3O49A

Crystal structure of symfoil-1: de novo designed beta-trefoil architecture with symmetric primary structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
b'KPVLLKSTETGQYLRINPDGTVDGTRDRSDQHIQFQVSPEGGGEVLLKSTETGQYLRINPDGTVDGTRDRSDQHIQFQVSPEGGGEVLLKSTETGQYLRINPDGTVDGTRDRSDQHIQFQVSP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords de novo designed beta-trefoil architecture with symmetric pr
publication title Experimental support for the evolution of symmetric protein architecture from a simple peptide motif.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 34
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3o49A00
1EYLA 4QD2C 1SR4A 1HWMB 3BA5A 3HN1A 4KBBA 1HKNA 1RG8A 1S0GA 3R4SA 1XHBA 2HWAA 4XKIA 1R8NA 1P63A 1TFMB 2MC2A 1EVTA 3CA3A 3AZVA 1NUNA 2D23A 2FFUA 4A7KA 3WO2A 3POKA 3RMYA 5EC5A 3OBRA 3AKIA 4EFPA 5DSSB 4ZFWB 4I1BA 1BFCA 3NJ5A 3FJIA 1G9CA 3WMUA 4DCKC 1V6VA 1YYNA 3AH2A 3AJ5A 1G9DA 2AQZA 3IM5A 3CQAA 3S8JA 3V79C 3H6RB 3T8SA 4OWKA 1T9FA 1N4KA 3ILAA 2Y9WC 5BQUC 2K43A 1D0HA 1L2HA 1FMZA 5BXPA 3FJDA 5BOWA 4LO0C 4LO2C 5FZZA 1JT5A 4J2XA 4J2KA 4ZKTB 4EKXB 4USOA 5BP5C 4Z9WB 4IONA 4FGFA 4GP0A 4HJJA 3VUOA 3BAUA 5HPZA 3UJ0A 4IZEA 4GAIA 1BASA 2NVHA 1I1BA 4I4QA 3BAGA 2X2TA 3CU1B 3Q7XA 1FWVA 4ISRA 3WMVA 3OGFA 4QC4A 3VSFA 1G9AA 3PUBA 3NBDA 3BAHA 1R8OA 3CA6A 3W9TA 3F1RA 2XOAA 3IM6A 1K5UA 4ZA3B 2FDBM 5JLVA 2Z48A 4KEJA 2WBCA 3O4BA 1JT7A 3ZXGA 1CVSA 1DQOA 4WBCA 5DUYA 4I4PA 1TP0A 4R6UB 1WD3A 3PMEA 1HWPB 1PUUB 1BFBA 3O4AA 4G9NA 4I4SA 2ZQNA 1V6XA 3AKHA 1AVAC 4II0A 5G00A 5GAQA 4OWLA 5I1BA 2HWMA 2BEAA 4LO7C 4OWJA 2E4MC 3CAHA 4D8HA 3OJVA 1MD6A 2NZ9A 4H04A 4XFTA 5E24E 3OJ2A 1DFCA 4D0ZA 4J2SA 1YXWA 4LO1A 1DFQA 3BAOA 3VT2A 2UUSA 5BXSA 3FJHA 4G6MA 5F8WA 2RG9B 1XG6A 2AXMA 4IHZA 4IZXA 4Q9GA 3RTJB 2RQ9A 2FGFA 1BA7A 3JUTA 3MPPG 2F2FA 3WINA 3V0BB 3B9UA 4HA2A 4ZLBB 2AAIB 3AJ6A 5FZYA 3QR5A 4YOLA 4LO3C 1NZKA 1S0EA 1ISWA 2HW9A 3O4DA 3I2XA 4ENDA 4IYBA 4XFSA 1A8DA 2Y9XE 3S8KA 1YTOA 3V0BA 1TTUA 1II4A 1FV3A 3H6SE 5BVPI 2D24A 3I2AA 2VUAA 3K1XA 2Z49A 3O4OA 2R9KB 4JKXB 1AVUA 2NM1A 3CA5A 4J23B 1AFCA 1BFFA 3UD9A 3LTQA 1T4QA 1DQGA 1WD4A 3PHZA 4I0YA 4QKSA 5F90A 5FZUA 2D7IA 2ET2A 3P6JA 4CJMA 4GOYA 3HMYA 4I6IA 3WO3A 1QQKA 2VU9A 4G1RA 2D1ZA 1XYFA 2DRYA 2ERMA 4I4YA 4P6AA 4EEEB 3AKGA 1S0LA 4TLPA 1J0SA 1PC8B 3LLPA 4KEIA 1BFGA 1G9BA 4JP0A 1S0CA 3BRFA 4A7YA 2P23A 1W3GA 1BARA 2QYIB 2MIBA 1IHKA 4I8MA 1S0FA 4P0KA 3H6RA 1TWEA 1IT0A 4OUJA 2FFVA 5FNWA 3WA1A 3RSJA 1TIEA 2ZQOA 3FFZA 4QD2B 3FJBA 1FV2A 5EHAA 3CRHA 4X37A 3KMVA 3CA4A 3FJCA 31BIA 2RSTA 5EG6C 1CE7B 2M49A 1V6WA 2BEBA 3JRRA 1SR4C 3ZX7A 5DVHA 4I2SA 1DJSB 3BA7A 1JQZA 3CA1A 3D7WB 2NYYA 21BIA 1JT4A 5B2HA 4I4UA 5BXTA 2KI4A 1MC9A 4ZBVB 1Z4SA 3A21A 4Z8SB 1EV2A 5BXRA 3V0AB 4IQPA 3FJEA 2LIQA 1Z2VA 3IM7A 2KKIA 3IIRA 4L4IA 1DZDA 1Q03A 1HCEA 3WO4A 1FN0A 3N7JA 2BFHA 3FJ8A 3R4UA 1W3FA 3VEQA 4JQ0A 1FMMS 1FGAA 2MLLB 1JT3A 2DRZA 4I96A 3AH1A 3V0AA 4J2YA 2D44A 4DENA 3OBTA 3Q7WA 2KI6B 1JLXA 4H9WA 3N7KA 3FJFA 1ONKB 4QALA 8I1BA 5F8SA 2DS0A 3A22A 4JPZA 5DZUA 1JLYA 1ISYA 3NBCA 4LO8B 3O5WB 1DLLA 2L5XA 3FJJA 3BTAA 2KH2A 1HWNB 1AVWB 3ZC8A 5BQUA 1WBCA 4QO3A 3H6QA 2YUGA 4OW4A 1YBIA 1DZCA 3OJMA 1AXMA 2VSEA 2K4AB 3P53A 2AFGA 2P39A 4LO2A 4LO0A 1HWOB 4I37A 7I1BA 3FUOA 5BP5A 4I4OA 3FUQA 3QYDA 3Q7YA 4JRAA 1K5VA 1SZ6B 1E0OA 1PWAA 3UJ4A 9ILBA 3VT1A 4OEEA 1FWUA 3CRGA 3UDAA 4GP3A 4G9MA 4XFUA 4GAFA 1M2TB 1VCLA 4ZOTA 1YF8B 1QQLA 1RZOB 2FO1A 4USPA 2IWTB 4F83A 1ITBA 5D62A 3O44A 4KC3A 3HSMA 1QXMA 3HALA 3UD8A 4F34A 1GGPB 4I4XA 1G82A 3I29B 3N7MA 4Q91A 1EPWA 3IAGC 4ISQA 2QN4A 2Y9GA 3FJ9A 3MALA 5D61A 3BADA 4QBCA 2ZR1B 1XZZA 1Q04A 1S0DA 3PG0A 4LO7B 3AKFA 4A7ZA 1BLDA 4P0JA 4AN6A 1TOOA 4EB2B 2NTDA 3RMXA 4ZFUB 5FNXA 2ESUA 1IRPA 3A07A 3VWCA 3TC2A 4I7IA 2VSAA 2E4MA 1ABRB 4I3NA 4LO1C 4ZFYB 5F8YA 4OEGA 3BX1C 3C9ZA 4X39A 2Q9XA 3P6IA 2LIEA 3BA4A 