3O5IA

Fk1 domain of fkbp51, crystal form ii
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
128
structure length
128
Chain Sequence
GAPATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 36
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5iA00
1F8AB 1FKDA 2PPPA 3I6CA 2LGOA 2VCDA 1D7HA 4GGQA 3KAIA 4JFLA 4JYSA 1P5QA 1ZCNA 4ODMA 1FKBA 5GPGA 4JFJA 1FKLA 1J4RA 4NNRA 4JFIA 4TNSA 3O5LA 3O5OA 4LAWA 4DZ3A 3UQIA 2PPOA 4BF8A 3VAWA 2ZQUA 3O5PA 5J6EA 2LJ4A 2RUDA 3O5EA 4FAPA 1F40A 1D6OA 2DG4A 4DRKA 2XP7A 3EY6A 5BXJA 5HTGA 2MF9A 4C02B 1N1AA 1FAPA 4U86A 3UI4A 3RFWA 2XPAA 2K8IA 4IQ2A 4DRQA 4W9PA 2ZR4A 1FKGA 2RQSA 3KZ7A 1FD9A 3O5KA 3O5GA 2ZQSA 4TW7A 4O2TA 4ODQA 4J4NA 4DH0A 2OFNA 3IK8A 2PBCA 1EQ3A 1Y0OA 2KE0A 3KAGA 5I98A 1NMVA 3WH0A 2XP8A 3PRBA 1JVWA 1YW5A 4N19A 5HW8A 1JNTA 1J4IA 5D75A 4LAYA 4TW8A 2KGJA 4TYOA 3UF8A 2F4EA 2KFWA 2ZQTA 1QZ2A 1M5YA 3O5MA 3O5QA 4IQCA 4ODKA 4W9OA 5HT1A 4MSPA 3O5JA 3GPKA 3UI6A 1FKFA 1FKIA 2XP9A 3PA7A 2F21A 3H9RB 1BL4A 1QPFA 3ODKA 4DIPA 4U84A 1HXVA 2M2AA 2KI3A 3JYMA 3CGMA 1FKSA 3IKDA 3O5RA 2KO7A 2PV2A 3RGCA 3TC5A 1FKRA 2FKEA 1BKFA 2Y78A 4DRJA 4LAVA 4DRMA 5B8IC 2ZR5A 5HKGA 5HW6A 1FKHA 1FKTA 2F2DA 2MLYA 2FAPA 5DIUA 3B7XA 2DG3A 5DIVA 5HWCA 1EYMA 1KT0A 2UZ5A 2M08A 1ROTA 2ZR6A 3MDYB 1J4HA 2M1IA 4GIVA 3TDBA 3KABA 2ITKA 2RURA 2D9FA 1NSGA 2JZVA 2VN1A 2PV1A 3LUOA 2XPBA 1W26A 3NI6A 4DRPA 2N87A 1TCOC 1FJDA 4DRNA 3KAFA 1Q6UA 3KAHA 2LPVA 1L1PA 4ODPA 4QIBA 5DITA 4DZ2A 3CGNA 4DRHA 4DROA 2MNTA 5HWBA 3OOBA 3O5IA 1D7IA 2RUQA 2MPHA 4ODRA 1R9HA 4QT3A 1Q6HA 4IPXA 1PINA 2XP4A 1U79A 4ITZA 3UI5A 1FKJA 3TCZA 4ODOA 3KACA 4MGVA 4J4OA 3KADA 4ODLA 4TX0A 2AWGA 2LKNA 2PPNA 2L2SA 2Q5AA 4JFKA 4G50A 1D7JA 3UQAA 3KCEA 4DT4A 2PV3A 3FAPA 3NTPA 3O5DA 2XP6A 1KT1A 1ROUA 4JFMA 4TW6A 2DG9A 5HUAA 1Q6IA 1B6CA 1ZK6A 1Q1CA 3IHZA 2RSEA 1YATA 4G2PA 2ZQVA 3JXVA 4LAXA 4W9QA 4U85A 3JYJA 1JNSA 3IKGA 2RUCA 3UQBA 1J6YA 2XP5A 1C9HA 1NMWA 3O5FA 2IF4A 5HW7A 4DRIA 1FKKA 4R0XA 1PBKA 1T11A 2MLXA 4FN2A 2MLZA 3PRDA 4ODNA 4QT2A 2KR7A 1QPLA 2XP3A 3NRKA 1A7XA
chains in the Genus database with same CATH superfamily
1F8AB 2PPPA 4ODMA 1FKBA 1VF8A 1FKLA 1J4RA 4Q22A 4WIWA 4ZPVR 2DT2A 2B31A 1UR8A 2XP7A 5GPRA 4C02B 2XPAA 1NH6A 4W9PA 1GUVA 3O5KA 4HBOA 4DWSC 1WAWA 4ODQA 4Z2JA 3BMBA 4NSBA 3GU0A 1HJVA 2XP8A 3ARXA 1YW5A 5HW8A 1JNTA 4TYOA 3UF8A 3O5MA 2KFWA 5HT1A 4P8VA 2PI6A 2XP9A 3RM8A 3H9RB 5JH8A 3CHEA 1NWRA 3WL1A 2A3BA 1HXVA 2A3AA 1EIBA 1FKSA 1ZL1A 3AS3A 4DRJA 4DRMA 5B8IC 3CHDA 5HKGA 1FKHA 2A3CA 1E9LA 1KT0A 3MDYB 4WK9A 2D9FA 2JZVA 1W1TA 3FXYA 3NI6A 3AQUA 2F23A 2N87A 1EHNA 1OWQA 1LQ0A 3KAHA 4UDMA 3WD3A 1L1PA 3CGNA 5HWBA 2MNTA 