3O5DA

Crystal structure of a fragment of fkbp51 comprising the fk1 and fk2 domains
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
242
structure length
242
Chain Sequence
SPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 55
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5dA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5dA02
3JXVA 2MF9A 3NRKA 4FN2A 4ITZA 4JFLA 2Y78A 2RSEA 2VCDA 3IKDA 3EY6A 1EQ3A 1NMVA 3JYJA 2DG4A 2KGJA 1NMWA 1D7IA 4ODKA 3I6CA 5HUAA 1J4HA 2JZVA 3IK8A 2D9FA 4IQ2A 3O5MA 2XP3A 4DZ2A 1R9HA 5HW7A 3NTPA 1YW5A 5HKGA 5I98A 3IKGA 3UI6A 2F21A 1QZ2A 1QPLA 5BXJA 2XP6A 3O5QA 4QIBA 2M1IA 1BKFA 1Q6UA 1JNTA 1FJDA 5GPGA 4QT2A 4TNSA 3O5LA 1FAPA 1FD9A 2PBCA 4TW6A 5HW8A 1L1PA 1FKDA 2LKNA 2XP5A 5DIUA 4DROA 4DRPA 2UZ5A 3UQAA 1A7XA 2ZR5A 2M2AA 3O5GA 1N1AA 3RFWA 2DG9A 4G2PA 1F8AB 2PV3A 2PV1A 2LGOA 4O2TA 1FKHA 4LAXA 4TW7A 2XP8A 1PINA 2F2DA 1U79A 4DZ3A 1FKRA 1ZK6A 1FKJA 2ZQVA 5HW6A 4ODLA 1F40A 2XPAA 3KACA 2LJ4A 4ODNA 4TX0A 3KADA 3UI4A 5DIVA 2MLZA 3H9RB 3ODKA 2KO7A 2LPVA 2PPOA 3O5FA 3IHZA 5J6EA 4DT4A 1M5YA 1W26A 3UQBA 2ZQTA 3WH0A 4NNRA 2PPPA 4TW8A 3VAWA 4FAPA 2ZR4A 1C9HA 2MPHA 4ODRA 1J4IA 3KAGA 2FKEA 3KABA 3FAPA 4DRQA 3O5EA 5HWBA 4MGVA 5DITA 1J6YA 2PV2A 1FKIA 2ZQUA 3O5OA 1Q6HA 1PBKA 2PPNA 1JVWA 3KAFA 4LAYA 1FKGA 2Q5AA 2MNTA 3O5KA 3NI6A 4BF8A 2OFNA 2FAPA 4IQCA 1P5QA 1ROUA 4N19A 2RURA 4DRMA 4ODMA 3TDBA 3UF8A 5B8IC 3CGMA 4ODOA 1HXVA 2IF4A 1NSGA 1ZCNA 2KFWA 4JYSA 1D7JA 4QT3A 1B6CA 3JYMA 4G50A 4JFIA 4LAVA 4TYOA 1JNSA 3CGNA 2RUQA 3UI5A 4DRIA 3LUOA 3O5DA 3PRBA 3PA7A 4LAWA 5D75A 4J4OA 1BL4A 2M08A 1KT0A 4W9OA 1Q1CA 1FKFA 2XPBA 2RUCA 4DRKA 2KE0A 3GPKA 3KAHA 3B7XA 4GGQA 3TCZA 1Y0OA 5HT1A 2RUDA 2XP9A 4DRJA 3O5JA 1TCOC 2ITKA 4R0XA 4JFJA 2K8IA 1J4RA 2DG3A 1KT1A 2VN1A 4U85A 4U84A 4C02B 1T11A 2RQSA 2ZQSA 3OOBA 4J4NA 4ODQA 3MDYB 1ROTA 2ZR6A 4GIVA 2N87A 4W9QA 3O5IA 1YATA 2XP4A 3UQIA 3KZ7A 2AWGA 4U86A 3RGCA 4IPXA 1QPFA 2F4EA 4ODPA 2MLXA 4MSPA 3TC5A 4DIPA 2KI3A 4DRNA 3KCEA 5HTGA 1EYMA 4JFKA 3PRDA 4W9PA 5HWCA 1D6OA 1FKBA 4DH0A 1FKLA 3O5RA 1D7HA 1Q6IA 2XP7A 1FKSA 1FKTA 2L2SA 2KR7A 1FKKA 3O5PA 3KAIA 4DRHA 4JFMA 2MLYA
chains in the Genus database with same CATH superfamily
2MF9A 4JFLA 2EULA 4S3JA 3JYJA 3I6CA 1J4HA 1OGBA 2G41A 3EIPA 2DSZA 1E6NA 3NTPA 1YW5A 5I98A 2F21A 1QPLA 5BXJA 1ZBCA 3RM9A 4QIBA 2M1IA 3CHDA 4XAKA 1FJDA 4QT2A 3O5LA 2LKNA 2DT0A 5DIUA 4DRPA 1A7XA 3RFWA 3FXYA 4DWSA 2DG9A 3WL1A 4G2PA 4O2TA 5GQBA 3WIJA 1FKJA 3WD2A 1H0GA 3W4RA 2LJ4A 3WKZA 5DIVA 4Z2GA 2DPEA 1ITXA 3O5FA 4MNKA 1HJXA 1M5YA 1W26A 2ZQTA 2A3BA 4NNRA 4ZPVR 4ODRA 4Z2HA 3FAPA 1ZBKA 1SR0A 4MGVA 1FKIA 2ZQUA 3O5OA 1Q6HA 3KAFA 