1UPSA 3FJKA 2F2FC 1AVXB 1ILR1 3WINC 1ISVA 4GOVA 1PUMB 2GO2A 3E8LC 5JMCA 1IJTA 2K8RA 3NBEA 2D20A 3UD7A 4G6JA 1S0BA 3OGGA 1HCDA 4IY9A 1AF9A 3FGMA 1PZZA 3BRDA 3AH4A 4LO3A 1WBAA 2J3PA 3A23A 4P0LA 1TWMA 1I1EA 5D63A 2DREA 4D0TA 3BB2A 3O3QA 1IILA 4QKRA 1RMLA 1HIBA 3O4CA 3O49A 1ISXA 3ZC9A 4DEPA 3ZXDA 4I1EA 3BAQA 4X3AA 4KEKA 4I4RA 1Z0HA 2D7RA 4Q9PA 3VSZA 3N7LA 1ISZA 4OEFA 2IHOA 3RTIB 1IRAX 3NBNA 1W3AA 4X38A 4ZGRB 2WRYA 1RY7A 1Q1UA 1BLAA 1M16A 2D22A 1FQ9A 4IY8A 4AN7B 3AZWA 3CRIA 2KLLA 4FVVA 2X2SA 1IOBA 2D43A 3BAVA 2GZBA 2Y9FA 4L4HA 3SNVA 2I1BA 2VXRA 3HOMA 2HZ9A 4JKQA 4QBVA 1DIWA 2VXTI 3BRGC 4HR6C 3N0KA 4PC4A 6I1BA 1JTCA 2VLCA 3F62B 1V6UA 4EFQA 2F8XC 3CA0A 2NP0A 1KNMA 4EFRA 1OQLB 4I4VA 1F31A 2Q3NB 1JY0A 3EF2A 3FJAA 4JAWA 3VT0A 41BIA 3HBWA
chains in the Genus database with same CATH superfamily
1EYLA 4QD2C 1SR4A 1HWMB 3BA5A 3HN1A 4KBBA 1HKNA 1RG8A 1S0GA 3R4SA 1XHBA 2HWAA 4XKIA 1R8NA 1P63A 1TFMB 2MC2A 1EVTA 3CA3A 3AZVA 1NUNA 2D23A 2FFUA 4A7KA 3WO2A 3POKA 3RMYA 5EC5A 3OBRA 3AKIA 4EFPA 5DSSB 4ZFWB 4I1BA 1BFCA 3NJ5A 3FJIA 1G9CA 3WMUA 4DCKC 1V6VA 1YYNA 3AH2A 3AJ5A 1G9DA 2AQZA 3IM5A 3CQAA 3S8JA 3V79C 3H6RB 3T8SA 4OWKA 1T9FA 1N4KA 3ILAA 2Y9WC 5BQUC 2K43A 1D0HA 1L2HA 1FMZA 5BXPA 3FJDA 5BOWA 4LO0C 4LO2C 5FZZA 1JT5A 4J2XA 4J2KA 4ZKTB 4EKXB 4USOA 5BP5C 4Z9WB 4IONA 4FGFA 4GP0A 4HJJA 4MZGB 3VUOA 4UY4A 3BAUA 5HPZA 3UJ0A 4IZEA 4GAIA 1BASA 2NVHA 1I1BA 4I4QA 3BAGA 2X2TA 3CU1B 3Q7XA 1FWVA 4ISRA 3WMVA 3OGFA 4QC4A 3VSFA 1G9AA 3PUBA 3NBDA 3BAHA 1R8OA 3CA6A 3W9TA 3F1RA 2XOAA 3IM6A 1K5UA 4ZA3B 2FDBM 5JLVA 2Z48A 4KEJA 2WBCA 3O4BA 1JT7A 3ZXGA 1CVSA 1DQOA 4WBCA 5DUYA 4I4PA 1TP0A 4R6UB 1WD3A 3PMEA 1HWPB 1PUUB 1BFBA 3O4AA 4G9NA 4I4SA 2ZQNA 1V6XA 3AKHA 1AVAC 4II0A 5G00A 5GAQA 4OWLA 5I1BA 2HWMA 2BEAA 4LO7C 4OWJA 2E4MC 3CAHA 4D8HA 3OJVA 1MD6A 2NZ9A 4H04A 4XFTA 5E24E 3OJ2A 1DFCA 4D0ZA 4J2SA 1YXWA 4LO1A 1DFQA 3BAOA 3VT2A 2UUSA 5BXSA 3FJHA 4G6MA 5F8WA 2RG9B 1XG6A 2AXMA 4IHZA 4IZXA 4Q9GA 3RTJB 2RQ9A 2FGFA 1BA7A 3JUTA 3MPPG 2F2FA 3WINA 3V0BB 3B9UA 4HA2A 4ZLBB 2AAIB 3AJ6A 5FZYA 3QR5A 4YOLA 4LO3C 1NZKA 1S0EA 1ISWA 2HW9A 3O4DA 3I2XA 4ENDA 4IYBA 4XFSA 1A8DA 2Y9XE 3S8KA 1YTOA 3V0BA 1TTUA 1II4A 1FV3A 3H6SE 5BVPI 2D24A 3I2AA 2VUAA 4MZFB 3K1XA 2Z49A 3O4OA 2R9KB 4JKXB 1AVUA 2NM1A 3CA5A 4J23B 1AFCA 1BFFA 3UD9A 3LTQA 1T4QA 1DQGA 1WD4A 3PHZA 4I0YA 4QKSA 5F90A 5FZUA 2D7IA 2ET2A 3P6JA 4CJMA 4GOYA 3HMYA 4I6IA 3WO3A 1QQKA 2VU9A 4G1RA 2D1ZA 1XYFA 2DRYA 2ERMA 4I4YA 4P6AA 4EEEB 3AKGA 1S0LA 4TLPA 1J0SA 1PC8B 3LLPA 4KEIA 1BFGA 1G9BA 4JP0A 1S0CA 3BRFA 4A7YA 2P23A 1W3GA 1BARA 2QYIB 2MIBA 1IHKA 4I8MA 1S0FA 4P0KA 3H6RA 1TWEA 1IT0A 4OUJA 2FFVA 5FNWA 3WA1A 3RSJA 1TIEA 2ZQOA 3FFZA 4QD2B 3FJBA 1FV2A 5EHAA 3CRHA 4X37A 3KMVA 3CA4A 3FJCA 31BIA 2RSTA 5EG6C 1CE7B 2M49A 1V6WA 2BEBA 3JRRA 1SR4C 3ZX7A 5DVHA 4I2SA 1DJSB 3BA7A 1JQZA 3CA1A 3D7WB 2NYYA 21BIA 1JT4A 5B2HA 4I4UA 5BXTA 2KI4A 1MC9A 4ZBVB 1Z4SA 3A21A 4Z8SB 1EV2A 5BXRA 3V0AB 4IQPA 3FJEA 2LIQA 1Z2VA 3IM7A 2KKIA 3IIRA 4L4IA 1DZDA 1Q03A 1HCEA 3WO4A 1FN0A 3N7JA 2BFHA 3FJ8A 3R4UA 1W3FA 3VEQA 4JQ0A 1FMMS 1FGAA 2MLLB 1JT3A 2DRZA 4I96A 3AH1A 3V0AA 4J2YA 2D44A 4DENA 3OBTA 3Q7WA 2KI6B 1JLXA 4H9WA 3N7KA 3FJFA 1ONKB 4QALA 8I1BA 5F8SA 2DS0A 3A22A 4JPZA 5DZUA 1JLYA 1ISYA 3NBCA 4LO8B 3O5WB 1DLLA 2L5XA 3FJJA 3BTAA 2KH2A 1HWNB 1AVWB 3ZC8A 5BQUA 1WBCA 4QO3A 3H6QA 2YUGA 4OW4A 1YBIA 1DZCA 3OJMA 1AXMA 2VSEA 2K4AB 3P53A 2AFGA 2P39A 4LO2A 4LO0A 1HWOB 4I37A 7I1BA 3FUOA 5BP5A 4I4OA 3FUQA 3QYDA 3Q7YA 4JRAA 1K5VA 1SZ6B 1E0OA 1PWAA 3UJ4A 9ILBA 3VT1A 4OEEA 1FWUA 3CRGA 3UDAA 4GP3A 4G9MA 4XFUA 4GAFA 1M2TB 1VCLA 4ZOTA 1YF8B 1QQLA 1RZOB 2FO1A 4USPA 2IWTB 4F83A 1ITBA 5D62A 3O44A 4KC3A 3HSMA 1QXMA 3HALA 3UD8A 4F34A 1GGPB 4I4XA 1G82A 3I29B 3N7MA 4Q91A 1EPWA 3IAGC 4ISQA 2QN4A 2Y9GA 3FJ9A 3MALA 5D61A 3BADA 4QBCA 2ZR1B 1XZZA 1Q04A 1S0DA 3PG0A 4LO7B 3AKFA 4A7ZA 1BLDA 4P0JA 