1E44A 1D7IA 2RUQA 1KFWA 2MPHA 1OGGA 1Q6HA 3CZ8A 1U79A 3UI5A 3WIJA 4DWSB 4Z2LA 4MAVA 4WJXA 4TX0A 2LKNA 4P8WA 2L2SA 1FFQA 2PV3A 3O5DA 4HBEA 2XP6A 1ROUA 3PR9A 1Q1CA 4G2PA 3JXVA 4KR0B 1GRJA 1J6YA 2WK2A 2IF4A 2DT1A 2ETNA 4R0XA 4ODNA 2KR7A 2XP3A 1D7HA 5GPGA 1W9VA 4TNSA 1FFRA 4BF8A 3O5PA 4WKAA 5J6EA 1E15A 4DRKA 3EY6A 5DF0A 4MTVA 5HTGA 2MF9A 3AS1A 3UI4A 1HKIA 2K8IA 4DRQA 3ARWA 2B5UB 2ZQSA 4TW7A 3IK8A 1EQ3A 1ZBCA 5DO2A 4NZCA 3QOKA 4LAYA 4TW8A 2YBTA 1QZ2A 2FDMA 4ODKA 2DPEA 1FKIA 1GPFA 3CH9A 3PA7A 3ARPA 1BL4A 4U84A 1EDQA 2M2AA 2DSZA 1HKKA 1NWTA 2PV2A 1O6IA 3TC5A 2FKEA 4LAVA 5HW6A 2ZR5A 1LG2A 2DG3A 4MNJA 5HWCA 1EYMA 3AS2A 2M08A 3KABA 1NSGA 1WNOA 4DRPA 3WD2A 3KAFA 4ZPTR 2LPVA 4IT6A 4Z2KA 3WKZA 1ZU8A 1ZB5A 4DROA 3OOBA 3ALFA 4ODRA 1R9HA 3ARZA 3B9EA 1E6RA 2O9OA 4S3JA 1FKJA 4Z2IA 3CHCA 3KADA 2AWGA 4JFKA 2Q5AA 4G50A 1ZBVA 4URIA 3UQAA 4L3NA 3RM4A 2DG9A 2WM0A 1Q6IA 2WLYA 2RSEA 4MNMA 2ZQVA 4U85A 3G6LA 2YBUA 2DSUA 2RUCA 1HJWA 3B9DA 1ZBKA 1FKKA 2MLZA 4QT2A 3EIPA 3ARQA 1QPLA 2PN0A 3I6CA 4GGQA 4XAKA 1X6NA 1JNDA 3KAIA 3WQVA 1P5QA 1ZCNA 1CTNA 4JFJA 1OGBA 3WD4A 2ESCA 4NNRA 4JFIA 3O5LA 4LAWA 4AY1A 3UQIA 2PPOA 4DZ3A 3VAWA 2LJ4A 4FAPA 1D6OA 2QF8A 1N1AA 4U86A 3RFWA 4HARA 4IQ2A 1W1VA 1GOIA 2ZR4A 3KZ7A 2RQSA 1FD9A 3O5GA 3GTYX 3B8SA 4O2TA 4J4NA 4DH0A 2OFNA 1W9UA 2PBCA 1Y0OA 3KAGA 4PTMA 3PRBA 4P8XA 1JVWA 4N19A 4W5UA 1J4IA 5D75A 2ZQTA 2WLZA 1M5YA 3O5QA 4W9OA 4MSPA 1FKFA 1H0GA 4WKHA 4DIPA 3JYMA 3ARSA 1LL6A 2Y78A 1K9TA 1HKMA 1FKTA 1W1PA 5DIUA 5DIVA 4QZVB 1XRVA 1ROTA 3TDBA 1J4HA 4GIVA 1XHGA 2ITKA 3LUOA 2PV1A 5GQBA 1TCOC 3RMEA 4DRNA 1NWSA 1Q6UA 1E6PA 5DITA 5DEZA 3BXWA 3ARVA 3CHFA 4QT3A 2EULA 4IPXA 4ITZA 2XP4A 2DT3A 2AOSA 3AROA 4IT4A 4MGVA 4J4OA 2PPNA 3ARRA 1D7JA 3KCEA 4DT4A 1SR0A 3B9AA 3ALGA 4JFMA 5HUAA 1ZK6A 3IHZA 1E6NA 1YATA 4W9QA 1JNSA 1C9HA 1NMWA 1ITXA 3O5FA 5HW7A 4DRIA 2MLXA 3WD1A 4WKFA 3NRKA 1A7XA 1FKDA 4MNKA 2LGOA 2VCDA 4JFLA 4JYSA 2IUZA 2O92A 3O5OA 2G41A 4ML4A 1D2KA 1JNEA 1TFVA 2ZQUA 5HBFA 1F40A 2RUDA 3O5EA 4KQZA 2DG4A 5BXJA 1FAPA 1ZBWA 3WD0A 1FKGA 3W4RA 4DWSA 1LL4A 4R5EA 3RM9A 3ARUA 1X6LA 1IX5A 4LGXA 2KE0A 3WQWA 5I98A 1NMVA 2OLHA 3WH0A 2DSVA 3WL0A 1H0IA 2KGJA 2F4EA 4IQCA 3OA5A 4MPKA 3PRAA 1SYTA 3O5JA 3GPKA 3UI6A 2F21A 4ZS6A 1QPFA 3ODKA 2DT0A 3ARYA 4ZPWR 2KI3A 2P4VA 3CGMA 3IKDA 3O5RA 4MNLA 2KO7A 1FKRA 1RD6A 4L72B 1BKFA 2MLYA 2F2DA 2FAPA 3B7XA 1LL7A 2UZ5A 4Q7NA 2ZR6A 2M1IA 4Z2HA 2RURA 2VN1A 4S3KA 2XPBA 1W26A 4Z2GA 1FJDA 3ARTA 4DWSD 4ODPA 4QIBA 4DRHA 1E6ZA 3O5IA 3FY1A 1W9PA 3G6MA 1PINA 3TCZA 4ODOA 1JCHB 3KACA 4ODLA 1WB0A 2A3EA 1HJXA 3FAPA 2G8ZA 3NTPA 1HKJA 1KT1A 4TW6A 1LJYA 1B6CA 4LAXA 3JYJA 1NWUA 3IKGA 3UQBA 2XP5A 1W1YA 3AS0A 1PBKA 1T11A 4FN2A 1LG1A 3PRDA 1UR9A 4DZ2A 2DSWA 3RGCA 4P8UA
