3O4AA

Crystal structure of symfoil-2: de novo designed beta-trefoil architecture with symmetric primary structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
123
structure length
123
Chain Sequence
PVLLKSTETGQYLRINPDGTVDGTRDRSDQHIQFQISPEGGGEVLLKSTETGQYLRINPDGTVDGTRDRSDQHIQFQISPEGGGEVLLKSTETGQYLRINPDGTVDGTRDRSDQHIQFQISPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental support for the evolution of symmetric protein architecture from a simple peptide motif.
pubmed doi rcsb
molecule keywords de novo designed beta-trefoil architecture with symmetric pr
molecule tags De novo protein
source organism Synthetic construct
total genus 34
structure length 123
sequence length 123
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3o4aA00
1AVWB 1Q1UA 3ZC9A 1K5VA 1WBCA 2D1ZA 3RSJA 2NZ9A 3BAOA 3VEQA 3HSMA 2YUGA 4LO0C 4IQPA 3N7MA 4FGFA 3AKHA 4GOVA 1V6UA 2AXMA 4LO3C 3K1XA 3AKFA 4X38A 2ZR1B 2NM1A 4A7KA 4KBBA 1QXMA 4I4UA 5FNXA 3OBRA 4Q9PA 4IYBA 3A07A 3MALA 4ZFUB 2VLCA 4G6MA 1G82A 3PUBA 1ISVA 1QQKA 1R8NA 3CA1A 3P6IA 2FO1A 4JKXB 1L2HA 3BB2A 1EPWA 5JLVA 1S0FA 4EFPA 1WD4A 2MIBA 1S0GA 3A22A 4IY9A 1J0SA 3OGGA 3WMVA 1R8OA 3VUOA 3CA4A 1UPSA 1HWOB 4LO1C 3O5WB 2HZ9A 2NP0A 2KI6B 4H9WA 1DFCA 1IRPA 3S8JA 4L4HA 1BARA 1ISYA 3V0AB 1S0EA 3BAUA 2ZQOA 4DCKC 4J23B 3N7KA 2DRZA 3O4OA 2D20A 2K8RA 3MPPG 2AAIB 1XZZA 2R9KB 3FJKA 4FVVA 3W9TA 4IZEA 2D22A 2D23A 3CA6A 4I6IA 2VXRA 2NVHA 3WINA 5DUYA 2IHOA 3R4SA 4R6UB 2K43A 3WO4A 1FV2A 3AKIA 1PWAA 1VCLA 2FGFA 5EG6C 4QBCA 3H6QA 1YTOA 3AJ5A 4G6JA 3VT1A 1HKNA 4F34A 2D7RA 1PUUB 3BX1C 5F8SA 5D62A 3PG0A 2KKIA 2L5XA 3BAHA 3BA4A 2KLLA 1II4A 2VSEA 2D7IA 1RZOB 3I2AA 5FZZA 3CA3A 4GP3A 3HOMA 1JT7A 1TIEA 4I4YA 1BLAA 5F8WA 3HBWA 3FJ8A 41BIA 1MD6A 4OEEA 5BXTA 3BTAA 1K5UA 2HW9A 2RQ9A 2AFGA 2X2SA 3V0BA 1FMZA 1M16A 4OWKA 5D63A 5E24E 3BA5A 4I4SA 4I37A 5DVHA 4DENA 21BIA 3IM7A 4I4OA 2Z49A 2P23A 4GOYA 2VU9A 4P6AA 1G9AA 2MC2A 1F31A 1P63A 2DRYA 3CU1B 5BQUC 2Q3NB 6I1BA 1EV2A 1IT0A 9ILBA 4IY8A 4KEIA 1YBIA 4OUJA 3F62B 5JMCA 1BLDA 3UD8A 3H6RB 3C9ZA 1DIWA 1IILA 1A8DA 3Q7YA 1NUNA 4G1RA 3EF2A 3CRGA 4I4RA 1XYFA 3O4BA 1T4QA 1AF9A 1SR4C 4J2KA 3V79C 1S0BA 3FJEA 1XHBA 3BAGA 1YYNA 3UDAA 5BP5C 1JT4A 3FGMA 2UUSA 3AH4A 1AVAC 1V6XA 4D8HA 2BFHA 3FFZA 4WBCA 4IZXA 1JQZA 3QR5A 2LIEA 7I1BA 2D24A 3N0KA 4OWLA 3CAHA 3E8LC 1G9DA 3JRRA 3RTIB 3ZC8A 3V0AA 1BFCA 1QQLA 3CRIA 1ABRB 1AFCA 1YXWA 3NJ5A 1XG6A 3AH1A 2VSAA 4ISQA 3BRFA 3AKGA 1S0LA 5BVPI 3O49A 1G9BA 4QO3A 1FWUA 3IM6A 3P6JA 1FV3A 1G9CA 1JTCA 2VUAA 4HJJA 1AXMA 4H04A 2F2FC 4EFRA 2KI4A 3OJVA 2Y9XE 4I4XA 4GAIA 1FMMS 1TWEA 3OBTA 4G9NA 1W3FA 2RSTA 3FJJA 3VSZA 1CE7B 4I8MA 3AZVA 4J2SA 5HPZA 2IWTB 1ILR1 1HWNB 4TLPA 4ZA3B 3A21A 3P53A 3ZX7A 3O3QA 4USPA 3TC2A 3WA1A 4JAWA 2WRYA 4ZOTA 3UJ4A 4I2SA 3AZWA 4D0TA 1FN0A 1HIBA 1JLXA 4ISRA 31BIA 4USOA 3JUTA 4XKIA 3RMYA 5BXRA 4I4PA 1HCDA 4I4VA 2ERMA 4EB2B 1PC8B 3FJAA 2X2TA 3IM5A 2AQZA 4LO2A 4J2XA 1TP0A 4ZFWB 1YF8B 3RTJB 3LTQA 4P0LA 5EC5A 1JT3A 1JY0A 4HR6C 1EVTA 4KEJA 4Z8SB 4LO8B 4P0KA 3FJFA 1BFBA 1ONKB 1JLYA 1TOOA 1Z0HA 3BAVA 1ISZA 3VSFA 4LO0A 3HN1A 5FZUA 1SZ6B 5FNWA 3AJ6A 3FJDA 4LO3A 3BRDA 3S8KA 1IOBA 3CA5A 2MLLB 4YOLA 3H6RA 4OW4A 4DEPA 1HWPB 1BA7A 5D61A 4I3NA 3IIRA 2NYYA 4QD2C 3WINC 4X37A 3UD9A 2DS0A 2P39A 3UD7A 4QC4A 2QYIB 1D0HA 3AH2A 3CRHA 3I29B 1FGAA 3FUOA 4A7YA 1BFFA 4X3AA 2K4AB 4OWJA 2DREA 2GZBA 4ENDA 2ZQNA 4KC3A 5DZUA 4LO1A 1Z4SA 4P0JA 2F2FA 3T8SA 4PC4A 1GGPB 2FDBM 2Y9GA 3FUQA 3CQAA 2FFVA 1DZCA 1S0CA 4KEKA 1PUMB 3I2XA 5GAQA 1V6WA 2FFUA 3OJMA 4OEGA 3ZXDA 5BOWA 1DLLA 1ITBA 3POKA 3N7JA 3F1RA 3KMVA 5BXSA 1N4KA 1BFGA 3Q7WA 3VT2A 1MC9A 2LIQA 1TWMA 3OGFA 1FWVA 4G9MA 3FJCA 1TTUA 3ILAA 4EFQA 3QYDA 4OEFA 2BEBA 3WO2A 1IRAX 4I7IA 2E4MC 4A7ZA 3O4CA 4AN6A 2ET2A 1BASA 2I1BA 1NZKA 3R4UA 4L4IA 5B2HA 3WO3A 3NBDA 2Q9XA 3FJ9A 1JT5A 1TFMB 4CJMA 1DZDA 4QBVA 3O4AA 1V6VA 5BXPA 4II0A 1I1EA 