3O4OA

Crystal structure of an interleukin-1 receptor complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
152
structure length
152
Chain Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 beta
publication title Structural insights into the assembly and activation of IL-1beta with its receptors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3o4oA00
1SZ6B 3RMYA 3F1RA 2WBCA 5I1BA 3N7MA 1OQLB 1HCEA 4F83A 4ZFWB 3CU1B 4I2SA 4LO7C 3BB2A 4LO7B 1AVUA 4J2XA 3P6JA 4II0A 3CRIA 4JRAA 5BQUA 4WBCA 2DRZA 4XKIA 3PMEA 2NYYA 4IZXA 4J2YA 4LO1A 4LO0C 2AXMA 1DZDA 4GP0A 4ZLBB 6I1BA 7I1BA 2FO1A 4I4OA 1JTCA 3FJAA 4JAWA 5FZZA 3FGMA 3Q7YA 2RG9B 4A7KA 3BAOA 4GOYA 3CRGA 3CA4A 3S8JA 4XFTA 1JT4A 4OEGA 1II4A 4ZFYB 3V0BA 1RZOB 2L5XA 1BASA 3IIRA 4QKSA 3BAVA 1YTOA 2UUSA 2Q3NB 3H6RB 1JT3A 3AH4A 2QYIB 3UD9A 3I2XA 4X39A 3CA3A 1PZZA 4AN6A 2NP0A 1IT0A 1HWPB 2D1ZA 1ONKB 1CVSA 2VUAA 3RTIB 1R8NA 4USPA 3RMXA 1S0BA 3FJCA 4CJMA 2X2TA 3JRRA 2E4MA 4I4XA 1XG6A 3C9ZA 1ISXA 1S0EA 3FJIA 5JLVA 3K1XA 1QXMA 1HWMB 1S0CA 4YOLA 4OUJA 3WO3A 1G9DA 1ILR1 4QD2C 3BRGC 2K43A 4QD2B 4EFRA 1YBIA 3AKHA 4ZGRB 5FNWA 2P23A 2K4AB 1V6WA 3AKGA 1DLLA 3N0KA 3VT0A 1K5UA 1T9FA 4JP0A 2NM1A 3V0AA 2BFHA 3ILAA 4I37A 1DJSB 3MPPG 3ZC9A 3A07A 3OGGA 1Q04A 3Q7WA 1Z4SA 2NTDA 3BAQA 2DREA 1ISYA 2MLLB 5FNXA 4OWJA 4I6IA 1XHBA 1ISZA 5BXRA 4I1BA 4I7IA 2FGFA 4OEFA 1FWVA 2FFUA 3UD7A 3ZX7A 3UJ4A 3H6SE 4DEPA 3FJ9A 2NZ9A 3OJMA 1DIWA 5FZYA 4ZFUB 4ZOTA 4Q9GA 3Q7XA 4G9MA 1FGAA 1S0DA 3VSZA 1BFGA 1G82A 2D24A 2ESUA 5DSSB 3TC2A 1BLDA 4F34A 3A23A 4KEKA 1TP0A 4JKXB 3OJ2A 3BAHA 4Q91A 3B9UA 3UJ0A 4G1RA 3V79C 3POKA 4IONA 2MC2A 1HWOB 1AVAC 3MALA 4Z8SB 2D23A 1ISWA 3AH1A 4OWLA 1KNMA 3RSJA 3ZXDA 4KBBA 3OBRA 1HKNA 4KEIA 1YYNA 3AZVA 4L4HA 2D44A 4OWKA 4QBVA 2F2FC 2VU9A 3BA4A 2GO2A 3AJ6A 1IILA 1DQOA 5BVPI 3FJDA 3FJHA 4I4UA 3AJ5A 4LO0A 4P0KA 1W3GA 4Q9PA 3FJKA 1YXWA 1SR4C 3O4AA 1ISVA 1FWUA 2D20A 1JLXA 3O5WB 5B2HA 1EPWA 4A7YA 3UD8A 5F8SA 3LLPA 2VXTI 4R6UB 3NBNA 4LO3C 5F90A 3BAUA 3CA5A 2NVHA 2D7RA 2LIQA 4FVVA 3O4CA 3BX1C 4I1EA 4X38A 4GAFA 3O4OA 2P39A 3NBDA 4DENA 3H6RA 1RMLA 4P0LA 3F62B 1YF8B 4I4SA 3FJEA 4D0TA 1EYLA 2AAIB 3FFZA 1TFMB 1FV2A 2BEAA 3N7LA 1DZCA 4IHZA 1EVTA 4TLPA 2HWAA 3WMVA 2XOAA 2ET2A 3PUBA 3VT1A 1W3AA 3ZC8A 1V6XA 4OEEA 1V6VA 1TWEA 3BADA 3VUOA 3FJJA 4IYBA 1TIEA 1ITBA 3R4SA 1BFFA 2ERMA 3CA0A 3WA1A 4EEEB 1AF9A 31BIA 3AH2A 3VT2A 4EB2B 1HCDA 2KKIA 1BFCA 3BAGA 4H04A 4I4YA 3O4BA 4J2SA 4EKXB 4HR6C 3H6QA 2KLLA 2ZQNA 1FMMS 2Q9XA 1IRPA 4J23B 1F31A 5D62A 2Y9WC 3VSFA 1PC8B 1FQ9A 5F8WA 3A22A 3HOMA 4GAIA 1IRAX 2Y9XE 1UPSA 2Z48A 1W3FA 3RTJB 3CAHA 3BRDA 1A8DA 1TTUA 1BA7A 3BRFA 3UDAA 1JT5A 1S0LA 4X37A 4ISRA 1N4KA 5EG6C 4A7ZA 4LO2A 4FGFA 3QYDA 4KEJA 1DFCA 3BA5A 2HZ9A 3T8SA 1BLAA 2FDBM 4I4RA 4OW4A 2WRYA 1FN0A 2X2SA 1GGPB 3WINC 4I4PA 4IY8A 5BXPA 1M16A 3IM6A 4I0YA 4GP3A 5HPZA 1L2HA 5D61A 3FJ8A 1RY7A 1S0FA 3QR5A 3WMUA 3SNVA 1HIBA 3JUTA 4H9WA 3P6IA 4L4IA 1ABRB 1FMZA 2GZBA 4ENDA 3W9TA 1WD3A 4EFPA 5BXTA 4GOVA 1PUUB 1AVWB 4I3NA 4G6MA 2F2FA 1HWNB 3I2AA 4JKQA 1VCLA 1CE7B 1M2TB 1BARA 4D0ZA 4J2KA 3HMYA 3O3QA 3HALA 5BP5C 5FZUA 1WBCA 1IOBA 3N7KA 3FUOA 1SR4A 4XFUA 5GAQA 3E8LC 3NBEA 3IAGC 2R9KB 1PWAA 2QN4A 4LO3A 3P53A 1XYFA 3FJBA 4D8HA 1BFBA 4XFSA 1JQZA 2D43A 1IHKA 4IZEA 5BQUC 5DZUA 2I1BA 2VSEA 4JPZA 3AKIA 2KH2A 2KI4A 1AFCA 3BTAA 4LO1C 1K5VA 3VEQA 1E0OA 4I4QA 4KC3A 1RG8A 1EV2A 4ISQA 4QBCA 2DS0A 3S8KA 4QC4A 4HJJA 3CQAA 5D63A 4QO3A 3FUQA 4I4VA 1FV3A 1G9BA 4ZBVB 3V0BB 1IJTA 3CA1A 3PG0A 1NUNA 3CA6A 2VSAA 3I29B 2RQ9A 5EC5A 2AQZA 3AKFA 1TOOA 2BEBA 4DCKC 3OBTA 2IHOA 4USOA 3NBCA 4I96A 2VXRA 3D7WB 5G00A 4QALA 3N7JA 4PC4A 2J3PA 2YUGA 5DUYA 1S0GA 1AVXB 4P6AA 3ZXGA 3HBWA 1G9AA 2M49A 1P63A 2E4MC 2K8RA 2IWTB 2VLCA 1V6UA 3WO4A 1I1BA 4AN7B 3IM5A 2D7IA 1T4QA 3O4DA 4ZA3B 1G9CA 3PHZA 3AZWA 4JQ0A 4G6JA 2ZR1B 3BA7A 3EF2A 3V0AB 4EFQA 1D0HA 1XZZA 2AFGA 3A21A 5DVHA 4Z9WB 1AXMA 3O49A 3VWCA 4I8MA 3R4UA 2FFVA 4P0JA 1QQLA 3WINA 1J0SA 1DQGA 1Q1UA 1PUMB 1JY0A 3LTQA 4QKRA 5F8YA 2HWMA 1MC9A 3CRHA 4IY9A 1DFQA 3OJVA 1Z0HA 9ILBA 3HN1A 4LO2C 3IM7A 4HA2A 4LO8B 1Z2VA 2DRYA 5E24E 1NZKA 1WD4A 4G9NA 21BIA 1JT7A 3WO2A 4ZKTB 2KI6B 2Y9GA 1TWMA 2F8XC 5BXSA 1I1EA 2MIBA 1WBAA 2Y9FA 8I1BA 1MD6A 2D22A 2HW9A 4IQPA 41BIA 1JLYA 2ZQOA 3KMVA 3OGFA 5JMCA 2LIEA 3FJFA 3O44A 5BOWA 1Q03A 1QQKA 2Z49A 5BP5A 4X3AA 3NJ5A 5EHAA 1R8OA 2RSTA 3HSMA
