3O5IA

Fk1 domain of fkbp51, crystal form ii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5iA00
4JFJA 3O5OA 1NMWA 2Q5AA 1FKRA 2PPOA 5BXJA 3PRDA 3ODKA 1JVWA 4R0XA 2VCDA 1JNTA 2MPHA 3KAFA 4U86A 5B8IC 4JYSA 4MSPA 4ODPA 4W9QA 1TCOC 3O5EA 2LGOA 3NI6A 5GPGA 2ZQVA 3KABA 3O5KA 1FKBA 2Y78A 4TW8A 2L2SA 3KADA 4JFKA 4JFLA 1JNSA 1J4RA 4W9PA 1L1PA 3KAGA 3CGMA 1Q6HA 3NTPA 2PBCA 3UQAA 2LPVA 2RQSA 3FAPA 2KO7A 3O5RA 3CGNA 3JYJA 4ODOA 2MF9A 4DH0A 4DRHA 2XP5A 1HXVA 3UQBA 3UQIA 5J6EA 4DRNA 4JFIA 5HUAA 1FKLA 1FKGA 1Q6IA 2XPAA 1PINA 1U79A 4LAXA 5HTGA 2MLXA 3MDYB 3O5GA 1FKTA 4ODMA 3UI4A 4DROA 4G50A 4ODLA 5DIUA 5DIVA 2M1IA 1FJDA 3O5PA 1T11A 3JXVA 2F2DA 2M08A 1NSGA 3O5IA 2UZ5A 1FKHA 1D7JA 1Q1CA 1YATA 2PV3A 1R9HA 4TW6A 3TC5A 5D75A 3TCZA 2KR7A 2VN1A 2M2AA 2XP8A 1F40A 3GPKA 4DIPA 2DG3A 2LKNA 1EYMA 2JZVA 1D7HA 1YW5A 2KI3A 2LJ4A 2XP6A 3B7XA 2PV2A 4U85A 1Y0OA 4G2PA 4TX0A 4DZ3A 2N87A 3JYMA 4DRKA 5HWBA 3O5MA 1FKJA 1FKDA 2KGJA 4DRIA 2XP7A 3IKDA 4DRPA 3O5FA 1PBKA 2RUDA 4ODNA 3PA7A 4DT4A 4GIVA 2FAPA 1J6YA 1W26A 3OOBA 5HW8A 4NNRA 3O5LA 4FAPA 1QPLA 4N19A 3UI5A 5I98A 4DRJA 3O5DA 1ZCNA 3KZ7A 1J4IA 4J4OA 1EQ3A 2ITKA 3IKGA 4C02B 1N1AA 1BKFA 2DG4A 1FKKA 5HW7A 4LAVA 4DZ2A 5HKGA 2K8IA 1KT0A 4LAWA 4BF8A 1M5YA 1ZK6A 4W9OA 1FAPA 1KT1A 1ROTA 4FN2A 3RGCA 4QT3A 1FKFA 2MLZA 3KCEA 2OFNA 2RURA 4IQCA 3WH0A 2ZR4A 2MNTA 2ZR6A 1ROUA 2RSEA 2DG9A 4ODQA 3EY6A 4GGQA 5HT1A 3UF8A 3VAWA 1D6OA 3IHZA 1D7IA 3O5JA 4ITZA 4U84A 1A7XA 1J4HA 1FD9A 3RFWA 2ZQSA 2ZQUA 4DRMA 2XP9A 4TYOA 3KACA 3NRKA 3I6CA 4DRQA 5HWCA 3KAHA 3LUOA 2RUQA 4ODKA 4JFMA 4QT2A 1NMVA 2KE0A 2RUCA 2XP4A 2AWGA 1Q6UA 4QIBA 3H9RB 4IPXA 4J4NA 4LAYA 5DITA 4ODRA 4TNSA 3KAIA 1FKIA 2PPPA 1QPFA 1F8AB 2F21A 2XPBA 2IF4A 2D9FA 4MGVA 2PPNA 1BL4A 2XP3A 1P5QA 3UI6A 2FKEA 1FKSA 2ZQTA 1C9HA 4TW7A 2MLYA 2KFWA 4IQ2A 2F4EA 2PV1A 3TDBA 2ZR5A 3PRBA 3O5QA 3IK8A 4O2TA 1QZ2A 5HW6A 1B6CA
chains in the Genus database with same CATH superfamily
1NMWA 5BXJA 3BXWA 4R0XA 1JNTA 2MPHA 4MSPA 3KABA 2Y78A 3ARWA 4Z2LA 1JNSA 1J4RA 2QF8A 1EHNA 3KAGA 3CGMA 1JCHB 3UQAA 3FAPA 2KO7A 4ODOA 2A3CA 5J6EA 5HUAA 4S3KA 1FKLA 4WKAA 1ZBCA 4IT4A 2MLXA 3MDYB 4DROA 4G50A 3B9EA 5DIVA 2F2DA 1FKHA 3TCZA 2KR7A 2VN1A 3GPKA 3CHFA 2LJ4A 1EYMA 2JZVA 1LL6A 2PV2A 4TX0A 5HWBA 1JNEA 2A3EA 1FKJA 4IT6A 1HKKA 3IKDA 1H0IA 4DT4A 1J6YA 1E9LA 1W9VA 4ZS6A 2DSVA 4LGXA 3WL1A 3WQWA 3O5DA 4J4OA 2ITKA 4C02B 4DZ2A 1KT0A 3FXYA 4LAWA 1M5YA 3ARRA 4QT3A 3KCEA 1EIBA 4IQCA 3WH0A 2MNTA 1ROUA 2RSEA 3EY6A 3UF8A 1D7IA 2ZQSA 4NSBA 1HJVA 3WD2A 1WNOA 3I6CA 4DRQA 3CZ8A 1GRJA 2RUQA 4MAVA 1SR0A 3AS1A 1Q6UA 2FDMA 3H9RB 4QIBA 4DWSC 1XHGA 4ODRA 4TNSA 