3NBEA 4Z9WB 8I1BA 4I96A 4JKQA 3UJ0A 3VWCA 2HWMA 4LO7B 2F8XC 4EEEB 3Q7XA 3BRGC 4ZKTB 3FJBA 3NBCA 4QALA 3N7LA 5I1BA 1Q04A 3O44A 4JPZA 2M49A 3A23A 1S0DA 4LO7C 2KH2A 4ZBVB 5BQUA 2NTDA 4GAFA 5F90A 1Q03A 4HA2A 2BEAA 4I1EA 2D43A 5G00A 4ZLBB 3B9UA 4I0YA 2HWAA 1KNMA 3PMEA 1DFQA 4JQ0A 4QKRA 5FZYA 2D44A 1DQOA 1AVXB 4J2YA 3BAQA 1AVUA 1E0OA 3SNVA 3VT0A 2Y9WC 1ISWA 2Z48A 3IAGC 4AN7B 3LLPA 3H6SE 4GP0A 4QD2B 4Q91A 2ESUA 3CA0A 2Y9FA 1SR4A 1IJTA 3ZXGA 1DQGA 2QN4A 1IHKA 2GO2A 4JRAA 1CVSA 5BP5A 1EYLA 1M2TB 3HALA 1DJSB 4ZFYB 1HCEA 3WMUA 3D7WB 4XFTA 4QKSA 4F83A 1W3AA 1PZZA 4ZGRB 1WBAA 1I1BA 5F8YA 1OQLB 3RMXA 1Z2VA 1ISXA 4EKXB 3OJ2A 3FJHA 4XFSA 4Q9GA 3HMYA 1W3GA 2VXTI 2J3PA 4D0ZA 1WD3A 3O4DA 3NBNA 3BA7A 4X39A 5DSSB 1T9FA 1HWMB 1FQ9A 2RG9B 4LO2C 4I1BA 4I4QA 3V0BB 2WBCA 5EHAA 4XFUA 2E4MA 1RMLA 4JP0A 3PHZA 4IONA 4IHZA 2XOAA 3BADA 3FJIA 1RG8A 1RY7A
chains in the Genus database with same CATH superfamily
1AVWB 1Q1UA 3ZC9A 1K5VA 1WBCA 2D1ZA 3RSJA 2NZ9A 3BAOA 3VEQA 3HSMA 2YUGA 4LO0C 4IQPA 3N7MA 4FGFA 3AKHA 4GOVA 1V6UA 2AXMA 4LO3C 3K1XA 3AKFA 4X38A 2ZR1B 2NM1A 4A7KA 4KBBA 1QXMA 4I4UA 5FNXA 3OBRA 4Q9PA 4IYBA 3A07A 3MALA 4ZFUB 2VLCA 4G6MA 1G82A 3PUBA 1ISVA 1QQKA 1R8NA 3CA1A 4MZHA 3P6IA 2FO1A 4JKXB 1L2HA 3BB2A 1EPWA 5JLVA 1S0FA 4EFPA 1WD4A 2MIBA 1S0GA 3A22A 4IY9A 1J0SA 3OGGA 3WMVA 1R8OA 3VUOA 3CA4A 1UPSA 1HWOB 4LO1C 3O5WB 2HZ9A 2NP0A 2KI6B 4H9WA 1DFCA 1IRPA 3S8JA 4L4HA 1BARA 1ISYA 3V0AB 1S0EA 3BAUA 2ZQOA 4DCKC 4J23B 3N7KA 2DRZA 3O4OA 2D20A 2K8RA 3MPPG 2AAIB 1XZZA 2R9KB 3FJKA 4FVVA 3W9TA 4IZEA 2D22A 2D23A 3CA6A 4I6IA 2VXRA 2NVHA 3WINA 5DUYA 2IHOA 3R4SA 4R6UB 2K43A 3WO4A 1FV2A 3AKIA 1PWAA 1VCLA 2FGFA 5EG6C 4QBCA 3H6QA 1YTOA 3AJ5A 4G6JA 3VT1A 1HKNA 4F34A 2D7RA 1PUUB 3BX1C 5F8SA 5D62A 3PG0A 2KKIA 2L5XA 3BAHA 3BA4A 2KLLA 1II4A 2VSEA 2D7IA 1RZOB 3I2AA 4MZFB 5FZZA 3CA3A 4GP3A 3HOMA 1JT7A 1TIEA 4I4YA 1BLAA 5F8WA 3HBWA 3FJ8A 41BIA 1MD6A 4OEEA 5BXTA 3BTAA 1K5UA 2HW9A 2RQ9A 2AFGA 2X2SA 3V0BA 1FMZA 1M16A 4OWKA 5D63A 5E24E 3BA5A 4I4SA 4I37A 5DVHA 4DENA 21BIA 3IM7A 4I4OA 2Z49A 2P23A 4GOYA 2VU9A 4P6AA 1G9AA 2MC2A 1F31A 1P63A 2DRYA 3CU1B 5BQUC 2Q3NB 6I1BA 1EV2A 1IT0A 9ILBA 4IY8A 4KEIA 1YBIA 4OUJA 3F62B 5JMCA 1BLDA 3UD8A 3H6RB 3C9ZA 1DIWA 1IILA 1A8DA 3Q7YA 1NUNA 4G1RA 3EF2A 3CRGA 4I4RA 1XYFA 3O4BA 1T4QA 1AF9A 1SR4C 4J2KA 3V79C 1S0BA 3FJEA 1XHBA 3BAGA 1YYNA 3UDAA 5BP5C 1JT4A 3FGMA 2UUSA 3AH4A 1AVAC 1V6XA 4D8HA 2BFHA 3FFZA 4WBCA 4IZXA 1JQZA 3QR5A 2LIEA 4H75A 7I1BA 2D24A 3N0KA 4OWLA 3CAHA 3E8LC 1G9DA 3JRRA 3RTIB 3ZC8A 3V0AA 1BFCA 1QQLA 3CRIA 1ABRB 1AFCA 1YXWA 3NJ5A 1XG6A 3AH1A 2VSAA 4ISQA 3BRFA 3AKGA 1S0LA 5BVPI 3O49A 1G9BA 4QO3A 1FWUA 3IM6A 3P6JA 1FV3A 1G9CA 1JTCA 2VUAA 4HJJA 1AXMA 4H04A 2F2FC 4EFRA 2KI4A 3OJVA 2Y9XE 4I4XA 4GAIA 1FMMS 1TWEA 3OBTA 4G9NA 1W3FA 2RSTA 3FJJA 3VSZA 1CE7B 4I8MA 3AZVA 4J2SA 5HPZA 2IWTB 1ILR1 1HWNB 4TLPA 4ZA3B 3A21A 3P53A 3ZX7A 3O3QA 4USPA 3TC2A 3WA1A 4JAWA 2WRYA 4ZOTA 3UJ4A 2NS2A 4I2SA 3AZWA 4D0TA 1FN0A 1HIBA 1JLXA 4ISRA 31BIA 4USOA 3JUTA 4XKIA 3RMYA 5BXRA 4I4PA 4UY4A 1HCDA 4I4VA 2ERMA 4EB2B 1PC8B 3FJAA 2X2TA 3IM5A 2AQZA 4LO2A 4J2XA 1TP0A 4ZFWB 1YF8B 3RTJB 3LTQA 4P0LA 5EC5A 1JT3A 1JY0A 4HR6C 1EVTA 4KEJA 4Z8SB 4LO8B 4P0KA 3FJFA 1BFBA 1ONKB 1JLYA 1TOOA 1Z0HA 3BAVA 1ISZA 3VSFA 4LO0A 3HN1A 5FZUA 1SZ6B 5FNWA 3AJ6A 3FJDA 4LO3A 3BRDA 3S8KA 1IOBA 3CA5A 2MLLB 4YOLA 3H6RA 4OW4A 4DEPA 1HWPB 1BA7A 5D61A 4I3NA 3IIRA 2NYYA 4QD2C 3WINC 4X37A 3UD9A 2DS0A 2P39A 3UD7A 4QC4A 2QYIB 1D0HA 3AH2A 3CRHA 3I29B 1FGAA 3FUOA 4A7YA 1BFFA 4X3AA 2K4AB 4OWJA 2DREA 2GZBA 4ENDA 2ZQNA 4KC3A 5DZUA 4LO1A 1Z4SA 4P0JA 2F2FA 3T8SA 4PC4A 1GGPB 2FDBM 2Y9GA 3FUQA 3CQAA 2FFVA 1DZCA 1S0CA 4KEKA 1PUMB 3I2XA 5GAQA 1V6WA 2FFUA 3OJMA 4OEGA 3ZXDA 5BOWA 1DLLA 1ITBA 3POKA 3N7JA 3F1RA 3KMVA 5BXSA 1N4KA 1BFGA 3Q7WA 3VT2A 1MC9A 2LIQA 1TWMA 3OGFA 1FWVA 4G9MA 3FJCA 1TTUA 3ILAA 4EFQA 3QYDA 4OEFA 2BEBA 3WO2A 