3O5IA

Fk1 domain of fkbp51, crystal form ii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
b'GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
molecule tags Isomerase
source organism Homo sapiens
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
total genus 36
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5iA00
4JFMA 1QPFA 4ODQA 3RFWA 4W9QA 1ROTA 2LKNA 3NI6A 3EY6A 4GIVA 1P5QA 1FJDA 4ODLA 3O5KA 4J4NA 4W9OA 3KCEA 2RUDA 1U79A 2XP8A 1NMVA 4DRPA 2RQSA 4DRJA 2DG4A 2M2AA 5D75A 1D7IA 2MLXA 2JZVA 2ITKA 2XP7A 3B7XA 2IF4A 3PA7A 4TNSA 2RUQA 2AWGA 4IQCA 4IPXA 1FKRA 1ZK6A 1J6YA 2D9FA 2XP4A 4BF8A 2KR7A 4GGQA 2ZR5A 4DH0A 3UI6A 3KADA 2K8IA 1J4HA 2F21A 4G2PA 2MLZA 3LUOA 3RGCA 1M5YA 4LAVA 4FN2A 4JFJA 5DIVA 1D7JA 1Q6HA 1KT0A 4ITZA 4DZ3A 3O5IA 5HW7A 3TCZA 2PPNA 4LAXA 1PBKA 4MSPA 2L2SA 2RURA 2XP9A 4MGVA 2PPPA 3TDBA 1W26A 1FKBA 2MLYA 2PPOA 1D6OA 3UI5A 4FAPA 3NRKA 2XPAA 1FD9A 4LAYA 2VCDA 4ODNA 5B8IC 3PRDA 1QZ2A 3UQBA 2M08A 4R0XA 2FAPA 2KFWA 4U84A 1R9HA 1FKKA 3KZ7A 3IKDA 4TYOA 1FKGA 4U86A 4O2TA 4DIPA 1F8AB 2F2DA 2MF9A 2KGJA 2KE0A 2ZR4A 3O5OA 2XP3A 3O5GA 4IQ2A 5HW8A 5HTGA 1FKFA 3IK8A 2VN1A 3FAPA 1FKSA 2PV3A 1QPLA 1JNSA 4QT2A 2KI3A 3O5EA 1YATA 4DRKA 3O5RA 1J4RA 3IHZA 1Q1CA 2DG9A 4QIBA 1F40A 2XP5A 3O5JA 3GPKA 5HT1A 3ODKA 4C02B 4DZ2A 2N87A 4TW6A 4DROA 4TX0A 4DT4A 1D7HA 4TW7A 1NMWA 4U85A 4JFIA 1ZCNA 4DRNA 3CGNA 4TW8A 3KAIA 2PBCA 2MNTA 5HWCA 2KO7A 2PV2A 3I6CA 2ZQTA 1B6CA 1Q6IA 1T11A 2MPHA 4ODKA 1HXVA 2UZ5A 1C9HA 3KAFA 3O5PA 4ODMA 3VAWA 1FKJA 4ODPA 1ROUA 4JFLA 3TC5A 1JVWA 4NNRA 3PRBA 2LJ4A 3UF8A 3MDYB 2FKEA 3UQIA 3WH0A 3O5FA 3UI4A 3JYJA 5J6EA 3O5QA 1A7XA 2ZR6A 4DRMA 5HKGA 3KACA 5I98A 1PINA 2ZQVA 1FKIA 2XP6A 1FKHA 5HWBA 2PV1A 1J4IA 2RSEA 4QT3A 5DIUA 2ZQSA 2F4EA 3O5MA 1NSGA 4G50A 4JFKA 3NTPA 4JYSA 4ODRA 1KT1A 1FKDA 2Y78A 3JXVA 2LGOA 1FAPA 2ZQUA 3KABA 3O5DA 4J4OA 5DITA 4DRHA 5HW6A 3IKGA 3JYMA 4ODOA 2DG3A 1L1PA 3O5LA 4DRIA 4LAWA 3KAHA 3OOBA 4N19A 1BKFA 2XPBA 4DRQA 1BL4A 1FKTA 3CGMA 3H9RB 2M1IA 1YW5A 1Q6UA 2LPVA 1EQ3A 1JNTA 5HUAA 2RUCA 4W9PA 5GPGA 1TCOC 1EYMA 1Y0OA 2Q5AA 5BXJA 1N1AA 3UQAA 2OFNA 1FKLA 3KAGA
chains in the Genus database with same CATH superfamily
1GPFA 1QPFA 3WKZA 3RFWA 4W9QA 2DSUA 3RM4A 4Z2IA 1FJDA 4LGXA 4J4NA 1GUVA 2DSZA 4R5EA 2P4VA 4DRPA 4DRJA 1LL7A 1LG1A 2XP7A 3PA7A 3B7XA 3AROA 4IQCA 2DSWA 2XP4A 2K8IA 1D2KA 1J4HA 1EIBA 2MLZA 1HKJA 1HKIA 3O5IA 4LAXA 3WD3A 4MSPA 2PPOA 3AQUA 1IX5A 4P8XA 1NWRA 4WK9A 5GQBA 1VF8A 1QZ2A 4R0XA 1ZBVA 1UR8A 1R9HA 1LL4A 2DPEA 4MNMA 4U86A 1HKMA 1ZBCA 4O2TA 3O5OA 4ML4A 2KGJA 2KE0A 5HTGA 3PR9A 1KFWA 1JCHB 3B9AA 1FKSA 1GOIA 3ARWA 4QT2A 4P8UA 4DWSC 4DRKA 1J4RA 