V1Z A;  3DTI A;  3T1Q B;  4WMC D;  1EI5 A;  5AQB A;  4WN5 A;  2ZBB A;  3HJK A;  2ZC4 B;  1LL9 A;  2VZW A;  3C30 A;  4I3A A;  3EEH A;  3GR2 A;  3G34 A;  4WYY A;  1NXY A;  1XJ3 A;  4PM6 A;  1DP8 A;  2D01 A;  5HPI A;  3UE1 A;  3GQZ A;  4KZ3 A;  4Y15 A;  1P97 A;  2VGK A;  2VGL S;  2XK1 A;  2WKR A;  4X25 A;  3CUE C;  5L10 A;  3JPU A;  2ZM0 A;  2WGV A;  3JVU A;  3N8R A;  4RX3 A;  3H7W B;  4R4S A;  4EUV A;  4AFI A;  1PZP A;  4R0Q A;  5CGS A;  1MWR A;  1GSX A;  1IKI A;  3E0Y A;  3IXD A;  3NCK A;  2C6W B;  1YSQ A;  3OC2 A;  2V9A A;  5HFO A;  3G30 A;  3C7V A;  4Z1W A;  2DCF A;  4R3J A;  4WZ5 C;  1XJ6 A;  5DKL A;  2Z2L B;  3ZG5 A;  3CIT A;  1MC0 A;  3M6B A;  3IWO A;  4QWO A;  2P74 A;  3UPN A;  2WAE A;  1XFN A;  4FD8 A;  1K54 A;  3KSG A;  4ZBE A;  3K2N A;  3SS4 A;  5CXW A;  4DJ3 A;  4UAA A;  1BLP A;  1QME A;  3E2L A;  1GA0 A;  4JGP A;  5EVI C;  3QP6 A;  3PBR A;  1P9W A;  2EFX A;  1Y54 A;  1UWP X;  2DMW A;  1IEL A;  4R38 A;  1UWN X;  2P9V B;  2WKQ A;  5EV0 A;  5HDD A;  4DF6 A;  4MNR A;  4QU3 A;  5EE8 A;  4S2N A;  5A91 A;  3EGD C;  5M19 A;  2E8J A;  3VOZ A;  3MZE A;  4YFM A;  2XD5 A;  2UV0 E;  4LV2 A;  4S2K A;  2XFT A;  2KOI A;  5I5L A;  4EEU A;  5L09 A;  1GSW A;  4BL3 A;  4OH0 A;  4HES A;  2QWS A;  3NHQ A;  3ZHH A;  1XPB A;  2HF6 A;  4BBT A;  4PM8 A;  4ME4 A;  2QPN A;  3ZDJ A;  3OPP A;  4OVD A;  1BLS A;  1RCJ A;  3GSG A;  3PBS A;  5TJJ A;  3ZFZ A;  1DJB A;  4S2O A;  2JHE A;  2IA2 A;  3E4Q A;  5G18 A;  3FPW A;  4Y17 A;  4D60 A;  1XA7 A;  4E3M A;  3F1N B;  2GJ3 A;  3GV9 A;  1VB6 A;  3SZT A;  2EX8 A;  5A90 A;  2H5S A;  5HZH A;  1YKD A;  5F6A A;  3IBR A;  3G4P A;  2ZQC A;  4CLC A;  2XSS A;  2PHY A;  3A0R A;  5DTS A;  2V20 A;  3HLW A;  4GZB A;  3NY4 A;  5TGF A;  3T4S A;  4NXG A;  3V3S A;  2MJ6 A;  4IUK A;  2XLN A;  3KYE A;  1M6K A;  1DJA A;  1YLW A;  3G32 A;  1OTD A;  1K57 A;  2Y2Q A;  1W8Y A;  4A5R A;  1O07 A;  2XDM A;  3VSK A;  1D06 A;  2J9P A;  1ERO A;  2C5W B;  4GD6 A;  3IXH A;  3UPO A;  2NUP C;  1A0K A;  3BEC A;  4HNB A;  1NRJ A;  3CPT A;  3MS6 A;  2XA7 S;  3IXG A;  3OCL A;  2EFU A;  2WK0 