3O5IA

Fk1 domain of fkbp51, crystal form ii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 36
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5iA00
2ZQUA 4QIBA 5GPGA 3NI6A 5HT1A 1HXVA 3UQAA 4DZ2A 3KAFA 2XPAA 2XP4A 1R9HA 4JFIA 1ROTA 2ZQSA 4JFMA 1A7XA 1QPLA 2XP7A 3TCZA 1D7IA 5HTGA 2F21A 2ZQVA 4NNRA 4GIVA 2ZR4A 4ODMA 4JFLA 4DRJA 1FKGA 1FKRA 5HW6A 3PRDA 2KE0A 4DROA 2VCDA 2XP8A 2MNTA 2XPBA 3I6CA 3O5OA 3UI4A 4QT3A 1J4RA 4C02B 3KACA 3IK8A 3NRKA 4TW7A 2PBCA 2XP6A 4QT2A 3KAGA 2LKNA 1W26A 3KAHA 3O5KA 2Y78A 3CGNA 3UI6A 4TW8A 4U86A 3KADA 1PINA 1BKFA 3O5RA 4U84A 2RUDA 1J4HA 2DG4A 2KFWA 2DG3A 2MLXA 2UZ5A 4LAXA 2XP5A 3KAIA 4IQCA 5HWCA 5I98A 4O2TA 3O5IA 3JYMA 3TC5A 5HW7A 1QPFA 1C9HA 5DIUA 3OOBA 3O5DA 4FN2A 1NMVA 4JFKA 3VAWA 2L2SA 2MPHA 2LGOA 2PPNA 4G50A 2RQSA 3RGCA 4DH0A 1FKKA 5HW8A 4JFJA 1JNSA 4ODKA 1FKFA 1QZ2A 1FAPA 3H9RB 4JYSA 2N87A 2JZVA 1FKDA 1FKJA 1JNTA 4TW6A 5DITA 2RUCA 3IKGA 2PPOA 3KCEA 3O5QA 4MSPA 4ODOA 1Q6HA 2OFNA 4TX0A 3UQIA 1EYMA 1FKTA 2MLZA 3LUOA 2FKEA 2PV2A 2PV3A 3GPKA 4DRPA 1B6CA 1FKLA 5BXJA 1J6YA 3JYJA 4DRNA 4J4NA 1P5QA 4ODQA 4R0XA 2PPPA 5J6EA 2F2DA 1ZK6A 3EY6A 3O5LA 2FAPA 1Q6IA 2ZR5A 2KO7A 4ODPA 3UI5A 2IF4A 3UF8A 2PV1A 2ZR6A 5DIVA 1KT1A 2F4EA 1FKHA 4DIPA 1JVWA 4N19A 1BL4A 1KT0A 1EQ3A 2RURA 2Q5AA 2DG9A 2KR7A 2ZQTA 3KABA 1L1PA 4DRMA 1ROUA 2LPVA 3KZ7A 4W9QA 3RFWA 3O5JA 3PA7A 1FKIA 1FKSA 1T11A 3MDYB 3O5MA 5D75A 3O5FA 1NMWA 2LJ4A 2RSEA 3B7XA 5HKGA 4DRQA 4LAVA 1ZCNA 1TCOC 2M08A 4GGQA 4ODNA 1Q6UA 1FJDA 2AWGA 4LAYA 1F40A 5HUAA 3TDBA 1M5YA 3O5PA 1N1AA 1J4IA 4DRHA 4LAWA 2MF9A 2ITKA 1F8AB 1D6OA 3NTPA 2D9FA 4ODLA 3IHZA 3PRBA 4G2PA 2M1IA 4MGVA 5B8IC 3JXVA 4J4OA 4W9OA 3IKDA 2K8IA 4W9PA 4BF8A 3CGMA 4ITZA 4TYOA 4DZ3A 4U85A 2MLYA 1D7JA 1Y0OA 4IPXA 1FKBA 1Q1CA 1YATA 1YW5A 1PBKA 2VN1A 2XP3A 1D7HA 1FD9A 2XP9A 3O5GA 4DRIA 4FAPA 4DT4A 5HWBA 2RUQA 4ODRA 2KGJA 3O5EA 4DRKA 1NSGA 1U79A 4IQ2A 3UQBA 3FAPA 2M2AA 4TNSA 2KI3A 3ODKA 3WH0A
chains in the Genus database with same CATH superfamily
5GPGA 1HXVA 3UQAA 2XP4A 1ROTA 3RM8A 1D7IA 2IUZA 2PI6A 1JCHB 2ZQVA 4QZVB 3WD4A 2DT1A 1LG2A 2OLHA 5HW6A 2KE0A 1TFVA 1J4RA 4UDMA 4C02B 3KACA 2PBCA 2XP6A 4MNKA 1FFRA 4Z2HA 2DSWA 4Z2KA 3KADA 3O5RA 4NSBA 2KFWA 1JNEA 2DG3A 4S3JA 4LAXA 2G41A 4O2TA 1ZB5A 3O5IA 1QPFA 3WD3A 2L2SA 1EDQA 3EIPA 4W5UA 1FKFA 3H9RB 2YBUA 2JZVA 3CHEA 3KCEA 2OFNA 1W1PA 1FKTA 2MLZA 1FKRA 1B6CA 4R0XA 4Z2JA 1LG1A 3ALGA 3EY6A 1E6PA 5DO2A 4ODPA 1LL6A 3UF8A 5DEZA 4DIPA 4KQZA 4HBEA 1XRVA 2WLYA 1KT0A 3WQVA 3KABA 1L1PA 4DRMA 4W9QA 1FKIA 1HJWA 1SR0A 2B31A 2LJ4A 3AS2A 5HKGA 1HJVA 4HARA 1E6RA 4ODNA 1FJDA 4LAYA 3ARRA 1M5YA 3O5PA 1GOIA 1J4IA 