3KAIA 2F21A 1F8AB 2IF4A 2D9FA 4MGVA 5GQBA 5DEZA 3UI6A 1C9HA 3ALFA 2ZR5A 2WLYA 5HW6A 1UR9A 3CHEA 4JFJA 2PPOA 2PN0A 3ODKA 3KAFA 3AS2A 4ODPA 4W9QA 1TCOC 1XRVA 2LGOA 1WB0A 5GPGA 2ZQVA 2L2SA 4JFKA 4JFLA 1NH6A 4WK9A 4W9PA 3NTPA 1W1YA 2RQSA 3O5RA 4P8UA 2MF9A 4DRHA 1HXVA 3UQBA 2DSUA 3CHCA 1Q6IA 4LAXA 5HTGA 5HBFA 3O5GA 1FKTA 4Q22A 1ZBWA 1HKIA 4HBEA 4ODLA 1FJDA 1T11A 3JXVA 1LJYA 4MTVA 2UZ5A 1Q1CA 4Z2KA 1R9HA 3EIPA 1UR8A 2XP8A 4WKHA 1E44A 3ARQA 4PTMA 2A3AA 4U85A 4G2PA 4DWSA 2N87A 3JYMA 2KGJA 1E6NA 3ARZA 4S3JA 1LL4A 4GIVA 1W26A 5HW8A 3B8SA 4FAPA 4N19A 1K9TA 4DRJA 1ZCNA 1J4IA 5DF0A 3IKGA 4AY1A 3G6LA 2DG4A 3WD3A 4Z2HA 1RD6A 4LAVA 5HKGA 2K8IA 2YBTA 1ZK6A 4NZCA 1FKFA 2MLZA 2RURA 1LL7A 2DG9A 4ODQA 3WL0A 1OGGA 3WD1A 2AOSA 1D2KA 4ITZA 1ZU8A 1A7XA 4U84A 4TYOA 2OLHA 4MNJA 4Z2IA 4QT2A 2XP4A 1GPFA 4Z2GA 5DITA 3AS0A 3ARTA 2XPBA 1P5QA 5DO2A 2MLYA 2PV1A 3TDBA 2YBUA 3PRBA 1LG1A 1QZ2A 1FKRA 1E6PA 1B6CA 1JVWA 2F23A 1E6ZA 4JYSA 5GPRA 1WAWA 3ARXA 4L3NA 3B9DA 1FKBA 1H0GA 4KR0B 3KADA 4XAKA 3CHDA 2PBCA 2DT0A 1X6NA 1X6LA 2WM0A 3UQIA 4JFIA 1FKGA 2XPAA 1PINA 1U79A 4ODMA 1OWQA 5DIUA 3O5PA 1NSGA 1TFVA 3O5IA 1D7JA 1YATA 2PV3A 1VF8A 3TC5A 3RMEA 5D75A 4W5UA 2M2AA 2O92A 4DIPA 4MNLA 2DG3A 5JH8A 2KI3A 1E6RA 1Y0OA 3RM9A 4QZVB 4DRKA 2EULA 3O5MA 1NWTA 4ZPVR 4DRPA 3CH9A 1PBKA 3PA7A 4ML4A 3OOBA 3AROA 2B31A 1LG2A 4NNRA 4KQZA 1QPLA 3UI5A 1W9UA 3W4RA 3KZ7A 1ZB5A 1JNDA 4DWSD 1BKFA 3FY1A 5HW7A 2WK2A 4BF8A 1FAPA 1O6IA 1ROTA 4FN2A 2OFNA 2IUZA 2ZR4A 2ZR6A 1FFRA 4GGQA 5HT1A 1D6OA 3IHZA 3O5JA 4L72B 2DT1A 4DRMA 3KACA 3NRKA 3WIJA 1HKMA 3KAHA 4R5EA 4ODKA 3WD4A 3WQVA 4P8VA 4MNMA 2RUCA 3G6MA 3ARSA 4LAYA 1HJXA 2PPPA 1QPFA 4UDMA 2PPNA 4WJXA 1BL4A 3PR9A 2FKEA 2ZQTA 2ETNA 4ZPWR 4TW7A 2WLZA 2F4EA 3O5QA 1E15A 1GUVA 4O2TA 5B8IC 3O5OA 2Q5AA 3PRDA 2VCDA 3GTYX 4U86A 1GOIA 3O5EA 2G8ZA 4MPKA 2A3BA 3NI6A 1ZL1A 2DT3A 3O5KA 4TW8A 2O9OA 1HKJA 4Q7NA 1L1PA 4WIWA 1Q6HA 1W1TA 2LPVA 3AS3A 3B9AA 3CGNA 3JYJA 4DH0A 2XP5A 1HJWA 4DRNA 3ARPA 4URIA 2DT2A 3UI4A 2M1IA 4Z2JA 2M08A 4TW6A 1LQ0A 4DWSB 2DSWA 3WKZA 1KFWA 1F40A 2LKNA 1D7HA 1IX5A 1YW5A 2XP6A 3B7XA 4DZ3A 1W1VA 3BMBA 2ESCA 1W9PA 4HBOA 1FKDA 4ZPTR 1CTNA 3GU0A 4DRIA 2XP7A 3O5FA 2RUDA 4ODNA 2FAPA 3ARVA 2G41A 3O5LA 5I98A 2DSZA 3ARUA 1EQ3A 1NWRA 4WKFA 4MNKA 1N1AA 1FKKA 1NWUA 4W9OA 1KT1A 3RGCA 3ALGA 1SYTA 1ZBVA 3VAWA 4HARA 1J4HA 1FD9A 3RFWA 1ITXA 2DPEA 2ZQUA 1EDQA 3QOKA 3WD0A 2XP9A 3OA5A 5HWCA 3LUOA 4JFMA 1W1PA 1NMVA 2KE0A 1ZBKA 2AWGA 2B5UB 4IPXA 4J4NA 2PI6A 3PRAA 1FKIA 2P4VA 1NWSA 2XP3A 3ARYA 1OGBA 1FKSA 3RM4A 3RM8A 1FFQA 4IQ2A 2KFWA 3AQUA 3IK8A 4P8XA 4P8WA
chains in the Genus database with same CATH topology