4WK9A 1TFVA 1FKGA 4S3KA 1CTNA 2OLHA 1UR8A 1D2KA 1P5QA 2G8ZA 4ODMA 2PN0A 2IF4A 2QF8A 3QOKA 1JNSA 3CGNA 2RUQA 4DRIA 3LUOA 3O5DA 3PRBA 1NWSA 4DWSC 4Z2LA 2M08A 2XPBA 4PTMA 3GTYX 4WKAA 4DWSD 3B9AA 4DRJA 1OWQA 3AROA 4JFJA 1J4RA 2DG3A 4C02B 2ZQSA 4ODQA 4W9QA 3O5IA 2XP4A 3KZ7A 2AWGA 3RGCA 3ARYA 2MLXA 2O9OA 4MSPA 4DRNA 4MPKA 1HKMA 5HWCA 1D6OA 4DH0A 1FKLA 1Q6IA 4L3NA 1FKTA 1FKKA 4Z2IA 2DT3A 2MLYA 2A3CA 2VCDA 1HJVA 4MTVA 3ALFA 1NMVA 2KGJA 2P4VA 4ODKA 3IK8A 2D9FA 4DZ2A 3CHCA 3IKGA 4MNJA 3UI6A 1E44A 3WD0A 3ALGA 3ARZA 5GPGA 4TNSA 5HW8A 1L1PA 1FKDA 2UZ5A 3ARRA 1N1AA 3ARSA 1E15A 1F8AB 2PV3A 2PV1A 2LGOA 3ARTA 1FKHA 2XP8A 3G6MA 1LG2A 1ZK6A 2ZQVA 1F40A 2XPAA 4ODNA 1K9TA 1W9VA 1HKKA 3IHZA 4DT4A 3VAWA 2IUZA 1C9HA 2MPHA 2ZR4A 4IT4A 3KABA 1LQ0A 4DRQA 3O5EA 1VF8A 5HWBA 4WJXA 1ZB5A 4QZVB 2WK2A 4MNMA 4BF8A 1ROUA 2RURA 3TDBA 5B8IC 1E6PA 2DT2A 4JYSA 1ZCNA 4QT3A 5HBFA 2WLYA 4JFIA 1ZBWA 2DT1A 5D75A 3PA7A 1UR9A 4IT6A 4J4OA 4W9OA 3WD1A 1FKFA 4HBEA 2RUCA 4DRKA 2KE0A 3B7XA 4GGQA 1HJWA 3TCZA 4NZCA 2RUDA 3O5JA 4P8XA 2ITKA 2YBUA 2K8IA 1KT1A 1SYTA 1W1VA 3RM8A 1ROTA 2ZR6A 1GRJA 2FDMA 4HARA 2N87A 1H0IA 3WD4A 4U86A 4P8UA 2F4EA 4ODPA 2WM0A 3KCEA 1WAWA 3WQWA 4JFKA 4Z2JA 1FKBA 2B5UB 1D7HA 3ARVA 1FKSA 1LL7A 2KR7A 3KAIA 4LAYA 3JXVA 1LJYA 2Y78A 1JNEA 2RSEA 3EY6A 2DG4A 5HUAA 1NMWA 1D7IA 1X6NA 2JZVA 2O92A 4W5UA 4IQ2A 5HKGA 3GU0A 1JCHB 1QZ2A 4AY1A 1BKFA 1KFWA 1Q6UA 1JNTA 2DSVA 3ARQA 1FAPA 1FD9A 2PBCA 2DSUA 2XP5A 4DROA 1WNOA 3PR9A 4NSBA 1W9PA 2ZR5A 3FY1A 4MAVA 1E6RA 1W1PA 1XRVA 4TW7A 1PINA 4DZ3A 5HW6A 1NH6A 3KACA 4TX0A 3KADA 3UI4A 2MLZA 1RD6A 3H9RB 1O6IA 2LPVA 2PPOA 5J6EA 3UQBA 3WH0A 3ARUA 4TW8A 4FAPA 5DO2A 1NWRA 4P8VA 1J6YA 2PV2A 4DWSB 1IX5A 2PPNA 1GUVA 1JVWA 2ESCA 3AS2A 2DSWA 3WQVA 3B9EA 3AS3A 2OFNA 4N19A 3G6LA 3CGMA 1HXVA 1NSGA 1D7JA 1B6CA 3JYMA 4G50A 4TYOA 3UI5A 1OGGA 3CHFA 4ZS6A 1KT0A 1Q1CA 3BXWA 1LG1A 3BMBA 3KAHA 1GOIA 2AOSA 1WB0A 4URIA 3CH9A 4U85A 4J4NA 2RQSA 3OOBA 1W1YA 1EDQA 4GIVA 1QPFA 1W9UA 3TC5A 4Q22A 2KI3A 2YBTA 5DF0A 1JNDA 4P8WA 1EYMA 4W9PA 1XHGA 3O5RA 2XP7A 1FFRA 2L2SA 3WL0A 3O5PA 4DRHA 4JFMA 4WKFA 4FN2A 3NRKA 4ITZA 3B9DA 3IKDA 3RMEA 3ARXA 1EQ3A 4Q7NA 3O5MA 1LL6A 2XP3A 5HW7A 1R9HA 1EIBA 3OA5A 2XP6A 3O5QA 4HBOA 4ZPTR 4TW6A 1GPFA 3CHEA 3UQAA 3O5GA 2M2AA 4MNLA 4WIWA 1EHNA 3ARWA 4LAXA 2F2DA 1U79A 1FKRA 4ODLA 4KQZA 3CZ8A 1ZBVA 1ZU8A 4R5EA 3ODKA 2KO7A 2PPPA 1J4IA 3KAGA 2FKEA 1NWUA 2ETNA 4ML4A 1HKJA 5DITA 2PI6A 3AQUA 1NWTA 1PBKA 2A3EA 2Q5AA 2MNTA 3O5KA 3NI6A 1W1TA 2FAPA 4IQCA 2F23A 4DRMA 3UF8A 4ODOA 2KFWA 4WKHA 1HKIA 1X6LA 4LAVA 2B31A 4LAWA 1FFQA 1BL4A 3GPKA 5JH8A 1ZL1A 3AS0A 4ZPWR 5DEZA 1Y0OA 4KR0B 5HT1A 2XP9A 4Z2KA 3ARPA 1TCOC 4R0XA 4UDMA 4L72B 2VN1A 4U84A 1T11A 1LL4A 3MDYB 3B8SA 1E9LA 5GPRA 3PRAA 3AS1A 1YATA 3WD3A 3RM4A 3UQIA 4IPXA 4DIPA 5HTGA 2A3AA 3PRDA 4LGXA 2WLZA 1E6ZA