chains in the Genus database with same CATH topology
1F8AB 2PPPA 4ODMA 1FKBA 1VF8A 1FKLA 1J4RA 4Q22A 4WIWA 4ZPVR 2DT2A 2B31A 1UR8A 2XP7A 5GPRA 4C02B 2XPAA 1NH6A 4W9PA 1GUVA 3O5KA 4HBOA 4DWSC 1WAWA 4ODQA 4Z2JA 4NSBA 1HJVA 2XP8A 3ARXA 1YW5A 5HW8A 1JNTA 4TYOA 3UF8A 3O5MA 2KFWA 5HT1A 4P8VA 2PI6A 2XP9A 3RM8A 3H9RB 5JH8A 3CHEA 1NWRA 3WL1A 2A3BA 1HXVA 2A3AA 1EIBA 1FKSA 1ZL1A 3AS3A 4DRJA 4DRMA 5B8IC 3CHDA 5HKGA 1FKHA 2A3CA 1E9LA 1KT0A 3MDYB 4WK9A 2D9FA 2JZVA 1W1TA 3FXYA 3NI6A 3AQUA 2N87A 1EHNA 1OWQA 1LQ0A 3KAHA 3WD3A 1L1PA 3CGNA 5HWBA 2MNTA 1D7IA 2RUQA 1KFWA 2MPHA 1OGGA 1Q6HA 3CZ8A 1U79A 3UI5A 3WIJA 4DWSB 4Z2LA 4MAVA 4WJXA 4TX0A 2LKNA 4P8WA 2L2SA 1FFQA 2PV3A 3O5DA 4HBEA 2XP6A 1ROUA 3PR9A 1Q1CA 4G2PA 3JXVA 4KR0B 1J6YA 2WK2A 2IF4A 2DT1A 4R0XA 4ODNA 2KR7A 2XP3A 1D7HA 5GPGA 1W9VA 4TNSA 1FFRA 4BF8A 3O5PA 4WKAA 5J6EA 1E15A 4DRKA 3EY6A 5DF0A 4MTVA 5HTGA 2MF9A 3AS1A 3UI4A 1HKIA 2K8IA 4DRQA 3ARWA 2ZQSA 4TW7A 3IK8A 1EQ3A 1ZBCA 5DO2A 4NZCA 3QOKA 4LAYA 4TW8A 2YBTA 1QZ2A 2FDMA 4ODKA 2DPEA 1FKIA 1GPFA 3CH9A 3PA7A 3ARPA 1BL4A 4U84A 1EDQA 2M2AA 2DSZA 1HKKA 1NWTA 2PV2A 1O6IA 3TC5A 2FKEA 4LAVA 5HW6A 2ZR5A 1LG2A 2DG3A 4MNJA 5HWCA 1EYMA 3AS2A 2M08A 3KABA 1NSGA 1WNOA 4DRPA 3WD2A 3KAFA 4ZPTR 2LPVA 4IT6A 4Z2KA 3WKZA 1ZU8A 1ZB5A 4DROA 3OOBA 3ALFA 4ODRA 1R9HA 3ARZA 3B9EA 1E6RA 2O9OA 4S3JA 1FKJA 4Z2IA 3CHCA 3KADA 2AWGA 4JFKA 2Q5AA 4G50A 1ZBVA 4URIA 3UQAA 4L3NA 3RM4A 2DG9A 2WM0A 1Q6IA 2WLYA 2RSEA 4MNMA 2ZQVA 4U85A 3G6LA 2YBUA 2DSUA 2RUCA 1HJWA 3B9DA 1ZBKA 1FKKA 2MLZA 4QT2A 3ARQA 1QPLA 3I6CA 4GGQA 4XAKA 1X6NA 1JNDA 3KAIA 3WQVA 1P5QA 1ZCNA 1CTNA 4JFJA 1OGBA 3WD4A 2ESCA 4NNRA 4JFIA 3O5LA 4LAWA 4AY1A 3UQIA 2PPOA 4DZ3A 3VAWA 2LJ4A 4FAPA 1D6OA 2QF8A 1N1AA 4U86A 3RFWA 4HARA 4IQ2A 1W1VA 1GOIA 2ZR4A 3KZ7A 2RQSA 1FD9A 3O5GA 3B8SA 4O2TA 4J4NA 4DH0A 2OFNA 1W9UA 2PBCA 1Y0OA 3KAGA 4PTMA 3PRBA 4P8XA 1JVWA 4N19A 4W5UA 1J4IA 5D75A 2ZQTA 2WLZA 1M5YA 3O5QA 4W9OA 4MSPA 1FKFA 1H0GA 4WKHA 4DIPA 3JYMA 3ARSA 1LL6A 2Y78A 1K9TA 1HKMA 1FKTA 1W1PA 5DIUA 5DIVA 4QZVB 1XRVA 1ROTA 3TDBA 1J4HA 4GIVA 1XHGA 2ITKA 3LUOA 2PV1A 5GQBA 1TCOC 3RMEA 4DRNA 1NWSA 1Q6UA 1E6PA 5DITA 5DEZA 3BXWA 3ARVA 3CHFA 4QT3A 4IPXA 4ITZA 2XP4A 2DT3A 2AOSA 3AROA 4IT4A 4MGVA 4J4OA 2PPNA 3ARRA 1D7JA 3KCEA 4DT4A 1SR0A 3B9AA 3ALGA 4JFMA 5HUAA 1ZK6A 3IHZA 1E6NA 1YATA 4W9QA 1JNSA 1C9HA 1NMWA 1ITXA 3O5FA 5HW7A 4DRIA 2MLXA 3WD1A 4WKFA 3NRKA 1A7XA 1FKDA 4MNKA 2LGOA 2VCDA 4JFLA 4JYSA 2IUZA 2O92A 3O5OA 2G41A 4ML4A 1D2KA 1JNEA 1TFVA 2ZQUA 5HBFA 1F40A 2RUDA 3O5EA 4KQZA 2DG4A 5BXJA 1FAPA 1ZBWA 3WD0A 