4AN6A 1TOOA 4EB2B 2NTDA 3RMXA 4ZFUB 5FNXA 2ESUA 1IRPA 3A07A 3VWCA 3TC2A 4I7IA 2VSAA 2E4MA 1ABRB 4I3NA 4LO1C 4ZFYB 5F8YA 4OEGA 3BX1C 3C9ZA 4X39A 2Q9XA 3P6IA 2LIEA 3BA4A 1UPSA 3FJKA 2F2FC 1AVXB 1ILR1 3WINC 1ISVA 4GOVA 1PUMB 2GO2A 3E8LC 5JMCA 1IJTA 2K8RA 3NBEA 2D20A 3UD7A 4G6JA 4H75A 1S0BA 3OGGA 1HCDA 4IY9A 1AF9A 3FGMA 1PZZA 3BRDA 3AH4A 4LO3A 1WBAA 2J3PA 3A23A 4P0LA 1TWMA 1I1EA 5D63A 2DREA 4D0TA 3BB2A 3O3QA 1IILA 4QKRA 1RMLA 1HIBA 3O4CA 3O49A 1ISXA 3ZC9A 4DEPA 3ZXDA 4I1EA 3BAQA 4X3AA 4KEKA 4I4RA 1Z0HA 2D7RA 4Q9PA 3VSZA 3N7LA 1ISZA 4OEFA 2IHOA 3RTIB 1IRAX 3NBNA 1W3AA 4X38A 4ZGRB 2WRYA 1RY7A 1Q1UA 1BLAA 1M16A 2D22A 1FQ9A 4IY8A 4AN7B 3AZWA 3CRIA 2KLLA 4FVVA 2X2SA 4MZHA 1IOBA 2D43A 3BAVA 2GZBA 2Y9FA 2NS2A 4L4HA 3SNVA 2I1BA 2VXRA 3HOMA 2HZ9A 4JKQA 4QBVA 1DIWA 2VXTI 3BRGC 4HR6C 3N0KA 4PC4A 6I1BA 1JTCA 2VLCA 3F62B 1V6UA 4EFQA 2F8XC 3CA0A 2NP0A 1KNMA 4EFRA 1OQLB 4I4VA 1F31A 2Q3NB 1JY0A 3EF2A 3FJAA 4JAWA 3VT0A 41BIA 3HBWA
chains in the Genus database with same CATH topology
1EYLA 4QD2C 1SR4A 1HWMB 3BA5A 3HN1A 4KBBA 1HKNA 1RG8A 1S0GA 3R4SA 1XHBA 2HWAA 4XKIA 1R8NA 1P63A 1TFMB 2MC2A 1EVTA 3CA3A 3AZVA 1NUNA 2D23A 2FFUA 4A7KA 3WO2A 3POKA 3RMYA 5EC5A 3OBRA 3AKIA 4EFPA 5DSSB 4ZFWB 4I1BA 1BFCA 3NJ5A 3FJIA 1G9CA 3WMUA 4DCKC 1V6VA 1YYNA 3AH2A 3AJ5A 1G9DA 2AQZA 3IM5A 3CQAA 3S8JA 3V79C 3H6RB 3T8SA 4OWKA 1T9FA 1N4KA 3ILAA 2Y9WC 5BQUC 2K43A 1D0HA 1L2HA 1FMZA 5BXPA 3FJDA 5BOWA 4LO0C 4LO2C 5FZZA 1JT5A 4J2XA 4J2KA 4ZKTB 4EKXB 4USOA 5BP5C 4Z9WB 4IONA 4FGFA 4GP0A 4HJJA 4MZGB 3VUOA 4UY4A 3BAUA 5HPZA 3UJ0A 4IZEA 4GAIA 1BASA 2NVHA 1I1BA 4I4QA 3BAGA 2X2TA 3CU1B 3Q7XA 1FWVA 4ISRA 3WMVA 3OGFA 4QC4A 3VSFA 1G9AA 3PUBA 3NBDA 3BAHA 1R8OA 3CA6A 3W9TA 3F1RA 2XOAA 3IM6A 1K5UA 4ZA3B 2FDBM 5JLVA 2Z48A 4KEJA 2WBCA 3O4BA 1JT7A 3ZXGA 1CVSA 1DQOA 4WBCA 5DUYA 4I4PA 1TP0A 4R6UB 1WD3A 3PMEA 1HWPB 1PUUB 1BFBA 3O4AA 4G9NA 4I4SA 2ZQNA 1V6XA 3AKHA 1AVAC 4II0A 5G00A 5GAQA 4OWLA 5I1BA 2HWMA 2BEAA 4LO7C 4OWJA 2E4MC 3CAHA 4D8HA 3OJVA 1MD6A 2NZ9A 4H04A 4XFTA 5E24E 3OJ2A 1DFCA 4D0ZA 4J2SA 1YXWA 4LO1A 1DFQA 3BAOA 3VT2A 2UUSA 5BXSA 3FJHA 4G6MA 5F8WA 2RG9B 1XG6A 2AXMA 4IHZA 4IZXA 4Q9GA 3RTJB 2RQ9A 2FGFA 1BA7A 3JUTA 3MPPG 2F2FA 3WINA 3V0BB 3B9UA 4HA2A 4ZLBB 2AAIB 3AJ6A 5FZYA 3QR5A 4YOLA 4LO3C 1NZKA 1S0EA 1ISWA 2HW9A 3O4DA 3I2XA 4ENDA 4IYBA 4XFSA 1A8DA 2Y9XE 3S8KA 1YTOA 3V0BA 1TTUA 1II4A 1FV3A 3H6SE 5BVPI 2D24A 3I2AA 2VUAA 4MZFB 3K1XA 2Z49A 3O4OA 2R9KB 4JKXB 1AVUA 2NM1A 3CA5A 4J23B 1AFCA 1BFFA 3UD9A 3LTQA 1T4QA 1DQGA 1WD4A 3PHZA 4I0YA 4QKSA 5F90A 5FZUA 2D7IA 2ET2A 3P6JA 4CJMA 4GOYA 3HMYA 4I6IA 3WO3A 1QQKA 2VU9A 4G1RA 2D1ZA 1XYFA 2DRYA 2ERMA 4I4YA 4P6AA 4EEEB 3AKGA 1S0LA 4TLPA 1J0SA 1PC8B 3LLPA 4KEIA 1BFGA 1G9BA 4JP0A 1S0CA 3BRFA 4A7YA 2P23A 1W3GA 1BARA 2QYIB 2MIBA 1IHKA 4I8MA 1S0FA 4P0KA 3H6RA 1TWEA 1IT0A 4OUJA 2FFVA 5FNWA 3WA1A 3RSJA 1TIEA 2ZQOA 3FFZA 4QD2B 3FJBA 1FV2A 5EHAA 3CRHA 4X37A 3KMVA 3CA4A 3FJCA 31BIA 2RSTA 5EG6C 1CE7B 2M49A 1V6WA 2BEBA 3JRRA 1SR4C 3ZX7A 5DVHA 4I2SA 1DJSB 3BA7A 1JQZA 3CA1A 3D7WB 2NYYA 21BIA 1JT4A 5B2HA 4I4UA 5BXTA 2KI4A 1MC9A 4ZBVB 1Z4SA 3A21A 4Z8SB 1EV2A 5BXRA 3V0AB 4IQPA 3FJEA 2LIQA 1Z2VA 3IM7A 2KKIA 3IIRA 4L4IA 1DZDA 1Q03A 1HCEA 3WO4A 1FN0A 3N7JA 2BFHA 3FJ8A 3R4UA 1W3FA 3VEQA 4JQ0A 1FMMS 1FGAA 2MLLB 1JT3A 2DRZA 4I96A 3AH1A 3V0AA 4J2YA 2D44A 4DENA 3OBTA 3Q7WA 2KI6B 1JLXA 4H9WA 3N7KA 3FJFA 1ONKB 4QALA 8I1BA 5F8SA 2DS0A 3A22A 4JPZA 5DZUA 1JLYA 1ISYA 3NBCA 4LO8B 3O5WB 1DLLA 2L5XA 3FJJA 3BTAA 2KH2A 1HWNB 1AVWB 3ZC8A 5BQUA 1WBCA 4QO3A 3H6QA 2YUGA 4OW4A 1YBIA 1DZCA 3OJMA 1AXMA 2VSEA 2K4AB 3P53A 2AFGA 2P39A 4LO2A 4LO0A 1HWOB 4I37A 7I1BA 3FUOA 5BP5A 4I4OA 3FUQA 3QYDA 3Q7YA 4JRAA 1K5VA 1SZ6B 1E0OA 1PWAA 3UJ4A 9ILBA 3VT1A 4OEEA 1FWUA 3CRGA 3UDAA 4GP3A 4G9MA 4XFUA 4GAFA 1M2TB 1VCLA 4ZOTA 1YF8B 1QQLA 1RZOB 2FO1A 4USPA 2IWTB 4F83A 1ITBA 5D62A 3O44A 4KC3A 3HSMA 