chains in the Genus database with same CATH topology
2MF9A 4JFLA 4S3JA 3JYJA 3I6CA 1J4HA 1OGBA 2G41A 2DSZA 1E6NA 3NTPA 1YW5A 5I98A 2F21A 1QPLA 5BXJA 1ZBCA 3RM9A 4QIBA 2M1IA 3CHDA 4XAKA 1FJDA 4QT2A 3O5LA 2LKNA 2DT0A 5DIUA 4DRPA 1A7XA 3RFWA 3FXYA 4DWSA 2DG9A 3WL1A 4G2PA 4O2TA 5GQBA 3WIJA 1FKJA 3WD2A 1H0GA 3W4RA 2LJ4A 3WKZA 5DIVA 4Z2GA 2DPEA 1ITXA 3O5FA 4MNKA 1HJXA 1M5YA 1W26A 2ZQTA 2A3BA 4NNRA 4ZPVR 4ODRA 4Z2HA 3FAPA 1ZBKA 1SR0A 4MGVA 1FKIA 3O5OA 2ZQUA 1Q6HA 3KAFA 4WK9A 1TFVA 1FKGA 4S3KA 1CTNA 2OLHA 1UR8A 1D2KA 1P5QA 2G8ZA 4ODMA 2IF4A 2QF8A 3QOKA 1JNSA 3CGNA 2RUQA 4DRIA 3LUOA 3O5DA 3PRBA 1NWSA 4DWSC 4Z2LA 2M08A 2XPBA 4PTMA 4WKAA 4DWSD 3B9AA 4DRJA 1OWQA 3AROA 4JFJA 1J4RA 2DG3A 4C02B 2ZQSA 4ODQA 4W9QA 3O5IA 2XP4A 3KZ7A 2AWGA 3RGCA 3ARYA 2MLXA 2O9OA 4MSPA 4DRNA 4MPKA 1HKMA 5HWCA 1D6OA 4DH0A 1FKLA 1Q6IA 4L3NA 1FKTA 1FKKA 4Z2IA 2DT3A 2MLYA 2A3CA 2VCDA 1HJVA 4MTVA 3ALFA 1NMVA 2KGJA 4ODKA 3IK8A 2D9FA 4DZ2A 3CHCA 3IKGA 4MNJA 3UI6A 3WD0A 3ALGA 3ARZA 5GPGA 4TNSA 5HW8A 1L1PA 1FKDA 2UZ5A 3ARRA 1N1AA 3ARSA 1E15A 1F8AB 2PV3A 2PV1A 2LGOA 3ARTA 1FKHA 2XP8A 3G6MA 1LG2A 1ZK6A 2ZQVA 1F40A 2XPAA 4ODNA 1K9TA 1W9VA 1HKKA 3IHZA 4DT4A 3VAWA 2IUZA 1C9HA 2MPHA 2ZR4A 4IT4A 3KABA 1LQ0A 4DRQA 3O5EA 1VF8A 5HWBA 4WJXA 1ZB5A 4QZVB 2WK2A 4MNMA 4BF8A 1ROUA 2RURA 3TDBA 5B8IC 1E6PA 2DT2A 4JYSA 1ZCNA 4QT3A 5HBFA 2WLYA 4JFIA 1ZBWA 2DT1A 5D75A 3PA7A 1UR9A 4IT6A 4J4OA 4W9OA 3WD1A 1FKFA 4HBEA 2RUCA 4DRKA 2KE0A 3B7XA 4GGQA 1HJWA 3TCZA 4NZCA 2RUDA 3O5JA 4P8XA 2ITKA 2YBUA 2K8IA 1KT1A 1SYTA 1W1VA 3RM8A 1ROTA 2ZR6A 2FDMA 4HARA 2N87A 1H0IA 3WD4A 4U86A 4P8UA 2F4EA 4ODPA 2WM0A 3KCEA 1WAWA 3WQWA 4JFKA 4Z2JA 1FKBA 1D7HA 3ARVA 1FKSA 1LL7A 2KR7A 3KAIA 4LAYA 3JXVA 1LJYA 2Y78A 1JNEA 2RSEA 3EY6A 2DG4A 5HUAA 1NMWA 1D7IA 1X6NA 2JZVA 2O92A 4W5UA 4IQ2A 5HKGA 1QZ2A 4AY1A 1BKFA 1KFWA 1Q6UA 1JNTA 2DSVA 3ARQA 1FAPA 1FD9A 2PBCA 2DSUA 2XP5A 4DROA 1WNOA 3PR9A 4NSBA 1W9PA 2ZR5A 3FY1A 4MAVA 1E6RA 1W1PA 1XRVA 4TW7A 1PINA 4DZ3A 5HW6A 1NH6A 3KACA 4TX0A 3KADA 3UI4A 2MLZA 1RD6A 3H9RB 1O6IA 2LPVA 2PPOA 5J6EA 3UQBA 3WH0A 3ARUA 4TW8A 4FAPA 5DO2A 1NWRA 4P8VA 1J6YA 2PV2A 4DWSB 1IX5A 2PPNA 1GUVA 1JVWA 2ESCA 3AS2A 2DSWA 3WQVA 3B9EA 3AS3A 2OFNA 4N19A 3G6LA 3CGMA 1HXVA 1NSGA 1D7JA 1B6CA 3JYMA 4G50A 4TYOA 3UI5A 1OGGA 3CHFA 4ZS6A 1KT0A 1Q1CA 3BXWA 1LG1A 3KAHA 1GOIA 2AOSA 1WB0A 4URIA 3CH9A 4U85A 4J4NA 2RQSA 3OOBA 1W1YA 1EDQA 4GIVA 1QPFA 1W9UA 3TC5A 4Q22A 2KI3A 2YBTA 5DF0A 1JNDA 4P8WA 1EYMA 4W9PA 1XHGA 3O5RA 2XP7A 1FFRA 2L2SA 