chains in the Genus database with same CATH superfamily
1SZ6B 3RMYA 3F1RA 2WBCA 5I1BA 3N7MA 1OQLB 1HCEA 4F83A 4ZFWB 3CU1B 4I2SA 4LO7C 3BB2A 4LO7B 1AVUA 4J2XA 3P6JA 4II0A 3CRIA 4JRAA 5BQUA 4WBCA 2DRZA 4XKIA 3PMEA 2NYYA 4IZXA 4J2YA 4LO1A 4LO0C 2AXMA 1DZDA 4GP0A 4ZLBB 6I1BA 7I1BA 2FO1A 4I4OA 1JTCA 3FJAA 4JAWA 5FZZA 3FGMA 3Q7YA 2RG9B 4A7KA 3BAOA 4GOYA 3CRGA 3CA4A 3S8JA 4XFTA 1JT4A 4OEGA 1II4A 4ZFYB 3V0BA 1RZOB 2L5XA 1BASA 3IIRA 4QKSA 3BAVA 1YTOA 2UUSA 2Q3NB 3H6RB 1JT3A 3AH4A 2QYIB 3UD9A 3I2XA 4X39A 3CA3A 1PZZA 4AN6A 2NP0A 1IT0A 1HWPB 2D1ZA 1ONKB 1CVSA 2VUAA 3RTIB 1R8NA 4USPA 3RMXA 1S0BA 3FJCA 4CJMA 2X2TA 3JRRA 2E4MA 4I4XA 1XG6A 3C9ZA 1ISXA 1S0EA 3FJIA 2NS2A 5JLVA 3K1XA 1QXMA 1HWMB 1S0CA 4YOLA 4OUJA 3WO3A 1G9DA 1ILR1 4QD2C 3BRGC 2K43A 4QD2B 4EFRA 1YBIA 3AKHA 4ZGRB 5FNWA 2P23A 2K4AB 1V6WA 3AKGA 1DLLA 3N0KA 3VT0A 1K5UA 1T9FA 4JP0A 2NM1A 3V0AA 2BFHA 3ILAA 4I37A 1DJSB 3MPPG 3ZC9A 3A07A 3OGGA 1Q04A 3Q7WA 1Z4SA 2NTDA 3BAQA 2DREA 1ISYA 2MLLB 5FNXA 4OWJA 4I6IA 1XHBA 1ISZA 5BXRA 4I1BA 4I7IA 2FGFA 4OEFA 1FWVA 2FFUA 3UD7A 3ZX7A 3UJ4A 3H6SE 4DEPA 3FJ9A 2NZ9A 3OJMA 1DIWA 5FZYA 4ZFUB 4ZOTA 4Q9GA 3Q7XA 4G9MA 1FGAA 1S0DA 3VSZA 1BFGA 1G82A 2D24A 2ESUA 5DSSB 3TC2A 1BLDA 4F34A 3A23A 4KEKA 1TP0A 4JKXB 3OJ2A 3BAHA 4Q91A 3B9UA 3UJ0A 4G1RA 3V79C 3POKA 4IONA 2MC2A 1HWOB 1AVAC 3MALA 4Z8SB 2D23A 1ISWA 3AH1A 4OWLA 1KNMA 3RSJA 3ZXDA 4KBBA 3OBRA 1HKNA 4KEIA 1YYNA 3AZVA 4L4HA 2D44A 4OWKA 4QBVA 2F2FC 2VU9A 3BA4A 2GO2A 3AJ6A 1IILA 1DQOA 5BVPI 3FJDA 3FJHA 4I4UA 3AJ5A 4LO0A 4P0KA 1W3GA 4Q9PA 3FJKA 1YXWA 1SR4C 3O4AA 1ISVA 1FWUA 2D20A 1JLXA 3O5WB 5B2HA 1EPWA 4MZHA 4A7YA 3UD8A 4MZGB 5F8SA 3LLPA 2VXTI 4R6UB 3NBNA 4LO3C 5F90A 3BAUA 3CA5A 2NVHA 2D7RA 2LIQA 4FVVA 3O4CA 3BX1C 4I1EA 4X38A 4GAFA 3O4OA 2P39A 3NBDA 4DENA 3H6RA 1RMLA 4P0LA 3F62B 1YF8B 4H75A 3FJEA 4I4SA 4D0TA 1EYLA 2AAIB 3FFZA 1TFMB 1FV2A 2BEAA 3N7LA 1DZCA 4IHZA 1EVTA 4TLPA 2HWAA 3WMVA 2XOAA 2ET2A 3PUBA 3VT1A 1W3AA 3ZC8A 1V6XA 4OEEA 1V6VA 1TWEA 3BADA 3VUOA 3FJJA 4IYBA 1TIEA 1ITBA 3R4SA 1BFFA 2ERMA 3CA0A 3WA1A 4EEEB 1AF9A 31BIA 3AH2A 3VT2A 4EB2B 1HCDA 2KKIA 1BFCA 3BAGA 4H04A 4I4YA 3O4BA 4J2SA 4EKXB 4HR6C 3H6QA 2KLLA 2ZQNA 1FMMS 2Q9XA 1IRPA 4J23B 1F31A 5D62A 2Y9WC 3VSFA 1PC8B 1FQ9A 5F8WA 3A22A 3HOMA 4GAIA 1IRAX 2Y9XE 4UY4A 1UPSA 2Z48A 1W3FA 3RTJB 3CAHA 3BRDA 1A8DA 1TTUA 1BA7A 3BRFA 3UDAA 1JT5A 1S0LA 4X37A 4ISRA 1N4KA 5EG6C 4A7ZA 4LO2A 4FGFA 3QYDA 4KEJA 1DFCA 3BA5A 2HZ9A 3T8SA 1BLAA 2FDBM 4I4RA 4OW4A 2WRYA 1FN0A 2X2SA 1GGPB 3WINC 4I4PA 4IY8A 5BXPA 1M16A 3IM6A 4I0YA 4GP3A 5HPZA 1L2HA 5D61A 3FJ8A 1RY7A 1S0FA 3QR5A 3WMUA 3SNVA 1HIBA 3JUTA 4H9WA 3P6IA 4L4IA 1ABRB 1FMZA 2GZBA 4ENDA 3W9TA 1WD3A 4EFPA 5BXTA 4GOVA 1PUUB 1AVWB 4I3NA 4G6MA 2F2FA 1HWNB 3I2AA 4JKQA 1VCLA 1CE7B 1M2TB 1BARA 4D0ZA 4J2KA 3HMYA 3O3QA 3HALA 5BP5C 5FZUA 1WBCA 1IOBA 3N7KA 3FUOA 1SR4A 4XFUA 5GAQA 3E8LC 3NBEA 3IAGC 2R9KB 1PWAA 2QN4A 4LO3A 3P53A 1XYFA 3FJBA 4D8HA 1BFBA 4XFSA 1JQZA 2D43A 1IHKA 4IZEA 5BQUC 5DZUA 2I1BA 2VSEA 4JPZA 3AKIA 2KH2A 2KI4A 1AFCA 3BTAA 4LO1C 1K5VA 3VEQA 1E0OA 4I4QA 4KC3A 1RG8A 1EV2A 4ISQA 4QBCA 2DS0A 3S8KA 4QC4A 4HJJA 3CQAA 5D63A 4QO3A 3FUQA 4I4VA 1FV3A 1G9BA 4ZBVB 3V0BB 1IJTA 3CA1A 3PG0A 1NUNA 3CA6A 2VSAA 3I29B 2RQ9A 5EC5A 2AQZA 3AKFA 1TOOA 2BEBA 4DCKC 3OBTA 2IHOA 4USOA 3NBCA 4I96A 2VXRA 3D7WB 