1D2KA 1D6OA 1F8AB 3JXVA 4J4OA 3CZ8A 1KFWA 2O92A 4ZPTR 4W9PA 4BF8A 4ITZA 1RD6A 1GPFA 3WD0A 3ARSA 2DPEA 4IPXA 4ODMA 2XP3A 2XP9A 1XHGA 4AY1A 2F23A 2KGJA 1GRJA 4WKAA 2DSVA 4TNSA 1NWTA 3UQBA 3AS3A 4MNJA 1NWSA 5GPRA 4DZ2A 2XPAA 2ZQSA 1A7XA 2XP7A 5HTGA 2F21A 4NNRA 4DRJA 2ZR4A 3ARWA 2QF8A 3AS0A 2VCDA 3O5OA 4QT3A 3ARZA 4MNMA 4TW7A 3IK8A 4QT2A 1ZU8A 3KAGA 2O9OA 3UI6A 1NWUA 3BXWA 2RUDA 4Q22A 2DG4A 4MNLA 2P4VA 3WL0A 5HW7A 5DIUA 4WKHA 2PPNA 3RGCA 5HW8A 1JNSA 1WNOA 1QZ2A 1FFQA 1FAPA 4Z2LA 1JNTA 4TW6A 3ARQA 3GU0A 1Q6HA 1EYMA 4DWSC 1ZL1A 2PV2A 2PV3A 3GPKA 3PRAA 4DRPA 5BXJA 4DRNA 4J4NA 1P5QA 3RM4A 2PPPA 1ZK6A 2F2DA 2WK2A 1EHNA 3B9EA 2WLZA 2IF4A 2AOSA 2F4EA 4P8WA 3ARUA 1HKMA 1ZBKA 2KR7A 1W1YA 1ROUA 3ARVA 1W1TA 3O5FA 1ZBVA 4DRQA 1X6LA 1ZBWA 1LL4A 5DF0A 1UR9A 1NH6A 4GGQA 1Q6UA 4DWSD 2DT3A 5HUAA 1N1AA 4DWSB 2WM0A 1EIBA 3NTPA 2D9FA 4ODLA 4MGVA 4W9OA 3IKDA 2K8IA 2A3BA 2MLYA 1Q1CA 1YATA 1YW5A 3QOKA 1FD9A 5HWBA 4ODRA 3O5EA 3WD1A 4HBOA 1U79A 4WK9A 3FAPA 1E6NA 2KI3A 4DWSA 2ESCA 2ZQUA 4QIBA 2PN0A 3KAFA 4JFMA 3TCZA 4GIVA 4JFLA 1W9UA 3PRDA 2XP8A 2MNTA 2XPBA 3I6CA 3UI4A 2DSUA 3ALFA 4Z2GA 3BMBA 2LKNA 3KAHA 3AS1A 2A3EA 3CGNA 4TW8A 4U86A 2FDMA 1BKFA 2MLXA 5HWCA 3RM9A 1H0IA 3TC5A 4P8VA 4FN2A 3O5DA 3VAWA 4G50A 2LGOA 1HJXA 4DH0A 1FKKA 1X6NA 4ODKA 1HKIA 4JYSA 1JNDA 2N87A 1FKJA 2RUCA 3IKGA 2PPOA 4MSPA 4ML4A 4ODOA 4TX0A 3FXYA 2EULA 3UQIA 3LUOA 2FKEA 3G6LA 1HKJA 1CTNA 3JYJA 2B5UB 5J6EA 2A3AA 2ZR5A 3UI5A 2KO7A 2ZR6A 1FKHA 1JVWA 4N19A 1LQ0A 3PR9A 1ZBCA 1NWRA 1E9LA 5GQBA 2A3CA 3WQWA 3KZ7A 1H0GA 4MAVA 4IT4A 4ZPVR 5HBFA 3O5MA 5D75A 3WL1A 4LAVA 4P8XA 1OGBA 4WIWA 1TCOC 2M08A 1WB0A 4L3NA 2AWGA 4ZS6A 1WAWA 3WKZA 4L72B 2ETNA 4DRHA 2MF9A 1K9TA 2ITKA 3AROA 3AQUA 4G2PA 2M1IA 2DSZA 5B8IC 3CH9A 4TYOA 4U85A 1FKBA 4IQCA 2VN1A 3O5GA 1IX5A 4DRIA 4DT4A 1NSGA 4IQ2A 3G6MA 4MTVA 3WH0A 4LGXA 3NI6A 3FY1A 5HT1A 1R9HA 4JFIA 1QPLA 4XAKA 3WD2A 4MPKA 1FKGA 4DROA 5JH8A 1LL7A 3NRKA 4KR0B 3O5KA 1W26A 2Y78A 4WJXA 1PINA 4U84A 1J4HA 4WKFA 2UZ5A 2XP5A 3KAIA 5I98A 1W1VA 3ARYA 1O6IA 1OGGA 3JYMA 3CHFA 1C9HA 3OOBA 4Z2IA 1NMVA 4JFKA 2MPHA 2RQSA 4JFJA 4R5EA 3B9AA 1FKDA 5DITA 3OA5A 1HKKA 3O5QA 4IT6A 4PTMA 3ARPA 1J6YA 1FKLA 4ZPWR 4ODQA 3CHDA 3O5LA 2FAPA 1Q6IA 1OWQA 1W9PA 1E15A 2PV1A 3GTYX 5DIVA 1KT1A 3W4RA 1UR8A 1W9VA 4S3KA 1E44A 1BL4A 1SYTA 4P8UA 1EQ3A 2RURA 2Q5AA 2DG9A 2ZQTA 2LPVA 3WIJA 3RFWA 2DT0A 3O5JA 3PA7A 1FKSA 1T11A 3MDYB 1GUVA 4URIA 1NMWA 2RSEA 3B7XA 1E6ZA 1ITXA 1ZCNA 1F40A 3TDBA 4LAWA 2DT2A 1VF8A 2YBTA 3IHZA 3PRBA 3B9DA 3CGMA 4DZ3A 3B8SA 1D7JA 1Y0OA 4Q7NA 1PBKA 1D7HA 3CHCA 4FAPA 2RUQA 4DRKA 4NZCA 2G8ZA 3ARTA 3ARXA 1LJYA 2M2AA 3ODKA 3RMEA