3AS1A 1F40A 4DWSA 4TW6A 4DROA 1D7HA 4TW7A 2ESCA 3KAIA 2PBCA 3I6CA 4L72B 1X6NA 1Q6IA 4WKFA 1C9HA 1E9LA 4ODPA 3WD2A 3ALGA 3AS3A 5HBFA 3CHFA 1FFQA 3CHEA 2O9OA 4XAKA 4QZVB 4MNJA 5HKGA 5I98A 4DWSB 1FKHA 4W5UA 5DEZA 4G50A 1FFRA 3ARZA 3NTPA 4ODRA 1FAPA 4J4OA 3KABA 5DITA 2AOSA 4ZS6A 4DRHA 5HW6A 1W1YA 4ODOA 3OOBA 2OLHA 4DRQA 2LPVA 3AS0A 1JNTA 5HUAA 1EQ3A 4S3KA 1N1AA 3RMEA 2OFNA 1FKLA 4WKAA 1LJYA 1ROTA 4L3NA 3ARVA 4ODLA 2RQSA 2M2AA 2DT0A 2JZVA 4TNSA 3CZ8A 2KR7A 1E6RA 2YBUA 2ZR5A 4DH0A 1E6NA 3ALFA 2QF8A 3UI6A 4G2PA 3LUOA 3RGCA 1M5YA 4ITZA 2A3EA 1ZBWA 2PPPA 4MGVA 3TDBA 2MLYA 4Z2GA 4FAPA 3NRKA 5B8IC 2VCDA 3G6MA 2M08A 4HBEA 1HKKA 2WM0A 3EIPA 3IKDA 1EHNA 1O6IA 5GPRA 4DIPA 2FDMA 1F8AB 2F2DA 5HW8A 3O5GA 4IQ2A 5HWBA 4MPKA 4MAVA 3IK8A 2VN1A 2DT2A 1W1PA 3O5EA 3W4RA 4QIBA 3O5JA 4C02B 4NSBA 1K9TA 2WK2A 4TX0A 1NWSA 4U85A 3CGNA 4PTMA 4TW8A 1ZU8A 1RD6A 3BMBA 2ZQTA 1T11A 1EDQA 2B5UB 2MPHA 1HXVA 1ROUA 1XRVA 1JVWA 1GRJA 2FKEA 3WQVA 3G6LA 3UI4A 1OWQA 1SYTA 5J6EA 4MTVA 4DRMA 3BXWA 3KACA 2ZQVA 3WQWA 1FKIA 3RM8A 2PV1A 1J4IA 5DIUA 3WL0A 4MNLA 1SR0A 2DSVA 3O5MA 2Y78A 2ZQUA 3GU0A 3O5LA 2A3AA 3KAHA 1BKFA 3ARSA 3CGMA 3OA5A 1Q6UA 4W9PA 3UQAA 3FY1A 4WKHA 4Z2JA 3KAGA 3ARUA 1W1TA 1LL6A 4JFMA 1OGBA 3NI6A 2DT3A 3EY6A 4GIVA 1P5QA 4W9OA 2RUDA 2XP8A 1NMVA 2DG4A 1E15A 5D75A 1D7IA 2MLXA 1JNDA 2ITKA 4DWSD 2IF4A 2AWGA 4IPXA 3B9DA 1J6YA 1H0GA 2D9FA 3AS2A 4MNKA 4BF8A 1NWUA 3WL1A 3KADA 4WIWA 4ZPTR 1ZL1A 1E6PA 2PI6A 5DF0A 4LAVA 4P8VA 4S3JA 4JFJA 5DIVA 1D7JA 1Q6HA 1KT0A 4DZ3A 5HW7A 3TCZA 1PBKA 2L2SA 4Z2HA 1W26A 1FKBA 3UI5A 1H0IA 2XPAA 4LAYA 4ODNA 5DO2A 1WNOA 4U84A 2KFWA 4AY1A 1FKGA 5JH8A 2ZR4A 1W9VA 3FAPA 1JNSA 1QPLA 3CHCA 3O5RA 3GTYX 1HJVA 3IHZA 1Q1CA 1XHGA 1TFVA 5HT1A 3ODKA 2N87A 1WB0A 4DT4A 2A3BA 1NMWA 1ZBKA 4JFIA 1ZCNA 4DRNA 2MNTA 2O92A 5HWCA 1HJWA 2KO7A 2PV2A 1B6CA 4ODKA 2WLYA 1FKJA 1W1VA 4NNRA 3MDYB 3WH0A 3O5FA 3B9EA 3ARQA 4Q22A 1A7XA 4P8WA 1CTNA 2RSEA 2EULA 1NSGA 4JFKA 1KT1A 1FKDA 3O5DA 3ARPA 3IKGA 2DG3A 4DRIA 3WD4A 4LAWA 4URIA 2XPBA 1WAWA 1FKTA 3H9RB 1YW5A 2RUCA 1TCOC 2Q5AA 1NH6A 2WLZA 4HARA 1W9UA 3ARRA 4ODQA 1LG2A 2LKNA 2G41A 3O5KA 3KCEA 1U79A 3ARXA 3CH9A 1E6ZA 4TYOA 1OGGA 2DT1A 2RUQA 1FKRA 1ZK6A 2F23A 1E44A 3QOKA 4GGQA 1JNEA 1HJXA 2F21A 3FXYA 4FN2A 4ZPVR 2PPNA 3B8SA 3CHDA 1UR9A 2RURA 2XP9A 1D6OA 2IUZA 1FD9A 3PRDA 3UQBA 2FAPA 3ARYA 3KZ7A 1FKKA 1W9PA 2YBTA 4NZCA 2MF9A 2XP3A 4KR0B 1FKFA 2PV3A 1NWTA 4Z2KA 2KI3A 1YATA 3PRAA 2PN0A 2DG9A 3ARTA 2XP5A 3GPKA 4DZ2A 4Z2LA 2A3CA 4ZPWR 3RM9A 2UZ5A 3KAFA 3O5PA 4ODMA 3VAWA 4JFLA 3WIJA 3TC5A 3UF8A 3PRBA 2LJ4A 3UQIA 3JYJA 4IT4A 4Q7NA 3O5QA 3WD0A 2ZR6A 1PINA 1ZB5A 2XP6A 4QT3A 4WJXA 2ZQSA 2F4EA 2G8ZA 1X6LA 4JYSA 3JXVA 2LGOA 3JYMA 1L1PA 4UDMA 4N19A 1BL4A 4KQZA 4HBOA 2M1IA 3WD1A 4IT6A 1LQ0A 5GPGA 1EYMA 1Y0OA 5BXJA 2ETNA 1ITXA 2B31A
