3O5JA

Fk1 domain of fkbp51, crystal form iii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
ATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 124
sequence length 124
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5jA00
2IF4A 4DRNA 2OFNA 2RUCA 2XP3A 1FD9A 2K8IA 4NNRA 1ROUA 3MDYB 3O5PA 4JFLA 4DRHA 5HW6A 3KABA 2ZQVA 1TCOC 3UI5A 2M2AA 1U79A 3RFWA 2F21A 1JNTA 1YATA 2LPVA 3O5DA 5HTGA 4DRMA 4GGQA 1N1AA 3KZ7A 3JYJA 1FKBA 1NMWA 3OOBA 2XPBA 1NSGA 4JFJA 4DRQA 4O2TA 2RURA 4QIBA 2ITKA 1D7HA 1F8AB 1W26A 1FAPA 1FKDA 3O5QA 2PV1A 1D7IA 2DG9A 3ODKA 4IQCA 4U84A 4W9OA 4C02B 4DRIA 5J6EA 1FKTA 3FAPA 2DG4A 2F2DA 2KO7A 3LUOA 4BF8A 1PBKA 1NMVA 1ROTA 4ODLA 4DZ2A 3PRBA 1Y0OA 2JZVA 1ZK6A 3PRDA 2MF9A 2PV3A 4R0XA 2RSEA 1EQ3A 1JVWA 3IKGA 3RGCA 4DIPA 3VAWA 1FKGA 3KACA 5GPGA 1FKRA 4JFMA 3KAIA 4G50A 3KADA 4JYSA 4ODNA 4TW7A 1FJDA 3KCEA 1QZ2A 4TW6A 3TC5A 2KI3A 2Q5AA 2XPAA 3IK8A 1Q6UA 5D75A 3UI4A 3H9RB 2PBCA 1F40A 4FN2A 2ZR6A 1FKKA 3UQAA 1J4HA 1HXVA 5DITA 5I98A 2KR7A 2L2SA 2RUQA 1EYMA 2RUDA 3I6CA 1QPFA 3O5FA 5B8IC 1FKHA 4W9PA 2KE0A 2RQSA 3UQBA 2M08A 1JNSA 2AWGA 4TYOA 4LAYA 2FAPA 4LAVA 1KT0A 2LGOA 2XP6A 4ITZA 3TCZA 2M1IA 5HWCA 4IQ2A 5BXJA 5DIUA 1BL4A 2MLXA 4W9QA 3WH0A 3O5MA 1J4IA 1D7JA 2DG3A 2LJ4A 4ODPA 3TDBA 1T11A 1FKJA 3CGNA 2VCDA 4GIVA 4J4OA 3KAHA 2ZQTA 2VN1A 1M5YA 4MGVA 4TX0A 3B7XA 1QPLA 2MLZA 1D6OA 4ODKA 3KAGA 1BKFA 1YW5A 4DRPA 2PPOA 3NRKA 4IPXA 4LAWA 2XP5A 3KAFA 3EY6A 4ODOA 5HWBA 2XP9A 3O5KA 3O5EA 1FKFA 2MPHA 2FKEA 4J4NA 2Y78A 4ODQA 3UF8A 2ZQUA 4DRKA 1FKIA 3NI6A 3O5JA 4TNSA 1Q1CA 1L1PA 3O5LA 3UI6A 2MLYA 2LKNA 4TW8A 4DROA 4U85A 2ZR5A 5HW7A 4U86A 3UQIA 2MNTA 2UZ5A 4DT4A 4QT2A 1FKSA 2ZR4A 3IHZA 1ZCNA 3JXVA 3JYMA 3O5OA 3PA7A 4ODRA 4MSPA 2KFWA 3GPKA 5HT1A 4G2PA 1Q6IA 3O5RA 1J6YA 5DIVA 3O5GA 2ZQSA 2XP8A 3NTPA 1A7XA 5HUAA 4ODMA 2KGJA 4JFIA 4DRJA 2PPPA 3O5IA 1Q6HA 2XP7A 2XP4A 3IKDA 5HW8A 1R9HA 1J4RA 1FKLA 5HKGA 1C9HA 4DZ3A 1P5QA 4LAXA 2F4EA 4FAPA 2N87A 1PINA 2PPNA 4N19A 2PV2A 4QT3A 2D9FA 1KT1A 1B6CA 3CGMA 4DH0A 4JFKA
chains in the Genus database with same CATH superfamily
4Z2HA 2XP3A 2K8IA 4JFLA 1LQ0A 3UI5A 2M2AA 1WB0A 3OOBA 1NSGA 1XRVA 4O2TA 3ARYA 1W26A 3O5QA 2PV1A 4W9OA 5J6EA 2DG4A 2F2DA 4HBEA 4ML4A 1ROTA 3ARXA 1LL6A 3PRDA 2MF9A 2PV3A 2RSEA 4Q7NA 5GPGA 3CHDA 4G50A 4JYSA 4TW7A 1OGGA 3KCEA 4TW6A 2QF8A 2Q5AA 1Q6UA 3UI4A 3WD2A 2PBCA 4P8WA 1FKKA 3UQAA 1H0GA 4MTVA 1GRJA 2RUDA 1ITXA 3I6CA 1FKHA 2KE0A 2DSVA 1EHNA 2M08A 2ETNA 2XP6A 4ITZA 1LL7A 3TCZA 3B9DA 5BXJA 2MLXA 1HKKA 3WH0A 2G41A 1D7JA 1HJXA 1RD6A 3WQVA 1T11A 1FKJA 1O6IA 3CGNA 4J4OA 3GU0A 3ARPA 1D6OA 4L72B 1BKFA 1W1VA 1HKIA 3ARUA 3UF8A 2Y78A 