chains in the Genus database with same CATH topology
5GPGA 1HXVA 3UQAA 2XP4A 1ROTA 3RM8A 1D7IA 2IUZA 2PI6A 2ZQVA 4QZVB 3WD4A 2DT1A 1LG2A 2OLHA 5HW6A 2KE0A 1TFVA 1J4RA 4C02B 3KACA 2PBCA 2XP6A 4MNKA 1FFRA 4Z2HA 2DSWA 4Z2KA 3KADA 3O5RA 4NSBA 2KFWA 1JNEA 2DG3A 4S3JA 4LAXA 2G41A 4O2TA 1ZB5A 3O5IA 1QPFA 3WD3A 2L2SA 1EDQA 4W5UA 1FKFA 3H9RB 2YBUA 2JZVA 3CHEA 3KCEA 2OFNA 1W1PA 1FKTA 2MLZA 1FKRA 1B6CA 4R0XA 4Z2JA 1LG1A 3ALGA 3EY6A 1E6PA 5DO2A 4ODPA 1LL6A 3UF8A 5DEZA 4DIPA 4KQZA 4HBEA 1XRVA 2WLYA 1KT0A 3WQVA 3KABA 1L1PA 4DRMA 4W9QA 1FKIA 1HJWA 1SR0A 2B31A 2LJ4A 3AS2A 5HKGA 1HJVA 4HARA 1E6RA 4ODNA 1FJDA 4LAYA 3ARRA 1M5YA 3O5PA 1GOIA 1J4IA 1D2KA 1D6OA 1F8AB 3JXVA 4J4OA 3CZ8A 1KFWA 2O92A 4ZPTR 4W9PA 4BF8A 4ITZA 1RD6A 1GPFA 3WD0A 3ARSA 2DPEA 4IPXA 4ODMA 2XP3A 2XP9A 1XHGA 4AY1A 2KGJA 4WKAA 2DSVA 4TNSA 1NWTA 3UQBA 3AS3A 4MNJA 1NWSA 5GPRA 4DZ2A 2XPAA 2ZQSA 1A7XA 2XP7A 5HTGA 2F21A 4NNRA 4DRJA 2ZR4A 3ARWA 2QF8A 3AS0A 2VCDA 3O5OA 4QT3A 3ARZA 4MNMA 4TW7A 3IK8A 4QT2A 1ZU8A 3KAGA 2O9OA 3UI6A 1NWUA 3BXWA 2RUDA 4Q22A 2DG4A 4MNLA 3WL0A 5HW7A 5DIUA 4WKHA 2PPNA 3RGCA 5HW8A 1JNSA 1WNOA 1QZ2A 1FFQA 1FAPA 4Z2LA 1JNTA 4TW6A 3ARQA 1Q6HA 1EYMA 4DWSC 1ZL1A 2PV2A 2PV3A 3GPKA 3PRAA 4DRPA 5BXJA 4DRNA 4J4NA 1P5QA 3RM4A 2PPPA 1ZK6A 2F2DA 2WK2A 1EHNA 3B9EA 2WLZA 2IF4A 2AOSA 2F4EA 4P8WA 3ARUA 1HKMA 1ZBKA 2KR7A 1W1YA 1ROUA 3ARVA 1W1TA 3O5FA 1ZBVA 4DRQA 1X6LA 1ZBWA 1LL4A 5DF0A 1UR9A 1NH6A 4GGQA 1Q6UA 4DWSD 2DT3A 5HUAA 1N1AA 4DWSB 2WM0A 1EIBA 3NTPA 2D9FA 4ODLA 4MGVA 4W9OA 3IKDA 2K8IA 2A3BA 2MLYA 1Q1CA 1YATA 1YW5A 3QOKA 1FD9A 5HWBA 4ODRA 3O5EA 3WD1A 4HBOA 1U79A 4WK9A 3FAPA 1E6NA 2KI3A 4DWSA 2ESCA 2ZQUA 4QIBA 3KAFA 4JFMA 3TCZA 4GIVA 4JFLA 1W9UA 3PRDA 2XP8A 2MNTA 2XPBA 3I6CA 3UI4A 2DSUA 3ALFA 4Z2GA 2LKNA 3KAHA 3AS1A 2A3EA 3CGNA 4TW8A 4U86A 2FDMA 1BKFA 2MLXA 5HWCA 3RM9A 1H0IA 3TC5A 4P8VA 4FN2A 3O5DA 3VAWA 4G50A 2LGOA 1HJXA 4DH0A 1FKKA 1X6NA 4ODKA 1HKIA 4JYSA 1JNDA 2N87A 1FKJA 2RUCA 3IKGA 2PPOA 4MSPA 4ML4A 4ODOA 4TX0A 3FXYA 3UQIA 3LUOA 2FKEA 3G6LA 1HKJA 1CTNA 3JYJA 5J6EA 2A3AA 2ZR5A 3UI5A 2KO7A 2ZR6A 1FKHA 1JVWA 4N19A 1LQ0A 3PR9A 1ZBCA 1NWRA 1E9LA 5GQBA 2A3CA 3WQWA 3KZ7A 1H0GA 4MAVA 4IT4A 4ZPVR 5HBFA 3O5MA 5D75A 3WL1A 4LAVA 4P8XA 1OGBA 4WIWA 1TCOC 2M08A 1WB0A 4L3NA 2AWGA 4ZS6A 1WAWA 3WKZA 4L72B 4DRHA 2MF9A 1K9TA 2ITKA 3AROA 3AQUA 4G2PA 2M1IA 2DSZA 5B8IC 3CH9A 4TYOA 4U85A 1FKBA 4IQCA 2VN1A 3O5GA 1IX5A 4DRIA 4DT4A 1NSGA 4IQ2A 3G6MA 4MTVA 3WH0A 4LGXA 3NI6A 3FY1A 5HT1A 1R9HA 4JFIA 1QPLA 4XAKA 3WD2A 4MPKA 1FKGA 4DROA 5JH8A 1LL7A 3NRKA 4KR0B 3O5KA 1W26A 2Y78A 4WJXA 1PINA 4U84A 1J4HA 4WKFA 2UZ5A 2XP5A 3KAIA 5I98A 