A;  3HUN A;  4CLC B;  4IVK A;  3MQQ A;  1IOU A;  3TE8 A;  1JVJ A;  3WS2 A;  1BTL A;  4WEJ A;  2HDU A;  1HTZ A;  2EX9 A;  3AGE A;  1GHI A;  3IWI A;  5EEC A;  3WWX A;  4EBN A;  5DFY A;  3UDI A;  1QMF A;  4WBG A;  1BYW A;  1PZO A;  4UA7 A;  4B9O A;  1SKO A;  2JKT I;  2V0U A;  1XGJ A;  1TF1 A;  3H9W A;  3HUO A;  1MKM A;  4IBR A;  5HPF A;  1LSV A;  2GDN A;  3P98 A;  3PBQ A;  2DRW A;  4P0M A;  4GD8 A;  4QD4 A;  4FCF A;  1NY0 A;  1XX2 A;  1OTA A;  3UB9 A;  3MSH A;  1DJC A;  2Y2L A;  2G2W A;  1FR6 A;  4KEN B;  5FI2 A;  4HJ3 A;  1BUL A;  5M18 A;  2M7V A;  3MF0 A;  3RH8 B;  1N4O A;  3FKW A;  3MR0 A;  4O0P A;  1H0M A;  2L0W A;  2VEA A;  2ZL1 A;  4GJ4 A;  3U2A A;  4KQR A;  4NG2 A;  3TW8 A;  1KGE A;  1WE4 A;  3UDX A;  3GTC A;  1S1Y A;  4P6Z M;  4WLA A;  4H8R A;  2JKG A;  1ZG6 A;  2ZC7 A;  3A0S A;  1F9I A;  4PKY A;  3Q7Z A;  1PW1 A;  3B33 A;  4S2I A;  4LV0 A;  3NOU C;  4PMA A;  1RP5 A;  1SKO B;  5FQQ A;  4G3W A;  1W7F A;  3PAE A;  2ZM2 A;  3T12 B;  2OWH A;  2BTF P;  4WEK A;  1XXM A;  1HVB A;  3BQ8 A;  4Y0O A;  3Q07 A;  1FCO A;  4IVI A;  2H10 A;  4LFU A;  2ZL1 B;  5M1A A;  2A24 A;  2V0W A;  1LT0 A;  4JBF A;  1CI8 A;  5TFQ A;  4DKI A;  2Z2M B;  3A3E A;  2GZA A;  4I3J A;  2JN7 A;  3LR3 A;  2XH9 A;  4X1L A;  1H3Q A;  3UE0 A;  3QNB A;  3WS0 A;  2ZMV A;  1S6R A;  5U47 A;  2ZD8 A;  4KG2 A;  4CLC D;  1FSY A;  4OOM A;  1K25 A;  4QJG A;  1IFQ A;  4GS9 A;  2WUQ A;  4PM5 A;  1IYS A;  2X02 A;  3MMH A;  5DJU A;  3BY8 A;  2DNS A;  1AWI A;  5A8B A;  4X1M A;  2HP5 A;  1TVF A;  5L2F A;  5FQM A;  1XKZ A;  4KG5 A;  1OTE A;  1G68 A;  3LGO A;  3CJM A;  4K08 A;  2A24 B;  1FSW A;  1KVL A;  2K2N A;  2K31 A;  2H28 A;  3QP8 A;  4LRY C;  3SH9 A;  2FH5 A;  2V8F A;  2D02 A;  1PWD A;  1OPX A;  3DWK A;  3V3R A;  1V9Y A;  2PDR A;  4H6J A;  4K0W A;  3TJZ C;  3V67 A;  3SS5 A;  1LSW A;  3S22 A;  3O5Y A;  4KZB A;  1H8Y A;  1EWZ A;  2O0Y A;  5GLD A;  4KUO A;  2ACG A;  4PAU A;  4ZAM A;  4OPZ A;  4BEN A;  1YLP A;  3G6O A;  4O01 A;  5CHM A;  3K3C A;  1Z6F A;  2B95 A;  4WZ4 A;  5E2E A;  3WS5 A;  3W4O A;  2EX2 A;  1W5D A;  2R78 