4DRKA 3B9EA 4WIWA 3O5JA 3CHEA 4Z2GA 4IT4A 1W1PA 1FKSA 1ZCNA 4ODRA 3B8SA 4MNJA 4MSPA 4ZS6A 5HT1A 4WK9A 1J6YA 2A3CA 4Z2IA 2XP8A 5HUAA 3G6LA 1E6RA 4JFIA 2PPPA 1Q6HA 2XP7A 4Q22A 5HW8A 3ARZA 4WKHA 2G8ZA 2DT1A 1J4RA 1FKLA 2YBTA 1C9HA 1P5QA 1H0IA 2F4EA 4FAPA 2N87A 2PN0A 5DF0A 4QZVB 4DRNA 4NSBA 1FD9A 4PTMA 3O5PA 5HW6A 1E6NA 1WAWA 3KABA 1TCOC 1U79A 3RFWA 3O5DA 4S3JA 2O9OA 1N1AA 3KZ7A 1GOIA 3JYJA 1NMWA 5DO2A 3ARQA 1D2KA 1OGBA 2RURA 1KFWA 2ITKA 4U84A 4DRIA 4MNLA 1FKTA 2KO7A 4BF8A 1PBKA 4MNMA 4ODLA 1ZK6A 2JZVA 4R0XA 4MAVA 3RGCA 4DIPA 4ZPTR 3KACA 1VF8A 3KAIA 4ODNA 1W9UA 5GPRA 2PI6A 4P8VA 5D75A 2A3EA 1F40A 2ZR6A 2WK2A 3ALGA 4Z2KA 5DITA 1LL4A 1W9PA 2KR7A 2L2SA 2RUQA 3WD1A 5B8IC 3WL1A 1EIBA 4LAYA 2DT2A 2FAPA 2LGOA 1JNEA 2M1IA 2YBUA 4IQ2A 3O5MA 3TDBA 4URIA 2DSWA 2ZQTA 3RM8A 2VN1A 4MGVA 2MLZA 3KAGA 1YW5A 2PPOA 3KAFA 1GPFA 4ODOA 1NH6A 4UDMA 5JH8A 2XP9A 4W5UA 1NWRA 3O5KA 3O5EA 1FKFA 4J4NA 3BMBA 1FKIA 2O92A 3O5LA 1NWTA 3G6MA 1E6PA 3UI6A 4DROA 4U86A 4ZPWR 2MNTA 2UZ5A 3AS3A 3WD4A 2ZR4A 3IHZA 1ZL1A 3ARRA 2KFWA 3GPKA 2DSZA 2B5UB 1K9TA 1FFQA 4G2PA 4R5EA 5DIVA 3B9AA 2ZQSA 1A7XA 2KGJA 2DSUA 2XP4A 1X6LA 1LG1A 1R9HA 2IUZA 2P4VA 3RM4A 5HKGA 1W1YA 3WIJA 4S3KA 4N19A 2PPNA 2PV2A 2D9FA 1JCHB 1KT1A 2OLHA 2DT3A 4JFKA 1UR8A 2IF4A 4WJXA 3CH9A 3FXYA 2RUCA 3ALFA 4NNRA 1ROUA 3MDYB 4DRHA 1ZB5A 4KQZA 2F21A 1JNTA 1YATA 2LPVA 3WQWA 1FKBA 4Z2JA 2XPBA 1W1TA 4QIBA 1D7HA 1FAPA 3ARVA 4C02B 4L3NA 3OA5A 3FAPA 3LUOA 5GQBA 1NMVA 3RMEA 1WNOA 4DZ2A 3WD3A 3PRBA 1Y0OA 1NWSA 3AS0A 1JVWA 3VAWA 3KADA 1FJDA 2KI3A 3H9RB 1ZBVA 1J4HA 1IX5A 1XHGA 3PRAA 3RM9A 1W9VA 2RQSA 3BXWA 4WKAA 2WLZA 4P8UA 1GUVA 2WM0A 2AWGA 4TYOA 1ZBWA 5HWCA 3ARWA 1BL4A 1ZBKA 1J4IA 2DG3A 2LJ4A 1CTNA 1E9LA 2VCDA 3KAHA 1M5YA 1ZBCA 1E6ZA 4NZCA 4WKFA 3WL0A 2XP5A 3AS2A 3EY6A 5HWBA 4Z2LA 4ODQA 2ZQUA 1Q1CA 4TW8A 2LKNA 3EIPA 4KR0B 3QOKA 3JXVA 4AY1A 1OWQA 3CHCA 3O5RA 1E44A 3O5GA 3NTPA 4DRJA 3PR9A 5DEZA 1JNDA 4P8XA 4DZ3A 4LAXA 3FY1A 4QT2A 3CGMA 3CZ8A 2OFNA 4MPKA 1SYTA 4DWSC 2ZQVA 4DWSB 1SR0A 5HBFA 5HTGA 4DRMA 4GGQA 4HBOA 4JFJA 4DRQA 1X6NA 1F8AB 1LG2A 1FKDA 3AS1A 4IQCA 1D7IA 2DG9A 3ODKA 1HKJA 2DPEA 2A3BA 1EDQA 1EQ3A 1E15A 3IKGA 1FKGA 1UR9A 1FKRA 4JFMA 3AROA 1QZ2A 3TC5A 3IK8A 2XPAA 2FDMA 4FN2A 1HXVA 5I98A 3WD0A 2WLYA 1EYMA 1QPFA 3ARSA 2ESCA 3O5FA 4W9PA 3UQBA 4LGXA 1JNSA 2AOSA 4LAVA 1KT0A 1HJWA 5DIUA 4W9QA 1ZU8A 1FFRA 2B31A 1HKMA 4ODPA 4GIVA 4TX0A 3B7XA 4DWSA 1QPLA 3AQUA 4ODKA 4DRPA 3NRKA 3WKZA 4IPXA 1HJVA 4LAWA 4ZPVR 4MNKA 2MPHA 2FKEA 3NI6A 4TNSA 1NWUA 1L1PA 2MLYA 4XAKA 4U85A 2ZR5A 5HW7A 3UQIA 4DT4A 2EULA 3O5OA 3JYMA 3PA7A 2A3AA 4IT6A 1Q6IA 2F23A 3CHFA 2DT0A 4ODMA 3O5IA 3IKDA 1TFVA 4HARA 1LJYA 3GTYX 3W4RA 4DWSD 1PINA 4QT3A 1B6CA 4DH0A 3ARTA
