3O5JA

Fk1 domain of fkbp51, crystal form iii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
ATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 124
sequence length 124
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5jA00
4MGVA 4GGQA 2KFWA 5DIUA 4ODNA 4IQCA 1PBKA 5HWBA 2M08A 2MLZA 4JFMA 1FKRA 3O5OA 4QT3A 1N1AA 1YATA 3OOBA 1L1PA 1M5YA 1D7IA 2XP6A 4JFLA 3UQIA 3KABA 2PV3A 1FKDA 3NTPA 4TW7A 4W9QA 2M1IA 2ZR4A 2PPOA 1Q6UA 3O5PA 2KR7A 2RSEA 4JFIA 4ODOA 1FKSA 1PINA 2XP9A 1F8AB 4DRHA 5HW8A 3TCZA 3CGNA 3KADA 3KAHA 2KGJA 3O5IA 3WH0A 4MSPA 2DG9A 2PPPA 3O5DA 2XP8A 4J4OA 2MLYA 3NRKA 1FKJA 1J4HA 4BF8A 3UQAA 1FKBA 2F2DA 4DRKA 1A7XA 4JYSA 4LAVA 4G2PA 4QIBA 2PV2A 1FKTA 3FAPA 3KAGA 1J4IA 5HUAA 2KO7A 2FAPA 2RUQA 2VCDA 2XP7A 5HTGA 4GIVA 3UI6A 1JNSA 2M2AA 1HXVA 4C02B 3IKGA 2XPAA 2RUCA 3B7XA 2D9FA 1J4RA 1D7JA 2F4EA 5DIVA 1QZ2A 4FN2A 1ZK6A 2OFNA 2ZQSA 3KCEA 3RGCA 1FKLA 2RURA 3IK8A 1BL4A 2AWGA 5HT1A 1FKKA 2XP3A 1D7HA 3H9RB 4DIPA 4NNRA 1ROUA 4ODQA 1ROTA 4LAXA 4IQ2A 2IF4A 3O5QA 3KZ7A 5HW7A 3TDBA 3UQBA 4FAPA 2MLXA 3I6CA 2MNTA 1TCOC 2JZVA 3PA7A 4TW6A 2MF9A 2K8IA 3O5LA 1D6OA 5DITA 4DT4A 5HW6A 1FAPA 1F40A 1NMWA 4DRMA 1FKFA 1Q6HA 4U85A 2L2SA 2LGOA 4ODRA 4DRJA 2ZQVA 2DG3A 4TW8A 1BKFA 1C9HA 1B6CA 2ZR6A 1U79A 1FKIA 1FKGA 2PPNA 3UI5A 1KT1A 4G50A 2Q5AA 3CGMA 4ITZA 3KAFA 3GPKA 3UI4A 4DH0A 4DZ2A 2LPVA 3KACA 3JXVA 3PRDA 4U84A 2F21A 2XP5A 4ODPA 2XP4A 3PRBA 1ZCNA 4ODKA 3IHZA 4TX0A 1FJDA 2MPHA 3MDYB 4DZ3A 4DRQA 2KI3A 1W26A 1J6YA 2XPBA 3TC5A 1Q6IA 5BXJA 5J6EA 1EYMA 2PBCA 1R9HA 1QPFA 2ZQUA 3VAWA 4DROA 1JNTA 1NMVA 1KT0A 3O5MA 4TNSA 3O5RA 4TYOA 5D75A 4JFKA 1QPLA 2Y78A 1P5QA 3O5FA 3JYMA 5HKGA 3O5GA 5I98A 3KAIA 2DG4A 3UF8A 1FKHA 2VN1A 1T11A 2ZR5A 2LKNA 4LAYA 3EY6A 1JVWA 1Q1CA 3IKDA 1Y0OA 4R0XA 4W9OA 5HWCA 1YW5A 5GPGA 3NI6A 4U86A 2KE0A 2RUDA 2N87A 3RFWA 1EQ3A 2LJ4A 4JFJA 4W9PA 2RQSA 3O5KA 4O2TA 4DRNA 4QT2A 3ODKA 4LAWA 2ITKA 4J4NA 2FKEA 1FD9A 2ZQTA 4DRIA 4IPXA 3JYJA 5B8IC 3O5EA 3LUOA 4N19A 2PV1A 1NSGA 4ODMA 3O5JA 2UZ5A 4ODLA 4DRPA
chains in the Genus database with same CATH superfamily
4NZCA 1W9PA 5DIUA 1E6RA 1YATA 1LG1A 4L3NA 1W1TA 3UQIA 4W9QA 2EULA 2PPOA 1Q6UA 1ZBKA 1PINA 4HARA 4S3JA 4DRHA 3CGNA 3KAHA 4ZPWR 1O6IA 2DG9A 1VF8A 1FKJA 1ZBWA 3PR9A 4Z2JA 4DRKA 2F2DA 1GUVA 2FAPA 4DWSA 2VCDA 1ZBCA 2XP7A 1JNSA 4MNKA 2P4VA 1HXVA 1HKMA 3CHDA 3IKGA 4MNLA 1ZBVA 5DIVA 2B5UB 4KQZA 2ZQSA 3KCEA 3AQUA 1JNEA 3IK8A 4AY1A 5HT1A 1D7HA 3ARRA 3B9EA 4DWSB 1SR0A 4ZPTR 3O5QA 5GQBA 1OWQA 3UQBA 4IT6A 3WL1A 2JZVA 2G41A 4DT4A 3WIJA 3RMEA 1HJVA 1FKFA 1E6ZA 1ZU8A 2ZQVA 2DG3A 2ETNA 3WL0A 2ZR6A 1RD6A 1EHNA 1FKGA 3BMBA 3CH9A 1EDQA 3KACA 