A;  2Y2I A;  2PAV P;  1LHY A;  1PFL A;  1ERM A;  1ES3 A;  1BLH A;  2HJ9 C;  4MEZ A;  1FCM A;  3BEB A;  3MQ0 A;  2J3T D;  3EQU A;  2EXB A;  3OPL A;  1S66 L;  4JF5 A;  3LYX A;  2WGW A;  3EQV A;  4R3B A;  4GDB A;  1S1Z A;  4GOG A;  4H6J B;  5G4Z A;  1YLY A;  4PHT A;  4F3L A;  3UB8 A;  2PYP A;  4C75 A;  2NUT C;  4OPY A;  5F1F A;  3OZH A;  4DE1 A;  5F1G A;  1BT5 A;  4I3I A;  1V9Z A;  3BM6 A;  4XT2 A;  5EOE A;  3L7H A;  3A3F A;  2IWB A;  2Q9M A;  1MBL A;  4BL2 A;  4DE2 A;  4JKT A;  3NJA A;  1SKF A;  5E2H A;  4MLL A;  3ZYT A;  5JYO A;  2PD8 A;  5F69 A;  4GDN A;  5GLC A;  5HDS A;  4NKP A;  5F68 A;  3VP3 A;  2ZMF A;  4E3J A;  3AGF A;  4B4X A;  1L0E A;  3PBN A;  4MBH A;  1CI9 A;  2XQZ A;  2VX8 A;  2VJW A;  1TS0 A;  4RA7 A;  5DTT A;  2LB5 A;  1DY6 A;  2KDK A;  1XJ2 A;  5FEG A;  3S4X A;  1TEM A;  2LB9 A;  5A93 A;  1SCW A;  4YWZ A;  4F3L B;  3VP0 A;  3ITA A;  4GKU A;  3LUQ A;  4N9L A;  4XT2 B;  2H0Y A;  2Y2P A;  4BMW A;  1Q2Q A;  5EOO A;  2PU2 A;  1F5M A;  5HAQ A;  4YIN A;  3QHY A;  2ZQ8 A;  3N7W A;  2PR6 A;  3LR5 A;  4MN6 A;  1ES2 A;  5FL3 A;  5HWW A;  5F82 A;  3UB6 A;  1MXO A;  1FIL A;  3IHB A;  4EU0 A;  3BWL A;  1MWS A;  1YMX A;  3LID A;  2HP6 A;  2XGN A;  5F83 A;  3HLF A;  2QHK A;  4RQ9 A;  4MCW A;  4E3N A;  2IWC A;  5CGW A;  3NDE A;  3N8S A;  1KOU A;  2V2F F;  1J3W A;  4ZTK A;  3F1P A;  5FAP A;  4EQI A;  1S4S A;  3F1O A;  1MPL A;  2HDQ A;  4CQH A;  3BQA A;  1XFQ A;  4OPQ A;  4B4Z A;  4P6B A;  3KSF A;  4RX2 A;  1LI0 A;  1OME A;  4HI4 A;  2JC7 A;  5GLA A;  4HJ4 A;  1NYM A;  3CHW P;  3EWK A;  5F5Y A;  2Z6C A;  4GCZ A;  3PXP A;  5EM0 A;  5FQI A;  4E04 A;  2QJ7 A;  4ZDX A;  4LEN A;  3EGX C;  3MZF A;  1BLC A;  4PM9 A;  2VLG A;  4P6Z S;  3E4O A;  1L0F A;  4Q0J A;  3OCN A;  3S7N A;  4KZ6 A;  3GMW A;  1ES4 A;  4Y5F A;  3IF6 A;  2O9C A;  3UB5 P;  2QKP A;  3F1P B;  4R4R A;  2Y79 A;  3TSG A;  4OON A;  3KYZ A;  3RTY A;  3LR4 A;  2W3H A;  3LEQ A;  3S7Q A;  1CF0 A;  2X71 A;  2ZC5 B;  3KSH A;  3LIF A;  1ESU A;  3GEC A;  3UDF A;  2QJ5 A;  4PPR A;  2VV6 A;  5EM1 A;  4EXO A;  4MN5 A;  3SW1 A;  4NET