5G00A 4QALA 3N7JA 4PC4A 2J3PA 2YUGA 5DUYA 1S0GA 1AVXB 4P6AA 3ZXGA 3HBWA 1G9AA 2M49A 1P63A 2E4MC 2K8RA 2IWTB 2VLCA 1V6UA 3WO4A 1I1BA 4AN7B 3IM5A 4MZFB 2D7IA 1T4QA 3O4DA 4ZA3B 1G9CA 3PHZA 3AZWA 4JQ0A 4G6JA 2ZR1B 3BA7A 3EF2A 3V0AB 4EFQA 1D0HA 1XZZA 2AFGA 3A21A 5DVHA 4Z9WB 1AXMA 3O49A 3VWCA 4I8MA 3R4UA 2FFVA 4P0JA 1QQLA 3WINA 1J0SA 1DQGA 1Q1UA 1PUMB 1JY0A 3LTQA 4QKRA 5F8YA 2HWMA 1MC9A 3CRHA 4IY9A 1DFQA 3OJVA 1Z0HA 9ILBA 3HN1A 4LO2C 3IM7A 4HA2A 4LO8B 1Z2VA 2DRYA 5E24E 1NZKA 1WD4A 4G9NA 21BIA 1JT7A 3WO2A 4ZKTB 2KI6B 2Y9GA 1TWMA 2F8XC 5BXSA 1I1EA 2MIBA 1WBAA 2Y9FA 8I1BA 1MD6A 2D22A 2HW9A 4IQPA 41BIA 1JLYA 2ZQOA 3KMVA 3OGFA 5JMCA 2LIEA 3FJFA 3O44A 5BOWA 1Q03A 1QQKA 2Z49A 5BP5A 4X3AA 3NJ5A 5EHAA 1R8OA 2RSTA 3HSMA
chains in the Genus database with same CATH topology
1SZ6B 3RMYA 3F1RA 2WBCA 5I1BA 3N7MA 1OQLB 1HCEA 4F83A 4ZFWB 3CU1B 4I2SA 4LO7C 3BB2A 4LO7B 1AVUA 4J2XA 3P6JA 4II0A 3CRIA 4JRAA 5BQUA 4WBCA 2DRZA 4XKIA 3PMEA 2NYYA 4IZXA 4J2YA 4LO1A 4LO0C 2AXMA 1DZDA 4GP0A 4ZLBB 6I1BA 7I1BA 2FO1A 4I4OA 1JTCA 3FJAA 4JAWA 5FZZA 3FGMA 3Q7YA 2RG9B 4A7KA 3BAOA 4GOYA 3CRGA 3CA4A 3S8JA 4XFTA 1JT4A 4OEGA 1II4A 4ZFYB 3V0BA 1RZOB 2L5XA 1BASA 3IIRA 4QKSA 3BAVA 1YTOA 2UUSA 2Q3NB 3H6RB 1JT3A 3AH4A 2QYIB 3UD9A 3I2XA 4X39A 3CA3A 1PZZA 4AN6A 2NP0A 1IT0A 1HWPB 2D1ZA 1ONKB 1CVSA 2VUAA 3RTIB 1R8NA 4USPA 3RMXA 1S0BA 3FJCA 4CJMA 2X2TA 3JRRA 2E4MA 4I4XA 1XG6A 3C9ZA 1ISXA 1S0EA 3FJIA 2NS2A 5JLVA 3K1XA 1QXMA 1HWMB 1S0CA 4YOLA 4OUJA 3WO3A 1G9DA 1ILR1 4QD2C 3BRGC 2K43A 4QD2B 4EFRA 1YBIA 3AKHA 4ZGRB 5FNWA 2P23A 2K4AB 1V6WA 3AKGA 1DLLA 3N0KA 3VT0A 1K5UA 1T9FA 4JP0A 2NM1A 3V0AA 2BFHA 3ILAA 4I37A 1DJSB 3MPPG 3ZC9A 3A07A 3OGGA 1Q04A 3Q7WA 1Z4SA 2NTDA 3BAQA 2DREA 1ISYA 2MLLB 5FNXA 4OWJA 4I6IA 1XHBA 1ISZA 5BXRA 4I1BA 4I7IA 2FGFA 4OEFA 1FWVA 2FFUA 3UD7A 3ZX7A 3UJ4A 3H6SE 4DEPA 3FJ9A 2NZ9A 3OJMA 1DIWA 5FZYA 4ZFUB 4ZOTA 4Q9GA 3Q7XA 4G9MA 1FGAA 1S0DA 3VSZA 1BFGA 1G82A 2D24A 2ESUA 5DSSB 3TC2A 1BLDA 4F34A 3A23A 4KEKA 1TP0A 4JKXB 3OJ2A 3BAHA 4Q91A 3B9UA 3UJ0A 4G1RA 3V79C 3POKA 4IONA 2MC2A 1HWOB 1AVAC 3MALA 4Z8SB 2D23A 1ISWA 3AH1A 4OWLA 1KNMA 3RSJA 3ZXDA 4KBBA 3OBRA 1HKNA 4KEIA 1YYNA 3AZVA 4L4HA 2D44A 4OWKA 4QBVA 2F2FC 2VU9A 3BA4A 2GO2A 3AJ6A 1IILA 1DQOA 5BVPI 3FJDA 3FJHA 4I4UA 3AJ5A 4LO0A 4P0KA 1W3GA 4Q9PA 3FJKA 1YXWA 1SR4C 3O4AA 1ISVA 1FWUA 2D20A 1JLXA 3O5WB 5B2HA 1EPWA 4MZHA 4A7YA 3UD8A 4MZGB 5F8SA 3LLPA 2VXTI 4R6UB 3NBNA 4LO3C 5F90A 3BAUA 3CA5A 2NVHA 2D7RA 2LIQA 4FVVA 3O4CA 3BX1C 4I1EA 4X38A 4GAFA 3O4OA 2P39A 3NBDA 4DENA 3H6RA 1RMLA 4P0LA 3F62B 1YF8B 4H75A 3FJEA 4I4SA 4D0TA 1EYLA 2AAIB 3FFZA 1TFMB 1FV2A 2BEAA 3N7LA 1DZCA 4IHZA 1EVTA 4TLPA 2HWAA 3WMVA 2XOAA 2ET2A 3PUBA 3VT1A 1W3AA 3ZC8A 1V6XA 4OEEA 1V6VA 1TWEA 3BADA 3VUOA 3FJJA 4IYBA 1TIEA 1ITBA 3R4SA 1BFFA 2ERMA 3CA0A 3WA1A 4EEEB 1AF9A 31BIA 3AH2A 3VT2A 4EB2B 1HCDA 2KKIA 1BFCA 3BAGA 4H04A 4I4YA 3O4BA 4J2SA 4EKXB 4HR6C 3H6QA 2KLLA 2ZQNA 1FMMS 2Q9XA 1IRPA 4J23B 1F31A 5D62A 2Y9WC 3VSFA 1PC8B 1FQ9A 5F8WA 3A22A 3HOMA 4GAIA 1IRAX 2Y9XE 4UY4A 1UPSA 2Z48A 1W3FA 3RTJB 3CAHA 3BRDA 1A8DA 1TTUA 1BA7A 3BRFA 3UDAA 1JT5A 1S0LA 4X37A 4ISRA 1N4KA 5EG6C 4A7ZA 4LO2A 4FGFA 3QYDA 4KEJA 1DFCA 3BA5A 2HZ9A 3T8SA 1BLAA 2FDBM 4I4RA 4OW4A 2WRYA 1FN0A 2X2SA 1GGPB 3WINC 4I4PA 4IY8A 5BXPA 1M16A 3IM6A 4I0YA 4GP3A 5HPZA 1L2HA 5D61A 3FJ8A 1RY7A 1S0FA 3QR5A 3WMUA 3SNVA 1HIBA 3JUTA 4H9WA 3P6IA 4L4IA 1ABRB 1FMZA 2GZBA 4ENDA 3W9TA 1WD3A 4EFPA 5BXTA 4GOVA 1PUUB 1AVWB 4I3NA 4G6MA 2F2FA 1HWNB 3I2AA 4JKQA 1VCLA 1CE7B 1M2TB 1BARA 4D0ZA 4J2KA 3HMYA 3O3QA 3HALA 5BP5C 5FZUA 1WBCA 1IOBA 3N7KA 3FUOA 1SR4A 4XFUA 5GAQA 3E8LC 3NBEA 3IAGC 2R9KB 1PWAA 2QN4A 4LO3A 3P53A 1XYFA 3FJBA 4D8HA 1BFBA 4XFSA 1JQZA 2D43A 1IHKA 4IZEA 5BQUC 5DZUA 2I1BA 2VSEA 4JPZA 3AKIA 2KH2A 2KI4A 1AFCA 3BTAA 4LO1C 1K5VA 3VEQA 1E0OA 4I4QA 4KC3A 1RG8A 1EV2A 