3O52A

Structure of the e.coli gdp-mannose hydrolase (yffh) in complex with tartrate
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
189
structure length
175
Chain Sequence
QQITLIKDKILSDNYFTLHNITYDLTRKDGEVIRHKREVYDRGNGATILLYNTKKKTVVLIRQFRVATWVNGNESGQLIESCAGLLDNDEPEVCIRKEAIEETGYEVGEVRKLFELYMSPGGVTELIHFFIAEYSDIEVLELPFSQALEMIKTGEIRDGKTVLLLNYLQTSHLMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-mannose pyrophosphatase nudK
publication title Structural studies of the Nudix GDP-mannose hydrolase from E. coli reveals a new motif for mannose recognition.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 49
structure length 175
sequence length 189
chains with identical sequence B, C, D, E
ec nomenclature ec 3.6.1.-:
pdb deposition date 2010-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3o52A00
2RRKA 4DYWA 1VC8A 5GHNA 2B06A 3HYQA 2Q9PA 5C7QA 2B0VA 1XSCA 1V8RA 4NFXA 1PPWA 4YPHA 1MQWA 3SHDA 1IRYA 5BONA 1SOIA 4K6EA 2J8QA 3BM4A 5I8UA 2DSBA 3KVHA 3ZR0A 3OGAA 3GWYA 3EXQA 2O5WA 3U53A 3A6TA 3O61A 5IW4A 1V8TA 3SMDA 2A8TA 2FKBA 4IJXA 3A6SA 4NFWA 2QKMB 4YPRA 1SJYA 1V8SA 1VHGA 4ZG0A 3FSPA 3X0NA 2A8PA 4S2WA 5CFIA 2GT2A 2QJTA 1MP2A 5DPKA 1GA7A 1PUSA 3I7UA 2DSCA 1OW2A 1PVFA 4KG4A 5LPGA 3N9UA 3FK9A 3GZ5A 4V14A 2YYHA 3GG6A 3Q4IA 3X0LA 1U20A 3DKUA 2DUKA 3L85A 2YVPA 3Q91A 3R03A 5DDGA 4KYXA 3BHOA 2YVNA 3ZR1A 1NQYA 3WHWA 1VK6A 4C9XA 2FMLA 2XSQA 2A8QA 4ICKA 5FSKA 1VRLA 1R67A 1VCDA 3Q1PA 5GHMA 3MDIA 2KDVA 3MGMA 4N1TA 5HZXA 2DSDA 1PUQA 1V8UA 1MUTA 4N1UA 2I8UA 1X83A 1PPVA 3O8SA 3X0RA 3X0QA 1KHZA 3CNGA 2B2KA 2QJOA 1RYAA 2YVMA 1HX3A 3I9XA 3X0PA 4JZUA 2PNYA 2W4EA 1I9AA 4HVYA 1V8VA 3X0KA 2A8SA 4KG3A 4S2VA 3X0SA 3ID9A 1SU2A 2GB5A 3QSJA 5ANUA 2FVVA 3SONA 5CFJA 3GZ6A 1MR2A 3GRNA 1NFZA 5GHQA 4JZVA 5IW5A 3H95A 3O52A 3ACAA 3O69A 3X0IA 1HZTA 2CL3A 1G0SA 2A8RA 5GHOA 2G74A 4ILQA 3O6ZA 5C8LA 1KT9A 2ICJA 1V8MA 1XSAA 2ICKA 2VNPA 3J7Ye 4S2XA 1VHZA 1F3YA 1PUNA 4HFQA 4YOQA 3N77A 2I6KA 2YVOA 1V8IA 1VC9A 2G73A 5DD4A 3EEUA 5GHPA 5GHIA 2DHOA 