1FKGA 3W4RA 4DWSA 1LL4A 4R5EA 3RM9A 3ARUA 1X6LA 1IX5A 4LGXA 2KE0A 3WQWA 5I98A 1NMVA 2OLHA 3WH0A 2DSVA 3WL0A 1H0IA 2KGJA 2F4EA 4IQCA 3OA5A 4MPKA 3PRAA 1SYTA 3O5JA 3GPKA 3UI6A 2F21A 4ZS6A 1QPFA 3ODKA 2DT0A 3ARYA 4ZPWR 2KI3A 3CGMA 3O5RA 3IKDA 4MNLA 2KO7A 1FKRA 1RD6A 4L72B 1BKFA 2MLYA 2F2DA 2FAPA 3B7XA 1LL7A 2UZ5A 4Q7NA 2ZR6A 2M1IA 4Z2HA 2RURA 2VN1A 4S3KA 2XPBA 1W26A 4Z2GA 1FJDA 3ARTA 4DWSD 4ODPA 4QIBA 4DRHA 1E6ZA 3O5IA 3FY1A 1W9PA 3G6MA 1PINA 3TCZA 4ODOA 3KACA 4ODLA 1WB0A 2A3EA 1HJXA 3FAPA 2G8ZA 3NTPA 1HKJA 1KT1A 4TW6A 1LJYA 1B6CA 4LAXA 3JYJA 1NWUA 3IKGA 3UQBA 2XP5A 1W1YA 3AS0A 1PBKA 1T11A 4FN2A 1LG1A 3PRDA 1UR9A 4DZ2A 2DSWA 3RGCA 4P8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F8A B;  1FKD A;  2PPP A;  3I6C A;  2LGO A;  2VCD A;  1D7H A;  4GGQ A;  3KAI A;  4JFL A;  4JYS A;  1P5Q A;  1ZCN A;  4ODM A;  1FKB A;  5GPG A;  4JFJ A;  1FKL A;  1J4R A;  4NNR A;  4JFI A;  4TNS A;  3O5L A;  3O5O A;  4LAW A;  4DZ3 A;  3UQI A;  2PPO A;  4BF8 A;  3VAW A;  2ZQU A;  3O5P A;  5J6E A;  2LJ4 A;  2RUD A;  3O5E A;  4FAP A;  1F40 A;  1D6O A;  2DG4 A;  4DRK A;  2XP7 A;  3EY6 A;  5BXJ A;  5HTG A;  2MF9 A;  4C02 B;  1N1A A;  1FAP A;  4U86 A;  3UI4 A;  3RFW A;  2XPA A;  2K8I A;  4IQ2 A;  4DRQ A;  4W9P A;  2ZR4 A;  1FKG A;  2RQS A;  3KZ7 A;  1FD9 A;  3O5K A;  3O5G A;  2ZQS A;  4TW7 A;  4O2T A;  4ODQ A;  4J4N A;  4DH0 A;  2OFN A;  3IK8 A;  2PBC A;  1EQ3 A;  1Y0O A;  2KE0 A;  3KAG A;  5I98 A;  1NMV A;  3WH0 A;  2XP8 A;  3PRB A;  1JVW A;  1YW5 A;  4N19 A;  5HW8 A;  1JNT A;  1J4I A;  5D75 A;  4LAY A;  4TW8 A;  2KGJ A;  4TYO A;  3UF8 A;  2F4E A;  2KFW A;  2ZQT A;  1QZ2 A;  1M5Y A;  3O5M A;  3O5Q A;  4IQC A;  4ODK A;  4W9O A;  5HT1 A;  4MSP A;  3O5J A;  3GPK A;  3UI6 A;  1FKF A;  1FKI A;  2XP9 A;  3PA7 A;  2F21 A;  3H9R B;  1BL4 A;  1QPF A;  3ODK A;  4DIP A;  4U84 A;  1HXV A;  2M2A A;  2KI3 A;  3JYM A;  3CGM A;  1FKS A;  3IKD A;  3O5R A;  2KO7 A;  2PV2 A;  3RGC A;  3TC5 A;  1FKR A;  2FKE A;  1BKF A;  2Y78 A;  4DRJ A;  4LAV A;  4DRM A;  5B8I C;  2ZR5 A;  5HKG A;  5HW6 A;  1FKH A;  1FKT A;  2F2D A;  2MLY A;  2FAP A;  5DIU A;  3B7X A;  2DG3 A;  5DIV A;  5HWC A;  1EYM A;  1KT0 A;  2UZ5 A;  2M08 A;  1ROT A;  2ZR6 A;  3MDY B;  1J4H A;  2M1I A;  4GIV A;  3TDB A;  3KAB A;  2ITK A;  2RUR A;  2D9F A;  1NSG A;  2JZV A;  2VN1 A;  2PV1 A;  3LUO A;  2XPB A;  1W26 A;  3NI6 A;  4DRP A;  2N87 A;  1TCO C;  1FJD A;  4DRN A;  3KAF A;  1Q6U A;  3KAH A;  2LPV A;  1L1P A;  4ODP A;  4QIB A;  5DIT A;  4DZ2 A;  3CGN A;  4DRH A;  4DRO A;  2MNT A;  5HWB A;  3OOB A;  3O5I A;  1D7I A;  2RUQ A;  2MPH A;  4ODR A;  1R9H A;  4QT3 A;  