chains in the Genus database with same CATH topology
4Z2HA 2XP3A 2K8IA 4JFLA 1LQ0A 3UI5A 2M2AA 1WB0A 3OOBA 1NSGA 1XRVA 4O2TA 3ARYA 1W26A 3O5QA 2PV1A 4W9OA 5J6EA 2DG4A 2F2DA 4HBEA 4ML4A 1ROTA 3ARXA 1LL6A 3PRDA 2MF9A 2PV3A 2RSEA 4Q7NA 5GPGA 3CHDA 4G50A 4JYSA 4TW7A 1OGGA 3KCEA 4TW6A 2QF8A 2Q5AA 1Q6UA 3UI4A 3WD2A 2PBCA 4P8WA 1FKKA 3UQAA 1H0GA 4MTVA 2RUDA 1ITXA 3I6CA 1FKHA 2KE0A 2DSVA 1EHNA 2M08A 2XP6A 4ITZA 1LL7A 3TCZA 3B9DA 5BXJA 2MLXA 1HKKA 3WH0A 2G41A 1D7JA 1HJXA 1RD6A 3WQVA 1T11A 1FKJA 1O6IA 3CGNA 4J4OA 3ARPA 1D6OA 4L72B 1BKFA 1W1VA 1HKIA 3ARUA 3UF8A 2Y78A 4DRKA 3B9EA 4WIWA 3O5JA 3CHEA 4Z2GA 4IT4A 1W1PA 1FKSA 1ZCNA 4ODRA 3B8SA 4MNJA 4MSPA 4ZS6A 5HT1A 4WK9A 1J6YA 2A3CA 4Z2IA 2XP8A 5HUAA 3G6LA 1E6RA 4JFIA 2PPPA 1Q6HA 2XP7A 4Q22A 5HW8A 3ARZA 4WKHA 2G8ZA 2DT1A 1J4RA 1FKLA 2YBTA 1C9HA 1P5QA 1H0IA 2F4EA 4FAPA 2N87A 5DF0A 4QZVB 4DRNA 4NSBA 1FD9A 4PTMA 3O5PA 5HW6A 1E6NA 1WAWA 3KABA 1TCOC 1U79A 3RFWA 3O5DA 4S3JA 2O9OA 1N1AA 3KZ7A 1GOIA 3JYJA 1NMWA 5DO2A 3ARQA 1D2KA 1OGBA 2RURA 1KFWA 2ITKA 4U84A 4DRIA 4MNLA 1FKTA 2KO7A 4BF8A 1PBKA 4MNMA 4ODLA 1ZK6A 2JZVA 4R0XA 4MAVA 3RGCA 4DIPA 4ZPTR 3KACA 1VF8A 3KAIA 4ODNA 1W9UA 5GPRA 2PI6A 4P8VA 5D75A 2A3EA 1F40A 2ZR6A 2WK2A 3ALGA 4Z2KA 5DITA 1LL4A 1W9PA 2KR7A 2L2SA 2RUQA 3WD1A 5B8IC 3WL1A 1EIBA 4LAYA 2DT2A 2FAPA 2LGOA 1JNEA 2M1IA 2YBUA 4IQ2A 3O5MA 3TDBA 4URIA 2DSWA 2ZQTA 3RM8A 2VN1A 4MGVA 2MLZA 3KAGA 1YW5A 2PPOA 3KAFA 1GPFA 4ODOA 1NH6A 5JH8A 2XP9A 4W5UA 1NWRA 3O5KA 3O5EA 1FKFA 4J4NA 1FKIA 2O92A 3O5LA 1NWTA 3G6MA 1E6PA 3UI6A 4DROA 4U86A 4ZPWR 2MNTA 2UZ5A 3AS3A 3WD4A 2ZR4A 3IHZA 1ZL1A 3ARRA 2KFWA 3GPKA 2DSZA 1K9TA 1FFQA 4G2PA 4R5EA 5DIVA 3B9AA 2ZQSA 1A7XA 2KGJA 2DSUA 2XP4A 1X6LA 1LG1A 1R9HA 2IUZA 3RM4A 5HKGA 1W1YA 3WIJA 4S3KA 4N19A 2PPNA 2PV2A 2D9FA 1KT1A 2OLHA 2DT3A 4JFKA 1UR8A 2IF4A 4WJXA 3CH9A 3FXYA 2RUCA 3ALFA 4NNRA 1ROUA 3MDYB 4DRHA 1ZB5A 4KQZA 2F21A 1JNTA 1YATA 2LPVA 3WQWA 1FKBA 4Z2JA 2XPBA 1W1TA 4QIBA 1D7HA 1FAPA 3ARVA 4C02B 4L3NA 3OA5A 3FAPA 3LUOA 5GQBA 1NMVA 3RMEA 1WNOA 4DZ2A 3WD3A 3PRBA 1Y0OA 1NWSA 3AS0A 1JVWA 3VAWA 3KADA 1FJDA 2KI3A 3H9RB 1ZBVA 1J4HA 1IX5A 1XHGA 3PRAA 3RM9A 1W9VA 2RQSA 3BXWA 4WKAA 2WLZA 4P8UA 1GUVA 2WM0A 2AWGA 4TYOA 1ZBWA 5HWCA 3ARWA 1BL4A 1ZBKA 1J4IA 2DG3A 2LJ4A 1CTNA 1E9LA 2VCDA 3KAHA 1M5YA 1ZBCA 1E6ZA 4NZCA 4WKFA 3WL0A 2XP5A 3AS2A 3EY6A 5HWBA 4Z2LA 4ODQA 2ZQUA 1Q1CA 4TW8A 2LKNA 4KR0B 3QOKA 3JXVA 4AY1A 1OWQA 3CHCA 3O5RA 3O5GA 3NTPA 4DRJA 3PR9A 5DEZA 1JNDA 4P8XA 4DZ3A 4LAXA 3FY1A 4QT2A 3CGMA 3CZ8A 2OFNA 4MPKA 1SYTA 4DWSC 2ZQVA 4DWSB 1SR0A 5HBFA 5HTGA 4DRMA 