4ISQA 4QBCA 2DS0A 3S8KA 4QC4A 4HJJA 3CQAA 5D63A 4QO3A 3FUQA 4I4VA 1FV3A 1G9BA 4ZBVB 3V0BB 1IJTA 3CA1A 3PG0A 1NUNA 3CA6A 2VSAA 3I29B 2RQ9A 5EC5A 2AQZA 3AKFA 1TOOA 2BEBA 4DCKC 3OBTA 2IHOA 4USOA 3NBCA 4I96A 2VXRA 3D7WB 5G00A 4QALA 3N7JA 4PC4A 2J3PA 2YUGA 5DUYA 1S0GA 1AVXB 4P6AA 3ZXGA 3HBWA 1G9AA 2M49A 1P63A 2E4MC 2K8RA 2IWTB 2VLCA 1V6UA 3WO4A 1I1BA 4AN7B 3IM5A 4MZFB 2D7IA 1T4QA 3O4DA 4ZA3B 1G9CA 3PHZA 3AZWA 4JQ0A 4G6JA 2ZR1B 3BA7A 3EF2A 3V0AB 4EFQA 1D0HA 1XZZA 2AFGA 3A21A 5DVHA 4Z9WB 1AXMA 3O49A 3VWCA 4I8MA 3R4UA 2FFVA 4P0JA 1QQLA 3WINA 1J0SA 1DQGA 1Q1UA 1PUMB 1JY0A 3LTQA 4QKRA 5F8YA 2HWMA 1MC9A 3CRHA 4IY9A 1DFQA 3OJVA 1Z0HA 9ILBA 3HN1A 4LO2C 3IM7A 4HA2A 4LO8B 1Z2VA 2DRYA 5E24E 1NZKA 1WD4A 4G9NA 21BIA 1JT7A 3WO2A 4ZKTB 2KI6B 2Y9GA 1TWMA 2F8XC 5BXSA 1I1EA 2MIBA 1WBAA 2Y9FA 8I1BA 1MD6A 2D22A 2HW9A 4IQPA 41BIA 1JLYA 2ZQOA 3KMVA 3OGFA 5JMCA 2LIEA 3FJFA 3O44A 5BOWA 1Q03A 1QQKA 2Z49A 5BP5A 4X3AA 3NJ5A 5EHAA 1R8OA 2RSTA 3HSMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SZ6 B;  3RMY A;  3F1R A;  2WBC A;  5I1B A;  3N7M A;  1OQL B;  1HCE A;  4F83 A;  4ZFW B;  3CU1 B;  4I2S A;  4LO7 C;  3BB2 A;  4LO7 B;  1AVU A;  4J2X A;  3P6J A;  4II0 A;  3CRI A;  4JRA A;  5BQU A;  4WBC A;  2DRZ A;  4XKI A;  3PME A;  2NYY A;  4IZX A;  4J2Y A;  4LO1 A;  4LO0 C;  2AXM A;  1DZD A;  4GP0 A;  4ZLB B;  6I1B A;  7I1B A;  2FO1 A;  4I4O A;  1JTC A;  3FJA A;  4JAW A;  5FZZ A;  3FGM A;  3Q7Y A;  2RG9 B;  4A7K A;  3BAO A;  4GOY A;  3CRG A;  3CA4 A;  3S8J A;  4XFT A;  1JT4 A;  4OEG A;  1II4 A;  4ZFY B;  3V0B A;  1RZO B;  2L5X A;  1BAS A;  3IIR A;  4QKS A;  3BAV A;  1YTO A;  2UUS A;  2Q3N B;  3H6R B;  1JT3 A;  3AH4 A;  2QYI B;  3UD9 A;  3I2X A;  4X39 A;  3CA3 A;  1PZZ A;  4AN6 A;  2NP0 A;  1IT0 A;  1HWP B;  2D1Z A;  1ONK B;  1CVS A;  2VUA A;  3RTI B;  1R8N A;  4USP A;  3RMX A;  1S0B A;  3FJC A;  4CJM A;  2X2T A;  3JRR A;  2E4M A;  4I4X A;  1XG6 A;  3C9Z A;  1ISX A;  1S0E A;  3FJI A;  5JLV A;  3K1X A;  1QXM A;  1HWM B;  1S0C A;  4YOL A;  4OUJ A;  3WO3 A;  1G9D A;  1ILR 1;  4QD2 C;  3BRG C;  2K43 A;  4QD2 B;  4EFR A;  1YBI A;  3AKH A;  4ZGR B;  5FNW A;  2P23 A;  2K4A B;  1V6W A;  3AKG A;  1DLL A;  3N0K A;  3VT0 A;  1K5U A;  1T9F A;  4JP0 A;  2NM1 A;  3V0A A;  2BFH A;  3ILA A;  4I37 A;  1DJS B;  3MPP G;  3ZC9 A;  3A07 A;  3OGG A;  1Q04 A;  3Q7W A;  1Z4S A;  2NTD A;  3BAQ A;  2DRE A;  1ISY A;  2MLL B;  5FNX A;  4OWJ A;  4I6I A;  1XHB A;  1ISZ A;  5BXR A;  4I1B A;  4I7I A;  2FGF A;  4OEF A;  1FWV A;  2FFU A;  3UD7 A;  3ZX7 A;  3UJ4 A;  3H6S E;  4DEP A;  3FJ9 A;  2NZ9 A;  3OJM A;  1DIW A;  5FZY A;  4ZFU B;  4ZOT A;  4Q9G A;  3Q7X A;  4G9M A;  1FGA A;  1S0D A;  3VSZ A;  1BFG A;  1G82 A;  2D24 A;  2ESU A;  5DSS B;  3TC2 A;  1BLD A;  4F34 A;  3A23 A;  4KEK A;  1TP0 A;  4JKX B;  3OJ2 A;  3BAH A;  4Q91 A;  3B9U A;  3UJ0 A;  4G1R A;  3V79 C;  3POK A;  4ION A;  2MC2 A;  1HWO B;  1AVA C;  3MAL A;  4Z8S B;  2D23 A;  1ISW A;  3AH1 A;  4OWL A;  1KNM A;  3RSJ A;  3ZXD A;  4KBB A;  3OBR A;  1HKN A;  4KEI A;  1YYN A;  3AZV A;  4L4H A;  2D44 A;  4OWK A;  4QBV A;  2F2F C;  2VU9 A;  3BA4 A;  2GO2 A;  3AJ6 A;  1IIL A;  1DQO A;  5BVP I;  3FJD A;  3FJH A;  4I4U A;  3AJ5 A;  4LO0 A;  4P0K A;  1W3G A;  4Q9P A;  3FJK A;  1YXW A;  1SR4 C;  3O4A A;  1ISV A;  1FWU A;  2D20 A;  1JLX A;  3O5W B;  5B2H A;  1EPW A;  4A7Y A;  3UD8 A;  5F8S A;  3LLP A;  2VXT I;  4R6U B;  3NBN A;  4LO3 C;  5F90 A;  3BAU A;  3CA5 A;  2NVH A;  2D7R A;  2LIQ A;  4FVV A;  3O4C A;  3BX1 C;  4I1E A;  4X38 A;  4GAF A;  3O4O A;  2P39 A;  3NBD A;  4DEN A;  3H6R A;  1RML A;  4P0L A;  3F62 B;  1YF8 B;  4I4S A;  3FJE A;  4D0T A;  1EYL A;  2AAI B;  3FFZ A;  1TFM B;  1FV2 A;  2BEA A;  3N7L A;  1DZC A;  4IHZ A;  1EVT A;  4TLP A;  2HWA A;  3WMV A;  2XOA A;  2ET2 A;  3PUB A;  3VT1 A;  