1NMWA 5BXJA 3BXWA 4R0XA 1JNTA 2MPHA 4MSPA 3KABA 2Y78A 3ARWA 4Z2LA 1JNSA 1J4RA 2QF8A 1EHNA 3KAGA 3CGMA 3UQAA 3FAPA 2KO7A 4ODOA 2A3CA 5J6EA 5HUAA 4S3KA 1FKLA 4WKAA 1ZBCA 4IT4A 2MLXA 3MDYB 4DROA 4G50A 3B9EA 5DIVA 2F2DA 1FKHA 3TCZA 2KR7A 2VN1A 3GPKA 3CHFA 2LJ4A 1EYMA 2JZVA 1LL6A 2PV2A 4TX0A 5HWBA 1JNEA 2A3EA 1FKJA 4IT6A 1HKKA 3IKDA 1H0IA 4DT4A 1J6YA 1E9LA 1W9VA 4ZS6A 2DSVA 4LGXA 3WL1A 3WQWA 3O5DA 4J4OA 2ITKA 4C02B 4DZ2A 1KT0A 3FXYA 4LAWA 1M5YA 3ARRA 4QT3A 3KCEA 1EIBA 4IQCA 3WH0A 2MNTA 1ROUA 2RSEA 3EY6A 3UF8A 1D7IA 2ZQSA 4NSBA 1HJVA 3WD2A 1WNOA 3I6CA 4DRQA 3CZ8A 2RUQA 4MAVA 1SR0A 3AS1A 1Q6UA 2FDMA 3H9RB 4QIBA 4DWSC 1XHGA 4ODRA 4TNSA 3KAIA 2F21A 1F8AB 2IF4A 2D9FA 4MGVA 5GQBA 5DEZA 3UI6A 1C9HA 3ALFA 2ZR5A 2WLYA 5HW6A 1UR9A 3CHEA 4JFJA 2PPOA 3ODKA 3KAFA 3AS2A 4ODPA 4W9QA 1TCOC 1XRVA 2LGOA 1WB0A 5GPGA 2ZQVA 2L2SA 4JFKA 4JFLA 1NH6A 4WK9A 4W9PA 3NTPA 1W1YA 2RQSA 3O5RA 4P8UA 2MF9A 4DRHA 1HXVA 3UQBA 2DSUA 3CHCA 1Q6IA 4LAXA 5HTGA 5HBFA 3O5GA 1FKTA 4Q22A 1ZBWA 1HKIA 4HBEA 4ODLA 1FJDA 1T11A 3JXVA 1LJYA 4MTVA 2UZ5A 1Q1CA 4Z2KA 1R9HA 1UR8A 2XP8A 4WKHA 3ARQA 4PTMA 2A3AA 4U85A 4G2PA 4DWSA 2N87A 3JYMA 2KGJA 1E6NA 3ARZA 4S3JA 1LL4A 4GIVA 1W26A 5HW8A 3B8SA 4FAPA 4N19A 1K9TA 4DRJA 1ZCNA 1J4IA 5DF0A 3IKGA 4AY1A 3G6LA 2DG4A 3WD3A 4Z2HA 1RD6A 4LAVA 5HKGA 2K8IA 2YBTA 1ZK6A 4NZCA 1FKFA 2MLZA 2RURA 1LL7A 2DG9A 4ODQA 3WL0A 1OGGA 3WD1A 2AOSA 1D2KA 4ITZA 1ZU8A 1A7XA 4U84A 4TYOA 2OLHA 4MNJA 4Z2IA 4QT2A 2XP4A 1GPFA 4Z2GA 5DITA 3AS0A 3ARTA 2XPBA 1P5QA 5DO2A 2MLYA 2PV1A 3TDBA 2YBUA 3PRBA 1LG1A 1QZ2A 1FKRA 1E6PA 1B6CA 1JVWA 1E6ZA 4JYSA 5GPRA 1WAWA 3ARXA 4L3NA 3B9DA 1FKBA 1H0GA 4KR0B 3KADA 4XAKA 3CHDA 2PBCA 2DT0A 1X6NA 1X6LA 2WM0A 3UQIA 4JFIA 1FKGA 2XPAA 1PINA 1U79A 4ODMA 1OWQA 5DIUA 3O5PA 1NSGA 1TFVA 3O5IA 1D7JA 1YATA 2PV3A 1VF8A 3TC5A 3RMEA 5D75A 4W5UA 2M2AA 2O92A 4DIPA 4MNLA 2DG3A 5JH8A 2KI3A 1E6RA 1Y0OA 3RM9A 4QZVB 4DRKA 3O5MA 1NWTA 4ZPVR 4DRPA 3CH9A 1PBKA 3PA7A 4ML4A 3OOBA 3AROA 2B31A 1LG2A 4NNRA 4KQZA 1QPLA 3UI5A 1W9UA 3W4RA 3KZ7A 1ZB5A 1JNDA 4DWSD 1BKFA 3FY1A 5HW7A 2WK2A 4BF8A 1FAPA 1O6IA 1ROTA 4FN2A 2OFNA 2IUZA 2ZR4A 2ZR6A 1FFRA 4GGQA 5HT1A 1D6OA 3IHZA 3O5JA 4L72B 2DT1A 4DRMA 3KACA 3NRKA 3WIJA 1HKMA 3KAHA 4R5EA 4ODKA 3WD4A 3WQVA 4P8VA 4MNMA 2RUCA 3G6MA 3ARSA 4LAYA 1HJXA 2PPPA 1QPFA 2PPNA 4WJXA 1BL4A 3PR9A 2FKEA 2ZQTA 4ZPWR 4TW7A 2WLZA 2F4EA 3O5QA 1E15A 1GUVA 4O2TA 5B8IC 3O5OA 2Q5AA 3PRDA 2VCDA 4U86A 1GOIA 3O5EA 2G8ZA 4MPKA 2A3BA 3NI6A 1ZL1A 2DT3A 3O5KA 4TW8A 2O9OA 1HKJA 4Q7NA 1L1PA 4WIWA 1Q6HA 1W1TA 2LPVA 3AS3A 3B9AA 3CGNA 3JYJA 4DH0A 2XP5A 1HJWA 4DRNA 3ARPA 4URIA 2DT2A 