4C9WA 3A6VA 5ISYA 1QVJA 1RRSA 5FSLA 1Q27A 2GT4A 1Q54A 3FFUA 3Q2SA 3A6UA 5C7TA 3I7VA 2VNQA 3AC9A 3EESA 1X51A 5FSNA 1XSBA 2O5FA 3E57A 1NQZA 5FSOA 1V8LA 3FJYA 1KTGA 2R5WA 5DEQA 2PQVA 1PPXA 3COUA 1MQEA 2O1CA 3EF5A 3FCMA 3MCFA 3BAPA 3HHJA 3Q2TA 1JKNA 5ANVA 5ANTA 1V8NA 2AZWA 2KDWA 1TUMA 3F13A 5BS6A 3GZ8A 1K26A 1JRKA 1V8WA 4JZSA 3RH7A 3X0MA 2I8TA 4S2YA 1NFSA 3DUPA 1G9QA 3P5TA 1SZ3A 3F6AA 3P6YA 1VIUA 3Q93A 1RRQA 1V8YA 5FSMA 5ANSA 4MPOA 5ANWA 2JVBA 1Q33A 3G0QA 5GHJA 3X0OA 1VIQA 1K2EA 2A6TA 4JZTA 1X84A 3MDGA 5FSIA 1MK1A 3X0JA 4KTBA
chains in the Genus database with same CATH superfamily
2RRKA 4DYWA 1VC8A 5GHNA 2B06A 3HYQA 2Q9PA 5C7QA 2B0VA 1XSCA 1V8RA 4NFXA 1PPWA 4YPHA 1MQWA 3SHDA 1IRYA 5BONA 1SOIA 4K6EA 2J8QA 3BM4A 5I8UA 2DSBA 3KVHA 3ZR0A 3OGAA 3GWYA 3EXQA 2O5WA 3U53A 3A6TA 3O61A 5IW4A 1V8TA 3SMDA 2A8TA 2FKBA 4IJXA 3A6SA 4NFWA 2QKMB 4YPRA 1SJYA 1V8SA 1VHGA 4ZG0A 3FSPA 3X0NA 2A8PA 4S2WA 5CFIA 2GT2A 2QJTA 1MP2A 5DPKA 1GA7A 1PUSA 3I7UA 2DSCA 1OW2A 1PVFA 4KG4A 5LPGA 3N9UA 3FK9A 3GZ5A 4V14A 2YYHA 3GG6A 3Q4IA 3X0LA 1U20A 3DKUA 2DUKA 3L85A 2YVPA 3Q91A 3R03A 5DDGA 4KYXA 3BHOA 2YVNA 3ZR1A 1NQYA 3WHWA 1VK6A 4C9XA 2FMLA 2XSQA 2A8QA 4ICKA 5FSKA 1VRLA 1R67A 1VCDA 3Q1PA 5GHMA 3MDIA 2KDVA 3MGMA 4N1TA 5HZXA 2DSDA 1PUQA 1V8UA 1MUTA 4N1UA 2I8UA 1X83A 1PPVA 3O8SA 3X0RA 2CZRA 3X0QA 1KHZA 3CNGA 2B2KA 2QJOA 1RYAA 2YVMA 1HX3A 3I9XA 3X0PA 4JZUA 2PNYA 2W4EA 1I9AA 4HVYA 1V8VA 3X0KA 2A8SA 4KG3A 4S2VA 3X0SA 3ID9A 1SU2A 2GB5A 3QSJA 5ANUA 2FVVA 3SONA 5CFJA 3GZ6A 1MR2A 3GRNA 1NFZA 5GHQA 4JZVA 5IW5A 3H95A 3O52A 3ACAA 3O69A 3X0IA 1HZTA 4J7GA 2CL3A 1G0SA 2A8RA 5GHOA 2G74A 4ILQA 3O6ZA 5C8LA 1KT9A 2ICJA 1V8MA 1XSAA 2ICKA 2VNPA 3J7Ye 4S2XA 1VHZA 1F3YA 1PUNA 4HFQA 4YOQA 3N77A 2I6KA 2YVOA 1V8IA 1VC9A 2G73A 5DD4A 3EEUA 5GHPA 5GHIA 2DHOA 4C9WA 3A6VA 5ISYA 1QVJA 1RRSA 5FSLA 1Q27A 2GT4A 1Q54A 3FFUA 3Q2SA 3A6UA 5C7TA 3I7VA 2VNQA 3AC9A 3EESA 1X51A 5FSNA 1XSBA 2O5FA 3E57A 1NQZA 5FSOA 1V8LA 3FJYA 1KTGA 2R5WA 5DEQA 2PQVA 4J7HA 1PPXA 3COUA 1MQEA 2O1CA 3EF5A 3FCMA 3MCFA 