1IRAX 4I7IA 2E4MC 4A7ZA 3O4CA 4AN6A 2ET2A 1BASA 2I1BA 1NZKA 3R4UA 4L4IA 5B2HA 3WO3A 3NBDA 2Q9XA 3FJ9A 1JT5A 1TFMB 4CJMA 1DZDA 4QBVA 3O4AA 1V6VA 5BXPA 4II0A 1I1EA 3NBEA 4Z9WB 8I1BA 4I96A 4JKQA 3UJ0A 3VWCA 2HWMA 4LO7B 2F8XC 4EEEB 3Q7XA 3BRGC 4ZKTB 3FJBA 3NBCA 4QALA 3N7LA 5I1BA 1Q04A 3O44A 4JPZA 2M49A 3A23A 1S0DA 4LO7C 2KH2A 4ZBVB 5BQUA 2NTDA 4GAFA 5F90A 1Q03A 4HA2A 2BEAA 4I1EA 2D43A 5G00A 4ZLBB 3B9UA 4I0YA 2HWAA 1KNMA 3PMEA 1DFQA 4JQ0A 4QKRA 5FZYA 2D44A 1DQOA 1AVXB 4J2YA 3BAQA 1AVUA 1E0OA 3SNVA 3VT0A 2Y9WC 1ISWA 2Z48A 3IAGC 4AN7B 3LLPA 3H6SE 4GP0A 4QD2B 4Q91A 2ESUA 3CA0A 2Y9FA 1SR4A 1IJTA 3ZXGA 1DQGA 2QN4A 1IHKA 2GO2A 4JRAA 1CVSA 5BP5A 1EYLA 1M2TB 3HALA 1DJSB 4ZFYB 1HCEA 3WMUA 3D7WB 4XFTA 4QKSA 4F83A 1W3AA 1PZZA 4ZGRB 1WBAA 1I1BA 5F8YA 1OQLB 3RMXA 1Z2VA 1ISXA 4EKXB 3OJ2A 3FJHA 4MZGB 4XFSA 4Q9GA 3HMYA 1W3GA 2VXTI 2J3PA 4D0ZA 1WD3A 3O4DA 3NBNA 3BA7A 4X39A 5DSSB 1T9FA 1HWMB 1FQ9A 2RG9B 4LO2C 4I1BA 4I4QA 3V0BB 2WBCA 5EHAA 4XFUA 2E4MA 1RMLA 4JP0A 3PHZA 4IONA 4IHZA 2XOAA 3BADA 3FJIA 1RG8A 1RY7A
chains in the Genus database with same CATH topology
1AVWB 1Q1UA 3ZC9A 1K5VA 1WBCA 2D1ZA 3RSJA 2NZ9A 3BAOA 3VEQA 3HSMA 2YUGA 4LO0C 4IQPA 3N7MA 4FGFA 3AKHA 4GOVA 1V6UA 2AXMA 4LO3C 3K1XA 3AKFA 4X38A 2ZR1B 2NM1A 4A7KA 4KBBA 1QXMA 4I4UA 5FNXA 3OBRA 4Q9PA 4IYBA 3A07A 3MALA 4ZFUB 2VLCA 4G6MA 1G82A 3PUBA 1ISVA 1QQKA 1R8NA 3CA1A 4MZHA 3P6IA 2FO1A 4JKXB 1L2HA 3BB2A 1EPWA 5JLVA 1S0FA 4EFPA 1WD4A 2MIBA 1S0GA 3A22A 4IY9A 1J0SA 3OGGA 3WMVA 1R8OA 3VUOA 3CA4A 1UPSA 1HWOB 4LO1C 3O5WB 2HZ9A 2NP0A 2KI6B 4H9WA 1DFCA 1IRPA 3S8JA 4L4HA 1BARA 1ISYA 3V0AB 1S0EA 3BAUA 2ZQOA 4DCKC 4J23B 3N7KA 2DRZA 3O4OA 2D20A 2K8RA 3MPPG 2AAIB 1XZZA 2R9KB 3FJKA 4FVVA 3W9TA 4IZEA 2D22A 2D23A 3CA6A 4I6IA 2VXRA 2NVHA 3WINA 5DUYA 2IHOA 3R4SA 4R6UB 2K43A 3WO4A 1FV2A 3AKIA 1PWAA 1VCLA 2FGFA 5EG6C 4QBCA 3H6QA 1YTOA 3AJ5A 4G6JA 3VT1A 1HKNA 4F34A 2D7RA 1PUUB 3BX1C 5F8SA 5D62A 3PG0A 2KKIA 2L5XA 3BAHA 3BA4A 2KLLA 1II4A 2VSEA 2D7IA 1RZOB 3I2AA 4MZFB 5FZZA 3CA3A 4GP3A 3HOMA 1JT7A 1TIEA 4I4YA 1BLAA 5F8WA 3HBWA 3FJ8A 41BIA 1MD6A 4OEEA 5BXTA 3BTAA 1K5UA 2HW9A 2RQ9A 2AFGA 2X2SA 3V0BA 1FMZA 1M16A 4OWKA 5D63A 5E24E 3BA5A 4I4SA 4I37A 5DVHA 4DENA 21BIA 3IM7A 4I4OA 2Z49A 2P23A 4GOYA 2VU9A 4P6AA 1G9AA 2MC2A 1F31A 1P63A 2DRYA 3CU1B 5BQUC 2Q3NB 6I1BA 1EV2A 1IT0A 9ILBA 4IY8A 4KEIA 1YBIA 4OUJA 3F62B 5JMCA 1BLDA 3UD8A 3H6RB 3C9ZA 1DIWA 1IILA 1A8DA 3Q7YA 1NUNA 4G1RA 3EF2A 3CRGA 4I4RA 1XYFA 3O4BA 1T4QA 1AF9A 1SR4C 4J2KA 3V79C 1S0BA 3FJEA 1XHBA 3BAGA 1YYNA 3UDAA 5BP5C 1JT4A 3FGMA 2UUSA 3AH4A 1AVAC 1V6XA 4D8HA 2BFHA 3FFZA 4WBCA 4IZXA 1JQZA 3QR5A 2LIEA 4H75A 7I1BA 2D24A 3N0KA 4OWLA 3CAHA 3E8LC 1G9DA 3JRRA 3RTIB 3ZC8A 3V0AA 1BFCA 1QQLA 3CRIA 1ABRB 1AFCA 1YXWA 3NJ5A 1XG6A 3AH1A 2VSAA 4ISQA 3BRFA 3AKGA 1S0LA 5BVPI 3O49A 1G9BA 4QO3A 1FWUA 3IM6A 3P6JA 1FV3A 1G9CA 1JTCA 2VUAA 4HJJA 1AXMA 4H04A 2F2FC 4EFRA 2KI4A 3OJVA 2Y9XE 4I4XA 4GAIA 1FMMS 1TWEA 3OBTA 4G9NA 1W3FA 2RSTA 3FJJA 3VSZA 1CE7B 4I8MA 3AZVA 4J2SA 5HPZA 2IWTB 1ILR1 1HWNB 4TLPA 4ZA3B 3A21A 3P53A 3ZX7A 3O3QA 4USPA 3TC2A 3WA1A 4JAWA 2WRYA 4ZOTA 3UJ4A 2NS2A 4I2SA 3AZWA 4D0TA 1FN0A 1HIBA 1JLXA 4ISRA 31BIA 4USOA 3JUTA 4XKIA 3RMYA 5BXRA 4I4PA 4UY4A 1HCDA 4I4VA 2ERMA 4EB2B 1PC8B 3FJAA 2X2TA 3IM5A 2AQZA 4LO2A 4J2XA 1TP0A 4ZFWB 1YF8B 3RTJB 3LTQA 4P0LA 5EC5A 1JT3A 1JY0A 4HR6C 1EVTA 4KEJA 4Z8SB 4LO8B 4P0KA 3FJFA 1BFBA 1ONKB 1JLYA 1TOOA 1Z0HA 3BAVA 1ISZA 3VSFA 4LO0A 3HN1A 5FZUA 1SZ6B 5FNWA 3AJ6A 3FJDA 4LO3A 3BRDA 3S8KA 1IOBA 3CA5A 2MLLB 4YOLA 3H6RA 4OW4A 4DEPA 1HWPB 1BA7A 5D61A 4I3NA 3IIRA 2NYYA 4QD2C 3WINC 4X37A 3UD9A 2DS0A 2P39A 3UD7A 4QC4A 2QYIB 1D0HA 3AH2A 3CRHA 3I29B 1FGAA 3FUOA 4A7YA 1BFFA 4X3AA 2K4AB 4OWJA 2DREA 2GZBA 4ENDA 2ZQNA 4KC3A 5DZUA 4LO1A 1Z4SA 4P0JA 2F2FA 3T8SA 4PC4A 1GGPB 2FDBM 2Y9GA 3FUQA 3CQAA 2FFVA 1DZCA 1S0CA 4KEKA 1PUMB 3I2XA 5GAQA 1V6WA 2FFUA 3OJMA 