chains in the Genus database with same CATH topology
1GPFA 1QPFA 3WKZA 3RFWA 4W9QA 2DSUA 3RM4A 4Z2IA 1FJDA 4LGXA 4J4NA 1GUVA 2DSZA 4R5EA 4DRPA 4DRJA 1LL7A 1LG1A 2XP7A 3PA7A 3B7XA 3AROA 4IQCA 2DSWA 2XP4A 2K8IA 1D2KA 1J4HA 1EIBA 2MLZA 1HKJA 1HKIA 3O5IA 4LAXA 3WD3A 4MSPA 2PPOA 3AQUA 1IX5A 4P8XA 1NWRA 4WK9A 5GQBA 1VF8A 1QZ2A 4R0XA 1ZBVA 1UR8A 1R9HA 1LL4A 2DPEA 4MNMA 4U86A 1HKMA 1ZBCA 4O2TA 3O5OA 4ML4A 2KGJA 2KE0A 5HTGA 3PR9A 1KFWA 3B9AA 1FKSA 1GOIA 3ARWA 4QT2A 4P8UA 4DWSC 4DRKA 1J4RA 3AS1A 1F40A 4DWSA 4TW6A 4DROA 1D7HA 4TW7A 2ESCA 3KAIA 2PBCA 3I6CA 4L72B 1X6NA 1Q6IA 4WKFA 1C9HA 1E9LA 4ODPA 3WD2A 3ALGA 3AS3A 5HBFA 3CHFA 1FFQA 3CHEA 2O9OA 4XAKA 4QZVB 4MNJA 5HKGA 5I98A 4DWSB 1FKHA 4W5UA 5DEZA 4G50A 1FFRA 3ARZA 3NTPA 4ODRA 1FAPA 4J4OA 3KABA 5DITA 2AOSA 4ZS6A 4DRHA 5HW6A 1W1YA 4ODOA 3OOBA 2OLHA 4DRQA 2LPVA 3AS0A 1JNTA 5HUAA 1EQ3A 4S3KA 1N1AA 3RMEA 2OFNA 1FKLA 4WKAA 1LJYA 1ROTA 4L3NA 3ARVA 4ODLA 2RQSA 2M2AA 2DT0A 2JZVA 4TNSA 3CZ8A 2KR7A 1E6RA 2YBUA 2ZR5A 4DH0A 1E6NA 3ALFA 2QF8A 3UI6A 4G2PA 3LUOA 3RGCA 1M5YA 4ITZA 2A3EA 1ZBWA 2PPPA 4MGVA 3TDBA 2MLYA 4Z2GA 4FAPA 3NRKA 5B8IC 2VCDA 3G6MA 2M08A 4HBEA 1HKKA 2WM0A 3IKDA 1EHNA 1O6IA 5GPRA 4DIPA 2FDMA 1F8AB 2F2DA 5HW8A 3O5GA 4IQ2A 5HWBA 4MPKA 4MAVA 3IK8A 2VN1A 2DT2A 1W1PA 3O5EA 3W4RA 4QIBA 3O5JA 4C02B 4NSBA 1K9TA 2WK2A 4TX0A 1NWSA 4U85A 3CGNA 4PTMA 4TW8A 1ZU8A 1RD6A 2ZQTA 1T11A 1EDQA 2MPHA 1HXVA 1ROUA 1XRVA 1JVWA 2FKEA 3WQVA 3G6LA 3UI4A 1OWQA 1SYTA 5J6EA 4MTVA 4DRMA 3BXWA 3KACA 2ZQVA 3WQWA 1FKIA 3RM8A 2PV1A 1J4IA 5DIUA 3WL0A 4MNLA 1SR0A 2DSVA 3O5MA 2Y78A 2ZQUA 3O5LA 2A3AA 3KAHA 1BKFA 3ARSA 3CGMA 3OA5A 1Q6UA 4W9PA 3UQAA 3FY1A 4WKHA 4Z2JA 3KAGA 3ARUA 1W1TA 1LL6A 4JFMA 1OGBA 3NI6A 2DT3A 3EY6A 4GIVA 1P5QA 4W9OA 2RUDA 2XP8A 1NMVA 2DG4A 1E15A 5D75A 1D7IA 2MLXA 1JNDA 2ITKA 4DWSD 2IF4A 2AWGA 4IPXA 3B9DA 1J6YA 1H0GA 2D9FA 3AS2A 4MNKA 4BF8A 1NWUA 3WL1A 3KADA 4WIWA 4ZPTR 1ZL1A 1E6PA 2PI6A 5DF0A 4LAVA 4P8VA 4S3JA 4JFJA 5DIVA 1D7JA 1Q6HA 1KT0A 4DZ3A 5HW7A 3TCZA 1PBKA 2L2SA 4Z2HA 1W26A 1FKBA 3UI5A 1H0IA 2XPAA 4LAYA 4ODNA 5DO2A 1WNOA 4U84A 2KFWA 4AY1A 1FKGA 5JH8A 2ZR4A 1W9VA 3FAPA 1JNSA 1QPLA 3CHCA 3O5RA 1HJVA 3IHZA 1Q1CA 1XHGA 1TFVA 5HT1A 3ODKA 2N87A 1WB0A 4DT4A 2A3BA 1NMWA 1ZBKA 4JFIA 1ZCNA 4DRNA 2MNTA 2O92A 5HWCA 1HJWA 2KO7A 2PV2A 1B6CA 4ODKA 2WLYA 1FKJA 1W1VA 4NNRA 3MDYB 3WH0A 3O5FA 3B9EA 3ARQA 4Q22A 1A7XA 4P8WA 1CTNA 2RSEA 1NSGA 4JFKA 1KT1A 1FKDA 3O5DA 3ARPA 3IKGA 2DG3A 4DRIA 3WD4A 4LAWA 4URIA 2XPBA 1WAWA 1FKTA 3H9RB 1YW5A 