3WL0A 3O5PA 4DRHA 4JFMA 4WKFA 4FN2A 3NRKA 4ITZA 3B9DA 3IKDA 3RMEA 3ARXA 1EQ3A 4Q7NA 3O5MA 1LL6A 2XP3A 5HW7A 1R9HA 1EIBA 3OA5A 2XP6A 3O5QA 4HBOA 4ZPTR 4TW6A 1GPFA 3CHEA 3UQAA 3O5GA 2M2AA 4MNLA 4WIWA 1EHNA 3ARWA 4LAXA 2F2DA 1U79A 1FKRA 4ODLA 4KQZA 3CZ8A 1ZBVA 1ZU8A 4R5EA 3ODKA 2KO7A 2PPPA 1J4IA 3KAGA 2FKEA 1NWUA 4ML4A 1HKJA 5DITA 2PI6A 3AQUA 1NWTA 1PBKA 2A3EA 2Q5AA 2MNTA 3O5KA 3NI6A 1W1TA 2FAPA 4IQCA 4DRMA 3UF8A 4ODOA 2KFWA 4WKHA 1HKIA 1X6LA 4LAVA 2B31A 4LAWA 1FFQA 1BL4A 3GPKA 5JH8A 1ZL1A 3AS0A 4ZPWR 5DEZA 1Y0OA 4KR0B 5HT1A 2XP9A 4Z2KA 3ARPA 1TCOC 4R0XA 4L72B 2VN1A 4U84A 1T11A 1LL4A 3MDYB 3B8SA 1E9LA 5GPRA 3PRAA 3AS1A 1YATA 3WD3A 3RM4A 3UQIA 4IPXA 4DIPA 5HTGA 2A3AA 3PRDA 4LGXA 2WLZA 1E6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JXV A;  2MF9 A;  3NRK A;  4FN2 A;  4ITZ A;  4JFL A;  2Y78 A;  2RSE A;  2VCD A;  3IKD A;  3EY6 A;  1EQ3 A;  1NMV A;  3JYJ A;  2DG4 A;  2KGJ A;  1NMW A;  1D7I A;  4ODK A;  3I6C A;  5HUA A;  1J4H A;  2JZV A;  3IK8 A;  2D9F A;  4IQ2 A;  3O5M A;  2XP3 A;  4DZ2 A;  1R9H A;  5HW7 A;  3NTP A;  1YW5 A;  5HKG A;  5I98 A;  3IKG A;  3UI6 A;  2F21 A;  1QZ2 A;  1QPL A;  5BXJ A;  2XP6 A;  3O5Q A;  4QIB A;  2M1I A;  1BKF A;  1Q6U A;  1JNT A;  1FJD A;  5GPG A;  4QT2 A;  4TNS A;  3O5L A;  1FAP A;  1FD9 A;  2PBC A;  4TW6 A;  5HW8 A;  1L1P A;  1FKD A;  2LKN A;  2XP5 A;  5DIU A;  4DRO A;  4DRP A;  2UZ5 A;  3UQA A;  1A7X A;  2ZR5 A;  2M2A A;  3O5G A;  1N1A A;  3RFW A;  2DG9 A;  4G2P A;  1F8A B;  2PV3 A;  2PV1 A;  2LGO A;  4O2T A;  1FKH A;  4LAX A;  4TW7 A;  2XP8 A;  1PIN A;  2F2D A;  1U79 A;  4DZ3 A;  1FKR A;  1ZK6 A;  1FKJ A;  2ZQV A;  5HW6 A;  4ODL A;  1F40 A;  2XPA A;  3KAC A;  2LJ4 A;  4ODN A;  4TX0 A;  3KAD A;  3UI4 A;  5DIV A;  2MLZ A;  3H9R B;  3ODK A;  2KO7 A;  2LPV A;  2PPO A;  3O5F A;  3IHZ A;  5J6E A;  4DT4 A;  1M5Y A;  1W26 A;  3UQB A;  2ZQT A;  3WH0 A;  4NNR A;  2PPP A;  4TW8 A;  3VAW A;  4FAP A;  2ZR4 A;  1C9H A;  2MPH A;  4ODR A;  1J4I A;  3KAG A;  2FKE A;  3KAB A;  3FAP A;  4DRQ A;  3O5E A;  5HWB A;  4MGV A;  5DIT A;  1J6Y A;  2PV2 A;  1FKI A;  2ZQU A;  3O5O A;  1Q6H A;  1PBK A;  2PPN A;  1JVW A;  3KAF A;  4LAY A;  1FKG A;  2Q5A A;  2MNT A;  3O5K A;  3NI6 A;  4BF8 A;  2OFN A;  2FAP A;  4IQC A;  1P5Q A;  1ROU A;  4N19 A;  2RUR A;  4DRM A;  4ODM A;  3TDB A;  3UF8 A;  5B8I C;  3CGM A;  4ODO A;  1HXV A;  2IF4 A;  1NSG A;  1ZCN A;  2KFW A;  4JYS A;  1D7J A;  4QT3 A;  1B6C A;  3JYM A;  4G50 A;  4JFI A;  4LAV A;  4TYO A;  1JNS A;  3CGN A;  2RUQ A;  3UI5 A;  4DRI A;  3LUO A;  3O5D A;  3PRB A;  3PA7 A;  4LAW A;  5D75 A;  4J4O A;  1BL4 A;  2M08 A;  1KT0 A;  4W9O A;  