1Q6H A;  4IPX A;  1PIN A;  2XP4 A;  1U79 A;  4ITZ A;  3UI5 A;  1FKJ A;  3TCZ A;  4ODO A;  3KAC A;  4MGV A;  4J4O A;  3KAD A;  4ODL A;  4TX0 A;  2AWG A;  2LKN A;  2PPN A;  2L2S A;  2Q5A A;  4JFK A;  4G50 A;  1D7J A;  3UQA A;  3KCE A;  4DT4 A;  2PV3 A;  3FAP A;  3NTP A;  3O5D A;  2XP6 A;  1KT1 A;  1ROU A;  4JFM A;  4TW6 A;  2DG9 A;  5HUA A;  1Q6I A;  1B6C A;  1ZK6 A;  1Q1C A;  3IHZ A;  2RSE A;  1YAT A;  4G2P A;  2ZQV A;  3JXV A;  4LAX A;  4W9Q A;  4U85 A;  3JYJ A;  1JNS A;  3IKG A;  2RUC A;  3UQB A;  1J6Y A;  2XP5 A;  1C9H A;  1NMW A;  3O5F A;  2IF4 A;  5HW7 A;  4DRI A;  1FKK A;  4R0X A;  1PBK A;  1T11 A;  2MLX A;  4FN2 A;  2MLZ A;  3PRD A;  4ODN A;  4QT2 A;  2KR7 A;  1QPL A;  2XP3 A;  3NRK A;  1A7X A; 
#chains in the Genus database with same CATH topology
 1F8A B;  2PPP A;  4ODM A;  1FKB A;  1VF8 A;  1FKL A;  1J4R A;  4Q22 A;  4WIW A;  4ZPV R;  2DT2 A;  2B31 A;  1UR8 A;  2XP7 A;  5GPR A;  4C02 B;  2XPA A;  1NH6 A;  4W9P A;  1GUV A;  3O5K A;  4HBO A;  4DWS C;  1WAW A;  4ODQ A;  4Z2J A;  3BMB A;  4NSB A;  3GU0 A;  1HJV A;  2XP8 A;  3ARX A;  1YW5 A;  5HW8 A;  1JNT A;  4TYO A;  3UF8 A;  3O5M A;  2KFW A;  5HT1 A;  4P8V A;  2PI6 A;  2XP9 A;  3RM8 A;  3H9R B;  5JH8 A;  3CHE A;  1NWR A;  3WL1 A;  2A3B A;  1HXV A;  2A3A A;  1EIB A;  1FKS A;  1ZL1 A;  3AS3 A;  4DRJ A;  4DRM A;  5B8I C;  3CHD A;  5HKG A;  1FKH A;  2A3C A;  1E9L A;  1KT0 A;  3MDY B;  4WK9 A;  2D9F A;  2JZV A;  1W1T A;  3FXY A;  3NI6 A;  3AQU A;  2F23 A;  2N87 A;  1EHN A;  1OWQ A;  1LQ0 A;  3KAH A;  4UDM A;  3WD3 A;  1L1P A;  3CGN A;  5HWB A;  2MNT A;  1E44 A;  1D7I A;  2RUQ A;  1KFW A;  2MPH A;  1OGG A;  1Q6H A;  3CZ8 A;  1U79 A;  3UI5 A;  3WIJ A;  4DWS B;  4Z2L A;  4MAV A;  4WJX A;  4TX0 A;  2LKN A;  4P8W A;  2L2S A;  1FFQ A;  2PV3 A;  3O5D A;  4HBE A;  2XP6 A;  1ROU A;  3PR9 A;  1Q1C A;  4G2P A;  3JXV A;  4KR0 B;  1GRJ A;  1J6Y A;  2WK2 A;  2IF4 A;  2DT1 A;  2ETN A;  4R0X A;  4ODN A;  2KR7 A;  2XP3 A;  1D7H A;  5GPG A;  1W9V A;  4TNS A;  1FFR A;  4BF8 A;  3O5P A;  4WKA A;  5J6E A;  1E15 A;  4DRK A;  3EY6 A;  5DF0 A;  4MTV A;  5HTG A;  2MF9 A;  3AS1 A;  3UI4 A;  1HKI A;  2K8I A;  4DRQ A;  3ARW A;  2B5U B;  2ZQS A;  4TW7 A;  3IK8 A;  1EQ3 A;  1ZBC A;  5DO2 A;  4NZC A;  3QOK A;  4LAY A;  4TW8 A;  2YBT A;  1QZ2 A;  2FDM A;  4ODK A;  2DPE A;  1FKI A;  1GPF A;  3CH9 A;  3PA7 A;  3ARP A;  1BL4 A;  4U84 A;  1EDQ A;  2M2A A;  2DSZ A;  1HKK A;  1NWT A;  2PV2 A;  1O6I A;  3TC5 A;  2FKE A;  4LAV A;  5HW6 A;  2ZR5 A;  1LG2 A;  2DG3 A;  4MNJ A;  5HWC A;  1EYM A;  3AS2 A;  2M08 A;  3KAB A;  1NSG A;  1WNO A;  4DRP A;  3WD2 A;  3KAF A;  4ZPT R;  2LPV A;  4IT6 A;  4Z2K A;  3WKZ A;  1ZU8 A;  1ZB5 A;  4DRO A;  3OOB A;  3ALF A;  4ODR A;  1R9H A;  3ARZ A;  3B9E A;  1E6R A;  2O9O A;  4S3J A;  1FKJ A;  4Z2I A;  3CHC A;  3KAD A;  2AWG A;  4JFK A;  2Q5A A;  4G50 A;  1ZBV A;  4URI A;  3UQA A;  4L3N A;  3RM4 A;  2DG9 A;  2WM0 A;  1Q6I A;  2WLY A;  2RSE A;  4MNM A;  2ZQV A;  4U85 A;  3G6L A;  2YBU A;  2DSU A;  2RUC A;  1HJW A;  3B9D A;  1ZBK A;  1FKK A;  2MLZ A;  4QT2 A;  3EIP A;  3ARQ A;  1QPL A;  2PN0 A;  3I6C A;  4GGQ A;  4XAK A;  1X6N A;  1JND A;  3KAI A;  3WQV A;  1P5Q A;  1ZCN A;  1CTN A;  4JFJ A;  1OGB A;  3WD4 A;  2ESC A;  4NNR A;  4JFI A;  3O5L A;  4LAW A;  4AY1 A;  3UQI A;  2PPO A;  4DZ3 A;  3VAW A;  2LJ4 A;  4FAP A;  1D6O A;  2QF8 A;  1N1A A;  4U86 A;  3RFW A;  4HAR A;  4IQ2 A;  1W1V A;  1GOI A;  2ZR4 A;  3KZ7 A;  2RQS A;  1FD9 A;  3O5G A;  3GTY X;  3B8S A;  4O2T A;  4J4N A;  4DH0 A;  2OFN A;  1W9U A;  2PBC A;  1Y0O A;  3KAG A;  4PTM A;  3PRB A;  4P8X A;  1JVW A;  4N19 A;  4W5U A;  1J4I A;  5D75 A;  2ZQT A;  2WLZ A;  1M5Y A;  3O5Q A;  4W9O A;  4MSP A;  1FKF A;  1H0G A;  4WKH A;  4DIP A;  3JYM A;  3ARS A;  1LL6 A;  2Y78 A;  1K9T A;  1HKM A;  1FKT A;  1W1P A;  5DIU A;  5DIV A;  4QZV B;  1XRV A;  1ROT A;  3TDB A;  1J4H A;  4GIV A;  1XHG A;  2ITK A;  3LUO A;  2PV1 A;  5GQB A;  1TCO C;  3RME A;  4DRN A;  1NWS A;  1Q6U A;  1E6P A;  5DIT A;  5DEZ A;  3BXW A;  3ARV A;  3CHF A;  4QT3 A;  2EUL A;  4IPX A;  4ITZ A;  2XP4 A;  2DT3 A;  2AOS A;  3ARO A;  4IT4 A;  4MGV A;  4J4O A;  2PPN A;  3ARR A;  1D7J A;  3KCE A;  4DT4 A;  1SR0 A;  3B9A A;  3ALG A;  4JFM A;  5HUA A;  1ZK6 A;  3IHZ A;  1E6N A;  1YAT A;  4W9Q A;  1JNS A;  1C9H A;  1NMW A;  1ITX A;  3O5F A;  5HW7 A;  4DRI A;  2MLX A;  3WD1 A;  4WKF A;  3NRK A;  1A7X A;  1FKD A;  4MNK A;  2LGO A;  2VCD A;  4JFL A;  4JYS A;  2IUZ A;  2O92 A;  3O5O A;  2G41 A;  4ML4 A;  1D2K A;  1JNE A;  1TFV A;  2ZQU A;  5HBF A;  1F40 A;  2RUD A;  3O5E A;  4KQZ A;  2DG4 A;  5BXJ A;  1FAP A;  1ZBW A;  3WD0 A;  1FKG A;  3W4R A;  4DWS A;  1LL4 A;  4R5E A;  3RM9 A;  3ARU A;  1X6L A;  1IX5 A;  4LGX A;  2KE0 A;  3WQW A;  5I98 A;  1NMV A;  2OLH A;  3WH0 A;  2DSV A;  3WL0 A;  1H0I A;  2KGJ A;  2F4E A;  4IQC A;  3OA5 A;  4MPK A;  3PRA A;  1SYT A;  3O5J A;  3GPK A;  3UI6 A;  2F21 A;  4ZS6 A;  1QPF A;  3ODK A;  2DT0 A;  3ARY A;  4ZPW R;  2KI3 A;  2P4V A;  3CGM A;  3IKD A;  3O5R A;  4MNL A;  2KO7 A;  1FKR A;  1RD6 A;  4L72 B;  1BKF A;  2MLY A;  2F2D A;  2FAP A;  3B7X A;  1LL7 A;  2UZ5 A;  4Q7N A;  2ZR6 A;  2M1I A;  4Z2H A;  2RUR A;  2VN1 A;  4S3K A;  2XPB A;  1W26 A;  4Z2G A;  1FJD A;  3ART A;  