3O5JA

Fk1 domain of fkbp51, crystal form iii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
b'ATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 31
structure length 124
sequence length 124
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5jA00
2K8IA 1D7HA 3O5JA 1JVWA 2XP7A 4MGVA 2KR7A 5HTGA 2FAPA 1QPLA 1FD9A 3ODKA 1D7IA 2RUQA 2RSEA 4ODMA 1W26A 1FKKA 3O5PA 4TNSA 2LJ4A 4DRMA 4ODLA 1T11A 4DRIA 4TW8A 2XPAA 4NNRA 2FKEA 5D75A 3UI4A 2N87A 2XP9A 2KFWA 2VCDA 1PBKA 2ZQUA 3CGNA 2KO7A 3H9RB 1NMWA 1QZ2A 2MLYA 2M1IA 4W9QA 4DROA 3LUOA 4JYSA 4DZ3A 4W9PA 3IK8A 3JXVA 1U79A 1KT0A 3KCEA 4DRHA 1KT1A 2KE0A 4TW7A 3PRBA 3O5KA 2ZR4A 2RUDA 1F40A 5HWBA 3KAFA 3GPKA 4ODNA 4R0XA 1M5YA 2Q5AA 3KADA 3O5GA 4W9OA 4GGQA 3TCZA 3TDBA 3VAWA 1P5QA 3UI5A 1NSGA 5HUAA 4LAXA 2LGOA 3RFWA 4LAVA 2DG3A 2DG9A 3WH0A 2ZR6A 5DIVA 4U84A 3KAIA 1FKRA 3TC5A 2L2SA 2AWGA 3MDYB 3UQIA 1FKSA 4DH0A 5HWCA 1Q1CA 2PPOA 2RUCA 4N19A 1FKTA 1Y0OA 3O5MA 5HW6A 2RURA 2ITKA 4TYOA 2F21A 3IKGA 3O5FA 4DRQA 3I6CA 2ZQSA 3UI6A 2PV1A 2F4EA 3IKDA 4IQ2A 2Y78A 4BF8A 1Q6UA 4G2PA 2KI3A 4O2TA 3KABA 3O5RA 5BXJA 4FN2A 1B6CA 2PV3A 4JFJA 4DT4A 3UQBA 2XP4A 2JZVA 3IHZA 5B8IC 2PV2A 4ODKA 2XP8A 2XP6A 1YATA 4DRKA 2M08A 4ODOA 1FKLA 2IF4A 3RGCA 3O5EA 4TW6A 1ROUA 3PA7A 5I98A 2F2DA 4LAWA 1FKIA 1D6OA 2PPNA 3EY6A 4U86A 5HW8A 1EQ3A 2VN1A 2ZR5A 4LAYA 1L1PA 1Q6HA 3O5LA 3O5DA 1ZK6A 2ZQTA 4ODQA 4DRNA 1EYMA 2LKNA 4J4OA 3KAHA 1R9HA 2XP5A 2M2AA 1J6YA 1N1AA 3O5QA 4DZ2A 1TCOC 1J4RA 2XP3A 3JYJA 5J6EA 1JNTA 1FKGA 4JFIA 4IPXA 2PBCA 2PPPA 3O5IA 2MF9A 5HT1A 1C9HA 1FKJA 1ZCNA 4J4NA 1Q6IA 2LPVA 4ODRA 4ITZA 2UZ5A 1PINA 3KACA 1FKDA 1FJDA 1HXVA 1FKBA 3CGMA 2MNTA 4GIVA 4DRJA 4JFLA 1NMVA 5DITA 2MLXA 2MLZA 1BL4A 2D9FA 3B7XA 1A7XA 2MPHA 3O5OA 4IQCA 1J4IA 3UF8A 1JNSA 5GPGA 4JFMA 1FAPA 2KGJA 3NRKA 3PRDA 2XPBA 4ODPA 1FKFA 2DG4A 4QT2A 1ROTA 4C02B 4DRPA 1F8AB 1BKFA 1QPFA 4QT3A 4G50A 3JYMA 5HW7A 4DIPA 4FAPA 1D7JA 3NTPA 4MSPA 1FKHA 5DIUA 3FAPA 2ZQVA 2RQSA 4QIBA 1YW5A 1J4HA 2OFNA 3UQAA 4JFKA 5HKGA 3OOBA 4TX0A 3KZ7A 3KAGA 3NI6A 4U85A
chains in the Genus database with same CATH superfamily