4GGQA 4HBOA 4JFJA 4DRQA 1X6NA 1F8AB 1LG2A 1FKDA 3AS1A 4IQCA 1D7IA 2DG9A 3ODKA 1HKJA 2DPEA 2A3BA 1EDQA 1EQ3A 1E15A 3IKGA 1FKGA 1UR9A 1FKRA 4JFMA 3AROA 1QZ2A 3TC5A 3IK8A 2XPAA 2FDMA 4FN2A 1HXVA 5I98A 3WD0A 2WLYA 1EYMA 1QPFA 3ARSA 2ESCA 3O5FA 4W9PA 3UQBA 4LGXA 1JNSA 2AOSA 4LAVA 1KT0A 1HJWA 5DIUA 4W9QA 1ZU8A 1FFRA 2B31A 1HKMA 4ODPA 4GIVA 4TX0A 3B7XA 4DWSA 1QPLA 3AQUA 4ODKA 4DRPA 3NRKA 3WKZA 4IPXA 1HJVA 4LAWA 4ZPVR 4MNKA 2MPHA 2FKEA 3NI6A 4TNSA 1NWUA 1L1PA 2MLYA 4XAKA 4U85A 2ZR5A 5HW7A 3UQIA 4DT4A 3O5OA 3JYMA 3PA7A 2A3AA 4IT6A 1Q6IA 3CHFA 2DT0A 4ODMA 3O5IA 3IKDA 1TFVA 4HARA 1LJYA 3W4RA 4DWSD 1PINA 4QT3A 1B6CA 4DH0A 3ARTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IF4 A;  4DRN A;  2OFN A;  2RUC A;  2XP3 A;  1FD9 A;  2K8I A;  4NNR A;  1ROU A;  3MDY B;  3O5P A;  4JFL A;  4DRH A;  5HW6 A;  3KAB A;  2ZQV A;  1TCO C;  3UI5 A;  2M2A A;  1U79 A;  3RFW A;  2F21 A;  1JNT A;  1YAT A;  2LPV A;  3O5D A;  5HTG A;  4DRM A;  4GGQ A;  1N1A A;  3KZ7 A;  3JYJ A;  1FKB A;  1NMW A;  3OOB A;  2XPB A;  1NSG A;  4JFJ A;  4DRQ A;  4O2T A;  2RUR A;  4QIB A;  2ITK A;  1D7H A;  1F8A B;  1W26 A;  1FAP A;  1FKD A;  3O5Q A;  2PV1 A;  1D7I A;  2DG9 A;  3ODK A;  4IQC A;  4U84 A;  4W9O A;  4C02 B;  4DRI A;  5J6E A;  1FKT A;  3FAP A;  2DG4 A;  2F2D A;  2KO7 A;  3LUO A;  4BF8 A;  1PBK A;  1NMV A;  1ROT A;  4ODL A;  4DZ2 A;  3PRB A;  1Y0O A;  2JZV A;  1ZK6 A;  3PRD A;  2MF9 A;  2PV3 A;  4R0X A;  2RSE A;  1EQ3 A;  1JVW A;  3IKG A;  3RGC A;  4DIP A;  3VAW A;  1FKG A;  3KAC A;  5GPG A;  1FKR A;  4JFM A;  3KAI A;  4G50 A;  3KAD A;  4JYS A;  4ODN A;  4TW7 A;  1FJD A;  3KCE A;  1QZ2 A;  4TW6 A;  3TC5 A;  2KI3 A;  2Q5A A;  2XPA A;  3IK8 A;  1Q6U A;  5D75 A;  3UI4 A;  3H9R B;  2PBC A;  1F40 A;  4FN2 A;  2ZR6 A;  1FKK A;  3UQA A;  1J4H A;  1HXV A;  5DIT A;  5I98 A;  2KR7 A;  2L2S A;  2RUQ A;  1EYM A;  2RUD A;  3I6C A;  1QPF A;  3O5F A;  5B8I C;  1FKH A;  4W9P A;  2KE0 A;  2RQS A;  3UQB A;  2M08 A;  1JNS A;  2AWG A;  4TYO A;  4LAY A;  2FAP A;  4LAV A;  1KT0 A;  2LGO A;  2XP6 A;  4ITZ A;  3TCZ A;  2M1I A;  5HWC A;  4IQ2 A;  5BXJ A;  5DIU A;  1BL4 A;  2MLX A;  4W9Q A;  3WH0 A;  3O5M A;  1J4I A;  1D7J A;  2DG3 A;  2LJ4 A;  4ODP A;  3TDB A;  1T11 A;  1FKJ A;  3CGN A;  2VCD A;  4GIV A;  4J4O A;  3KAH A;  2ZQT A;  2VN1 A;  1M5Y A;  4MGV A;  4TX0 A;  3B7X A;  1QPL A;  2MLZ A;  1D6O A;  4ODK A;  3KAG A;  1BKF A;  1YW5 A;  4DRP A;  2PPO A;  3NRK A;  4IPX A;  4LAW A;  2XP5 A;  3KAF A;  3EY6 A;  4ODO A;  5HWB A;  2XP9 A;  3O5K A;  3O5E A;  1FKF A;  2MPH A;  2FKE A;  4J4N A;  2Y78 A;  4ODQ A;  3UF8 A;  2ZQU A;  4DRK A;  1FKI