4DWS D;  4ODP A;  4QIB A;  4DRH A;  1E6Z A;  3O5I A;  3FY1 A;  1W9P A;  3G6M A;  1PIN A;  3TCZ A;  4ODO A;  1JCH B;  3KAC A;  4ODL A;  1WB0 A;  2A3E A;  1HJX A;  3FAP A;  2G8Z A;  3NTP A;  1HKJ A;  1KT1 A;  4TW6 A;  1LJY A;  1B6C A;  4LAX A;  3JYJ A;  1NWU A;  3IKG A;  3UQB A;  2XP5 A;  1W1Y A;  3AS0 A;  1PBK A;  1T11 A;  4FN2 A;  1LG1 A;  3PRD A;  1UR9 A;  4DZ2 A;  2DSW A;  3RGC A;  4P8U A; 
#chains in the Genus database with same CATH homology
 1F8A B;  2PPP A;  4ODM A;  1FKB A;  1VF8 A;  1FKL A;  1J4R A;  4Q22 A;  4WIW A;  4ZPV R;  2DT2 A;  2B31 A;  1UR8 A;  2XP7 A;  5GPR A;  4C02 B;  2XPA A;  1NH6 A;  4W9P A;  1GUV A;  3O5K A;  4HBO A;  4DWS C;  1WAW A;  4ODQ A;  4Z2J A;  4NSB A;  1HJV A;  2XP8 A;  3ARX A;  1YW5 A;  5HW8 A;  1JNT A;  4TYO A;  3UF8 A;  3O5M A;  2KFW A;  5HT1 A;  4P8V A;  2PI6 A;  2XP9 A;  3RM8 A;  3H9R B;  5JH8 A;  3CHE A;  1NWR A;  3WL1 A;  2A3B A;  1HXV A;  2A3A A;  1EIB A;  1FKS A;  1ZL1 A;  3AS3 A;  4DRJ A;  4DRM A;  5B8I C;  3CHD A;  5HKG A;  1FKH A;  2A3C A;  1E9L A;  1KT0 A;  3MDY B;  4WK9 A;  2D9F A;  2JZV A;  1W1T A;  3FXY A;  3NI6 A;  3AQU A;  2N87 A;  1EHN A;  1OWQ A;  1LQ0 A;  3KAH A;  3WD3 A;  1L1P A;  3CGN A;  5HWB A;  2MNT A;  1D7I A;  2RUQ A;  1KFW A;  2MPH A;  1OGG A;  1Q6H A;  3CZ8 A;  1U79 A;  3UI5 A;  3WIJ A;  4DWS B;  4Z2L A;  4MAV A;  4WJX A;  4TX0 A;  2LKN A;  4P8W A;  2L2S A;  1FFQ A;  2PV3 A;  3O5D A;  4HBE A;  2XP6 A;  1ROU A;  3PR9 A;  1Q1C A;  4G2P A;  3JXV A;  4KR0 B;  1J6Y A;  2WK2 A;  2IF4 A;  2DT1 A;  4R0X A;  4ODN A;  2KR7 A;  2XP3 A;  1D7H A;  5GPG A;  1W9V A;  4TNS A;  1FFR A;  4BF8 A;  3O5P A;  4WKA A;  5J6E A;  1E15 A;  4DRK A;  3EY6 A;  5DF0 A;  4MTV A;  5HTG A;  2MF9 A;  3AS1 A;  3UI4 A;  1HKI A;  2K8I A;  4DRQ A;  3ARW A;  2ZQS A;  4TW7 A;  3IK8 A;  1EQ3 A;  1ZBC A;  5DO2 A;  4NZC A;  3QOK A;  4LAY A;  4TW8 A;  2YBT A;  1QZ2 A;  2FDM A;  4ODK A;  2DPE A;  1FKI A;  1GPF A;  3CH9 A;  3PA7 A;  3ARP A;  1BL4 A;  4U84 A;  1EDQ A;  2M2A A;  2DSZ A;  1HKK A;  1NWT A;  2PV2 A;  1O6I A;  3TC5 A;  2FKE A;  4LAV A;  5HW6 A;  2ZR5 A;  1LG2 A;  2DG3 A;  4MNJ A;  5HWC A;  1EYM A;  3AS2 A;  2M08 A;  3KAB A;  1NSG A;  1WNO A;  4DRP A;  3WD2 A;  3KAF A;  4ZPT R;  2LPV A;  4IT6 A;  4Z2K A;  3WKZ A;  1ZU8 A;  1ZB5 A;  4DRO A;  3OOB A;  3ALF A;  4ODR A;  1R9H A;  3ARZ A;  3B9E A;  1E6R A;  2O9O A;  4S3J A;  1FKJ A;  4Z2I A;  3CHC A;  3KAD A;  2AWG A;  4JFK A;  2Q5A A;  4G50 A;  1ZBV A;  4URI A;  3UQA A;  4L3N A;  3RM4 A;  2DG9 A;  2WM0 A;  1Q6I A;  2WLY A;  2RSE A;  4MNM A;  2ZQV A;  4U85 A;  3G6L A;  2YBU A;  2DSU A;  2RUC A;  1HJW A;  