3BAPA 3HHJA 3Q2TA 1JKNA 5ANVA 5ANTA 1V8NA 2AZWA 2KDWA 1TUMA 3F13A 5BS6A 3GZ8A 1K26A 1JRKA 1V8WA 4JZSA 3RH7A 3X0MA 2I8TA 4S2YA 1NFSA 3DUPA 1G9QA 3P5TA 1SZ3A 3F6AA 3P6YA 1VIUA 3Q93A 1RRQA 1V8YA 5FSMA 5ANSA 4MPOA 5ANWA 2JVBA 1Q33A 3G0QA 5GHJA 3X0OA 1VIQA 1K2EA 2A6TA 4JZTA 1X84A 3MDGA 5FSIA 1MK1A 3X0JA 4KTBA
chains in the Genus database with same CATH topology
2RRKA 4DYWA 1VC8A 5GHNA 2B06A 3HYQA 2Q9PA 5C7QA 2B0VA 1XSCA 1V8RA 4NFXA 1PPWA 4YPHA 1MQWA 3SHDA 1IRYA 5BONA 1SOIA 4K6EA 2J8QA 3BM4A 5I8UA 2DSBA 3KVHA 3ZR0A 3OGAA 3GWYA 3EXQA 2O5WA 3U53A 3A6TA 3O61A 5IW4A 1V8TA 3SMDA 2A8TA 2FKBA 4IJXA 3A6SA 4NFWA 2QKMB 4YPRA 1SJYA 1V8SA 1VHGA 4ZG0A 3FSPA 3X0NA 2A8PA 4S2WA 5CFIA 2GT2A 2QJTA 1MP2A 5DPKA 1GA7A 1PUSA 3I7UA 2DSCA 1OW2A 1PVFA 4KG4A 5LPGA 3N9UA 3FK9A 3GZ5A 4V14A 2YYHA 3GG6A 3Q4IA 3X0LA 1U20A 3DKUA 2DUKA 3L85A 2YVPA 3Q91A 3R03A 5DDGA 4KYXA 3BHOA 2YVNA 3ZR1A 1NQYA 3WHWA 1VK6A 4C9XA 2FMLA 2XSQA 2A8QA 4ICKA 5FSKA 1VRLA 1R67A 1VCDA 3Q1PA 5GHMA 3MDIA 2KDVA 3MGMA 4N1TA 5HZXA 2DSDA 1PUQA 1V8UA 1MUTA 4N1UA 2I8UA 1X83A 1PPVA 3O8SA 3X0RA 2CZRA 3X0QA 1KHZA 3CNGA 2B2KA 2QJOA 1RYAA 2YVMA 1HX3A 3I9XA 3X0PA 4JZUA 2PNYA 2W4EA 1I9AA 4HVYA 1V8VA 3X0KA 2A8SA 4KG3A 4S2VA 3X0SA 3ID9A 1SU2A 2GB5A 3QSJA 5ANUA 2FVVA 3SONA 5CFJA 3GZ6A 1MR2A 3GRNA 1NFZA 5GHQA 4JZVA 5IW5A 3H95A 3O52A 3ACAA 3O69A 3X0IA 1HZTA 4J7GA 2CL3A 1G0SA 2A8RA 5GHOA 2G74A 4ILQA 3O6ZA 5C8LA 1KT9A 2ICJA 1V8MA 1XSAA 2ICKA 2VNPA 3J7Ye 4S2XA 1VHZA 1F3YA 1PUNA 4HFQA 4YOQA 3N77A 2I6KA 2YVOA 1V8IA 1VC9A 2G73A 5DD4A 3EEUA 5GHPA 5GHIA 2DHOA 4C9WA 3A6VA 5ISYA 1QVJA 1RRSA 5FSLA 1Q27A 2GT4A 1Q54A 3FFUA 3Q2SA 3A6UA 5C7TA 3I7VA 2VNQA 3AC9A 3EESA 1X51A 5FSNA 1XSBA 2O5FA 3E57A 1NQZA 5FSOA 1V8LA 3FJYA 1KTGA 2R5WA 5DEQA 2PQVA 4J7HA 1PPXA 3COUA 1MQEA 2O1CA 3EF5A 3FCMA 3MCFA 3BAPA 3HHJA 3Q2TA 1JKNA 5ANVA 5ANTA 1V8NA 2AZWA 2KDWA 1TUMA 3F13A 5BS6A 3GZ8A 1K26A 1JRKA 1V8WA 4JZSA 3RH7A 3X0MA 2I8TA 4S2YA 1NFSA 3DUPA 1G9QA 3P5TA 1SZ3A 3F6AA 3P6YA 1VIUA 3Q93A 1RRQA 1V8YA 5FSMA 5ANSA 4MPOA 5ANWA 2JVBA 