4OEGA 3ZXDA 5BOWA 1DLLA 1ITBA 3POKA 3N7JA 3F1RA 3KMVA 5BXSA 1N4KA 1BFGA 3Q7WA 3VT2A 1MC9A 2LIQA 1TWMA 3OGFA 1FWVA 4G9MA 3FJCA 1TTUA 3ILAA 4EFQA 3QYDA 4OEFA 2BEBA 3WO2A 1IRAX 4I7IA 2E4MC 4A7ZA 3O4CA 4AN6A 2ET2A 1BASA 2I1BA 1NZKA 3R4UA 4L4IA 5B2HA 3WO3A 3NBDA 2Q9XA 3FJ9A 1JT5A 1TFMB 4CJMA 1DZDA 4QBVA 3O4AA 1V6VA 5BXPA 4II0A 1I1EA 3NBEA 4Z9WB 8I1BA 4I96A 4JKQA 3UJ0A 3VWCA 2HWMA 4LO7B 2F8XC 4EEEB 3Q7XA 3BRGC 4ZKTB 3FJBA 3NBCA 4QALA 3N7LA 5I1BA 1Q04A 3O44A 4JPZA 2M49A 3A23A 1S0DA 4LO7C 2KH2A 4ZBVB 5BQUA 2NTDA 4GAFA 5F90A 1Q03A 4HA2A 2BEAA 4I1EA 2D43A 5G00A 4ZLBB 3B9UA 4I0YA 2HWAA 1KNMA 3PMEA 1DFQA 4JQ0A 4QKRA 5FZYA 2D44A 1DQOA 1AVXB 4J2YA 3BAQA 1AVUA 1E0OA 3SNVA 3VT0A 2Y9WC 1ISWA 2Z48A 3IAGC 4AN7B 3LLPA 3H6SE 4GP0A 4QD2B 4Q91A 2ESUA 3CA0A 2Y9FA 1SR4A 1IJTA 3ZXGA 1DQGA 2QN4A 1IHKA 2GO2A 4JRAA 1CVSA 5BP5A 1EYLA 1M2TB 3HALA 1DJSB 4ZFYB 1HCEA 3WMUA 3D7WB 4XFTA 4QKSA 4F83A 1W3AA 1PZZA 4ZGRB 1WBAA 1I1BA 5F8YA 1OQLB 3RMXA 1Z2VA 1ISXA 4EKXB 3OJ2A 3FJHA 4MZGB 4XFSA 4Q9GA 3HMYA 1W3GA 2VXTI 2J3PA 4D0ZA 1WD3A 3O4DA 3NBNA 3BA7A 4X39A 5DSSB 1T9FA 1HWMB 1FQ9A 2RG9B 4LO2C 4I1BA 4I4QA 3V0BB 2WBCA 5EHAA 4XFUA 2E4MA 1RMLA 4JP0A 3PHZA 4IONA 4IHZA 2XOAA 3BADA 3FJIA 1RG8A 1RY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVW B;  1Q1U A;  3ZC9 A;  1K5V A;  1WBC A;  2D1Z A;  3RSJ A;  2NZ9 A;  3BAO A;  3VEQ A;  3HSM A;  2YUG A;  4LO0 C;  4IQP A;  3N7M A;  4FGF A;  3AKH A;  4GOV A;  1V6U A;  2AXM A;  4LO3 C;  3K1X A;  3AKF A;  4X38 A;  2ZR1 B;  2NM1 A;  4A7K A;  4KBB A;  1QXM A;  4I4U A;  5FNX A;  3OBR A;  4Q9P A;  4IYB A;  3A07 A;  3MAL A;  4ZFU B;  2VLC A;  4G6M A;  1G82 A;  3PUB A;  1ISV A;  1QQK A;  1R8N A;  3CA1 A;  3P6I A;  2FO1 A;  4JKX B;  1L2H A;  3BB2 A;  1EPW A;  5JLV A;  1S0F A;  4EFP A;  1WD4 A;  2MIB A;  1S0G A;  3A22 A;  4IY9 A;  1J0S A;  3OGG A;  3WMV A;  1R8O A;  3VUO A;  3CA4 A;  1UPS A;  1HWO B;  4LO1 C;  3O5W B;  2HZ9 A;  2NP0 A;  2KI6 B;  4H9W A;  1DFC A;  1IRP A;  3S8J A;  4L4H A;  1BAR A;  1ISY A;  3V0A B;  1S0E A;  3BAU A;  2ZQO A;  4DCK C;  4J23 B;  3N7K A;  2DRZ A;  3O4O A;  2D20 A;  2K8R A;  3MPP G;  2AAI B;  1XZZ A;  2R9K B;  3FJK A;  4FVV A;  3W9T A;  4IZE A;  2D22 A;  2D23 A;  3CA6 A;  4I6I A;  2VXR A;  2NVH A;  3WIN A;  5DUY A;  2IHO A;  3R4S A;  4R6U B;  2K43 A;  3WO4 A;  1FV2 A;  3AKI A;  1PWA A;  1VCL A;  2FGF A;  5EG6 C;  4QBC A;  3H6Q A;  1YTO A;  3AJ5 A;  4G6J A;  3VT1 A;  1HKN A;  4F34 A;  2D7R A;  1PUU B;  3BX1 C;  5F8S A;  5D62 A;  3PG0 A;  2KKI A;  2L5X A;  3BAH A;  3BA4 A;  2KLL A;  1II4 A;  2VSE A;  2D7I A;  1RZO B;  3I2A A;  5FZZ A;  3CA3 A;  4GP3 A;  3HOM A;  1JT7 A;  1TIE A;  4I4Y A;  1BLA A;  5F8W A;  3HBW A;  3FJ8 A;  41BI A;  1MD6 A;  4OEE A;  5BXT A;  3BTA A;  1K5U A;  2HW9 A;  2RQ9 A;  2AFG A;  2X2S A;  3V0B A;  1FMZ A;  1M16 A;  4OWK A;  5D63 A;  5E24 E;  3BA5 A;  4I4S A;  4I37 A;  5DVH A;  4DEN A;  21BI A;  3IM7 A;  4I4O A;  2Z49 A;  2P23 A;  4GOY A;  2VU9 A;  4P6A A;  1G9A A;  2MC2 A;  1F31 A;  1P63 A;  2DRY A;  3CU1 B;  5BQU C;  2Q3N B;  6I1B A;  1EV2 A;  1IT0 A;  9ILB A;  4IY8 A;  4KEI A;  1YBI A;  4OUJ A;  3F62 B;  5JMC A;  1BLD A;  3UD8 A;  3H6R B;  3C9Z A;  1DIW A;  1IIL A;  1A8D A;  3Q7Y A;  1NUN A;  4G1R A;  3EF2 A;  3CRG A;  4I4R A;  1XYF A;  3O4B A;  1T4Q A;  1AF9 A;  1SR4 C;  4J2K A;  3V79 C;  1S0B A;  3FJE A;  1XHB A;  3BAG A;  1YYN A;  3UDA A;  5BP5 C;  1JT4 A;  3FGM A;  2UUS A;  3AH4 A;  1AVA C;  1V6X A;  4D8H A;  2BFH A;  3FFZ A;  4WBC A;  4IZX A;  1JQZ A;  3QR5 A;  2LIE A;  7I1B A;  2D24 A;  3N0K A;  4OWL A;  3CAH A;  3E8L C;  1G9D A;  3JRR A;  3RTI B;  3ZC8 A;  3V0A A;  1BFC A;  1QQL A;  3CRI A;  1ABR B;  1AFC A;  1YXW A;  3NJ5 A;  1XG6 A;  3AH1 A;  2VSA A;  4ISQ A;  3BRF A;  3AKG A;  1S0L A;  5BVP I;  3O49 A;  1G9B A;  4QO3 A;  1FWU A;  3IM6 A;  3P6J A;  1FV3 A;  1G9C A;  1JTC