A;  1F2K A;  1VEU A;  2Y2O A;  3LEZ A;  3HRE A;  4OQG A;  2RL3 A;  5BOH A;  3RXX A;  2Q9N A;  4HH2 A;  3T4T A;  1E25 A;  4CLC C;  3D3O A;  4HH3 A;  4NK3 A;  1ACF A;  4WL9 A;  4X53 A;  4WM9 A;  3T1X A;  5TR7 A;  4BWI A;  3IF6 B;  3NDG A;  2WGI A;  2A2L A;  4ZJ3 A;  3I7J A;  3RXW A;  3UN7 A;  2HZ5 A;  1RGY A;  4JF6 A;  5D3O A;  3ZVT A;  1GA9 A;  3LI9 A;  2WAD A;  1K57 C;  3DTM A;  1YQS A;  3T4O A;  3VMA A;  1OJG A;  2GNX A;  4UQI M;  5AQA A;  1XGI A;  2XFS A;  1GHM A;  3P01 A;  1LLB A;  3BFD A;  4R6L A;  1VEU B;  3VSL A;  1K0K A;  1L3L A;  3G35 A;  4R1G A;  3V5M A;  4IJG A;  1VET A;  4FSF A;  3C38 A;  5DF9 A;  3O88 A;  3IHA A;  3SH7 A;  3S7O A;  1T1A A;  5KZH A;  2EWV A;  3V39 A;  4OKP A;  4X69 A;  4LRX C;  5I94 A;  3UNW A;  1E4D A;  3PTE A;  3UE3 A;  1IYP A;  2M7U A;  2JKT M;  4WEL A;  2Z6D A;  5FI6 A;  3BFC A;  4BBV A;  3Q7V A;  4LV1 A;  4EBP A;  3MFD A;  4EUZ A;  3M6H A;  4DDY A;  4MBF A;  5DJT A;  2B02 A;  5J3W A;  1STZ A;  4X6T A;  2R9X A;  1OT6 A;  5IU1 A;  2BLS A;  4GHI A;  3BFF A;  2WYX A;  5CX7 A;  3EOI A;  3IF5 A;  4L9E A;  1VET B;  4ETZ A;  1TD5 A;  3T4J A;  2BG1 A;  2OAP 1;  1I2S A;  1IYO A;  1CEG A;  1KGG A;  4YOF A;  1ZC2 A;  2PBD P;  1HLU P;  3KO6 A;  2EXA A;  4K91 A;  4S2L A;  4KZ5 A;  1E3U A;  3T50 A;  5FQK A;  4XUZ A;  3PHY A;  1BZA A;  2V1B A;  1IEM A;  1S0W A;  3UY6 A;  4NXE A;  3W4P A;  3LR0 A;  3A3I A;  4S2P A;  3ZCZ A;  1PWG A;  3CPT B;  1LSX A;  3IBJ A;  1WYC A;  3Q7V B;  2VV7 A;  2EA9 A;  2Y2K A;  3C7U A;  4QPR A;  1I2W A;  1U60 A;  3D9Y A;  4F94 A;  1KE0 A;  3N6I A;  1F98 A;  3HLC A;  3O86 A;  5KSC A;  4GHI B;  4LGW A;  5FDS A;  4LV3 A;  4R70 A;  4E6W A;  3IH9 A;  3GDI A;  4E3K A;  4OLG A;  4MN7 A;  4IED A;  2JCH A;  2ZJ9 A;  1K4E A;  3QP1 A;  1K6S A;  3CG5 A;  1KVM A;  4E3L A;  2CMN A;  2W3F A;  4Y3I A; 
#chains in the Genus database with same CATH homology