1W3A A;  3ZC8 A;  1V6X A;  4OEE A;  1V6V A;  1TWE A;  3BAD A;  3VUO A;  3FJJ A;  4IYB A;  1TIE A;  1ITB A;  3R4S A;  1BFF A;  2ERM A;  3CA0 A;  3WA1 A;  4EEE B;  1AF9 A;  31BI A;  3AH2 A;  3VT2 A;  4EB2 B;  1HCD A;  2KKI A;  1BFC A;  3BAG A;  4H04 A;  4I4Y A;  3O4B A;  4J2S A;  4EKX B;  4HR6 C;  3H6Q A;  2KLL A;  2ZQN A;  1FMM S;  2Q9X A;  1IRP A;  4J23 B;  1F31 A;  5D62 A;  2Y9W C;  3VSF A;  1PC8 B;  1FQ9 A;  5F8W A;  3A22 A;  3HOM A;  4GAI A;  1IRA X;  2Y9X E;  1UPS A;  2Z48 A;  1W3F A;  3RTJ B;  3CAH A;  3BRD A;  1A8D A;  1TTU A;  1BA7 A;  3BRF A;  3UDA A;  1JT5 A;  1S0L A;  4X37 A;  4ISR A;  1N4K A;  5EG6 C;  4A7Z A;  4LO2 A;  4FGF A;  3QYD A;  4KEJ A;  1DFC A;  3BA5 A;  2HZ9 A;  3T8S A;  1BLA A;  2FDB M;  4I4R A;  4OW4 A;  2WRY A;  1FN0 A;  2X2S A;  1GGP B;  3WIN C;  4I4P A;  4IY8 A;  5BXP A;  1M16 A;  3IM6 A;  4I0Y A;  4GP3 A;  5HPZ A;  1L2H A;  5D61 A;  3FJ8 A;  1RY7 A;  1S0F A;  3QR5 A;  3WMU A;  3SNV A;  1HIB A;  3JUT A;  4H9W A;  3P6I A;  4L4I A;  1ABR B;  1FMZ A;  2GZB A;  4END A;  3W9T A;  1WD3 A;  4EFP A;  5BXT A;  4GOV A;  1PUU B;  1AVW B;  4I3N A;  4G6M A;  2F2F A;  1HWN B;  3I2A A;  4JKQ A;  1VCL A;  1CE7 B;  1M2T B;  1BAR A;  4D0Z A;  4J2K A;  3HMY A;  3O3Q A;  3HAL A;  5BP5 C;  5FZU A;  1WBC A;  1IOB A;  3N7K A;  3FUO A;  1SR4 A;  4XFU A;  5GAQ A;  3E8L C;  3NBE A;  3IAG C;  2R9K B;  1PWA A;  2QN4 A;  4LO3 A;  3P53 A;  1XYF A;  3FJB A;  4D8H A;  1BFB A;  4XFS A;  1JQZ A;  2D43 A;  1IHK A;  4IZE A;  5BQU C;  5DZU A;  2I1B A;  2VSE A;  4JPZ A;  3AKI A;  2KH2 A;  2KI4 A;  1AFC A;  3BTA A;  4LO1 C;  1K5V A;  3VEQ A;  1E0O A;  4I4Q A;  4KC3 A;  1RG8 A;  1EV2 A;  4ISQ A;  4QBC A;  2DS0 A;  3S8K A;  4QC4 A;  4HJJ A;  3CQA A;  5D63 A;  4QO3 A;  3FUQ A;  4I4V A;  1FV3 A;  1G9B A;  4ZBV B;  3V0B B;  1IJT A;  3CA1 A;  3PG0 A;  1NUN A;  3CA6 A;  2VSA A;  3I29 B;  2RQ9 A;  5EC5 A;  2AQZ A;  3AKF A;  1TOO A;  2BEB A;  4DCK C;  3OBT A;  2IHO A;  4USO A;  3NBC A;  4I96 A;  2VXR A;  3D7W B;  5G00 A;  4QAL A;  3N7J A;  4PC4 A;  2J3P A;  2YUG A;  5DUY A;  1S0G A;  1AVX B;  4P6A A;  3ZXG A;  3HBW A;  1G9A A;  2M49 A;  1P63 A;  2E4M C;  2K8R A;  2IWT B;  2VLC A;  1V6U A;  3WO4 A;  1I1B A;  4AN7 B;  3IM5 A;  2D7I A;  1T4Q A;  3O4D A;  4ZA3 B;  1G9C A;  3PHZ A;  3AZW A;  4JQ0 A;  4G6J A;  2ZR1 B;  3BA7 A;  3EF2 A;  3V0A B;  4EFQ A;  1D0H A;  1XZZ A;  2AFG A;  3A21 A;  5DVH A;  4Z9W B;  1AXM A;  3O49 A;  3VWC A;  4I8M A;  3R4U A;  2FFV A;  4P0J A;  1QQL A;  3WIN A;  1J0S A;  1DQG A;  1Q1U A;  1PUM B;  1JY0 A;  3LTQ A;  4QKR A;  5F8Y A;  2HWM A;  1MC9 A;  3CRH A;  4IY9 A;  1DFQ A;  3OJV A;  1Z0H A;  9ILB A;  3HN1 A;  4LO2 C;  3IM7 A;  4HA2 A;  4LO8 B;  1Z2V A;  2DRY A;  5E24 E;  1NZK A;  1WD4 A;  4G9N A;  21BI A;  1JT7 A;  3WO2 A;  4ZKT B;  2KI6 B;  2Y9G A;  1TWM A;  2F8X C;  5BXS A;  1I1E A;  2MIB A;  1WBA A;  2Y9F A;  8I1B A;  1MD6 A;  2D22 A;  2HW9 A;  4IQP A;  41BI A;  1JLY A;  2ZQO A;  3KMV A;  3OGF A;  5JMC A;  2LIE A;  3FJF A;  3O44 A;  5BOW A;  1Q03 A;  1QQK A;  2Z49 A;  5BP5 A;  4X3A A;  3NJ5 A;  5EHA A;  1R8O A;  2RST A;  3HSM A; 
#chains in the Genus database with same CATH topology
 1SZ6 B;  3RMY A;  3F1R A;  2WBC A;  5I1B A;  3N7M A;  1OQL B;  1HCE A;  4F83 A;  4ZFW B;  3CU1 B;  4I2S A;  4LO7 C;  3BB2 A;  4LO7 B;  1AVU A;  4J2X A;  3P6J A;  4II0 A;  3CRI A;  4JRA A;  5BQU A;  4WBC A;  2DRZ A;  4XKI A;  3PME A;  2NYY A;  4IZX A;  4J2Y A;  4LO1 A;  4LO0 C;  2AXM A;  1DZD A;  4GP0 A;  4ZLB B;  6I1B A;  7I1B A;  2FO1 A;  4I4O A;  1JTC A;  3FJA A;  4JAW A;  5FZZ A;  3FGM A;  3Q7Y A;  2RG9 B;  4A7K A;  3BAO A;  4GOY A;  3CRG A;  3CA4 A;  3S8J A;  4XFT A;  1JT4 A;  4OEG A;  1II4 A;  4ZFY B;  3V0B A;  1RZO B;  2L5X A;  1BAS A;  3IIR A;  4QKS A;  3BAV A;  1YTO A;  2UUS A;  