A;  2VUA A;  4HJJ A;  1AXM A;  4H04 A;  2F2F C;  4EFR A;  2KI4 A;  3OJV A;  2Y9X E;  4I4X A;  4GAI A;  1FMM S;  1TWE A;  3OBT A;  4G9N A;  1W3F A;  2RST A;  3FJJ A;  3VSZ A;  1CE7 B;  4I8M A;  3AZV A;  4J2S A;  5HPZ A;  2IWT B;  1ILR 1;  1HWN B;  4TLP A;  4ZA3 B;  3A21 A;  3P53 A;  3ZX7 A;  3O3Q A;  4USP A;  3TC2 A;  3WA1 A;  4JAW A;  2WRY A;  4ZOT A;  3UJ4 A;  4I2S A;  3AZW A;  4D0T A;  1FN0 A;  1HIB A;  1JLX A;  4ISR A;  31BI A;  4USO A;  3JUT A;  4XKI A;  3RMY A;  5BXR A;  4I4P A;  1HCD A;  4I4V A;  2ERM A;  4EB2 B;  1PC8 B;  3FJA A;  2X2T A;  3IM5 A;  2AQZ A;  4LO2 A;  4J2X A;  1TP0 A;  4ZFW B;  1YF8 B;  3RTJ B;  3LTQ A;  4P0L A;  5EC5 A;  1JT3 A;  1JY0 A;  4HR6 C;  1EVT A;  4KEJ A;  4Z8S B;  4LO8 B;  4P0K A;  3FJF A;  1BFB A;  1ONK B;  1JLY A;  1TOO A;  1Z0H A;  3BAV A;  1ISZ A;  3VSF A;  4LO0 A;  3HN1 A;  5FZU A;  1SZ6 B;  5FNW A;  3AJ6 A;  3FJD A;  4LO3 A;  3BRD A;  3S8K A;  1IOB A;  3CA5 A;  2MLL B;  4YOL A;  3H6R A;  4OW4 A;  4DEP A;  1HWP B;  1BA7 A;  5D61 A;  4I3N A;  3IIR A;  2NYY A;  4QD2 C;  3WIN C;  4X37 A;  3UD9 A;  2DS0 A;  2P39 A;  3UD7 A;  4QC4 A;  2QYI B;  1D0H A;  3AH2 A;  3CRH A;  3I29 B;  1FGA A;  3FUO A;  4A7Y A;  1BFF A;  4X3A A;  2K4A B;  4OWJ A;  2DRE A;  2GZB A;  4END A;  2ZQN A;  4KC3 A;  5DZU A;  4LO1 A;  1Z4S A;  4P0J A;  2F2F A;  3T8S A;  4PC4 A;  1GGP B;  2FDB M;  2Y9G A;  3FUQ A;  3CQA A;  2FFV A;  1DZC A;  1S0C A;  4KEK A;  1PUM B;  3I2X A;  5GAQ A;  1V6W A;  2FFU A;  3OJM A;  4OEG A;  3ZXD A;  5BOW A;  1DLL A;  1ITB A;  3POK A;  3N7J A;  3F1R A;  3KMV A;  5BXS A;  1N4K A;  1BFG A;  3Q7W A;  3VT2 A;  1MC9 A;  2LIQ A;  1TWM A;  3OGF A;  1FWV A;  4G9M A;  3FJC A;  1TTU A;  3ILA A;  4EFQ A;  3QYD A;  4OEF A;  2BEB A;  3WO2 A;  1IRA X;  4I7I A;  2E4M C;  4A7Z A;  3O4C A;  4AN6 A;  2ET2 A;  1BAS A;  2I1B A;  1NZK A;  3R4U A;  4L4I A;  5B2H A;  3WO3 A;  3NBD A;  2Q9X A;  3FJ9 A;  1JT5 A;  1TFM B;  4CJM A;  1DZD A;  4QBV A;  3O4A A;  1V6V A;  5BXP A;  4II0 A;  1I1E A;  3NBE A;  4Z9W B;  8I1B A;  4I96 A;  4JKQ A;  3UJ0 A;  3VWC A;  2HWM A;  4LO7 B;  2F8X C;  4EEE B;  3Q7X A;  3BRG C;  4ZKT B;  3FJB A;  3NBC A;  4QAL A;  3N7L A;  5I1B A;  1Q04 A;  3O44 A;  4JPZ A;  2M49 A;  3A23 A;  1S0D A;  4LO7 C;  2KH2 A;  4ZBV B;  5BQU A;  2NTD A;  4GAF A;  5F90 A;  1Q03 A;  4HA2 A;  2BEA A;  4I1E A;  2D43 A;  5G00 A;  4ZLB B;  3B9U A;  4I0Y A;  2HWA A;  1KNM A;  3PME A;  1DFQ A;  4JQ0 A;  4QKR A;  5FZY A;  2D44 A;  1DQO A;  1AVX B;  4J2Y A;  3BAQ A;  1AVU A;  1E0O A;  3SNV A;  3VT0 A;  2Y9W C;  1ISW A;  2Z48 A;  3IAG C;  4AN7 B;  3LLP A;  3H6S E;  4GP0 A;  4QD2 B;  4Q91 A;  2ESU A;  3CA0 A;  2Y9F A;  1SR4 A;  1IJT A;  3ZXG A;  1DQG A;  2QN4 A;  1IHK A;  2GO2 A;  4JRA A;  1CVS A;  5BP5 A;  1EYL A;  1M2T B;  3HAL A;  1DJS B;  4ZFY B;  1HCE A;  3WMU A;  3D7W B;  4XFT A;  4QKS A;  4F83 A;  1W3A A;  1PZZ A;  4ZGR B;  1WBA A;  1I1B A;  5F8Y A;  1OQL B;  3RMX A;  1Z2V A;  1ISX A;  4EKX B;  3OJ2 A;  3FJH A;  4XFS A;  4Q9G A;  3HMY A;  1W3G A;  2VXT I;  2J3P A;  4D0Z A;  1WD3 A;  3O4D A;  3NBN A;  3BA7 A;  4X39 A;  5DSS B;  1T9F A;  1HWM B;  1FQ9 A;  2RG9 B;  4LO2 C;  4I1B A;  4I4Q A;  3V0B B;  2WBC A;  5EHA A;  4XFU A;  2E4M A;  1RML A;  4JP0 A;  3PHZ A;  4ION A;  4IHZ A;  2XOA A;  3BAD A;  3FJI A;  1RG8 A;  1RY7 A; 
#chains in the Genus database with same CATH topology