1Q1C A;  1FKF A;  2XPB A;  2RUC A;  4DRK A;  2KE0 A;  3GPK A;  3KAH A;  3B7X A;  4GGQ A;  3TCZ A;  1Y0O A;  5HT1 A;  2RUD A;  2XP9 A;  4DRJ A;  3O5J A;  1TCO C;  2ITK A;  4R0X A;  4JFJ A;  2K8I A;  1J4R A;  2DG3 A;  1KT1 A;  2VN1 A;  4U85 A;  4U84 A;  4C02 B;  1T11 A;  2RQS A;  2ZQS A;  3OOB A;  4J4N A;  4ODQ A;  3MDY B;  1ROT A;  2ZR6 A;  4GIV A;  2N87 A;  4W9Q A;  3O5I A;  1YAT A;  2XP4 A;  3UQI A;  3KZ7 A;  2AWG A;  4U86 A;  3RGC A;  4IPX A;  1QPF A;  2F4E A;  4ODP A;  2MLX A;  4MSP A;  3TC5 A;  4DIP A;  2KI3 A;  4DRN A;  3KCE A;  5HTG A;  1EYM A;  4JFK A;  3PRD A;  4W9P A;  5HWC A;  1D6O A;  1FKB A;  4DH0 A;  1FKL A;  3O5R A;  1D7H A;  1Q6I A;  2XP7 A;  1FKS A;  1FKT A;  2L2S A;  2KR7 A;  1FKK A;  3O5P A;  3KAI A;  4DRH A;  4JFM A;  2MLY A; 
#chains in the Genus database with same CATH topology
 2MF9 A;  4JFL A;  2EUL A;  4S3J A;  3JYJ A;  3I6C A;  1J4H A;  1OGB A;  2G41 A;  3EIP A;  2DSZ A;  1E6N A;  3NTP A;  1YW5 A;  5I98 A;  2F21 A;  1QPL A;  5BXJ A;  1ZBC A;  3RM9 A;  4QIB A;  2M1I A;  3CHD A;  4XAK A;  1FJD A;  4QT2 A;  3O5L A;  2LKN A;  2DT0 A;  5DIU A;  4DRP A;  1A7X A;  3RFW A;  3FXY A;  4DWS A;  2DG9 A;  3WL1 A;  4G2P A;  4O2T A;  5GQB A;  3WIJ A;  1FKJ A;  3WD2 A;  1H0G A;  3W4R A;  2LJ4 A;  3WKZ A;  5DIV A;  4Z2G A;  2DPE A;  1ITX A;  3O5F A;  4MNK A;  1HJX A;  1M5Y A;  1W26 A;  2ZQT A;  2A3B A;  4NNR A;  4ZPV R;  4ODR A;  4Z2H A;  3FAP A;  1ZBK A;  1SR0 A;  4MGV A;  1FKI A;  2ZQU A;  3O5O A;  1Q6H A;  3KAF A;  4WK9 A;  1TFV A;  1FKG A;  4S3K A;  1CTN A;  2OLH A;  1UR8 A;  1D2K A;  1P5Q A;  2G8Z A;  4ODM A;  2PN0 A;  2IF4 A;  2QF8 A;  3QOK A;  1JNS A;  3CGN A;  2RUQ A;  4DRI A;  3LUO A;  3O5D A;  3PRB A;  1NWS A;  4DWS C;  4Z2L A;  2M08 A;  2XPB A;  4PTM A;  3GTY X;  4WKA A;  4DWS D;  3B9A A;  4DRJ A;  1OWQ A;  3ARO A;  4JFJ A;  1J4R A;  2DG3 A;  4C02 B;  2ZQS A;  4ODQ A;  4W9Q A;  3O5I A;  2XP4 A;  3KZ7 A;  2AWG A;  3RGC A;  3ARY A;  2MLX A;  2O9O A;  4MSP A;  4DRN A;  4MPK A;  1HKM A;  5HWC A;  1D6O A;  4DH0 A;  1FKL A;  1Q6I A;  4L3N A;  1FKT A;  1FKK A;  4Z2I A;  2DT3 A;  2MLY A;  2A3C A;  2VCD A;  1HJV A;  4MTV A;  3ALF A;  1NMV A;  2KGJ A;  2P4V A;  4ODK A;  3IK8 A;  2D9F A;  4DZ2 A;  3CHC A;  3IKG A;  4MNJ A;  3UI6 A;  1E44 A;  3WD0 A;  3ALG A;  3ARZ A;  5GPG A;  4TNS A;  5HW8 A;  1L1P A;  1FKD A;  2UZ5 A;  3ARR A;  1N1A A;  3ARS A;  1E15 A;  1F8A B;  2PV3 A;  2PV1 A;  2LGO A;  3ART A;  1FKH A;  2XP8 A;  3G6M A;  1LG2 A;  1ZK6 A;  2ZQV A;  1F40 A;  2XPA A;  4ODN A;  1K9T A;  1W9V A;  1HKK A;  3IHZ A;  4DT4 A;  3VAW A;  2IUZ A;  1C9H A;  2MPH A;  2ZR4 A;  4IT4 