1Q33A 3G0QA 5GHJA 3X0OA 1VIQA 1K2EA 2A6TA 4JZTA 1X84A 3MDGA 5FSIA 1MK1A 3X0JA 4KTBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RRK A;  4DYW A;  1VC8 A;  5GHN A;  2B06 A;  3HYQ A;  2Q9P A;  5C7Q A;  2B0V A;  1XSC A;  1V8R A;  4NFX A;  1PPW A;  4YPH A;  1MQW A;  3SHD A;  1IRY A;  5BON A;  1SOI A;  4K6E A;  2J8Q A;  3BM4 A;  5I8U A;  2DSB A;  3KVH A;  3ZR0 A;  3OGA A;  3GWY A;  3EXQ A;  2O5W A;  3U53 A;  3A6T A;  3O61 A;  5IW4 A;  1V8T A;  3SMD A;  2A8T A;  2FKB A;  4IJX A;  3A6S A;  4NFW A;  2QKM B;  4YPR A;  1SJY A;  1V8S A;  1VHG A;  4ZG0 A;  3FSP A;  3X0N A;  2A8P A;  4S2W A;  5CFI A;  2GT2 A;  2QJT A;  1MP2 A;  5DPK A;  1GA7 A;  1PUS A;  3I7U A;  2DSC A;  1OW2 A;  1PVF A;  4KG4 A;  5LPG A;  3N9U A;  3FK9 A;  3GZ5 A;  4V14 A;  2YYH A;  3GG6 A;  3Q4I A;  3X0L A;  1U20 A;  3DKU A;  2DUK A;  3L85 A;  2YVP A;  3Q91 A;  3R03 A;  5DDG A;  4KYX A;  3BHO A;  2YVN A;  3ZR1 A;  1NQY A;  3WHW A;  1VK6 A;  4C9X A;  2FML A;  2XSQ A;  2A8Q A;  4ICK A;  5FSK A;  1VRL A;  1R67 A;  1VCD A;  3Q1P A;  5GHM A;  3MDI A;  2KDV A;  3MGM A;  4N1T A;  5HZX A;  2DSD A;  1PUQ A;  1V8U A;  1MUT A;  4N1U A;  2I8U A;  1X83 A;  1PPV A;  3O8S A;  3X0R A;  3X0Q A;  1KHZ A;  3CNG A;  2B2K A;  2QJO A;  1RYA A;  2YVM A;  1HX3 A;  3I9X A;  3X0P A;  4JZU A;  2PNY A;  2W4E A;  1I9A A;  4HVY A;  1V8V A;  3X0K A;  2A8S A;  4KG3 A;  4S2V A;  3X0S A;  3ID9 A;  1SU2 A;  2GB5 A;  3QSJ A;  5ANU A;  2FVV A;  3SON A;  5CFJ A;  3GZ6 A;  1MR2 A;  3GRN A;  1NFZ A;  5GHQ A;  4JZV A;  5IW5 A;  3H95 A;  3O52 A;  3ACA A;  3O69 A;  3X0I A;  1HZT A;  2CL3 A;  1G0S A;  2A8R A;  5GHO A;  2G74 A;  4ILQ A;  3O6Z A;  5C8L A;  1KT9 A;  2ICJ A;  1V8M A;  1XSA A;  2ICK A;  2VNP A;  3J7Y e;  4S2X A;  1VHZ A;  1F3Y A;  1PUN A;  4HFQ A;  4YOQ A;  3N77 A;  2I6K A;  2YVO A;  1V8I A;  1VC9 A;  2G73 A;  5DD4 A;  3EEU A;  5GHP A;  5GHI A;  2DHO A;  4C9W A;  3A6V A;  5ISY A;  1QVJ A;  1RRS A;  5FSL A;  1Q27 A;  2GT4 A;  1Q54 A;  3FFU A;  3Q2S A;  3A6U A;  5C7T A;  3I7V A;  