3B9D A;  1ZBK A;  1FKK A;  2MLZ A;  4QT2 A;  3ARQ A;  1QPL A;  3I6C A;  4GGQ A;  4XAK A;  1X6N A;  1JND A;  3KAI A;  3WQV A;  1P5Q A;  1ZCN A;  1CTN A;  4JFJ A;  1OGB A;  3WD4 A;  2ESC A;  4NNR A;  4JFI A;  3O5L A;  4LAW A;  4AY1 A;  3UQI A;  2PPO A;  4DZ3 A;  3VAW A;  2LJ4 A;  4FAP A;  1D6O A;  2QF8 A;  1N1A A;  4U86 A;  3RFW A;  4HAR A;  4IQ2 A;  1W1V A;  1GOI A;  2ZR4 A;  3KZ7 A;  2RQS A;  1FD9 A;  3O5G A;  3B8S A;  4O2T A;  4J4N A;  4DH0 A;  2OFN A;  1W9U A;  2PBC A;  1Y0O A;  3KAG A;  4PTM A;  3PRB A;  4P8X A;  1JVW A;  4N19 A;  4W5U A;  1J4I A;  5D75 A;  2ZQT A;  2WLZ A;  1M5Y A;  3O5Q A;  4W9O A;  4MSP A;  1FKF A;  1H0G A;  4WKH A;  4DIP A;  3JYM A;  3ARS A;  1LL6 A;  2Y78 A;  1K9T A;  1HKM A;  1FKT A;  1W1P A;  5DIU A;  5DIV A;  4QZV B;  1XRV A;  1ROT A;  3TDB A;  1J4H A;  4GIV A;  1XHG A;  2ITK A;  3LUO A;  2PV1 A;  5GQB A;  1TCO C;  3RME A;  4DRN A;  1NWS A;  1Q6U A;  1E6P A;  5DIT A;  5DEZ A;  3BXW A;  3ARV A;  3CHF A;  4QT3 A;  4IPX A;  4ITZ A;  2XP4 A;  2DT3 A;  2AOS A;  3ARO A;  4IT4 A;  4MGV A;  4J4O A;  2PPN A;  3ARR A;  1D7J A;  3KCE A;  4DT4 A;  1SR0 A;  3B9A A;  3ALG A;  4JFM A;  5HUA A;  1ZK6 A;  3IHZ A;  1E6N A;  1YAT A;  4W9Q A;  1JNS A;  1C9H A;  1NMW A;  1ITX A;  3O5F A;  5HW7 A;  4DRI A;  2MLX A;  3WD1 A;  4WKF A;  3NRK A;  1A7X A;  1FKD A;  4MNK A;  2LGO A;  2VCD A;  4JFL A;  4JYS A;  2IUZ A;  2O92 A;  3O5O A;  2G41 A;  4ML4 A;  1D2K A;  1JNE A;  1TFV A;  2ZQU A;  5HBF A;  1F40 A;  2RUD A;  3O5E A;  4KQZ A;  2DG4 A;  5BXJ A;  1FAP A;  1ZBW A;  3WD0 A;  1FKG A;  3W4R A;  4DWS A;  1LL4 A;  4R5E A;  3RM9 A;  3ARU A;  1X6L A;  1IX5 A;  4LGX A;  2KE0 A;  3WQW A;  5I98 A;  1NMV A;  2OLH A;  3WH0 A;  2DSV A;  3WL0 A;  1H0I A;  2KGJ A;  2F4E A;  4IQC A;  3OA5 A;  4MPK A;  3PRA A;  1SYT A;  3O5J A;  3GPK A;  3UI6 A;  2F21 A;  4ZS6 A;  1QPF A;  3ODK A;  2DT0 A;  3ARY A;  4ZPW R;  2KI3 A;  3CGM A;  3O5R A;  3IKD A;  4MNL A;  2KO7 A;  1FKR A;  1RD6 A;  4L72 B;  1BKF A;  2MLY A;  2F2D A;  2FAP A;  3B7X A;  1LL7 A;  2UZ5 A;  4Q7N A;  2ZR6 A;  2M1I A;  4Z2H A;  2RUR A;  2VN1 A;  4S3K A;  2XPB A;  1W26 A;  4Z2G A;  1FJD A;  3ART A;  4DWS D;  4ODP A;  4QIB A;  4DRH A;  1E6Z A;  3O5I A;  3FY1 A;  1W9P A;  3G6M A;  1PIN A;  3TCZ A;  4ODO A;  3KAC A;  4ODL A;  1WB0 A;  2A3E A;  1HJX A;  3FAP A;  2G8Z A;  3NTP A;  1HKJ A;  1KT1 A;  4TW6 A;  1LJY A;  1B6C A;  4LAX A;  3JYJ A;  1NWU A;  3IKG A;  3UQB A;  2XP5 A;  1W1Y A;  3AS0 A;  1PBK A;  1T11 A;  4FN2 A;  1LG1 A;  3PRD A;  1UR9 A;  4DZ2 A;  2DSW A;  3RGC A;  4P8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...