2K8IA 1HKKA 2XP7A 2FAPA 1FD9A 1D7IA 2A3CA 2RSEA 2YBUA 4ODMA 4TNSA 2LJ4A 4DRIA 4TW8A 2FKEA 5HUAA 3RFWA 1PBKA 3RM9A 4W9QA 3LUOA 4W9PA 1HKMA 4W5UA 3JXVA 3KCEA 1KT0A 1SR0A 1JCHB 3ARYA 4NSBA 3O5KA 3CHFA 2PI6A 2B31A 3KADA 1JNEA 3TCZA 1LJYA 2WM0A 3UI5A 1NSGA 1FFQA 1ZBWA 2ZR6A 3KAIA 3MDYB 1H0GA 3O5MA 1FFRA 4TYOA 1GRJA 2ZQSA 3UI6A 2DSVA 1E9LA 2PV1A 4IQ2A 2KI3A 4FN2A 1B6CA 5HBFA 1NH6A 4DRKA 2IF4A 1FKIA 1GUVA 3EY6A 3RM8A 5HW8A 3WD0A 1Q6HA 3CHEA 3G6MA 1HKIA 2M2AA 4L3NA 3JYJA 1J4RA 4MNJA 3CH9A 5J6EA 3WL1A 2G41A 1FKJA 4J4NA 3G6LA 1E6ZA 1ZBCA 2LPVA 3B8SA 2UZ5A 1PINA 1HXVA 1HJXA 1FJDA 2OLHA 1FKBA 1CTNA 4DRJA 2YBTA 1E15A 1W1VA 1HKJA 3BXWA 3WQVA 1LL6A 1XRVA 4JFMA 1FAPA 3NRKA 1NWRA 4ZS6A 4ZPWR 3EIPA 4HARA 3WD1A 2DT1A 1BKFA 2AOSA 5HW7A 3WD4A 2IUZA 3WD2A 2ZQVA 4Z2LA 2DT3A 4NZCA 3FXYA 4TX0A 4Z2KA 3RM4A 3KZ7A 3O5JA 4WIWA 4MGVA 4MTVA 1W26A 3AROA 3O5PA 4UDMA 4ODLA 1T11A 5GQBA 2P4VA 4DWSD 5D75A 2XP9A 3H9RB 2KO7A 1QZ2A 3ARXA 2ZR4A 1WNOA 1E6RA 1UR8A 3GPKA 3VAWA 4GGQA 3ALFA 4IT6A 4LAXA 4LAVA 2DG9A 3WH0A 5DIVA 4U84A 3GTYX 3TC5A 3UQIA 4DH0A 4N19A 4MNLA 1FKTA 1Y0OA 1EIBA 3ARVA 3I6CA 5JH8A 3IKDA 3WIJA 3CHCA 3UQBA 4HBOA 2XP4A 3IHZA 2XP8A 1YATA 4ODOA 4WKAA 3O5EA 4TW6A 5I98A 2F2DA 1X6NA 2ZR5A 4LAYA 1ZK6A 2QF8A 2ZQTA 3PR9A 3RMEA 2DSZA 2LKNA 3KAHA 2XP5A 4DZ2A 1W1YA 1FKGA 4JFIA 2MF9A 2DT2A 1OGGA 1X6LA 1Q6IA 1H0IA 3FY1A 4Z2IA 4GIVA 4P8XA 4ZPTR 5DITA 2MLXA 3B7XA 1BL4A 2D9FA 1A7XA 4Q22A 1JNSA 2KGJA 4ODPA 2XPBA 1FKFA 2DG4A 1ROTA 4C02B 5DF0A 2A3AA 2WK2A 4DIPA 4KR0B 5DIUA 4MAVA 1LG2A 4JFKA 3GU0A 3OOBA 3NI6A 4MNMA 1D7HA 1JVWA 3ARWA 4MPKA 3UQAA 5HTGA 2RUQA 1FKKA 1UR9A 1W1TA 4DRMA 1O6IA 3UI4A 2VCDA 4DROA 4JYSA 4DZ3A 2RUDA 2DSWA 4QZVB 1F40A 5HWBA 2FDMA 1WB0A 2B5UB 4WK9A 4ODNA 4R0XA 1M5YA 1LG1A 1GPFA 4W9OA 2O9OA 4S3KA 4P8VA 2DG3A 3CHDA 4S3JA 1IX5A 1FKSA 5HWCA 1Q1CA 4DWSC 2RUCA 4AY1A 5HW6A 1KFWA 3IKGA 3O5FA 2F4EA 2Y78A 5DEZA 1ZU8A 2PV3A 2EULA 1ZBVA 4ODKA 3AS2A 2M08A 3ARTA 2A3EA 1ROUA 3AQUA 3PA7A 1ZL1A 4LAWA 1D6OA 3ARZA 2PPNA 3WQWA 4U86A 4Z2JA 1EQ3A 2VN1A 3CZ8A 2DPEA 3W4RA 3O5LA 3O5DA 2WLZA 4ODQA 4DRNA 1EYMA 