A;  3NI6 A;  3O5J A;  4TNS A;  1Q1C A;  1L1P A;  3O5L A;  3UI6 A;  2MLY A;  2LKN A;  4TW8 A;  4DRO A;  4U85 A;  2ZR5 A;  5HW7 A;  4U86 A;  3UQI A;  2MNT A;  2UZ5 A;  4DT4 A;  4QT2 A;  1FKS A;  2ZR4 A;  3IHZ A;  1ZCN A;  3JXV A;  3JYM A;  3O5O A;  3PA7 A;  4ODR A;  4MSP A;  2KFW A;  3GPK A;  5HT1 A;  4G2P A;  1Q6I A;  3O5R A;  1J6Y A;  5DIV A;  3O5G A;  2ZQS A;  2XP8 A;  3NTP A;  1A7X A;  5HUA A;  4ODM A;  2KGJ A;  4JFI A;  4DRJ A;  2PPP A;  3O5I A;  1Q6H A;  2XP7 A;  2XP4 A;  3IKD A;  5HW8 A;  1R9H A;  1J4R A;  1FKL A;  5HKG A;  1C9H A;  4DZ3 A;  1P5Q A;  4LAX A;  2F4E A;  4FAP A;  2N87 A;  1PIN A;  2PPN A;  4N19 A;  2PV2 A;  4QT3 A;  2D9F A;  1KT1 A;  1B6C A;  3CGM A;  4DH0 A;  4JFK A; 
#chains in the Genus database with same CATH topology
 4Z2H A;  2XP3 A;  2K8I A;  4JFL A;  1LQ0 A;  3UI5 A;  2M2A A;  1WB0 A;  3OOB A;  1NSG A;  1XRV A;  4O2T A;  3ARY A;  1W26 A;  3O5Q A;  2PV1 A;  4W9O A;  5J6E A;  2DG4 A;  2F2D A;  4HBE A;  4ML4 A;  1ROT A;  3ARX A;  1LL6 A;  3PRD A;  2MF9 A;  2PV3 A;  2RSE A;  4Q7N A;  5GPG A;  3CHD A;  4G50 A;  4JYS A;  4TW7 A;  1OGG A;  3KCE A;  4TW6 A;  2QF8 A;  2Q5A A;  1Q6U A;  3UI4 A;  3WD2 A;  2PBC A;  4P8W A;  1FKK A;  3UQA A;  1H0G A;  4MTV A;  1GRJ A;  2RUD A;  1ITX A;  3I6C A;  1FKH A;  2KE0 A;  2DSV A;  1EHN A;  2M08 A;  2ETN A;  2XP6 A;  4ITZ A;  1LL7 A;  3TCZ A;  3B9D A;  5BXJ A;  2MLX A;  1HKK A;  3WH0 A;  2G41 A;  1D7J A;  1HJX A;  1RD6 A;  3WQV A;  1T11 A;  1FKJ A;  1O6I A;  3CGN A;  4J4O A;  3GU0 A;  3ARP A;  1D6O A;  4L72 B;  1BKF A;  1W1V A;  1HKI A;  3ARU A;  3UF8 A;  2Y78 A;  4DRK A;  3B9E A;  4WIW A;  3O5J A;  3CHE A;  4Z2G A;  4IT4 A;  1W1P A;  1FKS A;  1ZCN A;  4ODR A;  3B8S A;  4MNJ A;  4MSP A;  4ZS6 A;  5HT1 A;  4WK9 A;  1J6Y A;  2A3C A;  4Z2I A;  2XP8 A;  5HUA A;  3G6L A;  1E6R A;  4JFI A;  2PPP A;  1Q6H A;  2XP7 A;  4Q22 A;  5HW8 A;  3ARZ A;  4WKH A;  2G8Z A;  2DT1 A;  1J4R A;  1FKL A;  2YBT A;  1C9H A;  1P5Q A;  1H0I A;  2F4E A;  4FAP A;  2N87 A;  2PN0 A;  5DF0 A;  4QZV B;  4DRN A;  4NSB A;  1FD9 A;  4PTM A;  3O5P A;  5HW6 A;  1E6N A;  1WAW A;  3KAB A;  1TCO C;  1U79 A;  3RFW A;  3O5D A;  4S3J A;  2O9O A;  1N1A A;  3KZ7 A;  1GOI A;  3JYJ A;  1NMW A;  5DO2 A;  3ARQ A;  1D2K A;  1OGB A;  2RUR A;  1KFW A;  2ITK A;  4U84 A;  4DRI A;  4MNL A;  1FKT A;  2KO7 A;  4BF8 A;  1PBK A;  4MNM A;  4ODL A;  1ZK6 A;  2JZV A;  4R0X A;  4MAV A;  3RGC A;  4DIP A;  4ZPT R;  3KAC A;  1VF8 A;  3KAI A;  4ODN A;  1W9U A;  5GPR A;  2PI6 A;  4P8V A;  5D75 A;  2A3E A;  1F40 A;  2ZR6 A;  2WK2 A;  3ALG A;  4Z2K A;  5DIT A;  1LL4 A;  1W9P A;  2KR7 