3UI4A 2M1IA 4Z2JA 2M08A 4TW6A 1LQ0A 4DWSB 2DSWA 3WKZA 1KFWA 1F40A 2LKNA 1D7HA 1IX5A 1YW5A 2XP6A 3B7XA 4DZ3A 1W1VA 2ESCA 1W9PA 4HBOA 1FKDA 4ZPTR 1CTNA 4DRIA 2XP7A 3O5FA 2RUDA 4ODNA 2FAPA 3ARVA 2G41A 3O5LA 5I98A 2DSZA 3ARUA 1EQ3A 1NWRA 4WKFA 4MNKA 1N1AA 1FKKA 1NWUA 4W9OA 1KT1A 3RGCA 3ALGA 1SYTA 1ZBVA 3VAWA 4HARA 1J4HA 1FD9A 3RFWA 1ITXA 2DPEA 2ZQUA 1EDQA 3QOKA 3WD0A 2XP9A 3OA5A 5HWCA 3LUOA 4JFMA 1W1PA 1NMVA 2KE0A 1ZBKA 2AWGA 4J4NA 4IPXA 2PI6A 3PRAA 1FKIA 1NWSA 2XP3A 3ARYA 1OGBA 1FKSA 3RM4A 3RM8A 1FFQA 4IQ2A 2KFWA 3AQUA 3IK8A 4P8XA 4P8WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFJ A;  3O5O A;  1NMW A;  2Q5A A;  1FKR A;  2PPO A;  5BXJ A;  3PRD A;  3ODK A;  1JVW A;  4R0X A;  2VCD A;  1JNT A;  2MPH A;  3KAF A;  4U86 A;  5B8I C;  4JYS A;  4MSP A;  4ODP A;  4W9Q A;  1TCO C;  3O5E A;  2LGO A;  3NI6 A;  5GPG A;  2ZQV A;  3KAB A;  3O5K A;  1FKB A;  2Y78 A;  4TW8 A;  2L2S A;  3KAD A;  4JFK A;  4JFL A;  1JNS A;  1J4R A;  4W9P A;  1L1P A;  3KAG A;  3CGM A;  1Q6H A;  3NTP A;  2PBC A;  3UQA A;  2LPV A;  2RQS A;  3FAP A;  2KO7 A;  3O5R A;  3CGN A;  3JYJ A;  4ODO A;  2MF9 A;  4DH0 A;  4DRH A;  2XP5 A;  1HXV A;  3UQB A;  3UQI A;  5J6E A;  4DRN A;  4JFI A;  5HUA A;  1FKL A;  1FKG A;  1Q6I A;  2XPA A;  1PIN A;  1U79 A;  4LAX A;  5HTG A;  2MLX A;  3MDY B;  3O5G A;  1FKT A;  4ODM A;  3UI4 A;  4DRO A;  4G50 A;  4ODL A;  5DIU A;  5DIV A;  2M1I A;  1FJD A;  3O5P A;  1T11 A;  3JXV A;  2F2D A;  2M08 A;  1NSG A;  3O5I A;  2UZ5 A;  1FKH A;  1D7J A;  1Q1C A;  1YAT A;  2PV3 A;  1R9H A;  4TW6 A;  3TC5 A;  5D75 A;  3TCZ A;  2KR7 A;  2VN1 A;  2M2A A;  2XP8 A;  1F40 A;  3GPK A;  4DIP A;  2DG3 A;  2LKN A;  1EYM A;  2JZV A;  1D7H A;  1YW5 A;  2KI3 A;  2LJ4 A;  2XP6 A;  3B7X A;  2PV2 A;  4U85 A;  1Y0O A;  4G2P A;  4TX0 A;  4DZ3 A;  2N87 A;  3JYM A;  4DRK A;  5HWB A;  3O5M A;  1FKJ A;  1FKD A;  2KGJ A;  4DRI A;  2XP7 A;  3IKD A;  4DRP A;  3O5F A;  1PBK A;  2RUD A;  4ODN A;  3PA7 A;  4DT4 A;  4GIV A;  2FAP A;  1J6Y A;  1W26 A;  3OOB A;  5HW8 A;  4NNR A;  3O5L A;  4FAP A;  1QPL A;  4N19 A;  3UI5 A;  5I98 A;  4DRJ A;  3O5D A;  1ZCN A;  3KZ7 A;  1J4I A;  4J4O A;  1EQ3 A;  2ITK A;  3IKG A;  4C02 B;  1N1A A;  1BKF A;  2DG4 A;  1FKK A;  5HW7 A;  4LAV A;  4DZ2 A;  5HKG A;  2K8I A;  1KT0 A;  4LAW A;  4BF8 A;  1M5Y A;  1ZK6 A;  4W9O A;  1FAP A;  1KT1 A;  1ROT A;  4FN2 A;  3RGC A;  4QT3 A;  1FKF A;  2MLZ A;  3KCE A;  2OFN A;  2RUR A;  4IQC A;  3WH0 A;  2ZR4 A;  2MNT A;  2ZR6 A;  1ROU A;  2RSE A;  2DG9 A;  4ODQ A;  3EY6 A;  4GGQ A;  5HT1 A;  3UF8 A;  3VAW A;  1D6O A;  3IHZ A;  1D7I A;  3O5J