4J4OA 1J6YA 3O5QA 1TCOC 3BMBA 3WKZA 3O5IA 4WJXA 3AS0A 1W9UA 1ZCNA 4DWSA 1E44A 4ODRA 4Q7NA 1NWSA 3PRAA 1W9PA 1OWQA 2WLYA 2MPHA 3O5OA 1K9TA 3UF8A 3WL0A 1ZB5A 3PRDA 3ARSA 1W9VA 4L72B 1TFVA 3ARQA 1QPFA 4XAKA 1JNDA 3WD3A 1D7JA 3NTPA 3AS3A 3FAPA 2RQSA 4QIBA 1YW5A 5HKGA 2ETNA 4TW7A 2F23A 2DSUA 2KR7A 1QPLA 3ODKA 4ZPVR 4MNKA 4ML4A 3AS1A 2XPAA 4NNRA 2N87A 3CGNA 2KFWA 2ZQUA 1LQ0A 1NMWA 2MLYA 2M1IA 2DT0A 1W1PA 3IK8A 1U79A 4DRHA 1KT1A 2KE0A 3PRBA 5GPRA 3KAFA 4Z2GA 2Q5AA 3O5GA 1HJVA 3TDBA 1P5QA 2LGOA 4URIA 1RD6A 5DO2A 2G8ZA 1FKRA 2L2SA 2AWGA 4Z2HA 1E6PA 2PPOA 1NWTA 2RURA 2ITKA 2F21A 4DRQA 4IT4A 1GOIA 3B9DA 4BF8A 1Q6UA 4G2PA 1LL4A 4O2TA 3KABA 3O5RA 5BXJA 4JFJA 4DT4A 4DWSB 4P8WA 2JZVA 4LGXA 5B8IC 2PV2A 2XP6A 1FKLA 3RGCA 3ARUA 3B9AA 2PN0A 3B9EA 1VF8A 4WKHA 1NWUA 1EDQA 1SYTA 1L1PA 4KQZA 3OA5A 1EHNA 1WAWA 1D2KA 1R9HA 1N1AA 2XP3A 1ZBKA 1OGBA 2O92A 1JNTA 3ARPA 3QOKA 4IPXA 2PBCA 2PPPA 2A3BA 4R5EA 5HT1A 1C9HA 4HBEA 4ITZA 1LL7A 3KACA 1FKDA 3CGMA 2MNTA 4JFLA 1NMVA 4WKFA 3ALGA 2MLZA 4IQCA 1J4IA 1E6NA 5GPGA 1HJWA 4QT2A 4DRPA 1F8AB 4QT3A 4PTMA 4G50A 1XHGA 3JYMA 4FAPA 4MSPA 1FKHA 2ESCA 1ITXA 3ARRA 1J4HA 2OFNA 4P8UA 3KAGA 4U85A
chains in the Genus database with same CATH topology
2K8IA 1HKKA 2XP7A 2FAPA 1FD9A 1D7IA 2A3CA 2RSEA 2YBUA 4ODMA 4TNSA 2LJ4A 4DRIA 4TW8A 2FKEA 5HUAA 3RFWA 1PBKA 3RM9A 4W9QA 3LUOA 4W9PA 1HKMA 4W5UA 3JXVA 3KCEA 1KT0A 1SR0A 3ARYA 4NSBA 3O5KA 3CHFA 2PI6A 2B31A 3KADA 1JNEA 3TCZA 1LJYA 2WM0A 3UI5A 1NSGA 1FFQA 1ZBWA 2ZR6A 3KAIA 3MDYB 1H0GA 3O5MA 1FFRA 4TYOA 2ZQSA 3UI6A 2DSVA 1E9LA 2PV1A 4IQ2A 2KI3A 4FN2A 1B6CA 5HBFA 1NH6A 4DRKA 2IF4A 1FKIA 1GUVA 3EY6A 3RM8A 5HW8A 3WD0A 1Q6HA 3CHEA 3G6MA 1HKIA 2M2AA 4L3NA 3JYJA 1J4RA 4MNJA 3CH9A 5J6EA 3WL1A 2G41A 1FKJA 4J4NA 3G6LA 1E6ZA 1ZBCA 2LPVA 3B8SA 2UZ5A 1PINA 1HXVA 1HJXA 1FJDA 2OLHA 1FKBA 1CTNA 4DRJA 2YBTA 1E15A 1W1VA 1HKJA 3BXWA 3WQVA 1LL6A 1XRVA 4JFMA 1FAPA 3NRKA 1NWRA 4ZS6A 4ZPWR 4HARA 3WD1A 2DT1A 1BKFA 2AOSA 5HW7A 3WD4A 2IUZA 3WD2A 2ZQVA 4Z2LA 2DT3A 4NZCA 3FXYA 4TX0A 4Z2KA 3RM4A 3KZ7A 3O5JA 4WIWA 4MGVA 4MTVA 1W26A 3AROA 3O5PA 4ODLA 