 1AVW B;  1Q1U A;  3ZC9 A;  1K5V A;  1WBC A;  2D1Z A;  3RSJ A;  2NZ9 A;  3BAO A;  3VEQ A;  3HSM A;  2YUG A;  4LO0 C;  4IQP A;  3N7M A;  4FGF A;  3AKH A;  4GOV A;  1V6U A;  2AXM A;  4LO3 C;  3K1X A;  3AKF A;  4X38 A;  2ZR1 B;  2NM1 A;  4A7K A;  4KBB A;  1QXM A;  4I4U A;  5FNX A;  3OBR A;  4Q9P A;  4IYB A;  3A07 A;  3MAL A;  4ZFU B;  2VLC A;  4G6M A;  1G82 A;  3PUB A;  1ISV A;  1QQK A;  1R8N A;  3CA1 A;  4MZH A;  3P6I A;  2FO1 A;  4JKX B;  1L2H A;  3BB2 A;  1EPW A;  5JLV A;  1S0F A;  4EFP A;  1WD4 A;  2MIB A;  1S0G A;  3A22 A;  4IY9 A;  1J0S A;  3OGG A;  3WMV A;  1R8O A;  3VUO A;  3CA4 A;  1UPS A;  1HWO B;  4LO1 C;  3O5W B;  2HZ9 A;  2NP0 A;  2KI6 B;  4H9W A;  1DFC A;  1IRP A;  3S8J A;  4L4H A;  1BAR A;  1ISY A;  3V0A B;  1S0E A;  3BAU A;  2ZQO A;  4DCK C;  4J23 B;  3N7K A;  2DRZ A;  3O4O A;  2D20 A;  2K8R A;  3MPP G;  2AAI B;  1XZZ A;  2R9K B;  3FJK A;  4FVV A;  3W9T A;  4IZE A;  2D22 A;  2D23 A;  3CA6 A;  4I6I A;  2VXR A;  2NVH A;  3WIN A;  5DUY A;  2IHO A;  3R4S A;  4R6U B;  2K43 A;  3WO4 A;  1FV2 A;  3AKI A;  1PWA A;  1VCL A;  2FGF A;  5EG6 C;  4QBC A;  3H6Q A;  1YTO A;  3AJ5 A;  4G6J A;  3VT1 A;  1HKN A;  4F34 A;  2D7R A;  1PUU B;  3BX1 C;  5F8S A;  5D62 A;  3PG0 A;  2KKI A;  2L5X A;  3BAH A;  3BA4 A;  2KLL A;  1II4 A;  2VSE A;  2D7I A;  1RZO B;  3I2A A;  4MZF B;  5FZZ A;  3CA3 A;  4GP3 A;  3HOM A;  1JT7 A;  1TIE A;  4I4Y A;  1BLA A;  5F8W A;  3HBW A;  3FJ8 A;  41BI A;  1MD6 A;  4OEE A;  5BXT A;  3BTA A;  1K5U A;  2HW9 A;  2RQ9 A;  2AFG A;  2X2S A;  3V0B A;  1FMZ A;  1M16 A;  4OWK A;  5D63 A;  5E24 E;  3BA5 A;  4I4S A;  4I37 A;  5DVH A;  4DEN A;  21BI A;  3IM7 A;  4I4O A;  2Z49 A;  2P23 A;  4GOY A;  2VU9 A;  4P6A A;  1G9A A;  2MC2 A;  1F31 A;  1P63 A;  2DRY A;  3CU1 B;  5BQU C;  2Q3N B;  6I1B A;  1EV2 A;  1IT0 A;  9ILB A;  4IY8 A;  4KEI A;  1YBI A;  4OUJ A;  3F62 B;  5JMC A;  1BLD A;  3UD8 A;  3H6R B;  3C9Z A;  1DIW A;  1IIL A;  1A8D A;  3Q7Y A;  1NUN A;  4G1R A;  3EF2 A;  3CRG A;  4I4R A;  1XYF A;  3O4B A;  1T4Q A;  1AF9 A;  1SR4 C;  4J2K A;  3V79 C;  1S0B A;  3FJE A;  1XHB A;  3BAG A;  1YYN A;  3UDA A;  5BP5 C;  1JT4 A;  3FGM A;  2UUS A;  3AH4 A;  1AVA C;  1V6X A;  4D8H A;  2BFH A;  3FFZ A;  4WBC A;  4IZX A;  1JQZ A;  3QR5 A;  2LIE A;  4H75 A;  7I1B A;  2D24 A;  3N0K A;  4OWL A;  3CAH A;  3E8L C;  1G9D A;  3JRR A;  3RTI B;  3ZC8 A;  3V0A A;  1BFC A;  1QQL A;  3CRI A;  1ABR B;  1AFC A;  1YXW A;  3NJ5 A;  1XG6 A;  3AH1 A;  2VSA A;  4ISQ A;  3BRF A;  3AKG A;  1S0L A;  5BVP I;  3O49 A;  1G9B A;  4QO3 A;  1FWU A;  3IM6 A;  3P6J A;  1FV3 A;  1G9C A;  1JTC A;  2VUA A;  4HJJ A;  1AXM A;  4H04 A;  2F2F C;  4EFR A;  2KI4 A;  3OJV A;  2Y9X E;  4I4X A;  4GAI A;  1FMM S;  1TWE A;  3OBT A;  4G9N A;  1W3F A;  2RST A;  3FJJ A;  3VSZ A;  1CE7 B;  4I8M A;  3AZV A;  4J2S A;  5HPZ A;  2IWT B;  1ILR 1;  1HWN B;  4TLP A;  4ZA3 B;  3A21 A;  3P53 A;  3ZX7 A;  3O3Q A;  4USP A;  3TC2 A;  3WA1 A;  4JAW A;  2WRY A;  4ZOT A;  3UJ4 A;  2NS2 A;  4I2S A;  3AZW A;  4D0T A;  1FN0 A;  1HIB A;  1JLX A;  4ISR A;  31BI A;  4USO A;  3JUT A;  4XKI A;  3RMY A;  5BXR A;  4I4P A;  4UY4 A;  1HCD A;  4I4V A;  2ERM A;  4EB2 B;  1PC8 B;  3FJA A;  2X2T A;  3IM5 A;  2AQZ A;  4LO2 A;  4J2X A;  1TP0 A;  4ZFW B;  1YF8 B;  3RTJ B;  3LTQ A;  4P0L A;  5EC5 A;  1JT3 A;  1JY0 A;  4HR6 C;  1EVT A;  4KEJ A;  4Z8S B;  4LO8 B;  4P0K A;  3FJF A;  1BFB A;  1ONK B;  1JLY A;  1TOO A;  1Z0H A;  3BAV A;  1ISZ A;  3VSF A;  4LO0 A;  3HN1 A;  5FZU A;  1SZ6 B;  5FNW A;  3AJ6 A;  3FJD A;  4LO3 A;  3BRD A;  3S8K A;  1IOB A;  3CA5 A;  2MLL B;  4YOL A;  3H6R A;  4OW4 A;  4DEP A;  1HWP B;  1BA7 A;  5D61 A;  4I3N A;  3IIR A;  2NYY A;  4QD2 C;  3WIN C;  4X37 A;  3UD9 A;  2DS0 A;  2P39 A;  3UD7 A;  4QC4 A;  2QYI B;  1D0H A;  3AH2 A;  3CRH A;  3I29 B;  1FGA A;  3FUO A;  4A7Y A;  1BFF A;  4X3A A;  2K4A B;  4OWJ A;  2DRE A;  2GZB A;  4END A;  2ZQN A;  4KC3 A;  5DZU A;  4LO1 A;  1Z4S A;  4P0J A;  2F2F A;  3T8S A;  4PC4 A;  1GGP B;  2FDB M;  2Y9G A;  3FUQ A;  3CQA A;  2FFV A;  1DZC A;  1S0C A;  4KEK A;  1PUM B;  3I2X A;  5GAQ A;  1V6W A;  2FFU A;  3OJM A;  4OEG A;  3ZXD A;  5BOW A;  1DLL A;  1ITB A;  3POK A;  3N7J A;  3F1R A;  3KMV A;  5BXS A;  1N4K A;  1BFG A;  3Q7W A;  3VT2 A;  1MC9 A;  2LIQ A;  1TWM A;  3OGF A;  1FWV A;  4G9M A;  3FJC A;  