1W1VA 3ARYA 1O6IA 1OGGA 3JYMA 3CHFA 1C9HA 3OOBA 4Z2IA 1NMVA 4JFKA 2MPHA 2RQSA 4JFJA 4R5EA 3B9AA 1FKDA 5DITA 3OA5A 1HKKA 3O5QA 4IT6A 4PTMA 3ARPA 1J6YA 1FKLA 4ZPWR 4ODQA 3CHDA 3O5LA 2FAPA 1Q6IA 1OWQA 1W9PA 1E15A 2PV1A 5DIVA 1KT1A 3W4RA 1UR8A 1W9VA 4S3KA 1BL4A 1SYTA 4P8UA 1EQ3A 2RURA 2Q5AA 2DG9A 2ZQTA 2LPVA 3WIJA 3RFWA 2DT0A 3O5JA 3PA7A 1FKSA 1T11A 3MDYB 1GUVA 4URIA 1NMWA 2RSEA 3B7XA 1E6ZA 1ITXA 1ZCNA 1F40A 3TDBA 4LAWA 2DT2A 1VF8A 2YBTA 3IHZA 3PRBA 3B9DA 3CGMA 4DZ3A 3B8SA 1D7JA 1Y0OA 4Q7NA 1PBKA 1D7HA 3CHCA 4FAPA 2RUQA 4DRKA 4NZCA 2G8ZA 3ARTA 3ARXA 1LJYA 2M2AA 3ODKA 3RMEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZQU A;  4QIB A;  5GPG A;  3NI6 A;  5HT1 A;  1HXV A;  3UQA A;  4DZ2 A;  3KAF A;  2XPA A;  2XP4 A;  1R9H A;  4JFI A;  1ROT A;  2ZQS A;  4JFM A;  1A7X A;  1QPL A;  2XP7 A;  3TCZ A;  1D7I A;  5HTG A;  2F21 A;  2ZQV A;  4NNR A;  4GIV A;  2ZR4 A;  4ODM A;  4JFL A;  4DRJ A;  1FKG A;  1FKR A;  5HW6 A;  3PRD A;  2KE0 A;  4DRO A;  2VCD A;  2XP8 A;  2MNT A;  2XPB A;  3I6C A;  3O5O A;  3UI4 A;  4QT3 A;  1J4R A;  4C02 B;  3KAC A;  3IK8 A;  3NRK A;  4TW7 A;  2PBC A;  2XP6 A;  4QT2 A;  3KAG A;  2LKN A;  1W26 A;  3KAH A;  3O5K A;  2Y78 A;  3CGN A;  3UI6 A;  4TW8 A;  4U86 A;  3KAD A;  1PIN A;  1BKF A;  3O5R A;  4U84 A;  2RUD A;  1J4H A;  2DG4 A;  2KFW A;  2DG3 A;  2MLX A;  2UZ5 A;  4LAX A;  2XP5 A;  3KAI A;  4IQC A;  5HWC A;  5I98 A;  4O2T A;  3O5I A;  3JYM A;  3TC5 A;  5HW7 A;  1QPF A;  1C9H A;  5DIU A;  3OOB A;  3O5D A;  4FN2 A;  1NMV A;  4JFK A;  3VAW A;  2L2S A;  2MPH A;  2LGO A;  2PPN A;  4G50 A;  2RQS A;  3RGC A;  4DH0 A;  1FKK A;  5HW8 A;  4JFJ A;  1JNS A;  4ODK A;  1FKF A;  1QZ2 A;  1FAP A;  3H9R B;  4JYS A;  2N87 A;  2JZV A;  1FKD A;  1FKJ A;  1JNT A;  4TW6 A;  5DIT A;  2RUC A;  3IKG A;  2PPO A;  3KCE A;  3O5Q A;  4MSP A;  4ODO A;  1Q6H A;  2OFN A;  4TX0 A;  3UQI A;  1EYM A;  1FKT A;  2MLZ A;  3LUO A;  2FKE A;  2PV2 A;  2PV3 A;  3GPK A;  4DRP A;  1B6C A;  1FKL A;  5BXJ A;  1J6Y A;  3JYJ A;  4DRN A;  4J4N A;  1P5Q A;  4ODQ A;  4R0X A;  2PPP A;  5J6E A;  2F2D A;  1ZK6 A;  3EY6 A;  3O5L A;  2FAP A;  1Q6I A;  2ZR5 A;  2KO7 A;  4ODP A;  3UI5 A;  2IF4 A;  3UF8 A;  2PV1 A;  2ZR6 A;  5DIV A;  1KT1 A;  2F4E A;  1FKH A;  4DIP A;  1JVW A;  4N19 A;  1BL4 A;  1KT0 A;  1EQ3 A;  2RUR A;  2Q5A A;  2DG9 A;  2KR7 A;  2ZQT A;  3KAB A;  1L1P A;  4DRM A;  1ROU A;  2LPV A;  3KZ7 A;  4W9Q A;  3RFW A;  3O5J A;  3PA7 A;  1FKI A;  1FKS A;  1T11 A;  3MDY B;  3O5M A;  5D75 A;  3O5F A;  1NMW A;  2LJ4 A;  2RSE A;  3B7X A;  5HKG A;  4DRQ A;  4LAV A;  1ZCN A;  1TCO C;  2M08 A;  4GGQ A;  4ODN A;  1Q6U A;  1FJD A;  2AWG A;  4LAY A;  1F40 A;  5HUA A;  3TDB A;  1M5Y A;  3O5P A;  1N1A A;  1J4I A;  4DRH A;  4LAW A;  2MF9 A;  2ITK A;  1F8A B;  1D6O A;  3NTP A;  2D9F A;  4ODL A;  3IHZ A;  3PRB A;  4G2P A;  2M1I A;  4MGV A;  5B8I C;  3JXV A;  4J4O A;  4W9O A;  3IKD A;  2K8I A;  4W9P A;  4BF8 A;  3CGM A;  4ITZ A;  4TYO A;  4DZ3 A;  4U85 A;  2MLY A;  1D7J A;  1Y0O A;  4IPX A;  1FKB A;  1Q1C A;  1YAT A;  1YW5 A;  1PBK A;  2VN1 A;  2XP3 A;  1D7H A;  1FD9 A;  2XP9 A;  3O5G A;  4DRI A;  4FAP A;  4DT4 A;  5HWB A;  2RUQ A;  4ODR A;  2KGJ A;  3O5E A;  4DRK A;  1NSG A;  1U79 A;  4IQ2 A;  3UQB A;  3FAP A;  2M2A A;  4TNS A;  2KI3 A;  3ODK A;  3WH0 A; 
#chains in the Genus database with same CATH topology
 5GPG A;  1HXV A;  3UQA A;  2XP4 A;  1ROT A;  3RM8 A;  1D7I A;  2IUZ A;  2PI6 A;  1JCH B;  2ZQV A;  4QZV B;  3WD4 A;  2DT1 A;  1LG2 A;  2OLH A;  5HW6 A;  2KE0 A;  1TFV A;  1J4R A;  4UDM A;  4C02 B;  3KAC A;  2PBC A;  2XP6 A;  4MNK A;  1FFR A;  4Z2H A;  2DSW A;  4Z2K A;  3KAD A;  3O5R A;  4NSB A;  2KFW A;  1JNE A;  2DG3 A;  4S3J A;  4LAX A;  2G41 A;  4O2T A;  1ZB5 A;  3O5I A;  1QPF A;  3WD3 A;  2L2S A;  1EDQ A;  3EIP A;  4W5U A;  1FKF A;  3H9R B;  2YBU A;  2JZV A;  3CHE A;  3KCE A;  2OFN A;  1W1P A;  1FKT A;  2MLZ A;  1FKR A;  1B6C A;  4R0X A;  4Z2J A;  1LG1 A;  3ALG A;  3EY6 A;  1E6P A;  5DO2 A;  4ODP A;  1LL6 A;  3UF8 A;  5DEZ A;  4DIP A;  4KQZ A;  4HBE A;  1XRV A;  2WLY A;  1KT0 A;  3WQV A;  3KAB A;  1L1P A;  4DRM A;  4W9Q A;  1FKI A;  1HJW A;  1SR0 A;  2B31 A;  2LJ4 A;  3AS2 A;  5HKG A;  1HJV A;  4HAR A;  1E6R A;  4ODN A;  1FJD A;  4LAY A;  3ARR A;  1M5Y A;  3O5P A;  1GOI A;  1J4I A;  1D2K A;  1D6O A;  1F8A B;  3JXV A;  4J4O A;  3CZ8 A;  1KFW A;  2O92 A;  4ZPT R;  4W9P A;  4BF8 A;  4ITZ A;  1RD6 A;  1GPF A;  3WD0 A;  3ARS A;  2DPE A;  4IPX A;  4ODM A;  2XP3 A;  2XP9 A;  1XHG A;  4AY1 A;  2F23 A;  2KGJ A;  1GRJ A;  4WKA A;  2DSV A;  4TNS A;  1NWT A;  3UQB A;  3AS3 A;  4MNJ A;  1NWS A;  5GPR A;  4DZ2 A;  2XPA A;  2ZQS A;  1A7X A;  2XP7 A;  5HTG A;  2F21 A;  4NNR A;  4DRJ A;  2ZR4 A;  3ARW A;  2QF8 A;  3AS0 A;  2VCD A;  3O5O A;  4QT3 A;  3ARZ A;  4MNM A;  4TW7 A;  3IK8 A;  4QT2 A;  1ZU8 A;  3KAG A;  2O9O A;  3UI6 A;  1NWU A;  3BXW A;  2RUD A;  4Q22 A;  2DG4 A;  4MNL A;  2P4V A;  3WL0 A;  5HW7 A;  5DIU A;  4WKH A;  2PPN A;  3RGC A;  5HW8 A;  1JNS A;  1WNO A;  1QZ2 A;  1FFQ A;  1FAP A;  4Z2L A;  1JNT A;  4TW6 A;  3ARQ A;  3GU0 A;  1Q6H A;  1EYM A;  4DWS C;  1ZL1 A;  2PV2 A;  2PV3 A;  3GPK A;  3PRA A;  4DRP A;  5BXJ A;  4DRN A;  4J4N A;  1P5Q A;  3RM4 A;  2PPP A;  