1T11A 5GQBA 4DWSD 5D75A 2XP9A 3H9RB 2KO7A 1QZ2A 3ARXA 2ZR4A 1WNOA 1E6RA 1UR8A 3GPKA 3VAWA 4GGQA 3ALFA 4IT6A 4LAXA 4LAVA 2DG9A 3WH0A 5DIVA 4U84A 3TC5A 3UQIA 4DH0A 4N19A 4MNLA 1FKTA 1Y0OA 1EIBA 3ARVA 3I6CA 5JH8A 3IKDA 3WIJA 3CHCA 3UQBA 4HBOA 2XP4A 3IHZA 2XP8A 1YATA 4ODOA 4WKAA 3O5EA 4TW6A 5I98A 2F2DA 1X6NA 2ZR5A 4LAYA 1ZK6A 2QF8A 2ZQTA 3PR9A 3RMEA 2DSZA 2LKNA 3KAHA 2XP5A 4DZ2A 1W1YA 1FKGA 4JFIA 2MF9A 1X6LA 1OGGA 2DT2A 1Q6IA 1H0IA 3FY1A 4Z2IA 4GIVA 4P8XA 4ZPTR 5DITA 2MLXA 3B7XA 1BL4A 2D9FA 1A7XA 4Q22A 1JNSA 2KGJA 4ODPA 2XPBA 1FKFA 2DG4A 1ROTA 4C02B 5DF0A 2A3AA 2WK2A 4DIPA 4KR0B 5DIUA 4MAVA 1LG2A 4JFKA 3OOBA 3NI6A 4MNMA 1D7HA 1JVWA 3ARWA 4MPKA 3UQAA 5HTGA 2RUQA 1FKKA 1UR9A 1W1TA 4DRMA 1O6IA 3UI4A 2VCDA 4DROA 4JYSA 4DZ3A 2RUDA 2DSWA 4QZVB 1F40A 5HWBA 2FDMA 1WB0A 4WK9A 4ODNA 4R0XA 1M5YA 1LG1A 1GPFA 4W9OA 2O9OA 4S3KA 4P8VA 2DG3A 3CHDA 4S3JA 1IX5A 1FKSA 5HWCA 1Q1CA 4DWSC 2RUCA 4AY1A 5HW6A 1KFWA 3IKGA 3O5FA 2F4EA 2Y78A 5DEZA 1ZU8A 2PV3A 1ZBVA 4ODKA 3AS2A 2M08A 3ARTA 2A3EA 1ROUA 3AQUA 3PA7A 1ZL1A 4LAWA 1D6OA 3ARZA 2PPNA 3WQWA 4U86A 4Z2JA 1EQ3A 2VN1A 3CZ8A 2DPEA 3W4RA 3O5LA 3O5DA 2WLZA 4ODQA 4DRNA 1EYMA 4J4OA 1J6YA 3O5QA 1TCOC 3WKZA 3O5IA 4WJXA 3AS0A 1W9UA 1ZCNA 4DWSA 4ODRA 4Q7NA 1NWSA 3PRAA 1W9PA 1OWQA 2WLYA 2MPHA 3O5OA 1K9TA 3UF8A 3WL0A 1ZB5A 3PRDA 3ARSA 1W9VA 4L72B 1TFVA 3ARQA 1QPFA 4XAKA 1JNDA 3WD3A 1D7JA 3NTPA 3AS3A 3FAPA 2RQSA 4QIBA 1YW5A 5HKGA 4TW7A 2DSUA 2KR7A 1QPLA 3ODKA 4ZPVR 4MNKA 4ML4A 3AS1A 2XPAA 4NNRA 2N87A 3CGNA 2KFWA 2ZQUA 1LQ0A 1NMWA 2MLYA 2M1IA 2DT0A 1W1PA 3IK8A 1U79A 4DRHA 1KT1A 2KE0A 3PRBA 5GPRA 3KAFA 4Z2GA 2Q5AA 3O5GA 1HJVA 3TDBA 1P5QA 2LGOA 4URIA 1RD6A 5DO2A 2G8ZA 1FKRA 2L2SA 2AWGA 4Z2HA 1E6PA 2PPOA 1NWTA 2RURA 2ITKA 2F21A 4DRQA 4IT4A 1GOIA 3B9DA 4BF8A 1Q6UA 4G2PA 1LL4A 4O2TA 3KABA 3O5RA 5BXJA 4JFJA 4DT4A 4DWSB 4P8WA 2JZVA 4LGXA 5B8IC 2PV2A 2XP6A 1FKLA 3RGCA 3ARUA 3B9AA 3B9EA 1VF8A 4WKHA 1NWUA 1EDQA 1SYTA 1L1PA 4KQZA 3OA5A 1EHNA 1WAWA 1D2KA 1R9HA 1N1AA 2XP3A 1ZBKA 1OGBA 2O92A 1JNTA 3ARPA 3QOKA 4IPXA 2PBCA 2PPPA 2A3BA 4R5EA 5HT1A 1C9HA 4HBEA 4ITZA 1LL7A 