A;  4ITZ A;  4U84 A;  1A7X A;  1J4H A;  1FD9 A;  3RFW A;  2ZQS A;  2ZQU A;  4DRM A;  2XP9 A;  4TYO A;  3KAC A;  3NRK A;  3I6C A;  4DRQ A;  5HWC A;  3KAH A;  3LUO A;  2RUQ A;  4ODK A;  4JFM A;  4QT2 A;  1NMV A;  2KE0 A;  2RUC A;  2XP4 A;  2AWG A;  1Q6U A;  4QIB A;  3H9R B;  4IPX A;  4J4N A;  4LAY A;  5DIT A;  4ODR A;  4TNS A;  3KAI A;  1FKI A;  2PPP A;  1QPF A;  1F8A B;  2F21 A;  2XPB A;  2IF4 A;  2D9F A;  4MGV A;  2PPN A;  1BL4 A;  2XP3 A;  1P5Q A;  3UI6 A;  2FKE A;  1FKS A;  2ZQT A;  1C9H A;  4TW7 A;  2MLY A;  2KFW A;  4IQ2 A;  2F4E A;  2PV1 A;  3TDB A;  2ZR5 A;  3PRB A;  3O5Q A;  3IK8 A;  4O2T A;  1QZ2 A;  5HW6 A;  1B6C A; 
#chains in the Genus database with same CATH topology
 1NMW A;  5BXJ A;  3BXW A;  4R0X A;  1JNT A;  2MPH A;  4MSP A;  3KAB A;  2Y78 A;  3ARW A;  4Z2L A;  1JNS A;  1J4R A;  2QF8 A;  1EHN A;  3KAG A;  3CGM A;  1JCH B;  3UQA A;  3FAP A;  2KO7 A;  4ODO A;  2A3C A;  5J6E A;  5HUA A;  4S3K A;  1FKL A;  4WKA A;  1ZBC A;  4IT4 A;  2MLX A;  3MDY B;  4DRO A;  4G50 A;  3B9E A;  5DIV A;  2F2D A;  1FKH A;  3TCZ A;  2KR7 A;  2VN1 A;  3GPK A;  3CHF A;  2LJ4 A;  1EYM A;  2JZV A;  1LL6 A;  2PV2 A;  4TX0 A;  5HWB A;  1JNE A;  2A3E A;  1FKJ A;  4IT6 A;  1HKK A;  3IKD A;  1H0I A;  4DT4 A;  1J6Y A;  1E9L A;  1W9V A;  4ZS6 A;  2DSV A;  4LGX A;  3WL1 A;  3WQW A;  3O5D A;  4J4O A;  2ITK A;  4C02 B;  4DZ2 A;  1KT0 A;  3FXY A;  4LAW A;  1M5Y A;  3ARR A;  4QT3 A;  3KCE A;  1EIB A;  4IQC A;  3WH0 A;  2MNT A;  1ROU A;  2RSE A;  3EY6 A;  3UF8 A;  1D7I A;  2ZQS A;  4NSB A;  1HJV A;  3WD2 A;  1WNO A;  3I6C A;  4DRQ A;  3CZ8 A;  1GRJ A;  2RUQ A;  4MAV A;  1SR0 A;  3AS1 A;  1Q6U A;  2FDM A;  3H9R B;  4QIB A;  4DWS C;  1XHG A;  4ODR A;  4TNS A;  3KAI A;  2F21 A;  1F8A B;  2IF4 A;  2D9F A;  4MGV A;  5GQB A;  5DEZ A;  3UI6 A;  1C9H A;  3ALF A;  2ZR5 A;  2WLY A;  5HW6 A;  1UR9 A;  3CHE A;  4JFJ A;  2PPO A;  2PN0 A;  3ODK A;  3KAF A;  3AS2 A;  4ODP A;  4W9Q A;  1TCO C;  1XRV A;  2LGO A;  1WB0 A;  5GPG A;  2ZQV A;  2L2S A;  4JFK A;  4JFL A;  1NH6 A;  4WK9 A;  4W9P A;  3NTP A;  1W1Y A;  2RQS A;  3O5R A;  4P8U A;  2MF9 A;  4DRH A;  1HXV A;  3UQB A;  2DSU A;  3CHC A;  1Q6I A;  4LAX A;  5HTG A;  5HBF A;  3O5G A;  1FKT A;  4Q22 A;  1ZBW A;  1HKI A;  4HBE A;  4ODL A;  1FJD A;  1T11 A;  3JXV A;  1LJY A;  4MTV A;  2UZ5 A;  1Q1C A;  4Z2K A;  1R9H A;  3EIP A;  1UR8 A;  2XP8 A;  4WKH A;  1E44 A;  3ARQ A;  4PTM A;  2A3A A;  4U85 A;  4G2P A;  4DWS A;  2N87 A;  3JYM A;  2KGJ A;  1E6N A;  3ARZ A;  4S3J A;  1LL4 A;  4GIV A;  1W26 A;  5HW8 A;  3B8S A;  4FAP A;  4N19 A;  1K9T A;  4DRJ A;  