2Q3N B;  3H6R B;  1JT3 A;  3AH4 A;  2QYI B;  3UD9 A;  3I2X A;  4X39 A;  3CA3 A;  1PZZ A;  4AN6 A;  2NP0 A;  1IT0 A;  1HWP B;  2D1Z A;  1ONK B;  1CVS A;  2VUA A;  3RTI B;  1R8N A;  4USP A;  3RMX A;  1S0B A;  3FJC A;  4CJM A;  2X2T A;  3JRR A;  2E4M A;  4I4X A;  1XG6 A;  3C9Z A;  1ISX A;  1S0E A;  3FJI A;  2NS2 A;  5JLV A;  3K1X A;  1QXM A;  1HWM B;  1S0C A;  4YOL A;  4OUJ A;  3WO3 A;  1G9D A;  1ILR 1;  4QD2 C;  3BRG C;  2K43 A;  4QD2 B;  4EFR A;  1YBI A;  3AKH A;  4ZGR B;  5FNW A;  2P23 A;  2K4A B;  1V6W A;  3AKG A;  1DLL A;  3N0K A;  3VT0 A;  1K5U A;  1T9F A;  4JP0 A;  2NM1 A;  3V0A A;  2BFH A;  3ILA A;  4I37 A;  1DJS B;  3MPP G;  3ZC9 A;  3A07 A;  3OGG A;  1Q04 A;  3Q7W A;  1Z4S A;  2NTD A;  3BAQ A;  2DRE A;  1ISY A;  2MLL B;  5FNX A;  4OWJ A;  4I6I A;  1XHB A;  1ISZ A;  5BXR A;  4I1B A;  4I7I A;  2FGF A;  4OEF A;  1FWV A;  2FFU A;  3UD7 A;  3ZX7 A;  3UJ4 A;  3H6S E;  4DEP A;  3FJ9 A;  2NZ9 A;  3OJM A;  1DIW A;  5FZY A;  4ZFU B;  4ZOT A;  4Q9G A;  3Q7X A;  4G9M A;  1FGA A;  1S0D A;  3VSZ A;  1BFG A;  1G82 A;  2D24 A;  2ESU A;  5DSS B;  3TC2 A;  1BLD A;  4F34 A;  3A23 A;  4KEK A;  1TP0 A;  4JKX B;  3OJ2 A;  3BAH A;  4Q91 A;  3B9U A;  3UJ0 A;  4G1R A;  3V79 C;  3POK A;  4ION A;  2MC2 A;  1HWO B;  1AVA C;  3MAL A;  4Z8S B;  2D23 A;  1ISW A;  3AH1 A;  4OWL A;  1KNM A;  3RSJ A;  3ZXD A;  4KBB A;  3OBR A;  1HKN A;  4KEI A;  1YYN A;  3AZV A;  4L4H A;  2D44 A;  4OWK A;  4QBV A;  2F2F C;  2VU9 A;  3BA4 A;  2GO2 A;  3AJ6 A;  1IIL A;  1DQO A;  5BVP I;  3FJD A;  3FJH A;  4I4U A;  3AJ5 A;  4LO0 A;  4P0K A;  1W3G A;  4Q9P A;  3FJK A;  1YXW A;  1SR4 C;  3O4A A;  1ISV A;  1FWU A;  2D20 A;  1JLX A;  3O5W B;  5B2H A;  1EPW A;  4MZH A;  4A7Y A;  3UD8 A;  4MZG B;  5F8S A;  3LLP A;  2VXT I;  4R6U B;  3NBN A;  4LO3 C;  5F90 A;  3BAU A;  3CA5 A;  2NVH A;  2D7R A;  2LIQ A;  4FVV A;  3O4C A;  3BX1 C;  4I1E A;  4X38 A;  4GAF A;  3O4O A;  2P39 A;  3NBD A;  4DEN A;  3H6R A;  1RML A;  4P0L A;  3F62 B;  1YF8 B;  4H75 A;  3FJE A;  4I4S A;  4D0T A;  1EYL A;  2AAI B;  3FFZ A;  1TFM B;  1FV2 A;  2BEA A;  3N7L A;  1DZC A;  4IHZ A;  1EVT A;  4TLP A;  2HWA A;  3WMV A;  2XOA A;  2ET2 A;  3PUB A;  3VT1 A;  1W3A A;  3ZC8 A;  1V6X A;  4OEE A;  1V6V A;  1TWE A;  3BAD A;  3VUO A;  3FJJ A;  4IYB A;  1TIE A;  1ITB A;  3R4S A;  1BFF A;  2ERM A;  3CA0 A;  3WA1 A;  4EEE B;  1AF9 A;  31BI A;  3AH2 A;  3VT2 A;  4EB2 B;  1HCD A;  2KKI A;  1BFC A;  3BAG A;  4H04 A;  4I4Y A;  3O4B A;  4J2S A;  4EKX B;  4HR6 C;  3H6Q A;  2KLL A;  2ZQN A;  1FMM S;  2Q9X A;  1IRP A;  4J23 B;  1F31 A;  5D62 A;  2Y9W C;  3VSF A;  1PC8 B;  1FQ9 A;  5F8W A;  3A22 A;  3HOM A;  4GAI A;  1IRA X;  2Y9X E;  4UY4 A;  1UPS A;  2Z48 A;  1W3F A;  3RTJ B;  3CAH A;  3BRD A;  1A8D A;  1TTU A;  1BA7 A;  3BRF A;  3UDA A;  1JT5 A;  1S0L A;  4X37 A;  4ISR A;  1N4K A;  5EG6 C;  4A7Z A;  4LO2 A;  4FGF A;  3QYD A;  4KEJ A;  1DFC A;  3BA5 A;  2HZ9 A;  3T8S A;  1BLA A;  2FDB M;  4I4R A;  4OW4 A;  2WRY A;  1FN0 A;  2X2S A;  1GGP B;  3WIN C;  4I4P A;  4IY8 A;  5BXP A;  1M16 A;  3IM6 A;  4I0Y A;  4GP3 A;  5HPZ A;  1L2H A;  5D61 A;  3FJ8 A;  1RY7 A;  1S0F A;  3QR5 A;  3WMU A;  3SNV A;  1HIB A;  3JUT A;  4H9W A;  3P6I A;  4L4I A;  1ABR B;  1FMZ A;  2GZB A;  4END A;  3W9T A;  1WD3 A;  4EFP A;  5BXT A;  4GOV A;  1PUU B;  1AVW B;  4I3N A;  4G6M A;  2F2F A;  1HWN B;  3I2A A;  4JKQ A;  1VCL A;  1CE7 B;  1M2T B;  1BAR A;  4D0Z A;  4J2K A;  3HMY A;  3O3Q A;  3HAL A;  5BP5 C;  5FZU A;  1WBC A;  1IOB A;  3N7K A;  3FUO A;  1SR4 A;  4XFU A;  5GAQ A;  3E8L C;  3NBE A;  3IAG C;  2R9K B;  1PWA A;  2QN4 A;  4LO3 A;  3P53 A;  1XYF A;  3FJB A;  4D8H A;  1BFB A;  4XFS A;  1JQZ A;  2D43 A;  1IHK A;  4IZE A;  5BQU C;  5DZU A;  2I1B A;  2VSE A;  4JPZ A;  3AKI A;  2KH2 A;  2KI4 A;  1AFC A;  3BTA