2VNQ A;  3AC9 A;  3EES A;  1X51 A;  5FSN A;  1XSB A;  2O5F A;  3E57 A;  1NQZ A;  5FSO A;  1V8L A;  3FJY A;  1KTG A;  2R5W A;  5DEQ A;  2PQV A;  1PPX A;  3COU A;  1MQE A;  2O1C A;  3EF5 A;  3FCM A;  3MCF A;  3BAP A;  3HHJ A;  3Q2T A;  1JKN A;  5ANV A;  5ANT A;  1V8N A;  2AZW A;  2KDW A;  1TUM A;  3F13 A;  5BS6 A;  3GZ8 A;  1K26 A;  1JRK A;  1V8W A;  4JZS A;  3RH7 A;  3X0M A;  2I8T A;  4S2Y A;  1NFS A;  3DUP A;  1G9Q A;  3P5T A;  1SZ3 A;  3F6A A;  3P6Y A;  1VIU A;  3Q93 A;  1RRQ A;  1V8Y A;  5FSM A;  5ANS A;  4MPO A;  5ANW A;  2JVB A;  1Q33 A;  3G0Q A;  5GHJ A;  3X0O A;  1VIQ A;  1K2E A;  2A6T A;  4JZT A;  1X84 A;  3MDG A;  5FSI A;  1MK1 A;  3X0J A;  4KTB A; 
#chains in the Genus database with same CATH topology
 2RRK A;  4DYW A;  1VC8 A;  5GHN A;  2B06 A;  3HYQ A;  2Q9P A;  5C7Q A;  2B0V A;  1XSC A;  1V8R A;  4NFX A;  1PPW A;  4YPH A;  1MQW A;  3SHD A;  1IRY A;  5BON A;  1SOI A;  4K6E A;  2J8Q A;  3BM4 A;  5I8U A;  2DSB A;  3KVH A;  3ZR0 A;  3OGA A;  3GWY A;  3EXQ A;  2O5W A;  3U53 A;  3A6T A;  3O61 A;  5IW4 A;  1V8T A;  3SMD A;  2A8T A;  2FKB A;  4IJX A;  3A6S A;  4NFW A;  2QKM B;  4YPR A;  1SJY A;  1V8S A;  1VHG A;  4ZG0 A;  3FSP A;  3X0N A;  2A8P A;  4S2W A;  5CFI A;  2GT2 A;  2QJT A;  1MP2 A;  5DPK A;  1GA7 A;  1PUS A;  3I7U A;  2DSC A;  1OW2 A;  1PVF A;  4KG4 A;  5LPG A;  3N9U A;  3FK9 A;  3GZ5 A;  4V14 A;  2YYH A;  3GG6 A;  3Q4I A;  3X0L A;  1U20 A;  3DKU A;  2DUK A;  3L85 A;  2YVP A;  3Q91 A;  3R03 A;  5DDG A;  4KYX A;  3BHO A;  2YVN A;  3ZR1 A;  1NQY A;  3WHW A;  1VK6 A;  4C9X A;  2FML A;  2XSQ A;  2A8Q A;  4ICK A;  5FSK A;  1VRL A;  1R67 A;  1VCD A;  3Q1P A;  5GHM A;  3MDI A;  2KDV A;  3MGM A;  4N1T A;  5HZX A;  2DSD A;  1PUQ A;  1V8U A;  1MUT A;  4N1U A;  2I8U A;  1X83 A;  1PPV A;  3O8S A;  3X0R A;  2CZR A;  3X0Q A;  1KHZ A;  3CNG A;  2B2K A;  2QJO A;  1RYA A;  2YVM A;  1HX3 A;  3I9X A;  3X0P A;  4JZU A;  2PNY A;  2W4E A;  1I9A A;  4HVY A;  1V8V A;  3X0K A;  2A8S A;  4KG3 A;  4S2V A;  3X0S A;  3ID9 A;  