3PRDA 3G6MA 4TX0A 2MPHA 3MDYB 2A3AA 4DRQA 1J6YA 1QPFA 2A3BA 1JNTA 1W9VA 1KT0A 4TNSA 4TYOA 2Y78A 1P5QA 3O5FA 1OGGA 5HKGA 5JH8A 1FKHA 2ZR5A 4L72B 4MPKA 2LKNA 1GOIA 3IKDA 5HWCA 3UQAA 1YW5A 4R5EA 5GPGA 4U86A 4Z2GA 1EQ3A 3AS2A 4DRNA 4O2TA 3ARVA 4WK9A 4MTVA 2WLYA 1JCHB 4J4NA 1X6NA 4N19A 2PV1A 4DRPA 4MGVA 1W9UA 2DSWA 4IQCA 5HWBA 3RM8A 2ESCA 4JFMA 1LG2A 2B31A 4ZPVR 1L1PA 1D7IA 2WLZA 1LQ0A 3KABA 4TW7A 2M1IA 2ZR4A 4Q22A 3O5PA 2RSEA 4JFIA 4ODOA 2G8ZA 2XP9A 5DEZA 5HW8A 3KADA 2KGJA 4Z2HA 3RM4A 2DSVA 3WD0A 4Z2IA 4J4OA 2MLYA 4W5UA 4WJXA 3FY1A 1A7XA 4JYSA 4LAVA 1FFRA 4G2PA 1FKTA 1GPFA 1ITXA 3ALFA 2KO7A 4XAKA 2DPEA 5HTGA 1E44A 3ARYA 2O92A 3B7XA 2F4EA 1QZ2A 2OFNA 3RGCA 5DF0A 1BL4A 1E9LA 1NWSA 1FKKA 3H9RB 3WQWA 4DIPA 4NNRA 2PI6A 4ODQA 4LAXA 4IQ2A 3KZ7A 2DT1A 3TDBA 2DSUA 2MLXA 2MNTA 1UR8A 3WKZA 1TFVA 5DITA 3O5LA 1D6OA 1X6LA 3CHFA 1FAPA 3ARUA 4DRMA 1D2KA 1Q6HA 2YBTA 1B6CA 1U79A 2A3EA 2DSZA 2PPNA 4Z2LA 1JNDA 3GTYX 4UDMA 2Q5AA 3CGMA 4DZ2A 3GPKA 3CHCA 3JXVA 4ODPA 1H0IA 4ODKA 3FXYA 1FJDA 4DZ3A 1W26A 1OGBA 3AS1A 5J6EA 2PBCA 1HKIA 4DROA 3VAWA 3O5MA 1NMVA 1W1YA 3ARPA 3EIPA 3G6LA 5I98A 1XRVA 1NWTA 4LAYA 3EY6A 4R0XA 2N87A 3AROA 2LJ4A 3ARQA 4W9PA 2RQSA 3AS3A 4QT2A 2ITKA 2FKEA 3JYJA 3LUOA 4ODMA 3O5JA 1NH6A 4ODLA 4GGQA 2KFWA 4ODNA 3O5OA 4HBEA 1M5YA 1HKJA 2XP6A 1E6PA 4JFLA 4WKFA 1W1VA 2PV3A 1FKDA 4MAVA 1ZL1A 3TCZA 1WB0A 1H0GA 3O5DA 1HJWA 3NRKA 2YBUA 1J4HA 4QIBA 3FAPA 1J4IA 2IUZA 2RUQA 4IT4A 4GIVA 2M2AA 4C02B 1WAWA 2XPAA 4WKHA 2D9FA 3ARSA 5HBFA 4FN2A 1ZK6A 1FKLA 4P8XA 2AWGA 1CTNA 2XP3A 1XHGA 1ROUA 1ROTA 2OLHA 2IF4A 4MNMA 3I6CA 1TCOC 3PA7A 4P8UA 2K8IA 3ALGA 3QOKA 5HW6A 1F40A 4U85A 2L2SA 4ODRA 4DRJA 1BKFA 1C9HA 1E15A 1FKIA 1LL6A 1SYTA 3CHEA 4Q7NA 4PTMA 4DH0A 1LL7A 1E6NA 2XP5A 3B8SA 2XP4A 3IHZA 4LGXA 2DT0A 3W4RA 2KI3A 2XPBA 3ARWA 3WQVA 1R9HA 5D75A 4JFKA 2WK2A 3AS0A 2F23A 1NWRA 2DG4A 2VN1A 1T11A 4W9OA 1JVWA 1Q1CA 1Y0OA 3NI6A 3ARXA 4JFJA 2DT3A 3O5KA 4LAWA 1NWUA 4P8VA 1NSGA 4P8WA 3B9DA 2UZ5A 4S3KA 3RM9A 1WNOA 1PBKA 2M08A 2MLZA 1FKRA 4QT3A 1N1AA 3OOBA 4ZS6A 4DWSD 3NTPA 2KR7A 1EIBA 1FKSA 1F8AB 1K9TA 2A3CA 3O5IA 3WH0A 4MSPA 2PPPA 2XP8A 4BF8A 4URIA 1FKBA 1FFQA 4WIWA 2PV2A 2O9OA 3KAGA 5HUAA 3WD1A 2PN0A 3UI6A 1HKKA 1LL4A 2RUCA 1J4RA 1D7JA 3WD3A 2DT2A 2RURA 3WD2A 1W1PA 4WKAA 4QZVB 3ARZA 4KR0B 5HW7A 4FAPA 3ARTA 2QF8A 4TW6A 2MF9A 1NMWA 2LGOA 4TW8A 3UI5A 1KT1A 4G50A 1ZB5A 4ITZA 3KAFA 3UI4A 3PRAA 2LPVA 4MNJA 5DO2A 4U84A 2F21A 4NSBA 3PRBA 4ML4A 1ZCNA 1GRJA 2FDMA 3TC5A 1Q6IA 5BXJA 1EYMA 1KFWA 2ZQUA 1HJXA 5GPRA 3O5RA 1QPLA 4DWSC 3CZ8A 3JYMA 3GU0A 3B9AA 3O5GA 3KAIA 3UF8A 4Z2KA 1IX5A 4HBOA 1UR9A 3BXWA 3RFWA 2KE0A 2RUDA 3OA5A 3WD4A 1LJYA 2WM0A 3ODKA 4DRIA 2ZQTA 1FD9A 4IPXA 5B8IC 3O5EA 2AOSA