A;  2L2S A;  2RUQ A;  3WD1 A;  5B8I C;  3WL1 A;  1EIB A;  4LAY A;  2DT2 A;  2FAP A;  2LGO A;  1JNE A;  2M1I A;  2YBU A;  4IQ2 A;  3O5M A;  3TDB A;  4URI A;  2DSW A;  2ZQT A;  3RM8 A;  2VN1 A;  4MGV A;  2MLZ A;  3KAG A;  1YW5 A;  2PPO A;  3KAF A;  1GPF A;  4ODO A;  1NH6 A;  4UDM A;  5JH8 A;  2XP9 A;  4W5U A;  1NWR A;  3O5K A;  3O5E A;  1FKF A;  4J4N A;  3BMB A;  1FKI A;  2O92 A;  3O5L A;  1NWT A;  3G6M A;  1E6P A;  3UI6 A;  4DRO A;  4U86 A;  4ZPW R;  2MNT A;  2UZ5 A;  3AS3 A;  3WD4 A;  2ZR4 A;  3IHZ A;  1ZL1 A;  3ARR A;  2KFW A;  3GPK A;  2DSZ A;  2B5U B;  1K9T A;  1FFQ A;  4G2P A;  4R5E A;  5DIV A;  3B9A A;  2ZQS A;  1A7X A;  2KGJ A;  2DSU A;  2XP4 A;  1X6L A;  1LG1 A;  1R9H A;  2IUZ A;  2P4V A;  3RM4 A;  5HKG A;  1W1Y A;  3WIJ A;  4S3K A;  4N19 A;  2PPN A;  2PV2 A;  2D9F A;  1JCH B;  1KT1 A;  2OLH A;  2DT3 A;  4JFK A;  1UR8 A;  2IF4 A;  4WJX A;  3CH9 A;  3FXY A;  2RUC A;  3ALF A;  4NNR A;  1ROU A;  3MDY B;  4DRH A;  1ZB5 A;  4KQZ A;  2F21 A;  1JNT A;  1YAT A;  2LPV A;  3WQW A;  1FKB A;  4Z2J A;  2XPB A;  1W1T A;  4QIB A;  1D7H A;  1FAP A;  3ARV A;  4C02 B;  4L3N A;  3OA5 A;  3FAP A;  3LUO A;  5GQB A;  1NMV A;  3RME A;  1WNO A;  4DZ2 A;  3WD3 A;  3PRB A;  1Y0O A;  1NWS A;  3AS0 A;  1JVW A;  3VAW A;  3KAD A;  1FJD A;  2KI3 A;  3H9R B;  1ZBV A;  1J4H A;  1IX5 A;  1XHG A;  3PRA A;  3RM9 A;  1W9V A;  2RQS A;  3BXW A;  4WKA A;  2WLZ A;  4P8U A;  1GUV A;  2WM0 A;  2AWG A;  4TYO A;  1ZBW A;  5HWC A;  3ARW A;  1BL4 A;  1ZBK A;  1J4I A;  2DG3 A;  2LJ4 A;  1CTN A;  1E9L A;  2VCD A;  3KAH A;  1M5Y A;  1ZBC A;  1E6Z A;  4NZC A;  4WKF A;  3WL0 A;  2XP5 A;  3AS2 A;  3EY6 A;  5HWB A;  4Z2L A;  4ODQ A;  2ZQU A;  1Q1C A;  4TW8 A;  2LKN A;  3EIP A;  4KR0 B;  3QOK A;  3JXV A;  4AY1 A;  1OWQ A;  3CHC A;  3O5R A;  1E44 A;  3O5G A;  3NTP A;  4DRJ A;  3PR9 A;  5DEZ A;  1JND A;  4P8X A;  4DZ3 A;  4LAX A;  3FY1 A;  4QT2 A;  3CGM A;  3CZ8 A;  2OFN A;  4MPK A;  1SYT A;  4DWS C;  2ZQV A;  4DWS B;  1SR0 A;  5HBF A;  5HTG A;  4DRM A;  4GGQ A;  4HBO A;  4JFJ A;  4DRQ A;  1X6N A;  1F8A B;  1LG2 A;  1FKD A;  3AS1 A;  4IQC A;  1D7I A;  2DG9 A;  3ODK A;  1HKJ A;  2DPE A;  2A3B A;  1EDQ A;  1EQ3 A;  1E15 A;  3IKG A;  1FKG A;  1UR9 A;  1FKR A;  4JFM A;  3ARO A;  1QZ2 A;  3TC5 A;  3IK8 A;  2XPA A;  2FDM A;  4FN2 A;  1HXV A;  5I98 A;  3WD0 A;  2WLY A;  1EYM A;  1QPF A;  3ARS A;  2ESC A;  3O5F A;  4W9P A;  3UQB A;  4LGX A;  1JNS A;  2AOS A;  4LAV A;  1KT0 A;  1HJW A;  5DIU A;  4W9Q A;  1ZU8 A;  1FFR A;  2B31 A;  1HKM A;  4ODP A;  4GIV A;  4TX0 A;  3B7X A;  4DWS A;  1QPL A;  3AQU A;  4ODK A;  4DRP A;  3NRK A;  