1SU2 A;  2GB5 A;  3QSJ A;  5ANU A;  2FVV A;  3SON A;  5CFJ A;  3GZ6 A;  1MR2 A;  3GRN A;  1NFZ A;  5GHQ A;  4JZV A;  5IW5 A;  3H95 A;  3O52 A;  3ACA A;  3O69 A;  3X0I A;  1HZT A;  4J7G A;  2CL3 A;  1G0S A;  2A8R A;  5GHO A;  2G74 A;  4ILQ A;  3O6Z A;  5C8L A;  1KT9 A;  2ICJ A;  1V8M A;  1XSA A;  2ICK A;  2VNP A;  3J7Y e;  4S2X A;  1VHZ A;  1F3Y A;  1PUN A;  4HFQ A;  4YOQ A;  3N77 A;  2I6K A;  2YVO A;  1V8I A;  1VC9 A;  2G73 A;  5DD4 A;  3EEU A;  5GHP A;  5GHI A;  2DHO A;  4C9W A;  3A6V A;  5ISY A;  1QVJ A;  1RRS A;  5FSL A;  1Q27 A;  2GT4 A;  1Q54 A;  3FFU A;  3Q2S A;  3A6U A;  5C7T A;  3I7V A;  2VNQ A;  3AC9 A;  3EES A;  1X51 A;  5FSN A;  1XSB A;  2O5F A;  3E57 A;  1NQZ A;  5FSO A;  1V8L A;  3FJY A;  1KTG A;  2R5W A;  5DEQ A;  2PQV A;  4J7H A;  1PPX A;  3COU A;  1MQE A;  2O1C A;  3EF5 A;  3FCM A;  3MCF A;  3BAP A;  3HHJ A;  3Q2T A;  1JKN A;  5ANV A;  5ANT A;  1V8N A;  2AZW A;  2KDW A;  1TUM A;  3F13 A;  5BS6 A;  3GZ8 A;  1K26 A;  1JRK A;  1V8W A;  4JZS A;  3RH7 A;  3X0M A;  2I8T A;  4S2Y A;  1NFS A;  3DUP A;  1G9Q A;  3P5T A;  1SZ3 A;  3F6A A;  3P6Y A;  1VIU A;  3Q93 A;  1RRQ A;  1V8Y A;  5FSM A;  5ANS A;  4MPO A;  5ANW A;  2JVB A;  1Q33 A;  3G0Q A;  5GHJ A;  3X0O A;  1VIQ A;  1K2E A;  2A6T A;  4JZT A;  1X84 A;  3MDG A;  5FSI A;  1MK1 A;  3X0J A;  4KTB A; 
#chains in the Genus database with same CATH homology
 2RRK A;  4DYW A;  1VC8 A;  5GHN A;  2B06 A;  3HYQ A;  2Q9P A;  5C7Q A;  2B0V A;  1XSC A;  1V8R A;  4NFX A;  1PPW A;  4YPH A;  1MQW A;  3SHD A;  1IRY A;  5BON A;  1SOI A;  4K6E A;  2J8Q A;  3BM4 A;  5I8U A;  2DSB A;  3KVH A;  3ZR0 A;  3OGA A;  3GWY A;  3EXQ A;  2O5W A;  3U53 A;  3A6T A;  3O61 A;  5IW4 A;  1V8T A;  3SMD A;  2A8T A;  2FKB A;  4IJX A;  3A6S A;  4NFW A;  2QKM B;  4YPR A;  1SJY A;  1V8S A;  1VHG A;  4ZG0 A;  3FSP A;  3X0N A;  2A8P A;  4S2W A;  5CFI A;  2GT2 A;  2QJT A;  1MP2 A;  5DPK A;  1GA7 A;  1PUS A;  3I7U A;  2DSC A;  1OW2 A;  1PVF A;  4KG4 A;  5LPG A;  3N9U A;  3FK9 A;  3GZ5 A;  4V14 A;  2YYH A;  3GG6 A;  3Q4I A;  3X0L A;  1U20 A;  3DKU A;  2DUK A;  3L85 A;  2YVP A;  3Q91 A;  3R03 A;  5DDG A;  4KYX A;  3BHO A;  2YVN A;  3ZR1 A;  1NQY A;  3WHW A;  1VK6 A;  4C9X A;  2FML A;  2XSQ A;  2A8Q A;  4ICK A;  5FSK A;  1VRL A;  1R67 A;  1VCD A;  3Q1P A;  5GHM A;  3MDI A;  2KDV A;  3MGM A;  4N1T A;  5HZX A;  2DSD A;  1PUQ A;  1V8U A;  1MUT A;  4N1U A;  2I8U A;  1X83 A;  1PPV A;  3O8S A;  3X0R A;  2CZR A;  3X0Q A;  1KHZ A;  3CNG A;  2B2K A;  2QJO A;  1RYA A;  2YVM A;  1HX3 A;  3I9X A;  3X0P A;  4JZU A;  2PNY A;  2W4E A;  1I9A A;  4HVY A;  1V8V A;  3X0K A;  2A8S A;  4KG3 A;  4S2V A;  3X0S A;  3ID9 A;  1SU2 A;  2GB5 A;  3QSJ A;  5ANU A;  2FVV A;  3SON A;  5CFJ A;  3GZ6 A;  1MR2 A;  3GRN A;  1NFZ A;  5GHQ A;  4JZV A;  5IW5 A;  3H95 A;  3O52 A;  3ACA A;  3O69 A;  3X0I A;  1HZT A;  4J7G A;  2CL3 A;  1G0S A;  2A8R A;  5GHO A;  2G74 A;  4ILQ A;  3O6Z A;  5C8L A;  1KT9 A;  2ICJ A;  1V8M A;  1XSA A;  2ICK A;  2VNP A;  3J7Y e;  4S2X A;  1VHZ A;  1F3Y A;  1PUN A;  4HFQ A;  4YOQ A;  3N77 A;  2I6K A;  2YVO A;  1V8I A;  1VC9 A;  2G73 A;  5DD4 A;  3EEU A;  5GHP A;  5GHI A;  2DHO A;  4C9W A;  3A6V A;  5ISY A;  1QVJ A;  1RRS A;  5FSL A;  1Q27 A;  2GT4 A;  1Q54 A;  3FFU A;  3Q2S A;  3A6U A;  5C7T A;  3I7V A;  2VNQ A;  3AC9 A;  3EES A;  1X51 A;  5FSN A;  1XSB A;  2O5F A;  3E57 A;  1NQZ A;  5FSO A;  1V8L A;  3FJY A;  1KTG A;  2R5W A;  5DEQ A;  2PQV A;  4J7H A;  1PPX A;  3COU A;  1MQE A;  2O1C A;  3EF5 A;  3FCM A;  3MCF A;  3BAP A;  3HHJ A;  3Q2T A;  1JKN A;  5ANV A;  5ANT A;  1V8N A;  2AZW A;  2KDW A;  1TUM A;  3F13 A;  5BS6 A;  3GZ8 A;  1K26 A;  1JRK A;  1V8W A;  4JZS A;  3RH7 A;  3X0M A;  2I8T A;  4S2Y A;  1NFS A;  3DUP A;  1G9Q A;  3P5T A;  1SZ3 A;  3F6A A;  3P6Y A;  1VIU A;  3Q93 A;  1RRQ A;  1V8Y A;  5FSM A;  5ANS A;  4MPO A;  5ANW A;  2JVB A;  1Q33 A;  3G0Q A;  5GHJ A;  3X0O A;  1VIQ A;  1K2E A;  2A6T A;  4JZT A;  1X84 A;  3MDG A;  5FSI A;  1MK1 A;  3X0J A;  4KTB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...