chains in the Genus database with same CATH topology
4NZCA 1W9PA 5DIUA 1E6RA 1YATA 1LG1A 4L3NA 1W1TA 3UQIA 4W9QA 2PPOA 1Q6UA 1ZBKA 1PINA 4HARA 4S3JA 4DRHA 3CGNA 3KAHA 4ZPWR 1O6IA 2DG9A 1VF8A 1FKJA 1ZBWA 3PR9A 4Z2JA 4DRKA 2F2DA 1GUVA 2FAPA 4DWSA 2VCDA 1ZBCA 2XP7A 1JNSA 4MNKA 1HXVA 1HKMA 3CHDA 3IKGA 4MNLA 1ZBVA 5DIVA 4KQZA 2ZQSA 3KCEA 3AQUA 1JNEA 3IK8A 4AY1A 5HT1A 1D7HA 3ARRA 3B9EA 4DWSB 1SR0A 4ZPTR 3O5QA 5GQBA 1OWQA 3UQBA 4IT6A 3WL1A 2JZVA 2G41A 4DT4A 3WIJA 3RMEA 1HJVA 1FKFA 1E6ZA 1ZU8A 2ZQVA 2DG3A 3WL0A 2ZR6A 1RD6A 1EHNA 1FKGA 3CH9A 1EDQA 3KACA 3PRDA 3G6MA 4TX0A 2MPHA 3MDYB 2A3AA 4DRQA 1J6YA 1QPFA 2A3BA 1JNTA 1W9VA 1KT0A 4TNSA 4TYOA 2Y78A 1P5QA 3O5FA 1OGGA 5HKGA 5JH8A 1FKHA 2ZR5A 4L72B 4MPKA 2LKNA 1GOIA 3IKDA 5HWCA 3UQAA 1YW5A 4R5EA 5GPGA 4U86A 4Z2GA 1EQ3A 3AS2A 4DRNA 4O2TA 3ARVA 4WK9A 4MTVA 2WLYA 4J4NA 1X6NA 4N19A 2PV1A 4DRPA 4MGVA 1W9UA 2DSWA 4IQCA 5HWBA 3RM8A 2ESCA 4JFMA 1LG2A 2B31A 4ZPVR 1L1PA 1D7IA 2WLZA 1LQ0A 3KABA 4TW7A 2M1IA 2ZR4A 4Q22A 3O5PA 2RSEA 4JFIA 4ODOA 2G8ZA 2XP9A 5DEZA 5HW8A 3KADA 2KGJA 4Z2HA 3RM4A 2DSVA 3WD0A 4Z2IA 4J4OA 2MLYA 4W5UA 4WJXA 3FY1A 1A7XA 4JYSA 4LAVA 1FFRA 4G2PA 1FKTA 1GPFA 1ITXA 3ALFA 2KO7A 4XAKA 2DPEA 5HTGA 3ARYA 2O92A 3B7XA 2F4EA 1QZ2A 2OFNA 3RGCA 5DF0A 1BL4A 1E9LA 1NWSA 1FKKA 3H9RB 3WQWA 4DIPA 4NNRA 2PI6A 4ODQA 4LAXA 4IQ2A 3KZ7A 2DT1A 3TDBA 2DSUA 2MLXA 2MNTA 1UR8A 3WKZA 1TFVA 5DITA 3O5LA 1D6OA 1X6LA 3CHFA 1FAPA 3ARUA 4DRMA 1D2KA 1Q6HA 2YBTA 1B6CA 1U79A 2A3EA 2DSZA 2PPNA 4Z2LA 1JNDA 2Q5AA 3CGMA 4DZ2A 3GPKA 3CHCA 3JXVA 4ODPA 1H0IA 4ODKA 3FXYA 1FJDA 4DZ3A 1W26A 1OGBA 3AS1A 5J6EA 2PBCA 1HKIA 4DROA 3VAWA 3O5MA 1NMVA 1W1YA 3ARPA 3G6LA 5I98A 1XRVA 1NWTA 4LAYA 3EY6A 4R0XA 2N87A 3AROA 2LJ4A 3ARQA 4W9PA 2RQSA 3AS3A 4QT2A 2ITKA 2FKEA 3JYJA 3LUOA 4ODMA 3O5JA 1NH6A 4ODLA 4GGQA 2KFWA 4ODNA 3O5OA 4HBEA 1M5YA 1HKJA 2XP6A 1E6PA 4JFLA 4WKFA 1W1VA 2PV3A 1FKDA 4MAVA 1ZL1A 3TCZA 1WB0A 1H0GA 3O5DA 1HJWA 3NRKA 2YBUA 1J4HA 4QIBA 3FAPA 1J4IA 2IUZA 2RUQA 4IT4A 4GIVA 2M2AA 4C02B 1WAWA 2XPAA 4WKHA 2D9FA 3ARSA 5HBFA 4FN2A 1ZK6A 1FKLA 4P8XA 2AWGA 1CTNA 2XP3A 1XHGA 1ROUA 1ROTA 2OLHA 2IF4A 4MNMA 3I6CA 1TCOC 3PA7A 4P8UA 2K8IA 3ALGA 3QOKA 5HW6A 1F40A 4U85A 2L2SA 4ODRA 4DRJA 1BKFA 1C9HA 1E15A 1FKIA 1LL6A 1SYTA 3CHEA 4Q7NA 4PTMA 4DH0A 1LL7A 1E6NA 2XP5A 3B8SA 2XP4A 3IHZA 4LGXA 2DT0A 3W4RA 2KI3A 2XPBA 3ARWA 3WQVA 1R9HA 5D75A 4JFKA 2WK2A 3AS0A 1NWRA 2DG4A 2VN1A 1T11A 4W9OA 1JVWA 1Q1CA 1Y0OA 3NI6A 3ARXA 4JFJA 2DT3A 3O5KA 4LAWA 1NWUA 4P8VA 1NSGA 4P8WA 3B9DA 2UZ5A 4S3KA 3RM9A 1WNOA 1PBKA 2M08A 2MLZA 1FKRA 4QT3A 