1ZK6 A;  2F2D A;  2WK2 A;  1EHN A;  3B9E A;  2WLZ A;  2IF4 A;  2AOS A;  2F4E A;  4P8W A;  3ARU A;  1HKM A;  1ZBK A;  2KR7 A;  1W1Y A;  1ROU A;  3ARV A;  1W1T A;  3O5F A;  1ZBV A;  4DRQ A;  1X6L A;  1ZBW A;  1LL4 A;  5DF0 A;  1UR9 A;  1NH6 A;  4GGQ A;  1Q6U A;  4DWS D;  2DT3 A;  5HUA A;  1N1A A;  4DWS B;  2WM0 A;  1EIB A;  3NTP A;  2D9F A;  4ODL A;  4MGV A;  4W9O A;  3IKD A;  2K8I A;  2A3B A;  2MLY A;  1Q1C A;  1YAT A;  1YW5 A;  3QOK A;  1FD9 A;  5HWB A;  4ODR A;  3O5E A;  3WD1 A;  4HBO A;  1U79 A;  4WK9 A;  3FAP A;  1E6N A;  2KI3 A;  4DWS A;  2ESC A;  2ZQU A;  4QIB A;  2PN0 A;  3KAF A;  4JFM A;  3TCZ A;  4GIV A;  4JFL A;  1W9U A;  3PRD A;  2XP8 A;  2MNT A;  2XPB A;  3I6C A;  3UI4 A;  2DSU A;  3ALF A;  4Z2G A;  3BMB A;  2LKN A;  3KAH A;  3AS1 A;  2A3E A;  3CGN A;  4TW8 A;  4U86 A;  2FDM A;  1BKF A;  2MLX A;  5HWC A;  3RM9 A;  1H0I A;  3TC5 A;  4P8V A;  4FN2 A;  3O5D A;  3VAW A;  4G50 A;  2LGO A;  1HJX A;  4DH0 A;  1FKK A;  1X6N A;  4ODK A;  1HKI A;  4JYS A;  1JND A;  2N87 A;  1FKJ A;  2RUC A;  3IKG A;  2PPO A;  4MSP A;  4ML4 A;  4ODO A;  4TX0 A;  3FXY A;  2EUL A;  3UQI A;  3LUO A;  2FKE A;  3G6L A;  1HKJ A;  1CTN A;  3JYJ A;  2B5U B;  5J6E A;  2A3A A;  2ZR5 A;  3UI5 A;  2KO7 A;  2ZR6 A;  1FKH A;  1JVW A;  4N19 A;  1LQ0 A;  3PR9 A;  1ZBC A;  1NWR A;  1E9L A;  5GQB A;  2A3C A;  3WQW A;  3KZ7 A;  1H0G A;  4MAV A;  4IT4 A;  4ZPV R;  5HBF A;  3O5M A;  5D75 A;  3WL1 A;  4LAV A;  4P8X A;  1OGB A;  4WIW A;  1TCO C;  2M08 A;  1WB0 A;  4L3N A;  2AWG A;  4ZS6 A;  1WAW A;  3WKZ A;  4L72 B;  2ETN A;  4DRH A;  2MF9 A;  1K9T A;  2ITK A;  3ARO A;  3AQU A;  4G2P A;  2M1I A;  2DSZ A;  5B8I C;  3CH9 A;  4TYO A;  4U85 A;  1FKB A;  4IQC A;  2VN1 A;  3O5G A;  1IX5 A;  4DRI A;  4DT4 A;  1NSG A;  4IQ2 A;  3G6M A;  4MTV A;  3WH0 A;  4LGX A;  3NI6 A;  3FY1 A;  5HT1 A;  1R9H A;  4JFI A;  1QPL A;  4XAK A;  3WD2 A;  4MPK A;  1FKG A;  4DRO A;  5JH8 A;  1LL7 A;  3NRK A;  4KR0 B;  3O5K A;  1W26 A;  2Y78 A;  4WJX A;  1PIN A;  4U84 A;  1J4H A;  4WKF A;  2UZ5 A;  2XP5 A;  3KAI A;  5I98 A;  1W1V A;  3ARY A;  1O6I A;  1OGG A;  3JYM A;  3CHF A;  1C9H A;  3OOB A;  4Z2I A;  1NMV A;  4JFK A;  2MPH A;  2RQS A;  4JFJ A;  4R5E A;  3B9A A;  1FKD A;  5DIT A;  3OA5 A;  1HKK A;  3O5Q A;  4IT6 A;  4PTM A;  3ARP A;  1J6Y A;  1FKL A;  4ZPW R;  4ODQ A;  3CHD A;  3O5L A;  2FAP A;  1Q6I A;  1OWQ A;  1W9P A;  1E15 A;  2PV1 A;  3GTY X;  5DIV A;  1KT1 A;  3W4R A;  1UR8 A;  1W9V A;  4S3K A;  1E44 A;  1BL4 A;  1SYT A;  4P8U A;  1EQ3 A;  2RUR A;  2Q5A A;  2DG9 A;  2ZQT A;  2LPV A;  3WIJ A;  3RFW A;  2DT0 A;  3O5J A;  3PA7 A;  1FKS A;  1T11 A;  3MDY B;  1GUV A;  4URI A;  1NMW A;  2RSE A;  3B7X A;  1E6Z A;  1ITX A;  1ZCN A;  1F40 A;  3TDB A;  4LAW A;  2DT2 A;  1VF8 A;  2YBT A;  3IHZ A;  3PRB A;  3B9D A;  3CGM A;  4DZ3 A;  3B8S A;  1D7J A;  1Y0O A;  4Q7N A;  1PBK A;  1D7H A;  3CHC A;  4FAP A;  2RUQ A;  4DRK A;  4NZC A;  2G8Z A;  3ART A;  3ARX A;  1LJY A;  2M2A A;  3ODK A;  3RME A; 