3WKZ A;  4IPX A;  1HJV A;  4LAW A;  4ZPV R;  4MNK A;  2MPH A;  2FKE A;  3NI6 A;  4TNS A;  1NWU A;  1L1P A;  2MLY A;  4XAK A;  4U85 A;  2ZR5 A;  5HW7 A;  3UQI A;  4DT4 A;  2EUL A;  3O5O A;  3JYM A;  3PA7 A;  2A3A A;  4IT6 A;  1Q6I A;  2F23 A;  3CHF A;  2DT0 A;  4ODM A;  3O5I A;  3IKD A;  1TFV A;  4HAR A;  1LJY A;  3GTY X;  3W4R A;  4DWS D;  1PIN A;  4QT3 A;  1B6C A;  4DH0 A;  3ART A; 
#chains in the Genus database with same CATH homology
 4Z2H A;  2XP3 A;  2K8I A;  4JFL A;  1LQ0 A;  3UI5 A;  2M2A A;  1WB0 A;  3OOB A;  1NSG A;  1XRV A;  4O2T A;  3ARY A;  1W26 A;  3O5Q A;  2PV1 A;  4W9O A;  5J6E A;  2DG4 A;  2F2D A;  4HBE A;  4ML4 A;  1ROT A;  3ARX A;  1LL6 A;  3PRD A;  2MF9 A;  2PV3 A;  2RSE A;  4Q7N A;  5GPG A;  3CHD A;  4G50 A;  4JYS A;  4TW7 A;  1OGG A;  3KCE A;  4TW6 A;  2QF8 A;  2Q5A A;  1Q6U A;  3UI4 A;  3WD2 A;  2PBC A;  4P8W A;  1FKK A;  3UQA A;  1H0G A;  4MTV A;  2RUD A;  1ITX A;  3I6C A;  1FKH A;  2KE0 A;  2DSV A;  1EHN A;  2M08 A;  2XP6 A;  4ITZ A;  1LL7 A;  3TCZ A;  3B9D A;  5BXJ A;  2MLX A;  1HKK A;  3WH0 A;  2G41 A;  1D7J A;  1HJX A;  1RD6 A;  3WQV A;  1T11 A;  1FKJ A;  1O6I A;  3CGN A;  4J4O A;  3ARP A;  1D6O A;  4L72 B;  1BKF A;  1W1V A;  1HKI A;  3ARU A;  3UF8 A;  2Y78 A;  4DRK A;  3B9E A;  4WIW A;  3O5J A;  3CHE A;  4Z2G A;  4IT4 A;  1W1P A;  1FKS A;  1ZCN A;  4ODR A;  3B8S A;  4MNJ A;  4MSP A;  4ZS6 A;  5HT1 A;  4WK9 A;  1J6Y A;  2A3C A;  4Z2I A;  2XP8 A;  5HUA A;  3G6L A;  1E6R A;  4JFI A;  2PPP A;  1Q6H A;  2XP7 A;  4Q22 A;  5HW8 A;  3ARZ A;  4WKH A;  2G8Z A;  2DT1 A;  1J4R A;  1FKL A;  2YBT A;  1C9H A;  1P5Q A;  1H0I A;  2F4E A;  4FAP A;  2N87 A;  5DF0 A;  4QZV B;  4DRN A;  4NSB A;  1FD9 A;  4PTM A;  3O5P A;  5HW6 A;  1E6N A;  1WAW A;  3KAB A;  1TCO C;  1U79 A;  3RFW A;  3O5D A;  4S3J A;  2O9O A;  1N1A A;  3KZ7 A;  1GOI A;  3JYJ A;  1NMW A;  5DO2 A;  3ARQ A;  1D2K A;  1OGB A;  2RUR A;  1KFW A;  2ITK A;  4U84 A;  4DRI A;  4MNL A;  1FKT A;  2KO7 A;  4BF8 A;  1PBK A;  4MNM A;  4ODL A;  1ZK6 A;  2JZV A;  4R0X A;  4MAV A;  3RGC A;  4DIP A;  4ZPT R;  3KAC A;  1VF8 A;  3KAI A;  4ODN A;  1W9U A;  5GPR A;  2PI6 A;  4P8V A;  5D75 A;  2A3E A;  1F40 A;  2ZR6 A;  2WK2 A;  3ALG A;  4Z2K A;  5DIT A;  1LL4 A;  1W9P A;  2KR7 A;  2L2S A;  2RUQ A;  3WD1 A;  5B8I C;  3WL1 A;  1EIB A;  4LAY A;  2DT2 A;  2FAP A;  2LGO A;  1JNE A;  2M1I A;  2YBU A;  4IQ2 A;  3O5M A;  3TDB A;  4URI A;  2DSW A;  2ZQT A;  3RM8 A;  2VN1 A;  4MGV A;  2MLZ A;  3KAG A;  1YW5 A;  2PPO A;  3KAF A;  1GPF A;  4ODO A;  1NH6 A;  5JH8 A;  2XP9 A;  4W5U A;  1NWR A;  3O5K A;  3O5E A;  1FKF A;  4J4N A;  1FKI