1ZCN A;  1J4I A;  5DF0 A;  3IKG A;  4AY1 A;  3G6L A;  2DG4 A;  3WD3 A;  4Z2H A;  1RD6 A;  4LAV A;  5HKG A;  2K8I A;  2YBT A;  1ZK6 A;  4NZC A;  1FKF A;  2MLZ A;  2RUR A;  1LL7 A;  2DG9 A;  4ODQ A;  3WL0 A;  1OGG A;  3WD1 A;  2AOS A;  1D2K A;  4ITZ A;  1ZU8 A;  1A7X A;  4U84 A;  4TYO A;  2OLH A;  4MNJ A;  4Z2I A;  4QT2 A;  2XP4 A;  1GPF A;  4Z2G A;  5DIT A;  3AS0 A;  3ART A;  2XPB A;  1P5Q A;  5DO2 A;  2MLY A;  2PV1 A;  3TDB A;  2YBU A;  3PRB A;  1LG1 A;  1QZ2 A;  1FKR A;  1E6P A;  1B6C A;  1JVW A;  2F23 A;  1E6Z A;  4JYS A;  5GPR A;  1WAW A;  3ARX A;  4L3N A;  3B9D A;  1FKB A;  1H0G A;  4KR0 B;  3KAD A;  4XAK A;  3CHD A;  2PBC A;  2DT0 A;  1X6N A;  1X6L A;  2WM0 A;  3UQI A;  4JFI A;  1FKG A;  2XPA A;  1PIN A;  1U79 A;  4ODM A;  1OWQ A;  5DIU A;  3O5P A;  1NSG A;  1TFV A;  3O5I A;  1D7J A;  1YAT A;  2PV3 A;  1VF8 A;  3TC5 A;  3RME A;  5D75 A;  4W5U A;  2M2A A;  2O92 A;  4DIP A;  4MNL A;  2DG3 A;  5JH8 A;  2KI3 A;  1E6R A;  1Y0O A;  3RM9 A;  4QZV B;  4DRK A;  2EUL A;  3O5M A;  1NWT A;  4ZPV R;  4DRP A;  3CH9 A;  1PBK A;  3PA7 A;  4ML4 A;  3OOB A;  3ARO A;  2B31 A;  1LG2 A;  4NNR A;  4KQZ A;  1QPL A;  3UI5 A;  1W9U A;  3W4R A;  3KZ7 A;  1ZB5 A;  1JND A;  4DWS D;  1BKF A;  3FY1 A;  5HW7 A;  2WK2 A;  4BF8 A;  1FAP A;  1O6I A;  1ROT A;  4FN2 A;  2OFN A;  2IUZ A;  2ZR4 A;  2ZR6 A;  1FFR A;  4GGQ A;  5HT1 A;  1D6O A;  3IHZ A;  3O5J A;  4L72 B;  2DT1 A;  4DRM A;  3KAC A;  3NRK A;  3WIJ A;  1HKM A;  3KAH A;  4R5E A;  4ODK A;  3WD4 A;  3WQV A;  4P8V A;  4MNM A;  2RUC A;  3G6M A;  3ARS A;  4LAY A;  1HJX A;  2PPP A;  1QPF A;  4UDM A;  2PPN A;  4WJX A;  1BL4 A;  3PR9 A;  2FKE A;  2ZQT A;  2ETN A;  4ZPW R;  4TW7 A;  2WLZ A;  2F4E A;  3O5Q A;  1E15 A;  1GUV A;  4O2T A;  5B8I C;  3O5O A;  2Q5A A;  3PRD A;  2VCD A;  3GTY X;  4U86 A;  1GOI A;  3O5E A;  2G8Z A;  4MPK A;  2A3B A;  3NI6 A;  1ZL1 A;  2DT3 A;  3O5K A;  4TW8 A;  2O9O A;  1HKJ A;  4Q7N A;  1L1P A;  4WIW A;  1Q6H A;  1W1T A;  2LPV A;  3AS3 A;  3B9A A;  3CGN A;  3JYJ A;  4DH0 A;  2XP5 A;  1HJW A;  4DRN A;  3ARP A;  4URI A;  2DT2 A;  3UI4 A;  2M1I A;  4Z2J A;  2M08 A;  4TW6 A;  1LQ0 A;  4DWS B;  2DSW A;  3WKZ A;  1KFW A;  1F40 A;  2LKN A;  1D7H A;  1IX5 A;  1YW5 A;  2XP6 A;  3B7X A;  4DZ3 A;  1W1V A;  3BMB A;  2ESC A;  1W9P A;  4HBO A;  1FKD A;  4ZPT R;  1CTN A;  3GU0 A;  4DRI A;  2XP7 A;  3O5F A;  2RUD A;  4ODN A;  2FAP A;  3ARV A;  2G41 A;  3O5L A;  5I98 A;  2DSZ A;  3ARU A;  1EQ3 A;  1NWR A;  4WKF A;  4MNK A;  1N1A A;  1FKK A;  1NWU A;  4W9O A;  1KT1 A;  3RGC A;  3ALG A;  1SYT A;  1ZBV A;  3VAW A;  4HAR A;  1J4H A;  1FD9 A;  3RFW A;  1ITX A;  2DPE A;  2ZQU A;  1EDQ A;  3QOK A;  3WD0 A;  2XP9 A;  3OA5 A;  5HWC A;  3LUO A;  4JFM A;  1W1P A;  1NMV A;  2KE0 A;  1ZBK A;  2AWG A;  2B5U B;  4IPX A;  4J4N A;  2PI6 A;  3PRA A;  1FKI A;  2P4V A;  1NWS A;  2XP3 A;  3ARY A;  1OGB A;  1FKS A;  3RM4 A;  3RM8 A;  1FFQ A;  4IQ2 A;  2KFW A;  3AQU A;  3IK8 A;  4P8X A;  4P8W A; 