1N1AA 3OOBA 4ZS6A 4DWSD 3NTPA 2KR7A 1EIBA 1FKSA 1F8AB 1K9TA 2A3CA 3O5IA 3WH0A 4MSPA 2PPPA 2XP8A 4BF8A 4URIA 1FKBA 1FFQA 4WIWA 2PV2A 2O9OA 3KAGA 5HUAA 3WD1A 3UI6A 1HKKA 1LL4A 2RUCA 1J4RA 1D7JA 3WD3A 2DT2A 2RURA 3WD2A 1W1PA 4WKAA 4QZVB 3ARZA 4KR0B 5HW7A 4FAPA 3ARTA 2QF8A 4TW6A 2MF9A 1NMWA 2LGOA 4TW8A 3UI5A 1KT1A 4G50A 1ZB5A 4ITZA 3KAFA 3UI4A 3PRAA 2LPVA 4MNJA 5DO2A 4U84A 2F21A 4NSBA 3PRBA 4ML4A 1ZCNA 2FDMA 3TC5A 1Q6IA 5BXJA 1EYMA 1KFWA 2ZQUA 1HJXA 5GPRA 3O5RA 1QPLA 4DWSC 3CZ8A 3JYMA 3B9AA 3O5GA 3KAIA 3UF8A 4Z2KA 1IX5A 4HBOA 1UR9A 3BXWA 3RFWA 2KE0A 2RUDA 3OA5A 3WD4A 1LJYA 2WM0A 3ODKA 4DRIA 2ZQTA 1FD9A 4IPXA 5B8IC 3O5EA 2AOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MGV A;  4GGQ A;  2KFW A;  5DIU A;  4ODN A;  4IQC A;  1PBK A;  5HWB A;  2M08 A;  2MLZ A;  4JFM A;  1FKR A;  3O5O A;  4QT3 A;  1N1A A;  1YAT A;  3OOB A;  1L1P A;  1M5Y A;  1D7I A;  2XP6 A;  4JFL A;  3UQI A;  3KAB A;  2PV3 A;  1FKD A;  3NTP A;  4TW7 A;  4W9Q A;  2M1I A;  2ZR4 A;  2PPO A;  1Q6U A;  3O5P A;  2KR7 A;  2RSE A;  4JFI A;  4ODO A;  1FKS A;  1PIN A;  2XP9 A;  1F8A B;  4DRH A;  5HW8 A;  3TCZ A;  3CGN A;  3KAD A;  3KAH A;  2KGJ A;  3O5I A;  3WH0 A;  4MSP A;  2DG9 A;  2PPP A;  3O5D A;  2XP8 A;  4J4O A;  2MLY A;  3NRK A;  1FKJ A;  1J4H A;  4BF8 A;  3UQA A;  1FKB A;  2F2D A;  4DRK A;  1A7X A;  4JYS A;  4LAV A;  4G2P A;  4QIB A;  2PV2 A;  1FKT A;  3FAP A;  3KAG A;  1J4I A;  5HUA A;  2KO7 A;  2FAP A;  2RUQ A;  2VCD A;  2XP7 A;  5HTG A;  4GIV A;  3UI6 A;  1JNS A;  2M2A A;  1HXV A;  4C02 B;  3IKG A;  2XPA A;  2RUC A;  3B7X A;  2D9F A;  1J4R A;  1D7J A;  2F4E A;  5DIV A;  1QZ2 A;  4FN2 A;  1ZK6 A;  2OFN A;  2ZQS A;  3KCE A;  3RGC A;  1FKL A;  2RUR A;  3IK8 A;  1BL4 A;  2AWG A;  5HT1 A;  1FKK A;  2XP3 A;  1D7H A;  3H9R B;  4DIP A;  4NNR A;  1ROU A;  4ODQ A;  1ROT A;  4LAX A;  4IQ2 A;  2IF4 A;  3O5Q A;  3KZ7 A;  5HW7 A;  3TDB A;  3UQB A;  4FAP A;  2MLX A;  3I6C A;  2MNT A;  1TCO C;  2JZV A;  3PA7 A;  4TW6 A;  2MF9 A;  2K8I A;  3O5L A;  1D6O A;  5DIT A;  4DT4 A;  5HW6 A;  1FAP A;  1F40 A;  1NMW A;  4DRM A;  1FKF A;  1Q6H A;  4U85 A;  2L2S A;  2LGO A;  4ODR A;  4DRJ A;  2ZQV A;  2DG3 A;  4TW8 A;  1BKF A;  1C9H A;  1B6C A;  2ZR6 A;  1U79 A;  1FKI A;  1FKG A;  2PPN A;  3UI5 A;  1KT1 A;  4G50 A;  2Q5A A;  3CGM A;  4ITZ A;  3KAF A;  3GPK A;  3UI4 A;  4DH0 A;  4DZ2 A;  2LPV A;  3KAC A;  3JXV A;  3PRD A;  4U84 A;  2F21 A;  2XP5 A;  4ODP A;  2XP4 A;  3PRB A;  1ZCN A;  4ODK A;  3IHZ A;  4TX0 A;  1FJD A;  2MPH A;  3MDY B;  4DZ3 A;  4DRQ A;  2KI3 A;  1W26 A;  1J6Y A;  2XPB A;  3TC5 A;  1Q6I A;  5BXJ A;  5J6E A;  1EYM A;  