2RUCA 1TCOC 2Q5AA 1NH6A 2WLZA 4HARA 1W9UA 3ARRA 4ODQA 1LG2A 2LKNA 2G41A 3O5KA 3KCEA 1U79A 3ARXA 3CH9A 1E6ZA 4TYOA 1OGGA 2DT1A 2RUQA 1FKRA 1ZK6A 3QOKA 4GGQA 1JNEA 1HJXA 2F21A 3FXYA 4FN2A 4ZPVR 2PPNA 3B8SA 3CHDA 1UR9A 2RURA 2XP9A 1D6OA 2IUZA 1FD9A 3PRDA 3UQBA 2FAPA 3ARYA 3KZ7A 1FKKA 1W9PA 2YBTA 4NZCA 2MF9A 2XP3A 4KR0B 1FKFA 2PV3A 1NWTA 4Z2KA 2KI3A 1YATA 3PRAA 2DG9A 3ARTA 2XP5A 3GPKA 4DZ2A 4Z2LA 2A3CA 4ZPWR 3RM9A 2UZ5A 3KAFA 3O5PA 4ODMA 3VAWA 4JFLA 3WIJA 3TC5A 3UF8A 3PRBA 2LJ4A 3UQIA 3JYJA 4IT4A 4Q7NA 3O5QA 3WD0A 2ZR6A 1PINA 1ZB5A 2XP6A 4QT3A 4WJXA 2ZQSA 2F4EA 2G8ZA 1X6LA 4JYSA 3JXVA 2LGOA 3JYMA 1L1PA 4N19A 1BL4A 4KQZA 4HBOA 2M1IA 3WD1A 4IT6A 1LQ0A 5GPGA 1EYMA 1Y0OA 5BXJA 1ITXA 2B31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JFM A;  1QPF A;  4ODQ A;  3RFW A;  4W9Q A;  1ROT A;  2LKN A;  3NI6 A;  3EY6 A;  4GIV A;  1P5Q A;  1FJD A;  4ODL A;  3O5K A;  4J4N A;  4W9O A;  3KCE A;  2RUD A;  1U79 A;  2XP8 A;  1NMV A;  4DRP A;  2RQS A;  4DRJ A;  2DG4 A;  2M2A A;  5D75 A;  1D7I A;  2MLX A;  2JZV A;  2ITK A;  2XP7 A;  3B7X A;  2IF4 A;  3PA7 A;  4TNS A;  2RUQ A;  2AWG A;  4IQC A;  4IPX A;  1FKR A;  1ZK6 A;  1J6Y A;  2D9F A;  2XP4 A;  4BF8 A;  2KR7 A;  4GGQ A;  2ZR5 A;  4DH0 A;  3UI6 A;  3KAD A;  2K8I A;  1J4H A;  2F21 A;  4G2P A;  2MLZ A;  3LUO A;  3RGC A;  1M5Y A;  4LAV A;  4FN2 A;  4JFJ A;  5DIV A;  1D7J A;  1Q6H A;  1KT0 A;  4ITZ A;  4DZ3 A;  3O5I A;  5HW7 A;  3TCZ A;  2PPN A;  4LAX A;  1PBK A;  4MSP A;  2L2S A;  2RUR A;  2XP9 A;  4MGV A;  2PPP A;  3TDB A;  1W26 A;  1FKB A;  2MLY A;  2PPO A;  1D6O A;  3UI5 A;  4FAP A;  3NRK A;  2XPA A;  1FD9 A;  4LAY A;  2VCD A;  4ODN A;  5B8I C;  3PRD A;  1QZ2 A;  3UQB A;  2M08 A;  4R0X A;  2FAP A;  2KFW A;  4U84 A;  1R9H A;  1FKK A;  3KZ7 A;  3IKD A;  4TYO A;  1FKG A;  4U86 A;  4O2T A;  4DIP A;  1F8A B;  2F2D A;  2MF9 A;  2KGJ A;  2KE0 A;  2ZR4 A;  3O5O A;  2XP3 A;  3O5G A;  4IQ2 A;  5HW8 A;  5HTG A;  1FKF A;  3IK8 A;  2VN1 A;  3FAP A;  1FKS A;  2PV3 A;  1QPL A;  1JNS A;  4QT2 A;  2KI3 A;  3O5E A;  1YAT A;  4DRK A;  3O5R A;  1J4R A;  3IHZ A;  1Q1C A;  2DG9 A;  4QIB A;  1F40 A;  2XP5 A;  3O5J A;  3GPK A;  5HT1 A;  3ODK A;  4C02 B;  4DZ2 A;  2N87 A;  4TW6 A;  4DRO A;  4TX0 A;  4DT4 A;  1D7H A;  4TW7 A;  1NMW A;  4U85 A;  4JFI A;  1ZCN A;  4DRN A;  3CGN A;  4TW8 A;  3KAI A;  2PBC A;  2MNT A;  5HWC A;  2KO7 A;  2PV2 A;  3I6C A;  2ZQT A;  1B6C A;  1Q6I A;  1T11 A;  2MPH A;  4ODK A;  1HXV A;  2UZ5 A;  1C9H A;  3KAF A;  3O5P A;  4ODM A;  3VAW A;  1FKJ A;  4ODP A;  1ROU A;  4JFL A;  3TC5 A;  1JVW A;  4NNR A;  3PRB A;  2LJ4 A;  3UF8 A;  3MDY B;  2FKE A;  3UQI