#chains in the Genus database with same CATH homology
 1NMW A;  5BXJ A;  3BXW A;  4R0X A;  1JNT A;  2MPH A;  4MSP A;  3KAB A;  2Y78 A;  3ARW A;  4Z2L A;  1JNS A;  1J4R A;  2QF8 A;  1EHN A;  3KAG A;  3CGM A;  3UQA A;  3FAP A;  2KO7 A;  4ODO A;  2A3C A;  5J6E A;  5HUA A;  4S3K A;  1FKL A;  4WKA A;  1ZBC A;  4IT4 A;  2MLX A;  3MDY B;  4DRO A;  4G50 A;  3B9E A;  5DIV A;  2F2D A;  1FKH A;  3TCZ A;  2KR7 A;  2VN1 A;  3GPK A;  3CHF A;  2LJ4 A;  1EYM A;  2JZV A;  1LL6 A;  2PV2 A;  4TX0 A;  5HWB A;  1JNE A;  2A3E A;  1FKJ A;  4IT6 A;  1HKK A;  3IKD A;  1H0I A;  4DT4 A;  1J6Y A;  1E9L A;  1W9V A;  4ZS6 A;  2DSV A;  4LGX A;  3WL1 A;  3WQW A;  3O5D A;  4J4O A;  2ITK A;  4C02 B;  4DZ2 A;  1KT0 A;  3FXY A;  4LAW A;  1M5Y A;  3ARR A;  4QT3 A;  3KCE A;  1EIB A;  4IQC A;  3WH0 A;  2MNT A;  1ROU A;  2RSE A;  3EY6 A;  3UF8 A;  1D7I A;  2ZQS A;  4NSB A;  1HJV A;  3WD2 A;  1WNO A;  3I6C A;  4DRQ A;  3CZ8 A;  2RUQ A;  4MAV A;  1SR0 A;  3AS1 A;  1Q6U A;  2FDM A;  3H9R B;  4QIB A;  4DWS C;  1XHG A;  4ODR A;  4TNS A;  3KAI A;  2F21 A;  1F8A B;  2IF4 A;  2D9F A;  4MGV A;  5GQB A;  5DEZ A;  3UI6 A;  1C9H A;  3ALF A;  2ZR5 A;  2WLY A;  5HW6 A;  1UR9 A;  3CHE A;  4JFJ A;  2PPO A;  3ODK A;  3KAF A;  3AS2 A;  4ODP A;  4W9Q A;  1TCO C;  1XRV A;  2LGO A;  1WB0 A;  5GPG A;  2ZQV A;  2L2S A;  4JFK A;  4JFL A;  1NH6 A;  4WK9 A;  4W9P A;  3NTP A;  1W1Y A;  2RQS A;  3O5R A;  4P8U A;  2MF9 A;  4DRH A;  1HXV A;  3UQB A;  2DSU A;  3CHC A;  1Q6I A;  4LAX A;  5HTG A;  5HBF A;  3O5G A;  1FKT A;  4Q22 A;  1ZBW A;  1HKI A;  4HBE A;  4ODL A;  1FJD A;  1T11 A;  3JXV A;  1LJY A;  4MTV A;  2UZ5 A;  1Q1C A;  4Z2K A;  1R9H A;  1UR8 A;  2XP8 A;  4WKH A;  3ARQ A;  4PTM A;  2A3A A;  4U85 A;  4G2P A;  4DWS A;  2N87 A;  3JYM A;  2KGJ A;  1E6N A;  3ARZ A;  4S3J A;  1LL4 A;  4GIV A;  1W26 A;  5HW8 A;  3B8S A;  4FAP A;  4N19 A;  1K9T A;  4DRJ A;  1ZCN A;  1J4I A;  5DF0 A;  3IKG A;  4AY1 A;  3G6L A;  2DG4 A;  3WD3 A;  4Z2H A;  1RD6 A;  4LAV A;  5HKG A;  2K8I A;  2YBT A;  1ZK6 A;  4NZC A;  1FKF A;  2MLZ A;  2RUR A;  1LL7 A;  2DG9 A;  4ODQ A;  3WL0 A;  1OGG A;  3WD1 A;  2AOS A;  1D2K A;  4ITZ A;  1ZU8 A;  1A7X A;  4U84 A;  4TYO A;  2OLH A;  4MNJ A;  4Z2I A;  4QT2 A;  