2PBC A;  1R9H A;  1QPF A;  2ZQU A;  3VAW A;  4DRO A;  1JNT A;  1NMV A;  1KT0 A;  3O5M A;  4TNS A;  3O5R A;  4TYO A;  5D75 A;  4JFK A;  1QPL A;  2Y78 A;  1P5Q A;  3O5F A;  3JYM A;  5HKG A;  3O5G A;  5I98 A;  3KAI A;  2DG4 A;  3UF8 A;  1FKH A;  2VN1 A;  1T11 A;  2ZR5 A;  2LKN A;  4LAY A;  3EY6 A;  1JVW A;  1Q1C A;  3IKD A;  1Y0O A;  4R0X A;  4W9O A;  5HWC A;  1YW5 A;  5GPG A;  3NI6 A;  4U86 A;  2KE0 A;  2RUD A;  2N87 A;  3RFW A;  1EQ3 A;  2LJ4 A;  4JFJ A;  4W9P A;  2RQS A;  3O5K A;  4O2T A;  4DRN A;  4QT2 A;  3ODK A;  4LAW A;  2ITK A;  4J4N A;  2FKE A;  1FD9 A;  2ZQT A;  4DRI A;  4IPX A;  3JYJ A;  5B8I C;  3O5E A;  3LUO A;  4N19 A;  2PV1 A;  1NSG A;  4ODM A;  3O5J A;  2UZ5 A;  4ODL A;  4DRP A; 
#chains in the Genus database with same CATH topology
 4NZC A;  1W9P A;  5DIU A;  1E6R A;  1YAT A;  1LG1 A;  4L3N A;  1W1T A;  3UQI A;  4W9Q A;  2EUL A;  2PPO A;  1Q6U A;  1ZBK A;  1PIN A;  4HAR A;  4S3J A;  4DRH A;  3CGN A;  3KAH A;  4ZPW R;  1O6I A;  2DG9 A;  1VF8 A;  1FKJ A;  1ZBW A;  3PR9 A;  4Z2J A;  4DRK A;  2F2D A;  1GUV A;  2FAP A;  4DWS A;  2VCD A;  1ZBC A;  2XP7 A;  1JNS A;  4MNK A;  2P4V A;  1HXV A;  1HKM A;  3CHD A;  3IKG A;  4MNL A;  1ZBV A;  5DIV A;  2B5U B;  4KQZ A;  2ZQS A;  3KCE A;  3AQU A;  1JNE A;  3IK8 A;  4AY1 A;  5HT1 A;  1D7H A;  3ARR A;  3B9E A;  4DWS B;  1SR0 A;  4ZPT R;  3O5Q A;  5GQB A;  1OWQ A;  3UQB A;  4IT6 A;  3WL1 A;  2JZV A;  2G41 A;  4DT4 A;  3WIJ A;  3RME A;  1HJV A;  1FKF A;  1E6Z A;  1ZU8 A;  2ZQV A;  2DG3 A;  2ETN A;  3WL0 A;  2ZR6 A;  1RD6 A;  1EHN A;  1FKG A;  3BMB A;  3CH9 A;  1EDQ A;  3KAC A;  3PRD A;  3G6M A;  4TX0 A;  2MPH A;  3MDY B;  2A3A A;  4DRQ A;  1J6Y A;  1QPF A;  2A3B A;  1JNT A;  1W9V A;  1KT0 A;  4TNS A;  4TYO A;  2Y78 A;  1P5Q A;  3O5F A;  1OGG A;  5HKG A;  5JH8 A;  1FKH A;  2ZR5 A;  4L72 B;  4MPK A;  2LKN A;  1GOI A;  3IKD A;  5HWC A;  3UQA A;  1YW5 A;  4R5E A;  5GPG A;  4U86 A;  4Z2G A;  1EQ3 A;  3AS2 A;  4DRN A;  4O2T A;  3ARV A;  4WK9 A;  4MTV A;  2WLY A;  1JCH B;  4J4N A;  1X6N A;  4N19 A;  2PV1 A;  4DRP A;  4MGV A;  1W9U A;  2DSW A;  4IQC A;  5HWB A;  3RM8 A;  2ESC A;  4JFM A;  1LG2 A;  2B31 A;  4ZPV R;  1L1P A;  1D7I A;  2WLZ A;  1LQ0 A;  3KAB A;  4TW7 A;  2M1I A;  2ZR4 A;  4Q22 A;  3O5P A;  2RSE A;  4JFI A;  4ODO A;  2G8Z A;  2XP9 A;  5DEZ A;  5HW8 A;  3KAD A;  2KGJ A;  4Z2H A;  3RM4 A;  2DSV A;  3WD0 A;  4Z2I A;  4J4O A;  2MLY A;  4W5U A;  4WJX A;  3FY1 A;  1A7X A;  4JYS A;  4LAV A;  1FFR A;  4G2P A;  1FKT A;  1GPF A;  1ITX A;  3ALF A;  2KO7 A;  4XAK A;  2DPE A;  5HTG A;  1E44 A;  3ARY A;  2O92 A;  3B7X A;  2F4E A;  1QZ2 