3KACA 1FKDA 3CGMA 2MNTA 4JFLA 1NMVA 4WKFA 3ALGA 2MLZA 4IQCA 1J4IA 1E6NA 5GPGA 1HJWA 4QT2A 4DRPA 1F8AB 4QT3A 4PTMA 4G50A 1XHGA 3JYMA 4FAPA 4MSPA 1FKHA 2ESCA 1ITXA 3ARRA 1J4HA 2OFNA 4P8UA 3KAGA 4U85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K8I A;  1D7H A;  3O5J A;  1JVW A;  2XP7 A;  4MGV A;  2KR7 A;  5HTG A;  2FAP A;  1QPL A;  1FD9 A;  3ODK A;  1D7I A;  2RUQ A;  2RSE A;  4ODM A;  1W26 A;  1FKK A;  3O5P A;  4TNS A;  2LJ4 A;  4DRM A;  4ODL A;  1T11 A;  4DRI A;  4TW8 A;  2XPA A;  4NNR A;  2FKE A;  5D75 A;  3UI4 A;  2N87 A;  2XP9 A;  2KFW A;  2VCD A;  1PBK A;  2ZQU A;  3CGN A;  2KO7 A;  3H9R B;  1NMW A;  1QZ2 A;  2MLY A;  2M1I A;  4W9Q A;  4DRO A;  3LUO A;  4JYS A;  4DZ3 A;  4W9P A;  3IK8 A;  3JXV A;  1U79 A;  1KT0 A;  3KCE A;  4DRH A;  1KT1 A;  2KE0 A;  4TW7 A;  3PRB A;  3O5K A;  2ZR4 A;  2RUD A;  1F40 A;  5HWB A;  3KAF A;  3GPK A;  4ODN A;  4R0X A;  1M5Y A;  2Q5A A;  3KAD A;  3O5G A;  4W9O A;  4GGQ A;  3TCZ A;  3TDB A;  3VAW A;  1P5Q A;  3UI5 A;  1NSG A;  5HUA A;  4LAX A;  2LGO A;  3RFW A;  4LAV A;  2DG3 A;  2DG9 A;  3WH0 A;  2ZR6 A;  5DIV A;  4U84 A;  3KAI A;  1FKR A;  3TC5 A;  2L2S A;  2AWG A;  3MDY B;  3UQI A;  1FKS A;  4DH0 A;  5HWC A;  1Q1C A;  2PPO A;  2RUC A;  4N19 A;  1FKT A;  1Y0O A;  3O5M A;  5HW6 A;  2RUR A;  2ITK A;  4TYO A;  2F21 A;  3IKG A;  3O5F A;  4DRQ A;  3I6C A;  2ZQS A;  3UI6 A;  2PV1 A;  2F4E A;  3IKD A;  4IQ2 A;  2Y78 A;  4BF8 A;  1Q6U A;  4G2P A;  2KI3 A;  4O2T A;  3KAB A;  3O5R A;  5BXJ A;  4FN2 A;  1B6C A;  2PV3 A;  4JFJ A;  4DT4 A;  3UQB A;  2XP4 A;  2JZV A;  3IHZ A;  5B8I C;  2PV2 A;  4ODK A;  2XP8 A;  2XP6 A;  1YAT A;  4DRK A;  2M08 A;  4ODO A;  1FKL A;  2IF4 A;  3RGC A;  3O5E A;  4TW6 A;  1ROU A;  3PA7 A;  5I98 A;  2F2D A;  4LAW A;  1FKI A;  1D6O A;  2PPN A;  3EY6 A;  4U86 A;  5HW8 A;  1EQ3 A;  2VN1 A;  2ZR5 A;  4LAY A;  1L1P A;  1Q6H A;  3O5L A;  3O5D A;  1ZK6 A;  2ZQT A;  4ODQ A;  4DRN A;  1EYM A;  2LKN A;  4J4O A;  3KAH A;  1R9H A;  2XP5 A;  2M2A A;  1J6Y A;  1N1A A;  3O5Q A;  4DZ2 A;  1TCO C;  1J4R A;  2XP3 A;  3JYJ A;  5J6E