1TTU A;  3ILA A;  4EFQ A;  3QYD A;  4OEF A;  2BEB A;  3WO2 A;  1IRA X;  4I7I A;  2E4M C;  4A7Z A;  3O4C A;  4AN6 A;  2ET2 A;  1BAS A;  2I1B A;  1NZK A;  3R4U A;  4L4I A;  5B2H A;  3WO3 A;  3NBD A;  2Q9X A;  3FJ9 A;  1JT5 A;  1TFM B;  4CJM A;  1DZD A;  4QBV A;  3O4A A;  1V6V A;  5BXP A;  4II0 A;  1I1E A;  3NBE A;  4Z9W B;  8I1B A;  4I96 A;  4JKQ A;  3UJ0 A;  3VWC A;  2HWM A;  4LO7 B;  2F8X C;  4EEE B;  3Q7X A;  3BRG C;  4ZKT B;  3FJB A;  3NBC A;  4QAL A;  3N7L A;  5I1B A;  1Q04 A;  3O44 A;  4JPZ A;  2M49 A;  3A23 A;  1S0D A;  4LO7 C;  2KH2 A;  4ZBV B;  5BQU A;  2NTD A;  4GAF A;  5F90 A;  1Q03 A;  4HA2 A;  2BEA A;  4I1E A;  2D43 A;  5G00 A;  4ZLB B;  3B9U A;  4I0Y A;  2HWA A;  1KNM A;  3PME A;  1DFQ A;  4JQ0 A;  4QKR A;  5FZY A;  2D44 A;  1DQO A;  1AVX B;  4J2Y A;  3BAQ A;  1AVU A;  1E0O A;  3SNV A;  3VT0 A;  2Y9W C;  1ISW A;  2Z48 A;  3IAG C;  4AN7 B;  3LLP A;  3H6S E;  4GP0 A;  4QD2 B;  4Q91 A;  2ESU A;  3CA0 A;  2Y9F A;  1SR4 A;  1IJT A;  3ZXG A;  1DQG A;  2QN4 A;  1IHK A;  2GO2 A;  4JRA A;  1CVS A;  5BP5 A;  1EYL A;  1M2T B;  3HAL A;  1DJS B;  4ZFY B;  1HCE A;  3WMU A;  3D7W B;  4XFT A;  4QKS A;  4F83 A;  1W3A A;  1PZZ A;  4ZGR B;  1WBA A;  1I1B A;  5F8Y A;  1OQL B;  3RMX A;  1Z2V A;  1ISX A;  4EKX B;  3OJ2 A;  3FJH A;  4MZG B;  4XFS A;  4Q9G A;  3HMY A;  1W3G A;  2VXT I;  2J3P A;  4D0Z A;  1WD3 A;  3O4D A;  3NBN A;  3BA7 A;  4X39 A;  5DSS B;  1T9F A;  1HWM B;  1FQ9 A;  2RG9 B;  4LO2 C;  4I1B A;  4I4Q A;  3V0B B;  2WBC A;  5EHA A;  4XFU A;  2E4M A;  1RML A;  4JP0 A;  3PHZ A;  4ION A;  4IHZ A;  2XOA A;  3BAD A;  3FJI A;  1RG8 A;  1RY7 A; 
#chains in the Genus database with same CATH homology
 1AVW B;  1Q1U A;  3ZC9 A;  1K5V A;  1WBC A;  2D1Z A;  3RSJ A;  2NZ9 A;  3BAO A;  3VEQ A;  3HSM A;  2YUG A;  4LO0 C;  4IQP A;  3N7M A;  4FGF A;  3AKH A;  4GOV A;  1V6U A;  2AXM A;  4LO3 C;  3K1X A;  3AKF A;  4X38 A;  2ZR1 B;  2NM1 A;  4A7K A;  4KBB A;  1QXM A;  4I4U A;  5FNX A;  3OBR A;  4Q9P A;  4IYB A;  3A07 A;  3MAL A;  4ZFU B;  2VLC A;  4G6M A;  1G82 A;  3PUB A;  1ISV A;  1QQK A;  1R8N A;  3CA1 A;  4MZH A;  3P6I A;  2FO1 A;  4JKX B;  1L2H A;  3BB2 A;  1EPW A;  5JLV A;  1S0F A;  4EFP A;  1WD4 A;  2MIB A;  1S0G A;  3A22 A;  4IY9 A;  1J0S A;  3OGG A;  3WMV A;  1R8O A;  3VUO A;  3CA4 A;  1UPS A;  1HWO B;  4LO1 C;  3O5W B;  2HZ9 A;  2NP0 A;  2KI6 B;  4H9W A;  1DFC A;  1IRP A;  3S8J A;  4L4H A;  1BAR A;  1ISY A;  3V0A B;  1S0E A;  3BAU A;  2ZQO A;  4DCK C;  4J23 B;  3N7K A;  2DRZ A;  3O4O A;  2D20 A;  2K8R A;  3MPP G;  2AAI B;  1XZZ A;  2R9K B;  3FJK A;  4FVV A;  3W9T A;  4IZE A;  2D22 A;  2D23 A;  3CA6 A;  4I6I A;  2VXR A;  2NVH A;  3WIN A;  5DUY A;  2IHO A;  3R4S A;  4R6U B;  2K43 A;  3WO4 A;  1FV2 A;  3AKI A;  1PWA A;  1VCL A;  2FGF A;  5EG6 C;  4QBC A;  3H6Q A;  1YTO A;  3AJ5 A;  4G6J A;  3VT1 A;  1HKN A;  4F34 A;  2D7R A;  1PUU B;  3BX1 C;  5F8S A;  5D62 A;  3PG0 A;  2KKI A;  2L5X A;  3BAH A;  3BA4 A;  2KLL A;  1II4 A;  2VSE A;  2D7I A;  1RZO B;  3I2A A;  4MZF B;  5FZZ A;  3CA3 A;  4GP3 A;  3HOM A;  1JT7 A;  1TIE A;  4I4Y A;  1BLA A;  5F8W A;  3HBW A;  3FJ8 A;  41BI A;  1MD6 A;  4OEE A;  5BXT A;  3BTA A;  1K5U A;  2HW9 A;  2RQ9 A;  2AFG A;  2X2S A;  3V0B A;  1FMZ A;  1M16 A;  4OWK A;  5D63 A;  5E24 E;  3BA5 A;  4I4S A;  4I37 A;  5DVH A;  4DEN A;  21BI A;  3IM7 A;  4I4O A;  2Z49 A;  2P23 A;  4GOY A;  2VU9 A;  4P6A A;  1G9A A;  2MC2 A;  1F31 A;  1P63 A;  2DRY A;  3CU1 B;  5BQU C;  2Q3N B;  6I1B A;  1EV2 A;  1IT0 A;  9ILB A;  4IY8 A;  4KEI A;  1YBI A;  4OUJ A;  3F62 B;  5JMC A;  1BLD A;  3UD8 A;  3H6R B;  3C9Z A;  1DIW A;  1IIL A;  1A8D A;  3Q7Y A;  1NUN A;  4G1R A;  3EF2 A;  3CRG A;  4I4R A;  1XYF A;  3O4B A;  1T4Q A;  1AF9 A;  1SR4 C;  4J2K A;  3V79 C;  1S0B A;  3FJE A;  1XHB A;  3BAG A;  1YYN A;  3UDA A;  5BP5 C;  1JT4 A;  3FGM