 2PBY A;  4WZ4 A;  5E2E A;  3WS5 A;  1M40 A;  3LY3 A;  1BUE A;  3W4O A;  4DXC A;  2EX2 A;  2HDR A;  1W5D A;  1IKG A;  3ZG9 B;  1YMS A;  2Y2I A;  2ZM0 A;  2WGV A;  3N8R A;  4Y0T A;  1SDN A;  2Y59 A;  1LHY A;  3IH8 A;  4RX3 A;  2Y2G A;  5EVI B;  4R4S A;  1PZP A;  1ERM A;  1ES3 A;  4R0Q A;  1PI5 A;  1BLH A;  5CGS A;  1MWR A;  4MEZ A;  1FCM A;  3BLM A;  3BEB A;  4L0L A;  2WKI A;  2Y2M A;  3EQU A;  5AQ7 A;  2EXB A;  1IKI A;  3OPL A;  4JF5 A;  3IXD A;  3NCK A;  2WGW A;  3EQV A;  4R3B A;  4GDB A;  2WKE A;  1W79 A;  3FYZ A;  2C6W B;  4GOG A;  3E2K A;  1YLY A;  4N1X A;  3C5A A;  3OC2 A;  4OQI A;  5HFO A;  3G30 A;  3C7V A;  3QNC A;  3ZG5 A;  2DCF A;  3OPR A;  4R3J A;  4WZ5 C;  4OOL A;  2Z2L B;  4OPY A;  4C75 A;  5F1F A;  3OZH A;  5KSH A;  3AGD A;  3M6B A;  3IWO A;  4LCM A;  1BT5 A;  2P74 A;  5F1G A;  3UPN A;  2WAE A;  3A3J A;  3B3X A;  1K54 A;  3BM6 A;  3DW0 A;  4FD8 A;  4KQO A;  4FH4 A;  5EOE A;  4P87 A;  4D2O A;  3A3F A;  4ZBE A;  1K6R A;  2Q9M A;  1MBL A;  4N9K A;  2IWB A;  3SS4 A;  4BL2 A;  4JKT A;  1L0D A;  1J9M A;  5CXW A;  3BLS A;  4UAA A;  1SKF A;  4GB7 A;  5E2H A;  1BLP A;  3VP1 A;  5GLB A;  1QME A;  3E2L A;  4MLL A;  3IWQ A;  1NZU A;  5JYO A;  1GA0 A;  5GLC A;  3OPH A;  4GDN A;  5EVI C;  3HL9 A;  1JTG A;  3VP3 A;  2J9O A;  4PM7 A;  1PWC A;  3PBR A;  5E43 A;  2EFX A;  3HVF A;  4E3J A;  1Y54 A;  3AGF A;  3C4P A;  1IEL A;  4B4X A;  1L0E A;  1BSG A;  2P9V B;  1MWU A;  3PBN A;  4MBH A;  5HW3 A;  1O7E A;  4KZ9 A;  4DF6 A;  4MNR A;  1CI9 A;  3WS4 A;  3BFE A;  4QU3 A;  5EE8 A;  2XQZ A;  4QY6 A;  4S2N A;  5A91 A;  1YM1 A;  2ZMA A;  2E8I A;  5M19 A;  1JTD A;  4RA7 A;  5DTT A;  3UO9 A;  1DY6 A;  3VOZ A;  3MZE A;  4YFM A;  4C6Y A;  4U0T A;  2XD5 A;  3Q82 A;  1YLT A;  4Z9Q A;  1H5X A;  4LV2 A;  4QB8 A;  3S4X A;  1TEM A;  4S2K A;  3IQA A;  1AXB A;  2XD1 A;  1SCW A;  5DF7 A;  4JF4 A;  2XFT A;  5A93 A;  1K55 A;  3VP0 A;  1NZO A;  3ITA A;  4GKU A;  5GL9 A;  4N9L A;  4BL3 A;  3P09 A;  1IYQ A;  4OH0 A;  4B88 A;  4HES A;  3FKV A;  3Q81 A;  3UPP A;  5A92 A;  2H0Y A;  3ZHH A;  4JXS A;  1XPB A;  2Y2P A;  4S2J A;  1Q2Q A;  5EOO A;  2PU2 A;  2HP9 A;  5HAQ A;  4YIN A;  4JPM A;  3QHY A;  4O7D A;  4PM8 A;  4FH2 A;  1KDW A;  2Y55 A;  2QPN A;  2WZX A;  3OPP A;  3ZDJ A;  2ZQ8 A;  3CMZ A;  4OVD A;  