A;  1JNT A;  1FKG A;  4JFI A;  4IPX A;  2PBC A;  2PPP A;  3O5I A;  2MF9 A;  5HT1 A;  1C9H A;  1FKJ A;  1ZCN A;  4J4N A;  1Q6I A;  2LPV A;  4ODR A;  4ITZ A;  2UZ5 A;  1PIN A;  3KAC A;  1FKD A;  1FJD A;  1HXV A;  1FKB A;  3CGM A;  2MNT A;  4GIV A;  4DRJ A;  4JFL A;  1NMV A;  5DIT A;  2MLX A;  2MLZ A;  1BL4 A;  2D9F A;  3B7X A;  1A7X A;  2MPH A;  3O5O A;  4IQC A;  1J4I A;  3UF8 A;  1JNS A;  5GPG A;  4JFM A;  1FAP A;  2KGJ A;  3NRK A;  3PRD A;  2XPB A;  4ODP A;  1FKF A;  2DG4 A;  4QT2 A;  1ROT A;  4C02 B;  4DRP A;  1F8A B;  1BKF A;  1QPF A;  4QT3 A;  4G50 A;  3JYM A;  5HW7 A;  4DIP A;  4FAP A;  1D7J A;  3NTP A;  4MSP A;  1FKH A;  5DIU A;  3FAP A;  2ZQV A;  2RQS A;  4QIB A;  1YW5 A;  1J4H A;  2OFN A;  3UQA A;  4JFK A;  5HKG A;  3OOB A;  4TX0 A;  3KZ7 A;  3KAG A;  3NI6 A;  4U85 A; 
#chains in the Genus database with same CATH topology
 2K8I A;  1HKK A;  2XP7 A;  2FAP A;  1FD9 A;  1D7I A;  2A3C A;  2RSE A;  2YBU A;  4ODM A;  4TNS A;  2LJ4 A;  4DRI A;  4TW8 A;  2FKE A;  5HUA A;  3RFW A;  1PBK A;  3RM9 A;  4W9Q A;  3LUO A;  4W9P A;  1HKM A;  4W5U A;  3JXV A;  3KCE A;  1KT0 A;  1SR0 A;  1JCH B;  3ARY A;  4NSB A;  3O5K A;  3CHF A;  2PI6 A;  2B31 A;  3KAD A;  1JNE A;  3TCZ A;  1LJY A;  2WM0 A;  3UI5 A;  1NSG A;  1FFQ A;  1ZBW A;  2ZR6 A;  3KAI A;  3MDY B;  1H0G A;  3O5M A;  1FFR A;  4TYO A;  1GRJ A;  2ZQS A;  3UI6 A;  2DSV A;  1E9L A;  2PV1 A;  4IQ2 A;  2KI3 A;  4FN2 A;  1B6C A;  5HBF A;  1NH6 A;  4DRK A;  2IF4 A;  1FKI A;  1GUV A;  3EY6 A;  3RM8 A;  5HW8 A;  3WD0 A;  1Q6H A;  3CHE A;  3G6M A;  1HKI A;  2M2A A;  4L3N A;  3JYJ A;  1J4R A;  4MNJ A;  3CH9 A;  5J6E A;  3WL1 A;  2G41 A;  1FKJ A;  4J4N A;  3G6L A;  1E6Z A;  1ZBC A;  2LPV A;  3B8S A;  2UZ5 A;  1PIN A;  1HXV A;  1HJX A;  1FJD A;  2OLH A;  1FKB A;  1CTN A;  4DRJ A;  2YBT A;  1E15 A;  1W1V A;  1HKJ A;  3BXW A;  3WQV A;  1LL6 A;  1XRV A;  4JFM A;  1FAP A;  3NRK A;  1NWR A;  4ZS6 A;  4ZPW R;  3EIP A;  4HAR A;  3WD1 A;  2DT1 A;  1BKF A;  2AOS A;  5HW7 A;  3WD4 A;  2IUZ A;  3WD2 A;  2ZQV A;  4Z2L A;  2DT3 A;  4NZC A;  3FXY