A;  2OFN A;  3RGC A;  5DF0 A;  1BL4 A;  1E9L A;  1NWS A;  1FKK A;  3H9R B;  3WQW A;  4DIP A;  4NNR A;  2PI6 A;  4ODQ A;  4LAX A;  4IQ2 A;  3KZ7 A;  2DT1 A;  3TDB A;  2DSU A;  2MLX A;  2MNT A;  1UR8 A;  3WKZ A;  1TFV A;  5DIT A;  3O5L A;  1D6O A;  1X6L A;  3CHF A;  1FAP A;  3ARU A;  4DRM A;  1D2K A;  1Q6H A;  2YBT A;  1B6C A;  1U79 A;  2A3E A;  2DSZ A;  2PPN A;  4Z2L A;  1JND A;  3GTY X;  4UDM A;  2Q5A A;  3CGM A;  4DZ2 A;  3GPK A;  3CHC A;  3JXV A;  4ODP A;  1H0I A;  4ODK A;  3FXY A;  1FJD A;  4DZ3 A;  1W26 A;  1OGB A;  3AS1 A;  5J6E A;  2PBC A;  1HKI A;  4DRO A;  3VAW A;  3O5M A;  1NMV A;  1W1Y A;  3ARP A;  3EIP A;  3G6L A;  5I98 A;  1XRV A;  1NWT A;  4LAY A;  3EY6 A;  4R0X A;  2N87 A;  3ARO A;  2LJ4 A;  3ARQ A;  4W9P A;  2RQS A;  3AS3 A;  4QT2 A;  2ITK A;  2FKE A;  3JYJ A;  3LUO A;  4ODM A;  3O5J A;  1NH6 A;  4ODL A;  4GGQ A;  2KFW A;  4ODN A;  3O5O A;  4HBE A;  1M5Y A;  1HKJ A;  2XP6 A;  1E6P A;  4JFL A;  4WKF A;  1W1V A;  2PV3 A;  1FKD A;  4MAV A;  1ZL1 A;  3TCZ A;  1WB0 A;  1H0G A;  3O5D A;  1HJW A;  3NRK A;  2YBU A;  1J4H A;  4QIB A;  3FAP A;  1J4I A;  2IUZ A;  2RUQ A;  4IT4 A;  4GIV A;  2M2A A;  4C02 B;  1WAW A;  2XPA A;  4WKH A;  2D9F A;  3ARS A;  5HBF A;  4FN2 A;  1ZK6 A;  1FKL A;  4P8X A;  2AWG A;  1CTN A;  2XP3 A;  1XHG A;  1ROU A;  1ROT A;  2OLH A;  2IF4 A;  4MNM A;  3I6C A;  1TCO C;  3PA7 A;  4P8U A;  2K8I A;  3ALG A;  3QOK A;  5HW6 A;  1F40 A;  4U85 A;  2L2S A;  4ODR A;  4DRJ A;  1BKF A;  1C9H A;  1E15 A;  1FKI A;  1LL6 A;  1SYT A;  3CHE A;  4Q7N A;  4PTM A;  4DH0 A;  1LL7 A;  1E6N A;  2XP5 A;  3B8S A;  2XP4 A;  3IHZ A;  4LGX A;  2DT0 A;  3W4R A;  2KI3 A;  2XPB A;  3ARW A;  3WQV A;  1R9H A;  5D75 A;  4JFK A;  2WK2 A;  3AS0 A;  2F23 A;  1NWR A;  2DG4 A;  2VN1 A;  1T11 A;  4W9O A;  1JVW A;  1Q1C A;  1Y0O A;  3NI6 A;  3ARX A;  4JFJ A;  2DT3 A;  3O5K A;  4LAW A;  1NWU A;  4P8V A;  1NSG A;  4P8W A;  3B9D A;  2UZ5 A;  4S3K A;  3RM9 A;  1WNO A;  1PBK A;  2M08 A;  2MLZ A;  1FKR A;  4QT3 A;  1N1A A;  3OOB A;  4ZS6 A;  4DWS D;  3NTP A;  2KR7 A;  1EIB A;  1FKS A;  1F8A B;  1K9T A;  2A3C A;  3O5I A;  3WH0 A;  4MSP A;  2PPP A;  2XP8 A;  4BF8 A;  4URI A;  1FKB A;  1FFQ A;  4WIW A;  2PV2 A;  2O9O A;  3KAG A;  5HUA A;  3WD1 A;  2PN0 A;  3UI6 A;  1HKK A;  1LL4 A;  2RUC A;  1J4R A;  1D7J A;  3WD3 A;  2DT2 A;  2RUR A;  3WD2 A;  1W1P A;  4WKA A;  4QZV B;  3ARZ A;  4KR0 B;  5HW7 A;  4FAP A;  3ART A;  2QF8 A;  4TW6 A;  2MF9 A;  1NMW A;  2LGO A;  4TW8 A;  3UI5 A;  1KT1 A;  4G50 A;  1ZB5 A;  4ITZ A;  3KAF A;  3UI4 A;  3PRA A;  2LPV A;  4MNJ A;  5DO2 A;  4U84 A;  2F21 A;  4NSB A;  