A;  4LO1 C;  1K5V A;  3VEQ A;  1E0O A;  4I4Q A;  4KC3 A;  1RG8 A;  1EV2 A;  4ISQ A;  4QBC A;  2DS0 A;  3S8K A;  4QC4 A;  4HJJ A;  3CQA A;  5D63 A;  4QO3 A;  3FUQ A;  4I4V A;  1FV3 A;  1G9B A;  4ZBV B;  3V0B B;  1IJT A;  3CA1 A;  3PG0 A;  1NUN A;  3CA6 A;  2VSA A;  3I29 B;  2RQ9 A;  5EC5 A;  2AQZ A;  3AKF A;  1TOO A;  2BEB A;  4DCK C;  3OBT A;  2IHO A;  4USO A;  3NBC A;  4I96 A;  2VXR A;  3D7W B;  5G00 A;  4QAL A;  3N7J A;  4PC4 A;  2J3P A;  2YUG A;  5DUY A;  1S0G A;  1AVX B;  4P6A A;  3ZXG A;  3HBW A;  1G9A A;  2M49 A;  1P63 A;  2E4M C;  2K8R A;  2IWT B;  2VLC A;  1V6U A;  3WO4 A;  1I1B A;  4AN7 B;  3IM5 A;  4MZF B;  2D7I A;  1T4Q A;  3O4D A;  4ZA3 B;  1G9C A;  3PHZ A;  3AZW A;  4JQ0 A;  4G6J A;  2ZR1 B;  3BA7 A;  3EF2 A;  3V0A B;  4EFQ A;  1D0H A;  1XZZ A;  2AFG A;  3A21 A;  5DVH A;  4Z9W B;  1AXM A;  3O49 A;  3VWC A;  4I8M A;  3R4U A;  2FFV A;  4P0J A;  1QQL A;  3WIN A;  1J0S A;  1DQG A;  1Q1U A;  1PUM B;  1JY0 A;  3LTQ A;  4QKR A;  5F8Y A;  2HWM A;  1MC9 A;  3CRH A;  4IY9 A;  1DFQ A;  3OJV A;  1Z0H A;  9ILB A;  3HN1 A;  4LO2 C;  3IM7 A;  4HA2 A;  4LO8 B;  1Z2V A;  2DRY A;  5E24 E;  1NZK A;  1WD4 A;  4G9N A;  21BI A;  1JT7 A;  3WO2 A;  4ZKT B;  2KI6 B;  2Y9G A;  1TWM A;  2F8X C;  5BXS A;  1I1E A;  2MIB A;  1WBA A;  2Y9F A;  8I1B A;  1MD6 A;  2D22 A;  2HW9 A;  4IQP A;  41BI A;  1JLY A;  2ZQO A;  3KMV A;  3OGF A;  5JMC A;  2LIE A;  3FJF A;  3O44 A;  5BOW A;  1Q03 A;  1QQK A;  2Z49 A;  5BP5 A;  4X3A A;  3NJ5 A;  5EHA A;  1R8O A;  2RST A;  3HSM A; 
#chains in the Genus database with same CATH homology
 1SZ6 B;  3RMY A;  3F1R A;  2WBC A;  5I1B A;  3N7M A;  1OQL B;  1HCE A;  4F83 A;  4ZFW B;  3CU1 B;  4I2S A;  4LO7 C;  3BB2 A;  4LO7 B;  1AVU A;  4J2X A;  3P6J A;  4II0 A;  3CRI A;  4JRA A;  5BQU A;  4WBC A;  2DRZ A;  4XKI A;  3PME A;  2NYY A;  4IZX A;  4J2Y A;  4LO1 A;  4LO0 C;  2AXM A;  1DZD A;  4GP0 A;  4ZLB B;  6I1B A;  7I1B A;  2FO1 A;  4I4O A;  1JTC A;  3FJA A;  4JAW A;  5FZZ A;  3FGM A;  3Q7Y A;  2RG9 B;  4A7K A;  3BAO A;  4GOY A;  3CRG A;  3CA4 A;  3S8J A;  4XFT A;  1JT4 A;  4OEG A;  1II4 A;  4ZFY B;  3V0B A;  1RZO B;  2L5X A;  1BAS A;  3IIR A;  4QKS A;  3BAV A;  1YTO A;  2UUS A;  2Q3N B;  3H6R B;  1JT3 A;  3AH4 A;  2QYI B;  3UD9 A;  3I2X A;  4X39 A;  3CA3 A;  1PZZ A;  4AN6 A;  2NP0 A;  1IT0 A;  1HWP B;  2D1Z A;  1ONK B;  1CVS A;  2VUA A;  3RTI B;  1R8N A;  4USP A;  3RMX A;  1S0B A;  3FJC A;  4CJM A;  2X2T A;  3JRR A;  2E4M A;  4I4X A;  1XG6 A;  3C9Z A;  1ISX A;  1S0E A;  3FJI A;  2NS2 A;  5JLV A;  3K1X A;  1QXM A;  1HWM B;  1S0C A;  4YOL A;  4OUJ A;  3WO3 A;  1G9D A;  1ILR 1;  4QD2 C;  3BRG C;  2K43 A;  4QD2 B;  4EFR A;  1YBI A;  3AKH A;  4ZGR B;  5FNW A;  2P23 A;  2K4A B;  1V6W A;  3AKG A;  1DLL A;  3N0K A;  3VT0 A;  1K5U A;  1T9F A;  4JP0 A;  2NM1 A;  3V0A A;  2BFH A;  3ILA A;  4I37 A;  1DJS B;  3MPP G;  3ZC9 A;  3A07 A;  3OGG A;  1Q04 A;  3Q7W A;  1Z4S A;  2NTD A;  3BAQ A;  2DRE A;  1ISY A;  2MLL B;  5FNX A;  4OWJ A;  4I6I A;  1XHB A;  1ISZ A;  5BXR A;  4I1B A;  4I7I A;  2FGF A;  4OEF A;  1FWV A;  2FFU A;  3UD7 A;  3ZX7 A;  3UJ4 A;  3H6S E;  4DEP A;  3FJ9 A;  2NZ9 A;  3OJM A;  1DIW A;  5FZY A;  4ZFU B;  4ZOT A;  4Q9G A;  3Q7X A;  4G9M A;  1FGA A;  1S0D A;  3VSZ A;  1BFG A;  1G82 A;  2D24 A;  2ESU A;  5DSS B;  3TC2 A;  1BLD A;  4F34 A;  3A23 A;  4KEK A;  1TP0 A;  4JKX B;  3OJ2 A;  3BAH A;  4Q91 A;  3B9U A;  3UJ0 A;  4G1R A;  3V79 C;  3POK A;  4ION A;  2MC2 A;  1HWO B;  1AVA C;  3MAL A;  4Z8S B;  2D23 A;  1ISW A;  3AH1 A;  4OWL A;  1KNM A;  3RSJ A;  3ZXD A;  4KBB A;  3OBR A;  1HKN A;  4KEI A;  1YYN A;  3AZV A;  4L4H A;  2D44 A;  4OWK A;  4QBV A;  2F2F C;  2VU9 A;  3BA4 A;  2GO2 A;  3AJ6 A;  1IIL A;  1DQO A;  5BVP I;  3FJD A;  3FJH A;  4I4U A;  3AJ5 A;  4LO0 A;  4P0K A;  