A;  3KAB A;  1LQ0 A;  4DRQ A;  3O5E A;  1VF8 A;  5HWB A;  4WJX A;  1ZB5 A;  4QZV B;  2WK2 A;  4MNM A;  4BF8 A;  1ROU A;  2RUR A;  3TDB A;  5B8I C;  1E6P A;  2DT2 A;  4JYS A;  1ZCN A;  4QT3 A;  5HBF A;  2WLY A;  4JFI A;  1ZBW A;  2DT1 A;  5D75 A;  3PA7 A;  1UR9 A;  4IT6 A;  4J4O A;  4W9O A;  3WD1 A;  1FKF A;  4HBE A;  2RUC A;  4DRK A;  2KE0 A;  3B7X A;  4GGQ A;  1HJW A;  3TCZ A;  4NZC A;  2RUD A;  3O5J A;  4P8X A;  2ITK A;  2YBU A;  2K8I A;  1KT1 A;  1SYT A;  1W1V A;  3RM8 A;  1ROT A;  2ZR6 A;  1GRJ A;  2FDM A;  4HAR A;  2N87 A;  1H0I A;  3WD4 A;  4U86 A;  4P8U A;  2F4E A;  4ODP A;  2WM0 A;  3KCE A;  1WAW A;  3WQW A;  4JFK A;  4Z2J A;  1FKB A;  2B5U B;  1D7H A;  3ARV A;  1FKS A;  1LL7 A;  2KR7 A;  3KAI A;  4LAY A;  3JXV A;  1LJY A;  2Y78 A;  1JNE A;  2RSE A;  3EY6 A;  2DG4 A;  5HUA A;  1NMW A;  1D7I A;  1X6N A;  2JZV A;  2O92 A;  4W5U A;  4IQ2 A;  5HKG A;  3GU0 A;  1JCH B;  1QZ2 A;  4AY1 A;  1BKF A;  1KFW A;  1Q6U A;  1JNT A;  2DSV A;  3ARQ A;  1FAP A;  1FD9 A;  2PBC A;  2DSU A;  2XP5 A;  4DRO A;  1WNO A;  3PR9 A;  4NSB A;  1W9P A;  2ZR5 A;  3FY1 A;  4MAV A;  1E6R A;  1W1P A;  1XRV A;  4TW7 A;  1PIN A;  4DZ3 A;  5HW6 A;  1NH6 A;  3KAC A;  4TX0 A;  3KAD A;  3UI4 A;  2MLZ A;  1RD6 A;  3H9R B;  1O6I A;  2LPV A;  2PPO A;  5J6E A;  3UQB A;  3WH0 A;  3ARU A;  4TW8 A;  4FAP A;  5DO2 A;  1NWR A;  4P8V A;  1J6Y A;  2PV2 A;  4DWS B;  1IX5 A;  2PPN A;  1GUV A;  1JVW A;  2ESC A;  3AS2 A;  2DSW A;  3WQV A;  3B9E A;  3AS3 A;  2OFN A;  4N19 A;  3G6L A;  3CGM A;  1HXV A;  1NSG A;  1D7J A;  1B6C A;  3JYM A;  4G50 A;  4TYO A;  3UI5 A;  1OGG A;  3CHF A;  4ZS6 A;  1KT0 A;  1Q1C A;  3BXW A;  1LG1 A;  3BMB A;  3KAH A;  1GOI A;  2AOS A;  1WB0 A;  4URI A;  3CH9 A;  4U85 A;  4J4N A;  2RQS A;  3OOB A;  1W1Y A;  1EDQ A;  4GIV A;  1QPF A;  1W9U A;  3TC5 A;  4Q22 A;  2KI3 A;  2YBT A;  5DF0 A;  1JND A;  4P8W A;  1EYM A;  4W9P A;  1XHG A;  3O5R A;  2XP7 A;  1FFR A;  2L2S A;  3WL0 A;  3O5P A;  4DRH A;  4JFM A;  4WKF A;  4FN2 A;  3NRK A;  4ITZ A;  3B9D A;  3IKD A;  3RME A;  3ARX A;  1EQ3 A;  4Q7N A;  3O5M A;  1LL6 A;  2XP3 A;  5HW7 A;  1R9H A;  1EIB A;  3OA5 A;  2XP6 A;  3O5Q A;  4HBO A;  4ZPT R;  4TW6 A;  1GPF A;  3CHE A;  3UQA A;  3O5G A;  2M2A A;  4MNL A;  4WIW A;  1EHN A;  3ARW A;  4LAX A;  2F2D A;  1U79 A;  1FKR A;  4ODL A;  4KQZ A;  3CZ8 A;  1ZBV A;  1ZU8 A;  4R5E A;  3ODK A;  2KO7 A;  2PPP A;  1J4I A;  3KAG A;  2FKE A;  1NWU A;  2ETN A;  4ML4 A;  1HKJ A;  5DIT A;  2PI6 A;  3AQU A;  1NWT A;  1PBK A;  2A3E A;  2Q5A A;  2MNT A;  3O5K A;  3NI6 A;  1W1T A;  2FAP A;  4IQC A;  2F23 A;  4DRM A;  3UF8 A;  4ODO A;  2KFW