3PRB A;  4ML4 A;  1ZCN A;  1GRJ A;  2FDM A;  3TC5 A;  1Q6I A;  5BXJ A;  1EYM A;  1KFW A;  2ZQU A;  1HJX A;  5GPR A;  3O5R A;  1QPL A;  4DWS C;  3CZ8 A;  3JYM A;  3GU0 A;  3B9A A;  3O5G A;  3KAI A;  3UF8 A;  4Z2K A;  1IX5 A;  4HBO A;  1UR9 A;  3BXW A;  3RFW A;  2KE0 A;  2RUD A;  3OA5 A;  3WD4 A;  1LJY A;  2WM0 A;  3ODK A;  4DRI A;  2ZQT A;  1FD9 A;  4IPX A;  5B8I C;  3O5E A;  2AOS A; 
#chains in the Genus database with same CATH homology
 4NZC A;  1W9P A;  5DIU A;  1E6R A;  1YAT A;  1LG1 A;  4L3N A;  1W1T A;  3UQI A;  4W9Q A;  2PPO A;  1Q6U A;  1ZBK A;  1PIN A;  4HAR A;  4S3J A;  4DRH A;  3CGN A;  3KAH A;  4ZPW R;  1O6I A;  2DG9 A;  1VF8 A;  1FKJ A;  1ZBW A;  3PR9 A;  4Z2J A;  4DRK A;  2F2D A;  1GUV A;  2FAP A;  4DWS A;  2VCD A;  1ZBC A;  2XP7 A;  1JNS A;  4MNK A;  1HXV A;  1HKM A;  3CHD A;  3IKG A;  4MNL A;  1ZBV A;  5DIV A;  4KQZ A;  2ZQS A;  3KCE A;  3AQU A;  1JNE A;  3IK8 A;  4AY1 A;  5HT1 A;  1D7H A;  3ARR A;  3B9E A;  4DWS B;  1SR0 A;  4ZPT R;  3O5Q A;  5GQB A;  1OWQ A;  3UQB A;  4IT6 A;  3WL1 A;  2JZV A;  2G41 A;  4DT4 A;  3WIJ A;  3RME A;  1HJV A;  1FKF A;  1E6Z A;  1ZU8 A;  2ZQV A;  2DG3 A;  3WL0 A;  2ZR6 A;  1RD6 A;  1EHN A;  1FKG A;  3CH9 A;  1EDQ A;  3KAC A;  3PRD A;  3G6M A;  4TX0 A;  2MPH A;  3MDY B;  2A3A A;  4DRQ A;  1J6Y A;  1QPF A;  2A3B A;  1JNT A;  1W9V A;  1KT0 A;  4TNS A;  4TYO A;  2Y78 A;  1P5Q A;  3O5F A;  1OGG A;  5HKG A;  5JH8 A;  1FKH A;  2ZR5 A;  4L72 B;  4MPK A;  2LKN A;  1GOI A;  3IKD A;  5HWC A;  3UQA A;  1YW5 A;  4R5E A;  5GPG A;  4U86 A;  4Z2G A;  1EQ3 A;  3AS2 A;  4DRN A;  4O2T A;  3ARV A;  4WK9 A;  4MTV A;  2WLY A;  4J4N A;  1X6N A;  4N19 A;  2PV1 A;  4DRP A;  4MGV A;  1W9U A;  2DSW A;  4IQC A;  5HWB A;  3RM8 A;  2ESC A;  4JFM A;  1LG2 A;  2B31 A;  4ZPV R;  1L1P A;  1D7I A;  2WLZ A;  1LQ0 A;  3KAB A;  4TW7 A;  2M1I A;  2ZR4 A;  4Q22 A;  3O5P A;  2RSE A;  4JFI A;  4ODO A;  2G8Z A;  2XP9 A;  5DEZ A;  5HW8 A;  3KAD A;  2KGJ A;  4Z2H A;  3RM4 A;  2DSV A;  3WD0 A;  4Z2I A;  4J4O A;  2MLY A;  4W5U A;  4WJX A;  3FY1 A;  1A7X A;  4JYS A;  4LAV A;  1FFR A;  4G2P A;  1FKT A;  1GPF A;  1ITX A;  3ALF A;  2KO7 A;  4XAK A;  2DPE A;  5HTG A;  3ARY A;  2O92 A;  3B7X A;  2F4E A;  1QZ2 A;  2OFN A;  3RGC A;  5DF0 A;  1BL4 A;  1E9L A;  1NWS A;  1FKK A;  3H9R B;  3WQW A;  4DIP A;  4NNR A;  2PI6 A;  4ODQ A;  4LAX A;  4IQ2 A;  3KZ7 A;  2DT1 A;  3TDB A;  2DSU A;  2MLX A;  2MNT A;  1UR8 A;  3WKZ A;  1TFV A;  5DIT A;  3O5L A;  1D6O A;  1X6L A;  3CHF A;  1FAP A;  3ARU A;  4DRM A;  1D2K A;  1Q6H A;  2YBT A;  1B6C A;  1U79 A;  2A3E A;  2DSZ A;  2PPN A;  4Z2L A;  