3N7W A;  3IXB A;  3NC8 A;  1BLS A;  5HX9 A;  1RCJ A;  5DVA A;  3GSG A;  1ES2 A;  4ZJ2 A;  3PBS A;  4S2M A;  1PI4 A;  3DWZ A;  4OPR A;  3IT9 A;  4QHC A;  5F82 A;  2WZZ A;  3SS3 A;  4UHU A;  3ZFZ A;  1DJB A;  4S2O A;  5EVL A;  1ES5 A;  1MXO A;  3IHB A;  1MWS A;  1YMX A;  5CHU A;  5G18 A;  3WRZ A;  2ZQD A;  4DE3 A;  5HL1 A;  4GNU A;  3SH8 A;  2HP6 A;  2XGN A;  1PW8 A;  5F83 A;  3HLF A;  1MY8 A;  1XA7 A;  4E3M A;  3WRT A;  1CEF A;  3GV9 A;  3MKF A;  4E3N A;  2IWC A;  5CGW A;  5HAR A;  3Q1F A;  4RYE A;  4C3Q A;  5IHV A;  4OQH A;  4E3I A;  1GCE A;  3NDE A;  1SHV A;  4JXW A;  2PU4 A;  3ZNY A;  3HLE A;  3N8S A;  2EX8 A;  5A90 A;  1E3U D;  3FWL A;  4GN2 A;  4E3O A;  2H5S A;  3CZD A;  5CTM A;  1FR1 A;  2V2F F;  1JWZ A;  3VP4 A;  4ZTK A;  3BYD A;  3ZG0 A;  3G4P A;  4UA9 A;  3PBT A;  1K4F A;  2ZQC A;  5FAP A;  5FAQ A;  4EQI A;  5EUA A;  1K38 A;  5EVI D;  1KGF A;  3NI9 A;  3TOI A;  4HBU A;  1MPL A;  2HDQ A;  5DTS A;  5GHZ A;  2V20 A;  2OV5 A;  4BD1 A;  4BLM A;  1I5Q A;  4XUX A;  5J8X A;  4K0X A;  2ZQ9 A;  3BRM A;  3HLW A;  4OPQ A;  4GZB A;  4P6B A;  3HLB A;  4N1H A;  4B4Z A;  1ONG A;  4RX2 A;  1LI0 A;  3NY4 A;  5TGF A;  1OME A;  3G2Z A;  1FQG A;  3V3S A;  2JC7 A;  1ALQ A;  4KZA A;  4JLF A;  5FI7 A;  5E2G A;  2XLN A;  2J7V A;  5GLA A;  3NBL A;  2XR0 A;  1M6K A;  1NYM A;  3G2Y A;  1DJA A;  1SDE A;  2B5R A;  1VQQ A;  1YLW A;  3G32 A;  1K56 A;  1RGZ A;  2RCX A;  1K57 A;  2Y2Q A;  1W8Y A;  5FQI A;  4A5R A;  1O07 A;  2XDM A;  3VSK A;  4DDS A;  3FZC A;  5FSR A;  4LEN A;  4ZDX A;  5FQJ A;  1FOF A;  2EX6 A;  2J9P A;  3MZF A;  5FAS A;  1ERO A;  5CTN A;  3LY4 A;  4X55 A;  3SOI A;  2Y2N A;  1BLC A;  1K55 C;  4PM9 A;  2C5W B;  4GD6 A;  3IXH A;  3PAG A;  4OLD A;  4IBX A;  1NJ4 A;  1Q2P A;  3UPO A;  3HUM A;  4EV4 A;  1JWP A;  3BEC A;  1L0F A;  1JWV A;  3HBR A;  3OCN A;  2A49 A;  2OLV A;  4KZ6 A;  2ZC6 B;  1XA1 A;  3GMW A;  3IXG A;  1ES4 A;  3IF6 A;  4WMC A;  5AQ9 A;  3NIA A;  2G2U A;  3OCL A;  3W8K A;  2EFU A;  2WK0 A;  3GRJ A;  4R4R A;  3HUN A;  3TSG A;  3MXR A;  4OON A;  1L0G A;  4IVK A;  1NRF A;  