A;  3WH0 A;  3O5F A;  3UI4 A;  3JYJ A;  5J6E A;  3O5Q A;  1A7X A;  2ZR6 A;  4DRM A;  5HKG A;  3KAC A;  5I98 A;  1PIN A;  2ZQV A;  1FKI A;  2XP6 A;  1FKH A;  5HWB A;  2PV1 A;  1J4I A;  2RSE A;  4QT3 A;  5DIU A;  2ZQS A;  2F4E A;  3O5M A;  1NSG A;  4G50 A;  4JFK A;  3NTP A;  4JYS A;  4ODR A;  1KT1 A;  1FKD A;  2Y78 A;  3JXV A;  2LGO A;  1FAP A;  2ZQU A;  3KAB A;  3O5D A;  4J4O A;  5DIT A;  4DRH A;  5HW6 A;  3IKG A;  3JYM A;  4ODO A;  2DG3 A;  1L1P A;  3O5L A;  4DRI A;  4LAW A;  3KAH A;  3OOB A;  4N19 A;  1BKF A;  2XPB A;  4DRQ A;  1BL4 A;  1FKT A;  3CGM A;  3H9R B;  2M1I A;  1YW5 A;  1Q6U A;  2LPV A;  1EQ3 A;  1JNT A;  5HUA A;  2RUC A;  4W9P A;  5GPG A;  1TCO C;  1EYM A;  1Y0O A;  2Q5A A;  5BXJ A;  1N1A A;  3UQA A;  2OFN A;  1FKL A;  3KAG A; 
#chains in the Genus database with same CATH topology
 1GPF A;  1QPF A;  3WKZ A;  3RFW A;  4W9Q A;  2DSU A;  3RM4 A;  4Z2I A;  1FJD A;  4LGX A;  4J4N A;  1GUV A;  2DSZ A;  4R5E A;  2P4V A;  4DRP A;  4DRJ A;  1LL7 A;  1LG1 A;  2XP7 A;  3PA7 A;  3B7X A;  3ARO A;  4IQC A;  2DSW A;  2XP4 A;  2K8I A;  1D2K A;  1J4H A;  1EIB A;  2MLZ A;  1HKJ A;  1HKI A;  3O5I A;  4LAX A;  3WD3 A;  4MSP A;  2PPO A;  3AQU A;  1IX5 A;  4P8X A;  1NWR A;  4WK9 A;  5GQB A;  1VF8 A;  1QZ2 A;  4R0X A;  1ZBV A;  1UR8 A;  1R9H A;  1LL4 A;  2DPE A;  4MNM A;  4U86 A;  1HKM A;  1ZBC A;  4O2T A;  3O5O A;  4ML4 A;  2KGJ A;  2KE0 A;  5HTG A;  3PR9 A;  1KFW A;  1JCH B;  3B9A A;  1FKS A;  1GOI A;  3ARW A;  4QT2 A;  4P8U A;  4DWS C;  4DRK A;  1J4R A;  3AS1 A;  1F40 A;  4DWS A;  4TW6 A;  4DRO A;  1D7H A;  4TW7 A;  2ESC A;  3KAI A;  2PBC A;  3I6C A;  4L72 B;  1X6N A;  1Q6I A;  4WKF A;  1C9H A;  1E9L A;  4ODP A;  3WD2 A;  3ALG A;  3AS3 A;  5HBF A;  3CHF A;  1FFQ A;  3CHE A;  2O9O A;  4XAK A;  4QZV B;  4MNJ A;  5HKG A;  5I98 A;  4DWS B;  1FKH A;  4W5U A;  5DEZ A;  4G50 A;  1FFR A;  3ARZ A;  3NTP A;  4ODR A;  1FAP A;  4J4O A;  3KAB A;  5DIT A;  2AOS A;  4ZS6 A;  4DRH A;  5HW6 A;  1W1Y A;  4ODO A;  3OOB A;  2OLH A;  4DRQ A;  2LPV A;  3AS0 A;  1JNT A;  5HUA A;  1EQ3 A;  4S3K A;  1N1A A;  3RME A;  2OFN A;  1FKL A;  4WKA A;  1LJY A;  1ROT A;  4L3N A;  3ARV A;  4ODL A;  2RQS A;  2M2A A;  2DT0 A;  2JZV A;  4TNS A;  3CZ8 A;  2KR7 A;  1E6R A;  2YBU A;  2ZR5 A;  4DH0 A;  1E6N A;  3ALF A;  2QF8 A;  3UI6 A;  4G2P A;  3LUO A;  3RGC A;  1M5Y A;  4ITZ A;  2A3E A;  1ZBW A;  2PPP A;  4MGV A;  3TDB A;  2MLY A;  4Z2G A;  4FAP A;  3NRK A;  5B8I C;  2VCD A;  3G6M A;  2M08 A;  4HBE A;  1HKK A;  2WM0 A;  3EIP A;  3IKD A;  1EHN A;  1O6I A;  5GPR A;  4DIP A;  2FDM A;  1F8A B;  2F2D A;  5HW8 A;  3O5G A;  4IQ2 A;  5HWB