#chains in the Genus database with same CATH homology
 5GPG A;  1HXV A;  3UQA A;  2XP4 A;  1ROT A;  3RM8 A;  1D7I A;  2IUZ A;  2PI6 A;  2ZQV A;  4QZV B;  3WD4 A;  2DT1 A;  1LG2 A;  2OLH A;  5HW6 A;  2KE0 A;  1TFV A;  1J4R A;  4C02 B;  3KAC A;  2PBC A;  2XP6 A;  4MNK A;  1FFR A;  4Z2H A;  2DSW A;  4Z2K A;  3KAD A;  3O5R A;  4NSB A;  2KFW A;  1JNE A;  2DG3 A;  4S3J A;  4LAX A;  2G41 A;  4O2T A;  1ZB5 A;  3O5I A;  1QPF A;  3WD3 A;  2L2S A;  1EDQ A;  4W5U A;  1FKF A;  3H9R B;  2YBU A;  2JZV A;  3CHE A;  3KCE A;  2OFN A;  1W1P A;  1FKT A;  2MLZ A;  1FKR A;  1B6C A;  4R0X A;  4Z2J A;  1LG1 A;  3ALG A;  3EY6 A;  1E6P A;  5DO2 A;  4ODP A;  1LL6 A;  3UF8 A;  5DEZ A;  4DIP A;  4KQZ A;  4HBE A;  1XRV A;  2WLY A;  1KT0 A;  3WQV A;  3KAB A;  1L1P A;  4DRM A;  4W9Q A;  1FKI A;  1HJW A;  1SR0 A;  2B31 A;  2LJ4 A;  3AS2 A;  5HKG A;  1HJV A;  4HAR A;  1E6R A;  4ODN A;  1FJD A;  4LAY A;  3ARR A;  1M5Y A;  3O5P A;  1GOI A;  1J4I A;  1D2K A;  1D6O A;  1F8A B;  3JXV A;  4J4O A;  3CZ8 A;  1KFW A;  2O92 A;  4ZPT R;  4W9P A;  4BF8 A;  4ITZ A;  1RD6 A;  1GPF A;  3WD0 A;  3ARS A;  2DPE A;  4IPX A;  4ODM A;  2XP3 A;  2XP9 A;  1XHG A;  4AY1 A;  2KGJ A;  4WKA A;  2DSV A;  4TNS A;  1NWT A;  3UQB A;  3AS3 A;  4MNJ A;  1NWS A;  5GPR A;  4DZ2 A;  2XPA A;  2ZQS A;  1A7X A;  2XP7 A;  5HTG A;  2F21 A;  4NNR A;  4DRJ A;  2ZR4 A;  3ARW A;  2QF8 A;  3AS0 A;  2VCD A;  3O5O A;  4QT3 A;  3ARZ A;  4MNM A;  4TW7 A;  3IK8 A;  4QT2 A;  1ZU8 A;  3KAG A;  2O9O A;  3UI6 A;  1NWU A;  3BXW A;  2RUD A;  4Q22 A;  2DG4 A;  4MNL A;  3WL0 A;  5HW7 A;  5DIU A;  4WKH A;  2PPN A;  3RGC A;  5HW8 A;  1JNS A;  1WNO A;  1QZ2 A;  1FFQ A;  1FAP A;  4Z2L A;  1JNT A;  4TW6 A;  3ARQ A;  1Q6H A;  1EYM A;  4DWS C;  1ZL1 A;  2PV2 A;  2PV3 A;  3GPK A;  3PRA A;  4DRP A;  5BXJ A;  4DRN A;  4J4N A;  1P5Q A;  3RM4 A;  2PPP A;  1ZK6 A;  2F2D A;  2WK2 A;  1EHN A;  3B9E A;  2WLZ A;  2IF4 A;  2AOS A;  2F4E A;  4P8W A;  3ARU A;  1HKM A;  1ZBK A;  2KR7 A;  1W1Y A;  1ROU A;  3ARV A;  1W1T A;  3O5F A;  1ZBV A;  4DRQ A;  1X6L A;  1ZBW A;  1LL4 A;  5DF0 A;  1UR9 A;  1NH6 A;  4GGQ A;  1Q6U A;  4DWS D;  2DT3 A;  5HUA A;  1N1A A;  4DWS B;  2WM0 A;  1EIB A;  3NTP A;  2D9F A;  4ODL A;  4MGV