A;  2O92 A;  3O5L A;  1NWT A;  3G6M A;  1E6P A;  3UI6 A;  4DRO A;  4U86 A;  4ZPW R;  2MNT A;  2UZ5 A;  3AS3 A;  3WD4 A;  2ZR4 A;  3IHZ A;  1ZL1 A;  3ARR A;  2KFW A;  3GPK A;  2DSZ A;  1K9T A;  1FFQ A;  4G2P A;  4R5E A;  5DIV A;  3B9A A;  2ZQS A;  1A7X A;  2KGJ A;  2DSU A;  2XP4 A;  1X6L A;  1LG1 A;  1R9H A;  2IUZ A;  3RM4 A;  5HKG A;  1W1Y A;  3WIJ A;  4S3K A;  4N19 A;  2PPN A;  2PV2 A;  2D9F A;  1KT1 A;  2OLH A;  2DT3 A;  4JFK A;  1UR8 A;  2IF4 A;  4WJX A;  3CH9 A;  3FXY A;  2RUC A;  3ALF A;  4NNR A;  1ROU A;  3MDY B;  4DRH A;  1ZB5 A;  4KQZ A;  2F21 A;  1JNT A;  1YAT A;  2LPV A;  3WQW A;  1FKB A;  4Z2J A;  2XPB A;  1W1T A;  4QIB A;  1D7H A;  1FAP A;  3ARV A;  4C02 B;  4L3N A;  3OA5 A;  3FAP A;  3LUO A;  5GQB A;  1NMV A;  3RME A;  1WNO A;  4DZ2 A;  3WD3 A;  3PRB A;  1Y0O A;  1NWS A;  3AS0 A;  1JVW A;  3VAW A;  3KAD A;  1FJD A;  2KI3 A;  3H9R B;  1ZBV A;  1J4H A;  1IX5 A;  1XHG A;  3PRA A;  3RM9 A;  1W9V A;  2RQS A;  3BXW A;  4WKA A;  2WLZ A;  4P8U A;  1GUV A;  2WM0 A;  2AWG A;  4TYO A;  1ZBW A;  5HWC A;  3ARW A;  1BL4 A;  1ZBK A;  1J4I A;  2DG3 A;  2LJ4 A;  1CTN A;  1E9L A;  2VCD A;  3KAH A;  1M5Y A;  1ZBC A;  1E6Z A;  4NZC A;  4WKF A;  3WL0 A;  2XP5 A;  3AS2 A;  3EY6 A;  5HWB A;  4Z2L A;  4ODQ A;  2ZQU A;  1Q1C A;  4TW8 A;  2LKN A;  4KR0 B;  3QOK A;  3JXV A;  4AY1 A;  1OWQ A;  3CHC A;  3O5R A;  3O5G A;  3NTP A;  4DRJ A;  3PR9 A;  5DEZ A;  1JND A;  4P8X A;  4DZ3 A;  4LAX A;  3FY1 A;  4QT2 A;  3CGM A;  3CZ8 A;  2OFN A;  4MPK A;  1SYT A;  4DWS C;  2ZQV A;  4DWS B;  1SR0 A;  5HBF A;  5HTG A;  4DRM A;  4GGQ A;  4HBO A;  4JFJ A;  4DRQ A;  1X6N A;  1F8A B;  1LG2 A;  1FKD A;  3AS1 A;  4IQC A;  1D7I A;  2DG9 A;  3ODK A;  1HKJ A;  2DPE A;  2A3B A;  1EDQ A;  1EQ3 A;  1E15 A;  3IKG A;  1FKG A;  1UR9 A;  1FKR A;  4JFM A;  3ARO A;  1QZ2 A;  3TC5 A;  3IK8 A;  2XPA A;  2FDM A;  4FN2 A;  1HXV A;  5I98 A;  3WD0 A;  2WLY A;  1EYM A;  1QPF A;  3ARS A;  2ESC A;  3O5F A;  4W9P A;  3UQB A;  4LGX A;  1JNS A;  2AOS A;  4LAV A;  1KT0 A;  1HJW A;  5DIU A;  4W9Q A;  1ZU8 A;  1FFR A;  2B31 A;  1HKM A;  4ODP A;  4GIV A;  4TX0 A;  3B7X A;  4DWS A;  1QPL A;  3AQU A;  4ODK A;  4DRP A;  3NRK A;  3WKZ A;  4IPX A;  1HJV A;  4LAW A;  4ZPV R;  4MNK A;  2MPH A;  2FKE A;  3NI6 A;  4TNS A;  1NWU A;  1L1P A;  2MLY A;  4XAK A;  4U85 A;  2ZR5 A;  5HW7 A;  3UQI A;  4DT4 A;  3O5O A;  3JYM A;  3PA7 A;  2A3A A;  4IT6 A;  1Q6I A;  3CHF A;  2DT0 A;  4ODM A;  3O5I A;  3IKD A;  1TFV A;  4HAR A;  1LJY A;  3W4R A;  4DWS D;  1PIN A;  4QT3 A;  1B6C A;  4DH0 A;  3ART A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...