A;  4MPK A;  4MAV A;  3IK8 A;  2VN1 A;  2DT2 A;  1W1P A;  3O5E A;  3W4R A;  4QIB A;  3O5J A;  4C02 B;  4NSB A;  1K9T A;  2WK2 A;  4TX0 A;  1NWS A;  4U85 A;  3CGN A;  4PTM A;  4TW8 A;  1ZU8 A;  1RD6 A;  3BMB A;  2ZQT A;  1T11 A;  1EDQ A;  2B5U B;  2MPH A;  1HXV A;  1ROU A;  1XRV A;  1JVW A;  1GRJ A;  2FKE A;  3WQV A;  3G6L A;  3UI4 A;  1OWQ A;  1SYT A;  5J6E A;  4MTV A;  4DRM A;  3BXW A;  3KAC A;  2ZQV A;  3WQW A;  1FKI A;  3RM8 A;  2PV1 A;  1J4I A;  5DIU A;  3WL0 A;  4MNL A;  1SR0 A;  2DSV A;  3O5M A;  2Y78 A;  2ZQU A;  3GU0 A;  3O5L A;  2A3A A;  3KAH A;  1BKF A;  3ARS A;  3CGM A;  3OA5 A;  1Q6U A;  4W9P A;  3UQA A;  3FY1 A;  4WKH A;  4Z2J A;  3KAG A;  3ARU A;  1W1T A;  1LL6 A;  4JFM A;  1OGB A;  3NI6 A;  2DT3 A;  3EY6 A;  4GIV A;  1P5Q A;  4W9O A;  2RUD A;  2XP8 A;  1NMV A;  2DG4 A;  1E15 A;  5D75 A;  1D7I A;  2MLX A;  1JND A;  2ITK A;  4DWS D;  2IF4 A;  2AWG A;  4IPX A;  3B9D A;  1J6Y A;  1H0G A;  2D9F A;  3AS2 A;  4MNK A;  4BF8 A;  1NWU A;  3WL1 A;  3KAD A;  4WIW A;  4ZPT R;  1ZL1 A;  1E6P A;  2PI6 A;  5DF0 A;  4LAV A;  4P8V A;  4S3J A;  4JFJ A;  5DIV A;  1D7J A;  1Q6H A;  1KT0 A;  4DZ3 A;  5HW7 A;  3TCZ A;  1PBK A;  2L2S A;  4Z2H A;  1W26 A;  1FKB A;  3UI5 A;  1H0I A;  2XPA A;  4LAY A;  4ODN A;  5DO2 A;  1WNO A;  4U84 A;  2KFW A;  4AY1 A;  1FKG A;  5JH8 A;  2ZR4 A;  1W9V A;  3FAP A;  1JNS A;  1QPL A;  3CHC A;  3O5R A;  3GTY X;  1HJV A;  3IHZ A;  1Q1C A;  1XHG A;  1TFV A;  5HT1 A;  3ODK A;  2N87 A;  1WB0 A;  4DT4 A;  2A3B A;  1NMW A;  1ZBK A;  4JFI A;  1ZCN A;  4DRN A;  2MNT A;  2O92 A;  5HWC A;  1HJW A;  2KO7 A;  2PV2 A;  1B6C A;  4ODK A;  2WLY A;  1FKJ A;  1W1V A;  4NNR A;  3MDY B;  3WH0 A;  3O5F A;  3B9E A;  3ARQ A;  4Q22 A;  1A7X A;  4P8W A;  1CTN A;  2RSE A;  2EUL A;  1NSG A;  4JFK A;  1KT1 A;  1FKD A;  3O5D A;  3ARP A;  3IKG A;  2DG3 A;  4DRI A;  3WD4 A;  4LAW A;  4URI A;  2XPB A;  1WAW A;  1FKT A;  3H9R B;  1YW5 A;  2RUC A;  1TCO C;  2Q5A A;  1NH6 A;  2WLZ A;  4HAR A;  1W9U A;  3ARR A;  4ODQ A;  1LG2 A;  2LKN A;  2G41 A;  3O5K A;  3KCE A;  1U79 A;  3ARX A;  3CH9 A;  1E6Z A;  4TYO A;  1OGG A;  2DT1 A;  2RUQ A;  1FKR A;  1ZK6 A;  2F23 A;  1E44 A;  3QOK A;  4GGQ A;  1JNE A;  1HJX A;  2F21 A;  3FXY A;  4FN2 A;  4ZPV R;  2PPN A;  3B8S A;  3CHD A;  1UR9 A;  2RUR A;  2XP9 A;  1D6O A;  2IUZ A;  1FD9 A;  3PRD A;  3UQB A;  2FAP A;  3ARY A;  3KZ7 A;  1FKK A;  1W9P A;  2YBT A;  4NZC A;  2MF9 A;  2XP3 A;  4KR0 B;  1FKF A;  2PV3 A;  1NWT A;  4Z2K A;  2KI3 A;  1YAT A;  3PRA A;  2PN0 A;  2DG9 A;  3ART A;  2XP5 A;  3GPK A;  4DZ2 A;  4Z2L A;  2A3C A;  4ZPW R;  3RM9 A;  2UZ5 A;  3KAF A;  