1QXMA 3HALA 3UD8A 4F34A 1GGPB 4I4XA 1G82A 3I29B 3N7MA 4Q91A 1EPWA 3IAGC 4ISQA 2QN4A 2Y9GA 3FJ9A 3MALA 5D61A 3BADA 4QBCA 2ZR1B 1XZZA 1Q04A 1S0DA 3PG0A 4LO7B 3AKFA 4A7ZA 1BLDA 4P0JA 4AN6A 1TOOA 4EB2B 2NTDA 3RMXA 4ZFUB 5FNXA 2ESUA 1IRPA 3A07A 3VWCA 3TC2A 4I7IA 2VSAA 2E4MA 1ABRB 4I3NA 4LO1C 4ZFYB 5F8YA 4OEGA 3BX1C 3C9ZA 4X39A 2Q9XA 3P6IA 2LIEA 3BA4A 1UPSA 3FJKA 2F2FC 1AVXB 1ILR1 3WINC 1ISVA 4GOVA 1PUMB 2GO2A 3E8LC 5JMCA 1IJTA 2K8RA 3NBEA 2D20A 3UD7A 4G6JA 4H75A 1S0BA 3OGGA 1HCDA 4IY9A 1AF9A 3FGMA 1PZZA 3BRDA 3AH4A 4LO3A 1WBAA 2J3PA 3A23A 4P0LA 1TWMA 1I1EA 5D63A 2DREA 4D0TA 3BB2A 3O3QA 1IILA 4QKRA 1RMLA 1HIBA 3O4CA 3O49A 1ISXA 3ZC9A 4DEPA 3ZXDA 4I1EA 3BAQA 4X3AA 4KEKA 4I4RA 1Z0HA 2D7RA 4Q9PA 3VSZA 3N7LA 1ISZA 4OEFA 2IHOA 3RTIB 1IRAX 3NBNA 1W3AA 4X38A 4ZGRB 2WRYA 1RY7A 1Q1UA 1BLAA 1M16A 2D22A 1FQ9A 4IY8A 4AN7B 3AZWA 3CRIA 2KLLA 4FVVA 2X2SA 4MZHA 1IOBA 2D43A 3BAVA 2GZBA 2Y9FA 2NS2A 4L4HA 3SNVA 2I1BA 2VXRA 3HOMA 2HZ9A 4JKQA 4QBVA 1DIWA 2VXTI 3BRGC 4HR6C 3N0KA 4PC4A 6I1BA 1JTCA 2VLCA 3F62B 1V6UA 4EFQA 2F8XC 3CA0A 2NP0A 1KNMA 4EFRA 1OQLB 4I4VA 1F31A 2Q3NB 1JY0A 3EF2A 3FJAA 4JAWA 3VT0A 41BIA 3HBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYL A;  4QD2 C;  1SR4 A;  1HWM B;  3BA5 A;  3HN1 A;  4KBB A;  1HKN A;  1RG8 A;  1S0G A;  3R4S A;  1XHB A;  2HWA A;  4XKI A;  1R8N A;  1P63 A;  1TFM B;  2MC2 A;  1EVT A;  3CA3 A;  3AZV A;  1NUN A;  2D23 A;  2FFU A;  4A7K A;  3WO2 A;  3POK A;  3RMY A;  5EC5 A;  3OBR A;  3AKI A;  4EFP A;  5DSS B;  4ZFW B;  4I1B A;  1BFC A;  3NJ5 A;  3FJI A;  1G9C A;  3WMU A;  4DCK C;  1V6V A;  1YYN A;  3AH2 A;  3AJ5 A;  1G9D A;  2AQZ A;  3IM5 A;  3CQA A;  3S8J A;  3V79 C;  3H6R B;  3T8S A;  4OWK A;  1T9F A;  1N4K A;  3ILA A;  2Y9W C;  5BQU C;  2K43 A;  1D0H A;  1L2H A;  1FMZ A;  5BXP A;  3FJD A;  5BOW A;  4LO0 C;  4LO2 C;  5FZZ A;  1JT5 A;  4J2X A;  4J2K A;  4ZKT B;  4EKX B;  4USO A;  5BP5 C;  4Z9W B;  4ION A;  4FGF A;  4GP0 A;  4HJJ A;  3VUO A;  3BAU A;  5HPZ A;  3UJ0 A;  4IZE A;  4GAI A;  1BAS A;  2NVH A;  1I1B A;  4I4Q A;  3BAG A;  2X2T A;  3CU1 B;  3Q7X A;  1FWV A;  4ISR A;  3WMV A;  3OGF A;  4QC4 A;  3VSF A;  1G9A A;  3PUB A;  3NBD A;  3BAH A;  1R8O A;  3CA6 A;  3W9T A;  3F1R A;  2XOA A;  3IM6 A;  1K5U A;  4ZA3 B;  2FDB M;  5JLV A;  2Z48 A;  4KEJ A;  2WBC A;  3O4B A;  1JT7 A;  3ZXG A;  1CVS A;  1DQO A;  4WBC A;  5DUY A;  4I4P A;  1TP0 A;  4R6U B;  1WD3 A;  3PME A;  1HWP B;  1PUU B;  1BFB A;  3O4A A;  4G9N A;  4I4S A;  2ZQN A;  1V6X A;  3AKH A;  1AVA C;  4II0 A;  5G00 A;  5GAQ A;  4OWL A;  5I1B A;  2HWM A;  2BEA A;  4LO7 C;  4OWJ A;  2E4M C;  3CAH A;  4D8H A;  3OJV A;  1MD6 A;  2NZ9 A;  4H04 A;  4XFT A;  5E24 E;  3OJ2 A;  1DFC A;  4D0Z A;  4J2S A;  1YXW A;  4LO1 A;  1DFQ A;  3BAO A;  3VT2 A;  2UUS A;  5BXS A;  3FJH A;  4G6M A;  5F8W A;  2RG9 B;  1XG6 A;  2AXM A;  4IHZ A;  4IZX A;  4Q9G A;  3RTJ B;  2RQ9 A;  2FGF A;  1BA7 A;  3JUT A;  3MPP G;  2F2F A;  3WIN A;  3V0B B;  3B9U A;  4HA2 A;  4ZLB B;  2AAI B;  3AJ6 A;  5FZY A;  3QR5 A;  4YOL A;  4LO3 C;  1NZK A;  1S0E A;  1ISW A;  2HW9 A;  3O4D A;  3I2X A;  4END A;  4IYB A;  4XFS A;  1A8D A;  2Y9X E;  3S8K A;  1YTO A;  3V0B A;  1TTU A;  1II4 A;  1FV3 A;  3H6S E;  5BVP I;  2D24 A;  3I2A A;  2VUA A;  3K1X A;  2Z49 A;  3O4O A;  2R9K B;  4JKX B;  1AVU A;  2NM1 A;  3CA5 A;  4J23 B;  1AFC A;  1BFF A;  3UD9 A;  3LTQ A;  1T4Q A;  1DQG A;  1WD4 A;  3PHZ A;  4I0Y A;  4QKS A;  5F90 A;  5FZU A;  2D7I A;  2ET2 A;  3P6J A;  4CJM A;  4GOY A;  3HMY A;  4I6I A;  3WO3 A;  1QQK A;  2VU9 A;  4G1R A;  2D1Z A;  1XYF A;  2DRY A;  2ERM A;  4I4Y A;  4P6A A;  4EEE B;  3AKG A;  1S0L A;  4TLP A;  1J0S A;  1PC8 B;  3LLP A;  4KEI A;  1BFG A;  1G9B A;  4JP0 A;  1S0C A;  3BRF A;  4A7Y A;  2P23 A;  1W3G A;  1BAR A;  2QYI B;  2MIB A;  1IHK A;  4I8M A;  1S0F A;  4P0K A;  3H6R A;  