4KZ4 A;  3LCE A;  4M3K A;  1YLJ A;  2WGW B;  1JVJ A;  3WS2 A;  1BTL A;  4WEJ A;  1KE3 A;  2HDU A;  1HTZ A;  1ERQ A;  2EX9 A;  4CPK A;  3AGE A;  1ZG4 A;  3ZVW A;  2R9W A;  4BJP A;  3HLD A;  1PYY A;  5CHJ A;  1GHI A;  1LL5 A;  4BD0 A;  3IWI A;  5EEC A;  5FDH A;  3V50 A;  3WWX A;  4EBN A;  2X71 A;  2ZC5 B;  3UDI A;  1QMF A;  2X01 A;  4WBG A;  1ESU A;  3UDF A;  1PZO A;  1ZKJ A;  2WAF A;  4PPR A;  5GHX A;  5KMW A;  4UA7 A;  2IWD A;  3MZD A;  4X68 A;  1K56 D;  1XGJ A;  3HUO A;  4NET A;  3RJU A;  2Y2O A;  3LEZ A;  3HRE A;  4IBR A;  4OQG A;  2GDN A;  2RL3 A;  3P98 A;  3PBQ A;  5BOH A;  2DRW A;  4P0M A;  2Y2J A;  3RXX A;  2Q9N A;  2QMI A;  4GD8 A;  4QD4 A;  4FCF A;  1NY0 A;  5FA7 A;  1XX2 A;  5GHY A;  1E25 A;  1KE4 A;  2JE5 A;  3TG9 A;  1DJC A;  4OQ0 A;  4KQQ A;  4NK3 A;  4X53 A;  2Y2L A;  3C4O A;  2G2W A;  4WM9 A;  1FR6 A;  3ISG A;  4KEN B;  5FI2 A;  5TR7 A;  3IF6 B;  3W4Q A;  3NDG A;  1BUL A;  4DXB A;  2QZ6 A;  5M18 A;  2WGI A;  2XF3 A;  1N4O A;  3FKW A;  3N8L A;  4KZ7 A;  4OP5 A;  4ZJ3 A;  3G31 A;  3I7J A;  3PBO A;  5CEC A;  2ZC3 B;  4KQR A;  4N92 A;  3RXW A;  1ONH A;  1KGE A;  3ZG8 B;  1WE4 A;  5DTK A;  3UDX A;  3UN7 A;  3GTC A;  1ESI A;  1RGY A;  4JF6 A;  5D3O A;  1K54 C;  2CC1 A;  3M2J A;  3ZVT A;  4LCL A;  4H8R A;  1GA9 A;  4R23 A;  2WAD A;  1ZG6 A;  1K57 C;  3DTM A;  1YQS A;  2ZC7 A;  1YT4 A;  3VMA A;  4DRT A;  3Q7Z A;  1HZO A;  1PW1 A;  4HBT A;  4S2I A;  2I72 A;  4LV0 A;  4EWF A;  5AQA A;  4PMA A;  1N9B A;  1XGI A;  2XFS A;  3ZNT A;  1GHM A;  1L2S A;  1RP5 A;  1LLB A;  3BFD A;  5FQQ A;  3VSL A;  3G35 A;  1W7F A;  3PAE A;  1HD8 A;  1WYB A;  2XEP A;  2ZM2 A;  4R1G A;  3V5M A;  4FSF A;  2P9V A;  3IF6 C;  1G6A A;  5DF9 A;  3O88 A;  4U0X A;  5CER A;  4S2N C;  4WEK A;  1PIO A;  3IHA A;  3FV7 A;  2Y91 A;  3VFF A;  3VP2 A;  3SH7 A;  1XXM A;  1HVB A;  4Y0O A;  5FAO A;  1MKI A;  5KZH A;  3Q07 A;  1FCO A;  4KZ8 A;  4IVI A;  3V39 A;  4OKP A;  5FAT A;  4E6X A;  4UA6 A;  4X69 A;  5I94 A;  2H10 A;  4U3T A;  3UNW A;  1MWT A;  3VOY A;  5M1A A;  2ZQ7 A;  1E4D A;  3PTE A;  4P85 A;  5E2F A;  3UE3 