1W3G A;  4Q9P A;  3FJK A;  1YXW A;  1SR4 C;  3O4A A;  1ISV A;  1FWU A;  2D20 A;  1JLX A;  3O5W B;  5B2H A;  1EPW A;  4MZH A;  4A7Y A;  3UD8 A;  4MZG B;  5F8S A;  3LLP A;  2VXT I;  4R6U B;  3NBN A;  4LO3 C;  5F90 A;  3BAU A;  3CA5 A;  2NVH A;  2D7R A;  2LIQ A;  4FVV A;  3O4C A;  3BX1 C;  4I1E A;  4X38 A;  4GAF A;  3O4O A;  2P39 A;  3NBD A;  4DEN A;  3H6R A;  1RML A;  4P0L A;  3F62 B;  1YF8 B;  4H75 A;  3FJE A;  4I4S A;  4D0T A;  1EYL A;  2AAI B;  3FFZ A;  1TFM B;  1FV2 A;  2BEA A;  3N7L A;  1DZC A;  4IHZ A;  1EVT A;  4TLP A;  2HWA A;  3WMV A;  2XOA A;  2ET2 A;  3PUB A;  3VT1 A;  1W3A A;  3ZC8 A;  1V6X A;  4OEE A;  1V6V A;  1TWE A;  3BAD A;  3VUO A;  3FJJ A;  4IYB A;  1TIE A;  1ITB A;  3R4S A;  1BFF A;  2ERM A;  3CA0 A;  3WA1 A;  4EEE B;  1AF9 A;  31BI A;  3AH2 A;  3VT2 A;  4EB2 B;  1HCD A;  2KKI A;  1BFC A;  3BAG A;  4H04 A;  4I4Y A;  3O4B A;  4J2S A;  4EKX B;  4HR6 C;  3H6Q A;  2KLL A;  2ZQN A;  1FMM S;  2Q9X A;  1IRP A;  4J23 B;  1F31 A;  5D62 A;  2Y9W C;  3VSF A;  1PC8 B;  1FQ9 A;  5F8W A;  3A22 A;  3HOM A;  4GAI A;  1IRA X;  2Y9X E;  4UY4 A;  1UPS A;  2Z48 A;  1W3F A;  3RTJ B;  3CAH A;  3BRD A;  1A8D A;  1TTU A;  1BA7 A;  3BRF A;  3UDA A;  1JT5 A;  1S0L A;  4X37 A;  4ISR A;  1N4K A;  5EG6 C;  4A7Z A;  4LO2 A;  4FGF A;  3QYD A;  4KEJ A;  1DFC A;  3BA5 A;  2HZ9 A;  3T8S A;  1BLA A;  2FDB M;  4I4R A;  4OW4 A;  2WRY A;  1FN0 A;  2X2S A;  1GGP B;  3WIN C;  4I4P A;  4IY8 A;  5BXP A;  1M16 A;  3IM6 A;  4I0Y A;  4GP3 A;  5HPZ A;  1L2H A;  5D61 A;  3FJ8 A;  1RY7 A;  1S0F A;  3QR5 A;  3WMU A;  3SNV A;  1HIB A;  3JUT A;  4H9W A;  3P6I A;  4L4I A;  1ABR B;  1FMZ A;  2GZB A;  4END A;  3W9T A;  1WD3 A;  4EFP A;  5BXT A;  4GOV A;  1PUU B;  1AVW B;  4I3N A;  4G6M A;  2F2F A;  1HWN B;  3I2A A;  4JKQ A;  1VCL A;  1CE7 B;  1M2T B;  1BAR A;  4D0Z A;  4J2K A;  3HMY A;  3O3Q A;  3HAL A;  5BP5 C;  5FZU A;  1WBC A;  1IOB A;  3N7K A;  3FUO A;  1SR4 A;  4XFU A;  5GAQ A;  3E8L C;  3NBE A;  3IAG C;  2R9K B;  1PWA A;  2QN4 A;  4LO3 A;  3P53 A;  1XYF A;  3FJB A;  4D8H A;  1BFB A;  4XFS A;  1JQZ A;  2D43 A;  1IHK A;  4IZE A;  5BQU C;  5DZU A;  2I1B A;  2VSE A;  4JPZ A;  3AKI A;  2KH2 A;  2KI4 A;  1AFC A;  3BTA A;  4LO1 C;  1K5V A;  3VEQ A;  1E0O A;  4I4Q A;  4KC3 A;  1RG8 A;  1EV2 A;  4ISQ A;  4QBC A;  2DS0 A;  3S8K A;  4QC4 A;  4HJJ A;  3CQA A;  5D63 A;  4QO3 A;  3FUQ A;  4I4V A;  1FV3 A;  1G9B A;  4ZBV B;  3V0B B;  1IJT A;  3CA1 A;  3PG0 A;  1NUN A;  3CA6 A;  2VSA A;  3I29 B;  2RQ9 A;  5EC5 A;  2AQZ A;  3AKF A;  1TOO A;  2BEB A;  4DCK C;  3OBT A;  2IHO A;  4USO A;  3NBC A;  4I96 A;  2VXR A;  3D7W B;  5G00 A;  4QAL A;  3N7J A;  4PC4 A;  2J3P A;  2YUG A;  5DUY A;  1S0G A;  1AVX B;  4P6A A;  3ZXG A;  3HBW A;  1G9A A;  2M49 A;  1P63 A;  2E4M C;  2K8R A;  2IWT B;  2VLC A;  1V6U A;  3WO4 A;  1I1B A;  4AN7 B;  3IM5 A;  4MZF B;  2D7I A;  1T4Q A;  3O4D A;  4ZA3 B;  1G9C A;  3PHZ A;  3AZW A;  4JQ0 A;  4G6J A;  2ZR1 B;  3BA7 A;  3EF2 A;  3V0A B;  4EFQ A;  1D0H A;  1XZZ A;  2AFG A;  3A21 A;  5DVH A;  4Z9W B;  1AXM A;  3O49 A;  3VWC A;  4I8M A;  3R4U A;  2FFV A;  4P0J A;  1QQL A;  3WIN A;  1J0S A;  1DQG A;  1Q1U A;  1PUM B;  1JY0 A;  3LTQ A;  4QKR A;  5F8Y A;  2HWM A;  1MC9 A;  3CRH A;  4IY9 A;  1DFQ A;  3OJV A;  1Z0H A;  9ILB A;  3HN1 A;  4LO2 C;  3IM7 A;  4HA2 A;  4LO8 B;  1Z2V A;  2DRY A;  5E24 E;  1NZK A;  1WD4 A;  4G9N A;  21BI A;  1JT7 A;  3WO2 A;  4ZKT B;  2KI6 B;  2Y9G A;  1TWM A;  2F8X C;  5BXS A;  1I1E A;  2MIB A;  1WBA A;  2Y9F A;  8I1B A;  1MD6 A;  2D22 A;  2HW9 A;  4IQP A;  41BI A;  1JLY A;  2ZQO A;  3KMV A;  3OGF A;  5JMC A;  2LIE A;  3FJF A;  3O44 A;  5BOW A;  1Q03 A;  1QQK A;  2Z49 A;  5BP5 A;  4X3A A;  3NJ5 A;  5EHA A;  1R8O A;  2RST A;  3HSM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...