3O5P A;  4ODM A;  3VAW A;  4JFL A;  3WIJ A;  3TC5 A;  3UF8 A;  3PRB A;  2LJ4 A;  3UQI A;  3JYJ A;  4IT4 A;  4Q7N A;  3O5Q A;  3WD0 A;  2ZR6 A;  1PIN A;  1ZB5 A;  2XP6 A;  4QT3 A;  4WJX A;  2ZQS A;  2F4E A;  2G8Z A;  1X6L A;  4JYS A;  3JXV A;  2LGO A;  3JYM A;  1L1P A;  4UDM A;  4N19 A;  1BL4 A;  4KQZ A;  4HBO A;  2M1I A;  3WD1 A;  4IT6 A;  1LQ0 A;  5GPG A;  1EYM A;  1Y0O A;  5BXJ A;  2ETN A;  1ITX A;  2B31 A; 
#chains in the Genus database with same CATH homology
 1GPF A;  1QPF A;  3WKZ A;  3RFW A;  4W9Q A;  2DSU A;  3RM4 A;  4Z2I A;  1FJD A;  4LGX A;  4J4N A;  1GUV A;  2DSZ A;  4R5E A;  4DRP A;  4DRJ A;  1LL7 A;  1LG1 A;  2XP7 A;  3PA7 A;  3B7X A;  3ARO A;  4IQC A;  2DSW A;  2XP4 A;  2K8I A;  1D2K A;  1J4H A;  1EIB A;  2MLZ A;  1HKJ A;  1HKI A;  3O5I A;  4LAX A;  3WD3 A;  4MSP A;  2PPO A;  3AQU A;  1IX5 A;  4P8X A;  1NWR A;  4WK9 A;  5GQB A;  1VF8 A;  1QZ2 A;  4R0X A;  1ZBV A;  1UR8 A;  1R9H A;  1LL4 A;  2DPE A;  4MNM A;  4U86 A;  1HKM A;  1ZBC A;  4O2T A;  3O5O A;  4ML4 A;  2KGJ A;  2KE0 A;  5HTG A;  3PR9 A;  1KFW A;  3B9A A;  1FKS A;  1GOI A;  3ARW A;  4QT2 A;  4P8U A;  4DWS C;  4DRK A;  1J4R A;  3AS1 A;  1F40 A;  4DWS A;  4TW6 A;  4DRO A;  1D7H A;  4TW7 A;  2ESC A;  3KAI A;  2PBC A;  3I6C A;  4L72 B;  1X6N A;  1Q6I A;  4WKF A;  1C9H A;  1E9L A;  4ODP A;  3WD2 A;  3ALG A;  3AS3 A;  5HBF A;  3CHF A;  1FFQ A;  3CHE A;  2O9O A;  4XAK A;  4QZV B;  4MNJ A;  5HKG A;  5I98 A;  4DWS B;  1FKH A;  4W5U A;  5DEZ A;  4G50 A;  1FFR A;  3ARZ A;  3NTP A;  4ODR A;  1FAP A;  4J4O A;  3KAB A;  5DIT A;  2AOS A;  4ZS6 A;  4DRH A;  5HW6 A;  1W1Y A;  4ODO A;  3OOB A;  2OLH A;  4DRQ A;  2LPV A;  3AS0 A;  1JNT A;  5HUA A;  1EQ3 A;  4S3K A;  1N1A A;  3RME A;  2OFN A;  1FKL A;  4WKA A;  1LJY A;  1ROT A;  4L3N A;  3ARV A;  4ODL A;  2RQS A;  2M2A A;  2DT0 A;  2JZV A;  4TNS A;  3CZ8 A;  2KR7 A;  1E6R A;  2YBU A;  2ZR5 A;  4DH0 A;  1E6N A;  3ALF A;  2QF8 A;  3UI6 A;  4G2P A;  3LUO A;  3RGC A;  1M5Y A;  4ITZ A;  2A3E A;  1ZBW A;  2PPP A;  4MGV A;  3TDB A;  2MLY A;  4Z2G A;  4FAP A;  3NRK A;  5B8I C;  2VCD A;  3G6M A;  2M08 A;  4HBE A;  1HKK A;  2WM0 A;  3IKD A;  1EHN A;  1O6I A;  5GPR A;  4DIP A;  2FDM A;  1F8A B;  2F2D A;  5HW8 A;  3O5G A;  4IQ2 A;  5HWB A;  4MPK A;  4MAV A;  3IK8 A;  2VN1 A;  2DT2 A;  1W1P A;  3O5E A;  3W4R A;  4QIB A;  3O5J A;  4C02 B;  4NSB A;  1K9T A;  2WK2 A;  4TX0 A;  1NWS A;  4U85 A;  3CGN A;  4PTM A;  4TW8 A;  1ZU8 A;  1RD6 A;  2ZQT A;  1T11 A;  1EDQ A;  2MPH A;  1HXV A;  1ROU A;  1XRV A;  1JVW A;  2FKE A;  3WQV A;  3G6L A;  3UI4 A;  1OWQ A;  1SYT A;  5J6E A;  4MTV A;  4DRM A;  3BXW A;  