A;  2UUS A;  3AH4 A;  1AVA C;  1V6X A;  4D8H A;  2BFH A;  3FFZ A;  4WBC A;  4IZX A;  1JQZ A;  3QR5 A;  2LIE A;  4H75 A;  7I1B A;  2D24 A;  3N0K A;  4OWL A;  3CAH A;  3E8L C;  1G9D A;  3JRR A;  3RTI B;  3ZC8 A;  3V0A A;  1BFC A;  1QQL A;  3CRI A;  1ABR B;  1AFC A;  1YXW A;  3NJ5 A;  1XG6 A;  3AH1 A;  2VSA A;  4ISQ A;  3BRF A;  3AKG A;  1S0L A;  5BVP I;  3O49 A;  1G9B A;  4QO3 A;  1FWU A;  3IM6 A;  3P6J A;  1FV3 A;  1G9C A;  1JTC A;  2VUA A;  4HJJ A;  1AXM A;  4H04 A;  2F2F C;  4EFR A;  2KI4 A;  3OJV A;  2Y9X E;  4I4X A;  4GAI A;  1FMM S;  1TWE A;  3OBT A;  4G9N A;  1W3F A;  2RST A;  3FJJ A;  3VSZ A;  1CE7 B;  4I8M A;  3AZV A;  4J2S A;  5HPZ A;  2IWT B;  1ILR 1;  1HWN B;  4TLP A;  4ZA3 B;  3A21 A;  3P53 A;  3ZX7 A;  3O3Q A;  4USP A;  3TC2 A;  3WA1 A;  4JAW A;  2WRY A;  4ZOT A;  3UJ4 A;  2NS2 A;  4I2S A;  3AZW A;  4D0T A;  1FN0 A;  1HIB A;  1JLX A;  4ISR A;  31BI A;  4USO A;  3JUT A;  4XKI A;  3RMY A;  5BXR A;  4I4P A;  4UY4 A;  1HCD A;  4I4V A;  2ERM A;  4EB2 B;  1PC8 B;  3FJA A;  2X2T A;  3IM5 A;  2AQZ A;  4LO2 A;  4J2X A;  1TP0 A;  4ZFW B;  1YF8 B;  3RTJ B;  3LTQ A;  4P0L A;  5EC5 A;  1JT3 A;  1JY0 A;  4HR6 C;  1EVT A;  4KEJ A;  4Z8S B;  4LO8 B;  4P0K A;  3FJF A;  1BFB A;  1ONK B;  1JLY A;  1TOO A;  1Z0H A;  3BAV A;  1ISZ A;  3VSF A;  4LO0 A;  3HN1 A;  5FZU A;  1SZ6 B;  5FNW A;  3AJ6 A;  3FJD A;  4LO3 A;  3BRD A;  3S8K A;  1IOB A;  3CA5 A;  2MLL B;  4YOL A;  3H6R A;  4OW4 A;  4DEP A;  1HWP B;  1BA7 A;  5D61 A;  4I3N A;  3IIR A;  2NYY A;  4QD2 C;  3WIN C;  4X37 A;  3UD9 A;  2DS0 A;  2P39 A;  3UD7 A;  4QC4 A;  2QYI B;  1D0H A;  3AH2 A;  3CRH A;  3I29 B;  1FGA A;  3FUO A;  4A7Y A;  1BFF A;  4X3A A;  2K4A B;  4OWJ A;  2DRE A;  2GZB A;  4END A;  2ZQN A;  4KC3 A;  5DZU A;  4LO1 A;  1Z4S A;  4P0J A;  2F2F A;  3T8S A;  4PC4 A;  1GGP B;  2FDB M;  2Y9G A;  3FUQ A;  3CQA A;  2FFV A;  1DZC A;  1S0C A;  4KEK A;  1PUM B;  3I2X A;  5GAQ A;  1V6W A;  2FFU A;  3OJM A;  4OEG A;  3ZXD A;  5BOW A;  1DLL A;  1ITB A;  3POK A;  3N7J A;  3F1R A;  3KMV A;  5BXS A;  1N4K A;  1BFG A;  3Q7W A;  3VT2 A;  1MC9 A;  2LIQ A;  1TWM A;  3OGF A;  1FWV A;  4G9M A;  3FJC A;  1TTU A;  3ILA A;  4EFQ A;  3QYD A;  4OEF A;  2BEB A;  3WO2 A;  1IRA X;  4I7I A;  2E4M C;  4A7Z A;  3O4C A;  4AN6 A;  2ET2 A;  1BAS A;  2I1B A;  1NZK A;  3R4U A;  4L4I A;  5B2H A;  3WO3 A;  3NBD A;  2Q9X A;  3FJ9 A;  1JT5 A;  1TFM B;  4CJM A;  1DZD A;  4QBV A;  3O4A A;  1V6V A;  5BXP A;  4II0 A;  1I1E A;  3NBE A;  4Z9W B;  8I1B A;  4I96 A;  4JKQ A;  3UJ0 A;  3VWC A;  2HWM A;  4LO7 B;  2F8X C;  4EEE B;  3Q7X A;  3BRG C;  4ZKT B;  3FJB A;  3NBC A;  4QAL A;  3N7L A;  5I1B A;  1Q04 A;  3O44 A;  4JPZ A;  2M49 A;  3A23 A;  1S0D A;  4LO7 C;  2KH2 A;  4ZBV B;  5BQU A;  2NTD A;  4GAF A;  5F90 A;  1Q03 A;  4HA2 A;  2BEA A;  4I1E A;  2D43 A;  5G00 A;  4ZLB B;  3B9U A;  4I0Y A;  2HWA A;  1KNM A;  3PME A;  1DFQ A;  4JQ0 A;  4QKR A;  5FZY A;  2D44 A;  1DQO A;  1AVX B;  4J2Y A;  3BAQ A;  1AVU A;  1E0O A;  3SNV A;  3VT0 A;  2Y9W C;  1ISW A;  2Z48 A;  3IAG C;  4AN7 B;  3LLP A;  3H6S E;  4GP0 A;  4QD2 B;  4Q91 A;  2ESU A;  3CA0 A;  2Y9F A;  1SR4 A;  1IJT A;  3ZXG A;  1DQG A;  2QN4 A;  1IHK A;  2GO2 A;  4JRA A;  1CVS A;  5BP5 A;  1EYL A;  1M2T B;  3HAL A;  1DJS B;  4ZFY B;  1HCE A;  3WMU A;  3D7W B;  4XFT A;  4QKS A;  4F83 A;  1W3A A;  1PZZ A;  4ZGR B;  1WBA A;  1I1B A;  5F8Y A;  1OQL B;  3RMX A;  1Z2V A;  1ISX A;  4EKX B;  3OJ2 A;  3FJH A;  4MZG B;  4XFS A;  4Q9G A;  3HMY A;  1W3G A;  2VXT I;  2J3P A;  4D0Z A;  1WD3 A;  3O4D A;  3NBN A;  3BA7 A;  4X39 A;  5DSS B;  1T9F A;  1HWM B;  1FQ9 A;  2RG9 B;  4LO2 C;  4I1B A;  4I4Q A;  3V0B B;  2WBC A;  5EHA A;  4XFU A;  2E4M A;  1RML A;  4JP0 A;  3PHZ A;  4ION A;  4IHZ A;  2XOA A;  3BAD A;  3FJI A;  1RG8 A;  1RY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...