1TWE A;  1IT0 A;  4OUJ A;  2FFV A;  5FNW A;  3WA1 A;  3RSJ A;  1TIE A;  2ZQO A;  3FFZ A;  4QD2 B;  3FJB A;  1FV2 A;  5EHA A;  3CRH A;  4X37 A;  3KMV A;  3CA4 A;  3FJC A;  31BI A;  2RST A;  5EG6 C;  1CE7 B;  2M49 A;  1V6W A;  2BEB A;  3JRR A;  1SR4 C;  3ZX7 A;  5DVH A;  4I2S A;  1DJS B;  3BA7 A;  1JQZ A;  3CA1 A;  3D7W B;  2NYY A;  21BI A;  1JT4 A;  5B2H A;  4I4U A;  5BXT A;  2KI4 A;  1MC9 A;  4ZBV B;  1Z4S A;  3A21 A;  4Z8S B;  1EV2 A;  5BXR A;  3V0A B;  4IQP A;  3FJE A;  2LIQ A;  1Z2V A;  3IM7 A;  2KKI A;  3IIR A;  4L4I A;  1DZD A;  1Q03 A;  1HCE A;  3WO4 A;  1FN0 A;  3N7J A;  2BFH A;  3FJ8 A;  3R4U A;  1W3F A;  3VEQ A;  4JQ0 A;  1FMM S;  1FGA A;  2MLL B;  1JT3 A;  2DRZ A;  4I96 A;  3AH1 A;  3V0A A;  4J2Y A;  2D44 A;  4DEN A;  3OBT A;  3Q7W A;  2KI6 B;  1JLX A;  4H9W A;  3N7K A;  3FJF A;  1ONK B;  4QAL A;  8I1B A;  5F8S A;  2DS0 A;  3A22 A;  4JPZ A;  5DZU A;  1JLY A;  1ISY A;  3NBC A;  4LO8 B;  3O5W B;  1DLL A;  2L5X A;  3FJJ A;  3BTA A;  2KH2 A;  1HWN B;  1AVW B;  3ZC8 A;  5BQU A;  1WBC A;  4QO3 A;  3H6Q A;  2YUG A;  4OW4 A;  1YBI A;  1DZC A;  3OJM A;  1AXM A;  2VSE A;  2K4A B;  3P53 A;  2AFG A;  2P39 A;  4LO2 A;  4LO0 A;  1HWO B;  4I37 A;  7I1B A;  3FUO A;  5BP5 A;  4I4O A;  3FUQ A;  3QYD A;  3Q7Y A;  4JRA A;  1K5V A;  1SZ6 B;  1E0O A;  1PWA A;  3UJ4 A;  9ILB A;  3VT1 A;  4OEE A;  1FWU A;  3CRG A;  3UDA A;  4GP3 A;  4G9M A;  4XFU A;  4GAF A;  1M2T B;  1VCL A;  4ZOT A;  1YF8 B;  1QQL A;  1RZO B;  2FO1 A;  4USP A;  2IWT B;  4F83 A;  1ITB A;  5D62 A;  3O44 A;  4KC3 A;  3HSM A;  1QXM A;  3HAL A;  3UD8 A;  4F34 A;  1GGP B;  4I4X A;  1G82 A;  3I29 B;  3N7M A;  4Q91 A;  1EPW A;  3IAG C;  4ISQ A;  2QN4 A;  2Y9G A;  3FJ9 A;  3MAL A;  5D61 A;  3BAD A;  4QBC A;  2ZR1 B;  1XZZ A;  1Q04 A;  1S0D A;  3PG0 A;  4LO7 B;  3AKF A;  4A7Z A;  1BLD A;  4P0J A;  4AN6 A;  1TOO A;  4EB2 B;  2NTD A;  3RMX A;  4ZFU B;  5FNX A;  2ESU A;  1IRP A;  3A07 A;  3VWC A;  3TC2 A;  4I7I A;  2VSA A;  2E4M A;  1ABR B;  4I3N A;  4LO1 C;  4ZFY B;  5F8Y A;  4OEG A;  3BX1 C;  3C9Z A;  4X39 A;  2Q9X A;  3P6I A;  2LIE A;  3BA4 A;  1UPS A;  3FJK A;  2F2F C;  1AVX B;  1ILR 1;  3WIN C;  1ISV A;  4GOV A;  1PUM B;  2GO2 A;  3E8L C;  5JMC A;  1IJT A;  2K8R A;  3NBE A;  2D20 A;  3UD7 A;  4G6J A;  1S0B A;  3OGG A;  1HCD A;  4IY9 A;  1AF9 A;  3FGM A;  1PZZ A;  3BRD A;  3AH4 A;  4LO3 A;  1WBA A;  2J3P A;  3A23 A;  4P0L A;  1TWM A;  1I1E A;  5D63 A;  2DRE A;  4D0T A;  3BB2 A;  3O3Q A;  1IIL A;  4QKR A;  1RML A;  1HIB A;  3O4C A;  3O49 A;  1ISX A;  3ZC9 A;  4DEP A;  3ZXD A;  4I1E A;  3BAQ A;  4X3A A;  4KEK A;  4I4R A;  1Z0H A;  2D7R A;  4Q9P A;  3VSZ A;  3N7L A;  1ISZ A;  4OEF A;  2IHO A;  3RTI B;  1IRA X;  3NBN A;  1W3A A;  4X38 A;  4ZGR B;  2WRY A;  1RY7 A;  1Q1U A;  1BLA A;  1M16 A;  2D22 A;  1FQ9 A;  4IY8 A;  4AN7 B;  3AZW A;  3CRI A;  2KLL A;  4FVV A;  2X2S A;  1IOB A;  2D43 A;  3BAV A;  2GZB A;  2Y9F A;  4L4H A;  3SNV A;  2I1B A;  2VXR A;  3HOM A;  2HZ9 A;  4JKQ A;  4QBV A;  1DIW A;  2VXT I;  3BRG C;  4HR6 C;  3N0K A;  4PC4 A;  6I1B A;  1JTC A;  2VLC A;  3F62 B;  1V6U A;  4EFQ A;  2F8X C;  3CA0 A;  2NP0 A;  1KNM A;  4EFR A;  1OQL B;  4I4V A;  1F31 A;  2Q3N B;  1JY0 A;  3EF2 A;  3FJA A;  4JAW A;  3VT0 A;  41BI A;  3HBW A; 
#chains in the Genus database with same CATH topology