1JND A;  2Q5A A;  3CGM A;  4DZ2 A;  3GPK A;  3CHC A;  3JXV A;  4ODP A;  1H0I A;  4ODK A;  3FXY A;  1FJD A;  4DZ3 A;  1W26 A;  1OGB A;  3AS1 A;  5J6E A;  2PBC A;  1HKI A;  4DRO A;  3VAW A;  3O5M A;  1NMV A;  1W1Y A;  3ARP A;  3G6L A;  5I98 A;  1XRV A;  1NWT A;  4LAY A;  3EY6 A;  4R0X A;  2N87 A;  3ARO A;  2LJ4 A;  3ARQ A;  4W9P A;  2RQS A;  3AS3 A;  4QT2 A;  2ITK A;  2FKE A;  3JYJ A;  3LUO A;  4ODM A;  3O5J A;  1NH6 A;  4ODL A;  4GGQ A;  2KFW A;  4ODN A;  3O5O A;  4HBE A;  1M5Y A;  1HKJ A;  2XP6 A;  1E6P A;  4JFL A;  4WKF A;  1W1V A;  2PV3 A;  1FKD A;  4MAV A;  1ZL1 A;  3TCZ A;  1WB0 A;  1H0G A;  3O5D A;  1HJW A;  3NRK A;  2YBU A;  1J4H A;  4QIB A;  3FAP A;  1J4I A;  2IUZ A;  2RUQ A;  4IT4 A;  4GIV A;  2M2A A;  4C02 B;  1WAW A;  2XPA A;  4WKH A;  2D9F A;  3ARS A;  5HBF A;  4FN2 A;  1ZK6 A;  1FKL A;  4P8X A;  2AWG A;  1CTN A;  2XP3 A;  1XHG A;  1ROU A;  1ROT A;  2OLH A;  2IF4 A;  4MNM A;  3I6C A;  1TCO C;  3PA7 A;  4P8U A;  2K8I A;  3ALG A;  3QOK A;  5HW6 A;  1F40 A;  4U85 A;  2L2S A;  4ODR A;  4DRJ A;  1BKF A;  1C9H A;  1E15 A;  1FKI A;  1LL6 A;  1SYT A;  3CHE A;  4Q7N A;  4PTM A;  4DH0 A;  1LL7 A;  1E6N A;  2XP5 A;  3B8S A;  2XP4 A;  3IHZ A;  4LGX A;  2DT0 A;  3W4R A;  2KI3 A;  2XPB A;  3ARW A;  3WQV A;  1R9H A;  5D75 A;  4JFK A;  2WK2 A;  3AS0 A;  1NWR A;  2DG4 A;  2VN1 A;  1T11 A;  4W9O A;  1JVW A;  1Q1C A;  1Y0O A;  3NI6 A;  3ARX A;  4JFJ A;  2DT3 A;  3O5K A;  4LAW A;  1NWU A;  4P8V A;  1NSG A;  4P8W A;  3B9D A;  2UZ5 A;  4S3K A;  3RM9 A;  1WNO A;  1PBK A;  2M08 A;  2MLZ A;  1FKR A;  4QT3 A;  1N1A A;  3OOB A;  4ZS6 A;  4DWS D;  3NTP A;  2KR7 A;  1EIB A;  1FKS A;  1F8A B;  1K9T A;  2A3C A;  3O5I A;  3WH0 A;  4MSP A;  2PPP A;  2XP8 A;  4BF8 A;  4URI A;  1FKB A;  1FFQ A;  4WIW A;  2PV2 A;  2O9O A;  3KAG A;  5HUA A;  3WD1 A;  3UI6 A;  1HKK A;  1LL4 A;  2RUC A;  1J4R A;  1D7J A;  3WD3 A;  2DT2 A;  2RUR A;  3WD2 A;  1W1P A;  4WKA A;  4QZV B;  3ARZ A;  4KR0 B;  5HW7 A;  4FAP A;  3ART A;  2QF8 A;  4TW6 A;  2MF9 A;  1NMW A;  2LGO A;  4TW8 A;  3UI5 A;  1KT1 A;  4G50 A;  1ZB5 A;  4ITZ A;  3KAF A;  3UI4 A;  3PRA A;  2LPV A;  4MNJ A;  5DO2 A;  4U84 A;  2F21 A;  4NSB A;  3PRB A;  4ML4 A;  1ZCN A;  2FDM A;  3TC5 A;  1Q6I A;  5BXJ A;  1EYM A;  1KFW A;  2ZQU A;  1HJX A;  5GPR A;  3O5R A;  1QPL A;  4DWS C;  3CZ8 A;  3JYM A;  3B9A A;  3O5G A;  3KAI A;  3UF8 A;  4Z2K A;  1IX5 A;  4HBO A;  1UR9 A;  3BXW A;  3RFW A;  2KE0 A;  2RUD A;  3OA5 A;  3WD4 A;  1LJY A;  2WM0 A;  3ODK A;  4DRI A;  2ZQT A;  1FD9 A;  4IPX A;  5B8I C;  3O5E A;  2AOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...