A;  5CRF A;  1IYP A;  1TDG A;  4JBF A;  1CI8 A;  5TFQ A;  4CJN A;  4WEL A;  4DKI A;  5FI6 A;  2Z2M B;  3A3E A;  3M2K A;  3BFC A;  2XH9 A;  2FFY A;  3GVB A;  5HAP A;  3Q7V A;  4LV1 A;  3D4F A;  4EBP A;  3UE0 A;  3MFD A;  3ZG7 B;  4XXR A;  2ZLY A;  4EUZ A;  3QNB A;  3M6H A;  2OLU A;  4DDY A;  4MBF A;  4KG6 A;  4Y0U A;  1VM1 A;  3VFH A;  3WS0 A;  3ZGA B;  2UWX A;  1YLZ A;  4Q8I A;  1S6R A;  5U47 A;  4X6T A;  2Y4A A;  2R9X A;  2ZD8 A;  4KG2 A;  3HLG A;  4OOY A;  2BLS A;  3LO7 A;  1FSY A;  4MBK A;  5JYP A;  3BFF A;  4OOM A;  1K25 A;  4QJG A;  2WYX A;  4Y7P A;  1NYY A;  2WUQ A;  4RVA A;  2Y2H A;  3IF5 A;  4PM5 A;  2OSU A;  1IYS A;  3O87 A;  2X02 A;  2BG1 A;  3MKE A;  1I2S A;  3MXS A;  1IYO A;  1CEG A;  1KGG A;  4WZ5 A;  1ZC2 A;  2DNS A;  2FFF B;  2HP5 A;  5CGX A;  2VGJ A;  2EXA A;  3A3D A;  3JYI A;  1GHP A;  1TVF A;  4K91 A;  5CED A;  4S2L A;  5L2F A;  2HDS A;  5FQM A;  1XKZ A;  3BFG A;  4KG5 A;  4KZ5 A;  1E3U A;  1LI9 A;  2JBF A;  4DE1 A;  1KDS A;  5FQK A;  2ZQA A;  1G68 A;  3ITB A;  3N4I A;  3O3V A;  3CJM A;  1XP4 A;  1CK3 A;  4XUZ A;  1W8Q A;  4JXG A;  5HAI A;  1BZA A;  1IEM A;  1FSW A;  1S0W A;  1TDL A;  2J8Y A;  5EVI A;  4JXV A;  3UY6 A;  1KVL A;  3W4P A;  1FCN A;  4HEF A;  1C3B A;  4ZJ1 A;  4EBL A;  3A3I A;  5CEB A;  4S2P A;  3ZCZ A;  1PWG A;  2ZM8 A;  2HPB A;  3SH9 A;  4ID4 A;  2V1Z A;  1WYC A;  5FQ9 A;  3Q7V B;  5EPH A;  2Y2K A;  3C7U A;  3MBZ A;  1PWD A;  1I2W A;  5DF8 A;  3DWK A;  3V3R A;  1U60 A;  2H0T A;  4WMC D;  1H8Z A;  1KE0 A;  3WS1 A;  4F94 A;  1EI5 A;  3N6I A;  5AQB A;  4K0W A;  3HLC A;  4OP8 A;  3SS5 A;  3O86 A;  4DE0 A;  3S22 A;  4KZB A;  1H8Y A;  5KSC A;  1EWZ A;  5GLD A;  2ZC4 B;  4QY5 A;  1LL9 A;  4LV3 A;  3GR2 A;  3G34 A;  4WYY A;  4E6W A;  4ZAM A;  4DE2 A;  3IH9 A;  4OPZ A;  4E3K A;  4X56 A;  4OLG A;  1NXY A;  4BQM A;  2A3U A;  4IED A;  4BEN A;  4PM6 A;  2WKH A;  1YLP A;  2JCH A;  2ZJ9 A;  1K4E A;  5CHM A;  3S1Y A;  1K6S A;  3UE1 A;  3GQZ A;  3CG5 A;  1KVM A;  4E3L A;  4KZ3 A;  1Z6F A;  2VGK A;  2XK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...