 1EYL A;  4QD2 C;  1SR4 A;  1HWM B;  3BA5 A;  3HN1 A;  4KBB A;  1HKN A;  1RG8 A;  1S0G A;  3R4S A;  1XHB A;  2HWA A;  4XKI A;  1R8N A;  1P63 A;  1TFM B;  2MC2 A;  1EVT A;  3CA3 A;  3AZV A;  1NUN A;  2D23 A;  2FFU A;  4A7K A;  3WO2 A;  3POK A;  3RMY A;  5EC5 A;  3OBR A;  3AKI A;  4EFP A;  5DSS B;  4ZFW B;  4I1B A;  1BFC A;  3NJ5 A;  3FJI A;  1G9C A;  3WMU A;  4DCK C;  1V6V A;  1YYN A;  3AH2 A;  3AJ5 A;  1G9D A;  2AQZ A;  3IM5 A;  3CQA A;  3S8J A;  3V79 C;  3H6R B;  3T8S A;  4OWK A;  1T9F A;  1N4K A;  3ILA A;  2Y9W C;  5BQU C;  2K43 A;  1D0H A;  1L2H A;  1FMZ A;  5BXP A;  3FJD A;  5BOW A;  4LO0 C;  4LO2 C;  5FZZ A;  1JT5 A;  4J2X A;  4J2K A;  4ZKT B;  4EKX B;  4USO A;  5BP5 C;  4Z9W B;  4ION A;  4FGF A;  4GP0 A;  4HJJ A;  4MZG B;  3VUO A;  4UY4 A;  3BAU A;  5HPZ A;  3UJ0 A;  4IZE A;  4GAI A;  1BAS A;  2NVH A;  1I1B A;  4I4Q A;  3BAG A;  2X2T A;  3CU1 B;  3Q7X A;  1FWV A;  4ISR A;  3WMV A;  3OGF A;  4QC4 A;  3VSF A;  1G9A A;  3PUB A;  3NBD A;  3BAH A;  1R8O A;  3CA6 A;  3W9T A;  3F1R A;  2XOA A;  3IM6 A;  1K5U A;  4ZA3 B;  2FDB M;  5JLV A;  2Z48 A;  4KEJ A;  2WBC A;  3O4B A;  1JT7 A;  3ZXG A;  1CVS A;  1DQO A;  4WBC A;  5DUY A;  4I4P A;  1TP0 A;  4R6U B;  1WD3 A;  3PME A;  1HWP B;  1PUU B;  1BFB A;  3O4A A;  4G9N A;  4I4S A;  2ZQN A;  1V6X A;  3AKH A;  1AVA C;  4II0 A;  5G00 A;  5GAQ A;  4OWL A;  5I1B A;  2HWM A;  2BEA A;  4LO7 C;  4OWJ A;  2E4M C;  3CAH A;  4D8H A;  3OJV A;  1MD6 A;  2NZ9 A;  4H04 A;  4XFT A;  5E24 E;  3OJ2 A;  1DFC A;  4D0Z A;  4J2S A;  1YXW A;  4LO1 A;  1DFQ A;  3BAO A;  3VT2 A;  2UUS A;  5BXS A;  3FJH A;  4G6M A;  5F8W A;  2RG9 B;  1XG6 A;  2AXM A;  4IHZ A;  4IZX A;  4Q9G A;  3RTJ B;  2RQ9 A;  2FGF A;  1BA7 A;  3JUT A;  3MPP G;  2F2F A;  3WIN A;  3V0B B;  3B9U A;  4HA2 A;  4ZLB B;  2AAI B;  3AJ6 A;  5FZY A;  3QR5 A;  4YOL A;  4LO3 C;  1NZK A;  1S0E A;  1ISW A;  2HW9 A;  3O4D A;  3I2X A;  4END A;  4IYB A;  4XFS A;  1A8D A;  2Y9X E;  3S8K A;  1YTO A;  3V0B A;  1TTU A;  1II4 A;  1FV3 A;  3H6S E;  5BVP I;  2D24 A;  3I2A A;  2VUA A;  4MZF B;  3K1X A;  2Z49 A;  3O4O A;  2R9K B;  4JKX B;  1AVU A;  2NM1 A;  3CA5 A;  4J23 B;  1AFC A;  1BFF A;  3UD9 A;  3LTQ A;  1T4Q A;  1DQG A;  1WD4 A;  3PHZ A;  4I0Y A;  4QKS A;  5F90 A;  5FZU A;  2D7I A;  2ET2 A;  3P6J A;  4CJM A;  4GOY A;  3HMY A;  4I6I A;  3WO3 A;  1QQK A;  2VU9 A;  4G1R A;  2D1Z A;  1XYF A;  2DRY A;  2ERM A;  4I4Y A;  4P6A A;  4EEE B;  3AKG A;  1S0L A;  4TLP A;  1J0S A;  1PC8 B;  3LLP A;  4KEI A;  1BFG A;  1G9B A;  4JP0 A;  1S0C A;  3BRF A;  4A7Y A;  2P23 A;  1W3G A;  1BAR A;  2QYI B;  2MIB A;  1IHK A;  4I8M A;  1S0F A;  4P0K A;  3H6R A;  1TWE A;  1IT0 A;  4OUJ A;  2FFV A;  5FNW A;  3WA1 A;  3RSJ A;  1TIE A;  2ZQO A;  3FFZ A;  4QD2 B;  3FJB A;  1FV2 A;  5EHA A;  3CRH A;  4X37 A;  3KMV A;  3CA4 A;  3FJC A;  31BI A;  2RST A;  5EG6 C;  1CE7 B;  2M49 A;  1V6W A;  2BEB A;  3JRR A;  1SR4 C;  3ZX7 A;  5DVH A;  4I2S A;  1DJS B;  3BA7 A;  1JQZ A;  3CA1 A;  3D7W B;  2NYY A;  21BI A;  1JT4 A;  5B2H A;  4I4U A;  5BXT A;  2KI4 A;  1MC9 A;  4ZBV B;  1Z4S A;  3A21 A;  4Z8S B;  1EV2 A;  5BXR A;  3V0A B;  4IQP A;  3FJE A;  2LIQ A;  1Z2V A;  3IM7 A;  2KKI A;  3IIR A;  4L4I A;  1DZD A;  1Q03 A;  1HCE A;  3WO4 A;  1FN0 A;  3N7J A;  2BFH A;  3FJ8 A;  3R4U A;  1W3F A;  3VEQ A;  4JQ0 A;  1FMM S;  1FGA A;  2MLL B;  1JT3 A;  2DRZ A;  4I96 A;  3AH1 A;  3V0A A;  4J2Y A;  2D44 A;  4DEN A;  3OBT A;  3Q7W A;  2KI6 B;  1JLX A;  4H9W A;  3N7K A;  3FJF A;  1ONK B;  4QAL A;  8I1B A;  5F8S A;  2DS0 A;  3A22 A;  4JPZ A;  5DZU A;  1JLY A;  1ISY A;  3NBC A;  4LO8 B;  3O5W B;  1DLL A;  2L5X A;  3FJJ A;  3BTA A;  2KH2 A;  1HWN B;  1AVW B;  3ZC8 A;  5BQU A;  1WBC A;  4QO3 A;  3H6Q A;  2YUG A;  4OW4 A;  1YBI A;  1DZC A;  3OJM A;  1AXM A;  2VSE A;  2K4A B;  3P53 A;  2AFG A;  2P39 A;  4LO2 A;  4LO0 A;  1HWO B;  4I37 A;  7I1B A;  3FUO A;  5BP5 A;  4I4O A;  3FUQ A;  3QYD A;  3Q7Y A;  4JRA A;  1K5V A;  1SZ6 B;  1E0O A;  1PWA A;  3UJ4 A;  9ILB A;  3VT1 A;  4OEE A;  1FWU A;  3CRG A;  3UDA A;  4GP3 A;  4G9M A;  4XFU A;  4GAF A;  1M2T B;  1VCL A;  4ZOT A;  1YF8 B;  1QQL A;  1RZO B;  2FO1 A;  4USP A;  2IWT B;  4F83 A;  1ITB A;  5D62 A;  3O44 A;  4KC3 A;  3HSM A;  1QXM A;  3HAL A;  3UD8 A;  4F34 A;  1GGP B;  4I4X A;  1G82 A;  3I29 B;  3N7M A;  4Q91 A;  1EPW A;  3IAG C;  4ISQ A;  