A;  4WKH A;  1HKI A;  1X6L A;  4LAV A;  2B31 A;  4LAW A;  1FFQ A;  1BL4 A;  3GPK A;  5JH8 A;  1ZL1 A;  3AS0 A;  4ZPW R;  5DEZ A;  1Y0O A;  4KR0 B;  5HT1 A;  2XP9 A;  4Z2K A;  3ARP A;  1TCO C;  4R0X A;  4UDM A;  4L72 B;  2VN1 A;  4U84 A;  1T11 A;  1LL4 A;  3MDY B;  3B8S A;  1E9L A;  5GPR A;  3PRA A;  3AS1 A;  1YAT A;  3WD3 A;  3RM4 A;  3UQI A;  4IPX A;  4DIP A;  5HTG A;  2A3A A;  3PRD A;  4LGX A;  2WLZ A;  1E6Z A; 
#chains in the Genus database with same CATH homology
 2MF9 A;  4JFL A;  4S3J A;  3JYJ A;  3I6C A;  1J4H A;  1OGB A;  2G41 A;  2DSZ A;  1E6N A;  3NTP A;  1YW5 A;  5I98 A;  2F21 A;  1QPL A;  5BXJ A;  1ZBC A;  3RM9 A;  4QIB A;  2M1I A;  3CHD A;  4XAK A;  1FJD A;  4QT2 A;  3O5L A;  2LKN A;  2DT0 A;  5DIU A;  4DRP A;  1A7X A;  3RFW A;  3FXY A;  4DWS A;  2DG9 A;  3WL1 A;  4G2P A;  4O2T A;  5GQB A;  3WIJ A;  1FKJ A;  3WD2 A;  1H0G A;  3W4R A;  2LJ4 A;  3WKZ A;  5DIV A;  4Z2G A;  2DPE A;  1ITX A;  3O5F A;  4MNK A;  1HJX A;  1M5Y A;  1W26 A;  2ZQT A;  2A3B A;  4NNR A;  4ZPV R;  4ODR A;  4Z2H A;  3FAP A;  1ZBK A;  1SR0 A;  4MGV A;  1FKI A;  3O5O A;  2ZQU A;  1Q6H A;  3KAF A;  4WK9 A;  1TFV A;  1FKG A;  4S3K A;  1CTN A;  2OLH A;  1UR8 A;  1D2K A;  1P5Q A;  2G8Z A;  4ODM A;  2IF4 A;  2QF8 A;  3QOK A;  1JNS A;  3CGN A;  2RUQ A;  4DRI A;  3LUO A;  3O5D A;  3PRB A;  1NWS A;  4DWS C;  4Z2L A;  2M08 A;  2XPB A;  4PTM A;  4WKA A;  4DWS D;  3B9A A;  4DRJ A;  1OWQ A;  3ARO A;  4JFJ A;  1J4R A;  2DG3 A;  4C02 B;  2ZQS A;  4ODQ A;  4W9Q A;  3O5I A;  2XP4 A;  3KZ7 A;  2AWG A;  3RGC A;  3ARY A;  2MLX A;  2O9O A;  4MSP A;  4DRN A;  4MPK A;  1HKM A;  5HWC A;  1D6O A;  4DH0 A;  1FKL A;  1Q6I A;  4L3N A;  1FKT A;  1FKK A;  4Z2I A;  2DT3 A;  2MLY A;  2A3C A;  2VCD A;  1HJV A;  4MTV A;  3ALF A;  1NMV A;  2KGJ A;  4ODK A;  3IK8 A;  2D9F A;  4DZ2 A;  3CHC A;  3IKG A;  4MNJ A;  3UI6 A;  3WD0 A;  3ALG A;  3ARZ A;  5GPG A;  4TNS A;  5HW8 A;  1L1P A;  1FKD A;  2UZ5 A;  3ARR A;  1N1A A;  3ARS A;  1E15 A;  1F8A B;  2PV3 A;  2PV1 A;  2LGO A;  3ART A;  1FKH A;  2XP8 A;  3G6M A;  1LG2 A;  1ZK6 A;  2ZQV A;  1F40 A;  2XPA A;  4ODN A;  1K9T A;  1W9V A;  1HKK A;  3IHZ A;  4DT4 A;  3VAW A;  2IUZ A;  1C9H A;  2MPH A;  2ZR4 A;  4IT4 A;  3KAB A;  1LQ0 A;  4DRQ A;  3O5E A;  1VF8 A;  5HWB A;  4WJX A;  1ZB5 A;  4QZV B;  2WK2 A;  4MNM A;  4BF8 A;  1ROU A;  2RUR A;  3TDB A;  5B8I C;  1E6P A;  2DT2 A;  4JYS A;  1ZCN A;  4QT3 A;  5HBF A;  2WLY A;  4JFI A;  1ZBW A;  2DT1 A;  5D75 A;  3PA7 A;  1UR9 A;  4IT6 A;  4J4O A;  4W9O A;  3WD1 A;  1FKF A;  4HBE A;  2RUC A;  4DRK A;  2KE0 A;  3B7X A;  4GGQ A;  1HJW A;  3TCZ A;  4NZC A;  2RUD