3KAC A;  2ZQV A;  3WQW A;  1FKI A;  3RM8 A;  2PV1 A;  1J4I A;  5DIU A;  3WL0 A;  4MNL A;  1SR0 A;  2DSV A;  3O5M A;  2Y78 A;  2ZQU A;  3O5L A;  2A3A A;  3KAH A;  1BKF A;  3ARS A;  3CGM A;  3OA5 A;  1Q6U A;  4W9P A;  3UQA A;  3FY1 A;  4WKH A;  4Z2J A;  3KAG A;  3ARU A;  1W1T A;  1LL6 A;  4JFM A;  1OGB A;  3NI6 A;  2DT3 A;  3EY6 A;  4GIV A;  1P5Q A;  4W9O A;  2RUD A;  2XP8 A;  1NMV A;  2DG4 A;  1E15 A;  5D75 A;  1D7I A;  2MLX A;  1JND A;  2ITK A;  4DWS D;  2IF4 A;  2AWG A;  4IPX A;  3B9D A;  1J6Y A;  1H0G A;  2D9F A;  3AS2 A;  4MNK A;  4BF8 A;  1NWU A;  3WL1 A;  3KAD A;  4WIW A;  4ZPT R;  1ZL1 A;  1E6P A;  2PI6 A;  5DF0 A;  4LAV A;  4P8V A;  4S3J A;  4JFJ A;  5DIV A;  1D7J A;  1Q6H A;  1KT0 A;  4DZ3 A;  5HW7 A;  3TCZ A;  1PBK A;  2L2S A;  4Z2H A;  1W26 A;  1FKB A;  3UI5 A;  1H0I A;  2XPA A;  4LAY A;  4ODN A;  5DO2 A;  1WNO A;  4U84 A;  2KFW A;  4AY1 A;  1FKG A;  5JH8 A;  2ZR4 A;  1W9V A;  3FAP A;  1JNS A;  1QPL A;  3CHC A;  3O5R A;  1HJV A;  3IHZ A;  1Q1C A;  1XHG A;  1TFV A;  5HT1 A;  3ODK A;  2N87 A;  1WB0 A;  4DT4 A;  2A3B A;  1NMW A;  1ZBK A;  4JFI A;  1ZCN A;  4DRN A;  2MNT A;  2O92 A;  5HWC A;  1HJW A;  2KO7 A;  2PV2 A;  1B6C A;  4ODK A;  2WLY A;  1FKJ A;  1W1V A;  4NNR A;  3MDY B;  3WH0 A;  3O5F A;  3B9E A;  3ARQ A;  4Q22 A;  1A7X A;  4P8W A;  1CTN A;  2RSE A;  1NSG A;  4JFK A;  1KT1 A;  1FKD A;  3O5D A;  3ARP A;  3IKG A;  2DG3 A;  4DRI A;  3WD4 A;  4LAW A;  4URI A;  2XPB A;  1WAW A;  1FKT A;  3H9R B;  1YW5 A;  2RUC A;  1TCO C;  2Q5A A;  1NH6 A;  2WLZ A;  4HAR A;  1W9U A;  3ARR A;  4ODQ A;  1LG2 A;  2LKN A;  2G41 A;  3O5K A;  3KCE A;  1U79 A;  3ARX A;  3CH9 A;  1E6Z A;  4TYO A;  1OGG A;  2DT1 A;  2RUQ A;  1FKR A;  1ZK6 A;  3QOK A;  4GGQ A;  1JNE A;  1HJX A;  2F21 A;  3FXY A;  4FN2 A;  4ZPV R;  2PPN A;  3B8S A;  3CHD A;  1UR9 A;  2RUR A;  2XP9 A;  1D6O A;  2IUZ A;  1FD9 A;  3PRD A;  3UQB A;  2FAP A;  3ARY A;  3KZ7 A;  1FKK A;  1W9P A;  2YBT A;  4NZC A;  2MF9 A;  2XP3 A;  4KR0 B;  1FKF A;  2PV3 A;  1NWT A;  4Z2K A;  2KI3 A;  1YAT A;  3PRA A;  2DG9 A;  3ART A;  2XP5 A;  3GPK A;  4DZ2 A;  4Z2L A;  2A3C A;  4ZPW R;  3RM9 A;  2UZ5 A;  3KAF A;  3O5P A;  4ODM A;  3VAW A;  4JFL A;  3WIJ A;  3TC5 A;  3UF8 A;  3PRB A;  2LJ4 A;  3UQI A;  3JYJ A;  4IT4 A;  4Q7N A;  3O5Q A;  3WD0 A;  2ZR6 A;  1PIN A;  1ZB5 A;  2XP6 A;  4QT3 A;  4WJX A;  2ZQS A;  2F4E A;  2G8Z A;  1X6L A;  4JYS A;  3JXV A;  2LGO A;  3JYM A;  1L1P A;  4N19 A;  1BL4 A;  4KQZ A;  4HBO A;  2M1I A;  3WD1 A;  4IT6 A;  1LQ0 A;  5GPG A;  1EYM A;  1Y0O A;  5BXJ A;  1ITX A;  2B31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...