2QN4 A;  2Y9G A;  3FJ9 A;  3MAL A;  5D61 A;  3BAD A;  4QBC A;  2ZR1 B;  1XZZ A;  1Q04 A;  1S0D A;  3PG0 A;  4LO7 B;  3AKF A;  4A7Z A;  1BLD A;  4P0J A;  4AN6 A;  1TOO A;  4EB2 B;  2NTD A;  3RMX A;  4ZFU B;  5FNX A;  2ESU A;  1IRP A;  3A07 A;  3VWC A;  3TC2 A;  4I7I A;  2VSA A;  2E4M A;  1ABR B;  4I3N A;  4LO1 C;  4ZFY B;  5F8Y A;  4OEG A;  3BX1 C;  3C9Z A;  4X39 A;  2Q9X A;  3P6I A;  2LIE A;  3BA4 A;  1UPS A;  3FJK A;  2F2F C;  1AVX B;  1ILR 1;  3WIN C;  1ISV A;  4GOV A;  1PUM B;  2GO2 A;  3E8L C;  5JMC A;  1IJT A;  2K8R A;  3NBE A;  2D20 A;  3UD7 A;  4G6J A;  4H75 A;  1S0B A;  3OGG A;  1HCD A;  4IY9 A;  1AF9 A;  3FGM A;  1PZZ A;  3BRD A;  3AH4 A;  4LO3 A;  1WBA A;  2J3P A;  3A23 A;  4P0L A;  1TWM A;  1I1E A;  5D63 A;  2DRE A;  4D0T A;  3BB2 A;  3O3Q A;  1IIL A;  4QKR A;  1RML A;  1HIB A;  3O4C A;  3O49 A;  1ISX A;  3ZC9 A;  4DEP A;  3ZXD A;  4I1E A;  3BAQ A;  4X3A A;  4KEK A;  4I4R A;  1Z0H A;  2D7R A;  4Q9P A;  3VSZ A;  3N7L A;  1ISZ A;  4OEF A;  2IHO A;  3RTI B;  1IRA X;  3NBN A;  1W3A A;  4X38 A;  4ZGR B;  2WRY A;  1RY7 A;  1Q1U A;  1BLA A;  1M16 A;  2D22 A;  1FQ9 A;  4IY8 A;  4AN7 B;  3AZW A;  3CRI A;  2KLL A;  4FVV A;  2X2S A;  4MZH A;  1IOB A;  2D43 A;  3BAV A;  2GZB A;  2Y9F A;  2NS2 A;  4L4H A;  3SNV A;  2I1B A;  2VXR A;  3HOM A;  2HZ9 A;  4JKQ A;  4QBV A;  1DIW A;  2VXT I;  3BRG C;  4HR6 C;  3N0K A;  4PC4 A;  6I1B A;  1JTC A;  2VLC A;  3F62 B;  1V6U A;  4EFQ A;  2F8X C;  3CA0 A;  2NP0 A;  1KNM A;  4EFR A;  1OQL B;  4I4V A;  1F31 A;  2Q3N B;  1JY0 A;  3EF2 A;  3FJA A;  4JAW A;  3VT0 A;  41BI A;  3HBW A; 
#chains in the Genus database with same CATH homology
 1EYL A;  4QD2 C;  1SR4 A;  1HWM B;  3BA5 A;  3HN1 A;  4KBB A;  1HKN A;  1RG8 A;  1S0G A;  3R4S A;  1XHB A;  2HWA A;  4XKI A;  1R8N A;  1P63 A;  1TFM B;  2MC2 A;  1EVT A;  3CA3 A;  3AZV A;  1NUN A;  2D23 A;  2FFU A;  4A7K A;  3WO2 A;  3POK A;  3RMY A;  5EC5 A;  3OBR A;  3AKI A;  4EFP A;  5DSS B;  4ZFW B;  4I1B A;  1BFC A;  3NJ5 A;  3FJI A;  1G9C A;  3WMU A;  4DCK C;  1V6V A;  1YYN A;  3AH2 A;  3AJ5 A;  1G9D A;  2AQZ A;  3IM5 A;  3CQA A;  3S8J A;  3V79 C;  3H6R B;  3T8S A;  4OWK A;  1T9F A;  1N4K A;  3ILA A;  2Y9W C;  5BQU C;  2K43 A;  1D0H A;  1L2H A;  1FMZ A;  5BXP A;  3FJD A;  5BOW A;  4LO0 C;  4LO2 C;  5FZZ A;  1JT5 A;  4J2X A;  4J2K A;  4ZKT B;  4EKX B;  4USO A;  5BP5 C;  4Z9W B;  4ION A;  4FGF A;  4GP0 A;  4HJJ A;  4MZG B;  3VUO A;  4UY4 A;  3BAU A;  5HPZ A;  3UJ0 A;  4IZE A;  4GAI A;  1BAS A;  2NVH A;  1I1B A;  4I4Q A;  3BAG A;  2X2T A;  3CU1 B;  3Q7X A;  1FWV A;  4ISR A;  3WMV A;  3OGF A;  4QC4 A;  3VSF A;  1G9A A;  3PUB A;  3NBD A;  3BAH A;  1R8O A;  3CA6 A;  3W9T A;  3F1R A;  2XOA A;  3IM6 A;  1K5U A;  4ZA3 B;  2FDB M;  5JLV A;  2Z48 A;  4KEJ A;  2WBC A;  3O4B A;  1JT7 A;  3ZXG A;  1CVS A;  1DQO A;  4WBC A;  5DUY A;  4I4P A;  1TP0 A;  4R6U B;  1WD3 A;  3PME A;  1HWP B;  1PUU B;  1BFB A;  3O4A A;  4G9N A;  4I4S A;  2ZQN A;  1V6X A;  3AKH A;  1AVA C;  4II0 A;  5G00 A;  5GAQ A;  4OWL A;  5I1B A;  2HWM A;  2BEA A;  4LO7 C;  4OWJ A;  2E4M C;  3CAH A;  4D8H A;  3OJV A;  1MD6 A;  2NZ9 A;  4H04 A;  4XFT A;  5E24 E;  3OJ2 A;  1DFC A;  4D0Z A;  4J2S A;  1YXW A;  4LO1 A;  1DFQ A;  3BAO A;  3VT2 A;  2UUS A;  5BXS A;  3FJH A;  4G6M A;  5F8W A;  2RG9 B;  1XG6 A;  2AXM A;  4IHZ A;  4IZX A;  4Q9G A;  3RTJ B;  2RQ9 A;  2FGF A;  1BA7 A;  3JUT A;  3MPP G;  2F2F A;  3WIN A;  3V0B B;  3B9U A;  4HA2 A;  4ZLB B;  2AAI B;  3AJ6 A;  5FZY A;  3QR5 A;  4YOL A;  4LO3 C;  1NZK A;  1S0E A;  1ISW A;  2HW9 A;  3O4D A;  3I2X A;  4END A;  4IYB A;  4XFS A;  1A8D A;  2Y9X E;  3S8K A;  1YTO A;  3V0B A;  1TTU A;  1II4 A;  1FV3 A;  3H6S E;  5BVP I;  2D24 A;  3I2A A;  2VUA A;  4MZF B;  3K1X A;  2Z49 A;  3O4O A;  2R9K B;  4JKX B;  1AVU A;  2NM1 A;  3CA5 A;  4J23 B;  1AFC A;  