2XP4 A;  1GPF A;  4Z2G A;  5DIT A;  3AS0 A;  3ART A;  2XPB A;  1P5Q A;  5DO2 A;  2MLY A;  2PV1 A;  3TDB A;  2YBU A;  3PRB A;  1LG1 A;  1QZ2 A;  1FKR A;  1E6P A;  1B6C A;  1JVW A;  1E6Z A;  4JYS A;  5GPR A;  1WAW A;  3ARX A;  4L3N A;  3B9D A;  1FKB A;  1H0G A;  4KR0 B;  3KAD A;  4XAK A;  3CHD A;  2PBC A;  2DT0 A;  1X6N A;  1X6L A;  2WM0 A;  3UQI A;  4JFI A;  1FKG A;  2XPA A;  1PIN A;  1U79 A;  4ODM A;  1OWQ A;  5DIU A;  3O5P A;  1NSG A;  1TFV A;  3O5I A;  1D7J A;  1YAT A;  2PV3 A;  1VF8 A;  3TC5 A;  3RME A;  5D75 A;  4W5U A;  2M2A A;  2O92 A;  4DIP A;  4MNL A;  2DG3 A;  5JH8 A;  2KI3 A;  1E6R A;  1Y0O A;  3RM9 A;  4QZV B;  4DRK A;  3O5M A;  1NWT A;  4ZPV R;  4DRP A;  3CH9 A;  1PBK A;  3PA7 A;  4ML4 A;  3OOB A;  3ARO A;  2B31 A;  1LG2 A;  4NNR A;  4KQZ A;  1QPL A;  3UI5 A;  1W9U A;  3W4R A;  3KZ7 A;  1ZB5 A;  1JND A;  4DWS D;  1BKF A;  3FY1 A;  5HW7 A;  2WK2 A;  4BF8 A;  1FAP A;  1O6I A;  1ROT A;  4FN2 A;  2OFN A;  2IUZ A;  2ZR4 A;  2ZR6 A;  1FFR A;  4GGQ A;  5HT1 A;  1D6O A;  3IHZ A;  3O5J A;  4L72 B;  2DT1 A;  4DRM A;  3KAC A;  3NRK A;  3WIJ A;  1HKM A;  3KAH A;  4R5E A;  4ODK A;  3WD4 A;  3WQV A;  4P8V A;  4MNM A;  2RUC A;  3G6M A;  3ARS A;  4LAY A;  1HJX A;  2PPP A;  1QPF A;  2PPN A;  4WJX A;  1BL4 A;  3PR9 A;  2FKE A;  2ZQT A;  4ZPW R;  4TW7 A;  2WLZ A;  2F4E A;  3O5Q A;  1E15 A;  1GUV A;  4O2T A;  5B8I C;  3O5O A;  2Q5A A;  3PRD A;  2VCD A;  4U86 A;  1GOI A;  3O5E A;  2G8Z A;  4MPK A;  2A3B A;  3NI6 A;  1ZL1 A;  2DT3 A;  3O5K A;  4TW8 A;  2O9O A;  1HKJ A;  4Q7N A;  1L1P A;  4WIW A;  1Q6H A;  1W1T A;  2LPV A;  3AS3 A;  3B9A A;  3CGN A;  3JYJ A;  4DH0 A;  2XP5 A;  1HJW A;  4DRN A;  3ARP A;  4URI A;  2DT2 A;  3UI4 A;  2M1I A;  4Z2J A;  2M08 A;  4TW6 A;  1LQ0 A;  4DWS B;  2DSW A;  3WKZ A;  1KFW A;  1F40 A;  2LKN A;  1D7H A;  1IX5 A;  1YW5 A;  2XP6 A;  3B7X A;  4DZ3 A;  1W1V A;  2ESC A;  1W9P A;  4HBO A;  1FKD A;  4ZPT R;  1CTN A;  4DRI A;  2XP7 A;  3O5F A;  2RUD A;  4ODN A;  2FAP A;  3ARV A;  2G41 A;  3O5L A;  5I98 A;  2DSZ A;  3ARU A;  1EQ3 A;  1NWR A;  4WKF A;  4MNK A;  1N1A A;  1FKK A;  1NWU A;  4W9O A;  1KT1 A;  3RGC A;  3ALG A;  1SYT A;  1ZBV A;  3VAW A;  4HAR A;  1J4H A;  1FD9 A;  3RFW A;  1ITX A;  2DPE A;  2ZQU A;  1EDQ A;  3QOK A;  3WD0 A;  2XP9 A;  3OA5 A;  5HWC A;  3LUO A;  4JFM A;  1W1P A;  1NMV A;  2KE0 A;  1ZBK A;  2AWG A;  4J4N A;  4IPX A;  2PI6 A;  3PRA A;  1FKI A;  1NWS A;  2XP3 A;  3ARY A;  1OGB A;  1FKS A;  3RM4 A;  3RM8 A;  1FFQ A;  4IQ2 A;  2KFW A;  3AQU A;  3IK8 A;  4P8X A;  4P8W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...