A;  4W9O A;  3IKD A;  2K8I A;  2A3B A;  2MLY A;  1Q1C A;  1YAT A;  1YW5 A;  3QOK A;  1FD9 A;  5HWB A;  4ODR A;  3O5E A;  3WD1 A;  4HBO A;  1U79 A;  4WK9 A;  3FAP A;  1E6N A;  2KI3 A;  4DWS A;  2ESC A;  2ZQU A;  4QIB A;  3KAF A;  4JFM A;  3TCZ A;  4GIV A;  4JFL A;  1W9U A;  3PRD A;  2XP8 A;  2MNT A;  2XPB A;  3I6C A;  3UI4 A;  2DSU A;  3ALF A;  4Z2G A;  2LKN A;  3KAH A;  3AS1 A;  2A3E A;  3CGN A;  4TW8 A;  4U86 A;  2FDM A;  1BKF A;  2MLX A;  5HWC A;  3RM9 A;  1H0I A;  3TC5 A;  4P8V A;  4FN2 A;  3O5D A;  3VAW A;  4G50 A;  2LGO A;  1HJX A;  4DH0 A;  1FKK A;  1X6N A;  4ODK A;  1HKI A;  4JYS A;  1JND A;  2N87 A;  1FKJ A;  2RUC A;  3IKG A;  2PPO A;  4MSP A;  4ML4 A;  4ODO A;  4TX0 A;  3FXY A;  3UQI A;  3LUO A;  2FKE A;  3G6L A;  1HKJ A;  1CTN A;  3JYJ A;  5J6E A;  2A3A A;  2ZR5 A;  3UI5 A;  2KO7 A;  2ZR6 A;  1FKH A;  1JVW A;  4N19 A;  1LQ0 A;  3PR9 A;  1ZBC A;  1NWR A;  1E9L A;  5GQB A;  2A3C A;  3WQW A;  3KZ7 A;  1H0G A;  4MAV A;  4IT4 A;  4ZPV R;  5HBF A;  3O5M A;  5D75 A;  3WL1 A;  4LAV A;  4P8X A;  1OGB A;  4WIW A;  1TCO C;  2M08 A;  1WB0 A;  4L3N A;  2AWG A;  4ZS6 A;  1WAW A;  3WKZ A;  4L72 B;  4DRH A;  2MF9 A;  1K9T A;  2ITK A;  3ARO A;  3AQU A;  4G2P A;  2M1I A;  2DSZ A;  5B8I C;  3CH9 A;  4TYO A;  4U85 A;  1FKB A;  4IQC A;  2VN1 A;  3O5G A;  1IX5 A;  4DRI A;  4DT4 A;  1NSG A;  4IQ2 A;  3G6M A;  4MTV A;  3WH0 A;  4LGX A;  3NI6 A;  3FY1 A;  5HT1 A;  1R9H A;  4JFI A;  1QPL A;  4XAK A;  3WD2 A;  4MPK A;  1FKG A;  4DRO A;  5JH8 A;  1LL7 A;  3NRK A;  4KR0 B;  3O5K A;  1W26 A;  2Y78 A;  4WJX A;  1PIN A;  4U84 A;  1J4H A;  4WKF A;  2UZ5 A;  2XP5 A;  3KAI A;  5I98 A;  1W1V A;  3ARY A;  1O6I A;  1OGG A;  3JYM A;  3CHF A;  1C9H A;  3OOB A;  4Z2I A;  1NMV A;  4JFK A;  2MPH A;  2RQS A;  4JFJ A;  4R5E A;  3B9A A;  1FKD A;  5DIT A;  3OA5 A;  1HKK A;  3O5Q A;  4IT6 A;  4PTM A;  3ARP A;  1J6Y A;  1FKL A;  4ZPW R;  4ODQ A;  3CHD A;  3O5L A;  2FAP A;  1Q6I A;  1OWQ A;  1W9P A;  1E15 A;  2PV1 A;  5DIV A;  1KT1 A;  3W4R A;  1UR8 A;  1W9V A;  4S3K A;  1BL4 A;  1SYT A;  4P8U A;  1EQ3 A;  2RUR A;  2Q5A A;  2DG9 A;  2ZQT A;  2LPV A;  3WIJ A;  3RFW A;  2DT0 A;  3O5J A;  3PA7 A;  1FKS A;  1T11 A;  3MDY B;  1GUV A;  4URI A;  1NMW A;  2RSE A;  3B7X A;  1E6Z A;  1ITX A;  1ZCN A;  1F40 A;  3TDB A;  4LAW A;  2DT2 A;  1VF8 A;  2YBT A;  3IHZ A;  3PRB A;  3B9D A;  3CGM A;  4DZ3 A;  3B8S A;  1D7J A;  1Y0O A;  4Q7N A;  1PBK A;  1D7H A;  3CHC A;  4FAP A;  2RUQ A;  4DRK A;  4NZC A;  2G8Z A;  3ART A;  3ARX A;  1LJY A;  2M2A A;  3ODK A;  3RME A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...