1BFF A;  3UD9 A;  3LTQ A;  1T4Q A;  1DQG A;  1WD4 A;  3PHZ A;  4I0Y A;  4QKS A;  5F90 A;  5FZU A;  2D7I A;  2ET2 A;  3P6J A;  4CJM A;  4GOY A;  3HMY A;  4I6I A;  3WO3 A;  1QQK A;  2VU9 A;  4G1R A;  2D1Z A;  1XYF A;  2DRY A;  2ERM A;  4I4Y A;  4P6A A;  4EEE B;  3AKG A;  1S0L A;  4TLP A;  1J0S A;  1PC8 B;  3LLP A;  4KEI A;  1BFG A;  1G9B A;  4JP0 A;  1S0C A;  3BRF A;  4A7Y A;  2P23 A;  1W3G A;  1BAR A;  2QYI B;  2MIB A;  1IHK A;  4I8M A;  1S0F A;  4P0K A;  3H6R A;  1TWE A;  1IT0 A;  4OUJ A;  2FFV A;  5FNW A;  3WA1 A;  3RSJ A;  1TIE A;  2ZQO A;  3FFZ A;  4QD2 B;  3FJB A;  1FV2 A;  5EHA A;  3CRH A;  4X37 A;  3KMV A;  3CA4 A;  3FJC A;  31BI A;  2RST A;  5EG6 C;  1CE7 B;  2M49 A;  1V6W A;  2BEB A;  3JRR A;  1SR4 C;  3ZX7 A;  5DVH A;  4I2S A;  1DJS B;  3BA7 A;  1JQZ A;  3CA1 A;  3D7W B;  2NYY A;  21BI A;  1JT4 A;  5B2H A;  4I4U A;  5BXT A;  2KI4 A;  1MC9 A;  4ZBV B;  1Z4S A;  3A21 A;  4Z8S B;  1EV2 A;  5BXR A;  3V0A B;  4IQP A;  3FJE A;  2LIQ A;  1Z2V A;  3IM7 A;  2KKI A;  3IIR A;  4L4I A;  1DZD A;  1Q03 A;  1HCE A;  3WO4 A;  1FN0 A;  3N7J A;  2BFH A;  3FJ8 A;  3R4U A;  1W3F A;  3VEQ A;  4JQ0 A;  1FMM S;  1FGA A;  2MLL B;  1JT3 A;  2DRZ A;  4I96 A;  3AH1 A;  3V0A A;  4J2Y A;  2D44 A;  4DEN A;  3OBT A;  3Q7W A;  2KI6 B;  1JLX A;  4H9W A;  3N7K A;  3FJF A;  1ONK B;  4QAL A;  8I1B A;  5F8S A;  2DS0 A;  3A22 A;  4JPZ A;  5DZU A;  1JLY A;  1ISY A;  3NBC A;  4LO8 B;  3O5W B;  1DLL A;  2L5X A;  3FJJ A;  3BTA A;  2KH2 A;  1HWN B;  1AVW B;  3ZC8 A;  5BQU A;  1WBC A;  4QO3 A;  3H6Q A;  2YUG A;  4OW4 A;  1YBI A;  1DZC A;  3OJM A;  1AXM A;  2VSE A;  2K4A B;  3P53 A;  2AFG A;  2P39 A;  4LO2 A;  4LO0 A;  1HWO B;  4I37 A;  7I1B A;  3FUO A;  5BP5 A;  4I4O A;  3FUQ A;  3QYD A;  3Q7Y A;  4JRA A;  1K5V A;  1SZ6 B;  1E0O A;  1PWA A;  3UJ4 A;  9ILB A;  3VT1 A;  4OEE A;  1FWU A;  3CRG A;  3UDA A;  4GP3 A;  4G9M A;  4XFU A;  4GAF A;  1M2T B;  1VCL A;  4ZOT A;  1YF8 B;  1QQL A;  1RZO B;  2FO1 A;  4USP A;  2IWT B;  4F83 A;  1ITB A;  5D62 A;  3O44 A;  4KC3 A;  3HSM A;  1QXM A;  3HAL A;  3UD8 A;  4F34 A;  1GGP B;  4I4X A;  1G82 A;  3I29 B;  3N7M A;  4Q91 A;  1EPW A;  3IAG C;  4ISQ A;  2QN4 A;  2Y9G A;  3FJ9 A;  3MAL A;  5D61 A;  3BAD A;  4QBC A;  2ZR1 B;  1XZZ A;  1Q04 A;  1S0D A;  3PG0 A;  4LO7 B;  3AKF A;  4A7Z A;  1BLD A;  4P0J A;  4AN6 A;  1TOO A;  4EB2 B;  2NTD A;  3RMX A;  4ZFU B;  5FNX A;  2ESU A;  1IRP A;  3A07 A;  3VWC A;  3TC2 A;  4I7I A;  2VSA A;  2E4M A;  1ABR B;  4I3N A;  4LO1 C;  4ZFY B;  5F8Y A;  4OEG A;  3BX1 C;  3C9Z A;  4X39 A;  2Q9X A;  3P6I A;  2LIE A;  3BA4 A;  1UPS A;  3FJK A;  2F2F C;  1AVX B;  1ILR 1;  3WIN C;  1ISV A;  4GOV A;  1PUM B;  2GO2 A;  3E8L C;  5JMC A;  1IJT A;  2K8R A;  3NBE A;  2D20 A;  3UD7 A;  4G6J A;  4H75 A;  1S0B A;  3OGG A;  1HCD A;  4IY9 A;  1AF9 A;  3FGM A;  1PZZ A;  3BRD A;  3AH4 A;  4LO3 A;  1WBA A;  2J3P A;  3A23 A;  4P0L A;  1TWM A;  1I1E A;  5D63 A;  2DRE A;  4D0T A;  3BB2 A;  3O3Q A;  1IIL A;  4QKR A;  1RML A;  1HIB A;  3O4C A;  3O49 A;  1ISX A;  3ZC9 A;  4DEP A;  3ZXD A;  4I1E A;  3BAQ A;  4X3A A;  4KEK A;  4I4R A;  1Z0H A;  2D7R A;  4Q9P A;  3VSZ A;  3N7L A;  1ISZ A;  4OEF A;  2IHO A;  3RTI B;  1IRA X;  3NBN A;  1W3A A;  4X38 A;  4ZGR B;  2WRY A;  1RY7 A;  1Q1U A;  1BLA A;  1M16 A;  2D22 A;  1FQ9 A;  4IY8 A;  4AN7 B;  3AZW A;  3CRI A;  2KLL A;  4FVV A;  2X2S A;  4MZH A;  1IOB A;  2D43 A;  3BAV A;  2GZB A;  2Y9F A;  2NS2 A;  4L4H A;  3SNV A;  2I1B A;  2VXR A;  3HOM A;  2HZ9 A;  4JKQ A;  4QBV A;  1DIW A;  2VXT I;  3BRG C;  4HR6 C;  3N0K A;  4PC4 A;  6I1B A;  1JTC A;  2VLC A;  3F62 B;  1V6U A;  4EFQ A;  2F8X C;  3CA0 A;  2NP0 A;  1KNM A;  4EFR A;  1OQL B;  4I4V A;  1F31 A;  2Q3N B;  1JY0 A;  3EF2 A;  3FJA A;  4JAW A;  3VT0 A;  41BI A;  3HBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...