A;  3O5J A;  4P8X A;  2ITK A;  2YBU A;  2K8I A;  1KT1 A;  1SYT A;  1W1V A;  3RM8 A;  1ROT A;  2ZR6 A;  2FDM A;  4HAR A;  2N87 A;  1H0I A;  3WD4 A;  4U86 A;  4P8U A;  2F4E A;  4ODP A;  2WM0 A;  3KCE A;  1WAW A;  3WQW A;  4JFK A;  4Z2J A;  1FKB A;  1D7H A;  3ARV A;  1FKS A;  1LL7 A;  2KR7 A;  3KAI A;  4LAY A;  3JXV A;  1LJY A;  2Y78 A;  1JNE A;  2RSE A;  3EY6 A;  2DG4 A;  5HUA A;  1NMW A;  1D7I A;  1X6N A;  2JZV A;  2O92 A;  4W5U A;  4IQ2 A;  5HKG A;  1QZ2 A;  4AY1 A;  1BKF A;  1KFW A;  1Q6U A;  1JNT A;  2DSV A;  3ARQ A;  1FAP A;  1FD9 A;  2PBC A;  2DSU A;  2XP5 A;  4DRO A;  1WNO A;  3PR9 A;  4NSB A;  1W9P A;  2ZR5 A;  3FY1 A;  4MAV A;  1E6R A;  1W1P A;  1XRV A;  4TW7 A;  1PIN A;  4DZ3 A;  5HW6 A;  1NH6 A;  3KAC A;  4TX0 A;  3KAD A;  3UI4 A;  2MLZ A;  1RD6 A;  3H9R B;  1O6I A;  2LPV A;  2PPO A;  5J6E A;  3UQB A;  3WH0 A;  3ARU A;  4TW8 A;  4FAP A;  5DO2 A;  1NWR A;  4P8V A;  1J6Y A;  2PV2 A;  4DWS B;  1IX5 A;  2PPN A;  1GUV A;  1JVW A;  2ESC A;  3AS2 A;  2DSW A;  3WQV A;  3B9E A;  3AS3 A;  2OFN A;  4N19 A;  3G6L A;  3CGM A;  1HXV A;  1NSG A;  1D7J A;  1B6C A;  3JYM A;  4G50 A;  4TYO A;  3UI5 A;  1OGG A;  3CHF A;  4ZS6 A;  1KT0 A;  1Q1C A;  3BXW A;  1LG1 A;  3KAH A;  1GOI A;  2AOS A;  1WB0 A;  4URI A;  3CH9 A;  4U85 A;  4J4N A;  2RQS A;  3OOB A;  1W1Y A;  1EDQ A;  4GIV A;  1QPF A;  1W9U A;  3TC5 A;  4Q22 A;  2KI3 A;  2YBT A;  5DF0 A;  1JND A;  4P8W A;  1EYM A;  4W9P A;  1XHG A;  3O5R A;  2XP7 A;  1FFR A;  2L2S A;  3WL0 A;  3O5P A;  4DRH A;  4JFM A;  4WKF A;  4FN2 A;  3NRK A;  4ITZ A;  3B9D A;  3IKD A;  3RME A;  3ARX A;  1EQ3 A;  4Q7N A;  3O5M A;  1LL6 A;  2XP3 A;  5HW7 A;  1R9H A;  1EIB A;  3OA5 A;  2XP6 A;  3O5Q A;  4HBO A;  4ZPT R;  4TW6 A;  1GPF A;  3CHE A;  3UQA A;  3O5G A;  2M2A A;  4MNL A;  4WIW A;  1EHN A;  3ARW A;  4LAX A;  2F2D A;  1U79 A;  1FKR A;  4ODL A;  4KQZ A;  3CZ8 A;  1ZBV A;  1ZU8 A;  4R5E A;  3ODK A;  2KO7 A;  2PPP A;  1J4I A;  3KAG A;  2FKE A;  1NWU A;  4ML4 A;  1HKJ A;  5DIT A;  2PI6 A;  3AQU A;  1NWT A;  1PBK A;  2A3E A;  2Q5A A;  2MNT A;  3O5K A;  3NI6 A;  1W1T A;  2FAP A;  4IQC A;  4DRM A;  3UF8 A;  4ODO A;  2KFW A;  4WKH A;  1HKI A;  1X6L A;  4LAV A;  2B31 A;  4LAW A;  1FFQ A;  1BL4 A;  3GPK A;  5JH8 A;  1ZL1 A;  3AS0 A;  4ZPW R;  5DEZ A;  1Y0O A;  4KR0 B;  5HT1 A;  2XP9 A;  4Z2K A;  3ARP A;  1TCO C;  4R0X A;  4L72 B;  2VN1 A;  4U84 A;  1T11 A;  1LL4 A;  3MDY B;  3B8S A;  1E9L A;  5GPR A;  3PRA A;  3AS1 A;  1YAT A;  3WD3 A;  3RM4 A;  3UQI A;  4IPX A;  4DIP A;  5HTG A;  2A3A A;  3PRD A;  4LGX A;  2WLZ A;  1E6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...