A;  4TX0 A;  4Z2K A;  3RM4 A;  3KZ7 A;  3O5J A;  4WIW A;  4MGV A;  4MTV A;  1W26 A;  3ARO A;  3O5P A;  4UDM A;  4ODL A;  1T11 A;  5GQB A;  2P4V A;  4DWS D;  5D75 A;  2XP9 A;  3H9R B;  2KO7 A;  1QZ2 A;  3ARX A;  2ZR4 A;  1WNO A;  1E6R A;  1UR8 A;  3GPK A;  3VAW A;  4GGQ A;  3ALF A;  4IT6 A;  4LAX A;  4LAV A;  2DG9 A;  3WH0 A;  5DIV A;  4U84 A;  3GTY X;  3TC5 A;  3UQI A;  4DH0 A;  4N19 A;  4MNL A;  1FKT A;  1Y0O A;  1EIB A;  3ARV A;  3I6C A;  5JH8 A;  3IKD A;  3WIJ A;  3CHC A;  3UQB A;  4HBO A;  2XP4 A;  3IHZ A;  2XP8 A;  1YAT A;  4ODO A;  4WKA A;  3O5E A;  4TW6 A;  5I98 A;  2F2D A;  1X6N A;  2ZR5 A;  4LAY A;  1ZK6 A;  2QF8 A;  2ZQT A;  3PR9 A;  3RME A;  2DSZ A;  2LKN A;  3KAH A;  2XP5 A;  4DZ2 A;  1W1Y A;  1FKG A;  4JFI A;  2MF9 A;  2DT2 A;  1OGG A;  1X6L A;  1Q6I A;  1H0I A;  3FY1 A;  4Z2I A;  4GIV A;  4P8X A;  4ZPT R;  5DIT A;  2MLX A;  3B7X A;  1BL4 A;  2D9F A;  1A7X A;  4Q22 A;  1JNS A;  2KGJ A;  4ODP A;  2XPB A;  1FKF A;  2DG4 A;  1ROT A;  4C02 B;  5DF0 A;  2A3A A;  2WK2 A;  4DIP A;  4KR0 B;  5DIU A;  4MAV A;  1LG2 A;  4JFK A;  3GU0 A;  3OOB A;  3NI6 A;  4MNM A;  1D7H A;  1JVW A;  3ARW A;  4MPK A;  3UQA A;  5HTG A;  2RUQ A;  1FKK A;  1UR9 A;  1W1T A;  4DRM A;  1O6I A;  3UI4 A;  2VCD A;  4DRO A;  4JYS A;  4DZ3 A;  2RUD A;  2DSW A;  4QZV B;  1F40 A;  5HWB A;  2FDM A;  1WB0 A;  2B5U B;  4WK9 A;  4ODN A;  4R0X A;  1M5Y A;  1LG1 A;  1GPF A;  4W9O A;  2O9O A;  4S3K A;  4P8V A;  2DG3 A;  3CHD A;  4S3J A;  1IX5 A;  1FKS A;  5HWC A;  1Q1C A;  4DWS C;  2RUC A;  4AY1 A;  5HW6 A;  1KFW A;  3IKG A;  3O5F A;  2F4E A;  2Y78 A;  5DEZ A;  1ZU8 A;  2PV3 A;  2EUL A;  1ZBV A;  4ODK A;  3AS2 A;  2M08 A;  3ART A;  2A3E A;  1ROU A;  3AQU A;  3PA7 A;  1ZL1 A;  4LAW A;  1D6O A;  3ARZ A;  2PPN A;  3WQW A;  4U86 A;  4Z2J A;  1EQ3 A;  2VN1 A;  3CZ8 A;  2DPE A;  3W4R A;  3O5L A;  3O5D A;  2WLZ A;  4ODQ A;  4DRN A;  1EYM A;  4J4O A;  1J6Y A;  3O5Q A;  1TCO C;  3BMB A;  3WKZ A;  3O5I A;  4WJX A;  3AS0 A;  1W9U A;  1ZCN A;  4DWS A;  1E44 A;  4ODR A;  4Q7N A;  1NWS A;  3PRA A;  1W9P A;  1OWQ A;  2WLY A;  2MPH A;  3O5O A;  1K9T A;  3UF8 A;  3WL0 A;  1ZB5 A;  3PRD A;  3ARS A;  1W9V A;  4L72 B;  1TFV A;  3ARQ A;  1QPF A;  4XAK A;  1JND A;  3WD3 A;  1D7J A;  3NTP A;  3AS3 A;  3FAP A;  2RQS A;  4QIB A;  1YW5 A;  5HKG A;  2ETN A;  4TW7 A;  2F23 A;  2DSU A;  2KR7 A;  1QPL A;  3ODK A;  4ZPV R;  4MNK A;  4ML4 A;  3AS1 A;  2XPA A;  4NNR A;  2N87 A;  3CGN A;  2KFW A;  2ZQU A;  1LQ0 A;  1NMW A;  2MLY A;  2M1I A;  2DT0 A;  1W1P A;  3IK8 A;  1U79 A;  4DRH A;  1KT1 A;  2KE0 A;  3PRB A;  5GPR A;  3KAF A;  4Z2G A;  2Q5A A;  3O5G A;  1HJV A;  3TDB A;  1P5Q A;  2LGO A;  4URI A;  1RD6 A;  5DO2 A;  2G8Z A;  1FKR A;  2L2S A;  2AWG A;  4Z2H A;  1E6P A;  2PPO A;  1NWT A;  2RUR A;  2ITK A;  2F21 A;  4DRQ A;  4IT4 A;  1GOI A;  3B9D A;  4BF8 A;  1Q6U A;  4G2P A;  1LL4 A;  4O2T A;  3KAB A;  3O5R A;  5BXJ A;  4JFJ A;  4DT4 A;  4DWS B;  4P8W A;  2JZV A;  4LGX A;  5B8I C;  2PV2 A;  2XP6 A;  1FKL A;  3RGC A;  3ARU A;  3B9A A;  2PN0 A;  3B9E A;  1VF8 A;  4WKH A;  1NWU A;  1EDQ A;  1SYT A;  1L1P A;  4KQZ A;  3OA5 A;  1EHN A;  1WAW A;  1D2K A;  1R9H A;  1N1A A;  2XP3 A;  1ZBK A;  1OGB A;  2O92 A;  1JNT A;  3ARP A;  3QOK A;  4IPX A;  2PBC A;  2PPP A;  2A3B A;  4R5E A;  5HT1 A;  1C9H A;  4HBE A;  4ITZ A;  1LL7 A;  3KAC A;  1FKD A;  3CGM A;  2MNT A;  4JFL A;  1NMV A;  4WKF A;  3ALG A;  2MLZ A;  4IQC A;  1J4I A;  1E6N A;  5GPG A;  1HJW A;  4QT2 A;  4DRP A;  1F8A B;  4QT3 A;  4PTM A;  4G50 A;  1XHG A;  3JYM A;  4FAP A;  4MSP A;  1FKH A;  2ESC A;  1ITX A;  3ARR A;  1J4H A;  2OFN A;  4P8U A;  3KAG A;  4U85 A; 
#chains in the Genus database with same CATH homology
 2K8I A;  1HKK A;  2XP7 A;  2FAP A;  1FD9 A;  1D7I A;  2A3C A;  2RSE A;  2YBU A;  4ODM A;  4TNS A;  2LJ4 A;  4DRI A;  4TW8 A;  2FKE A;  5HUA A;  3RFW A;  1PBK A;  3RM9 A;  4W9Q A;  3LUO A;  4W9P A;  1HKM A;  4W5U A;  3JXV A;  3KCE A;  1KT0 A;  1SR0 A;  3ARY A;  4NSB A;  3O5K A;  3CHF A;  2PI6 A;  2B31 A;  3KAD A;  1JNE A;  3TCZ A;  1LJY A;  2WM0 A;  3UI5 A;  1NSG A;  1FFQ A;  1ZBW A;  2ZR6 A;  3KAI A;  3MDY B;  1H0G A;  3O5M A;  1FFR A;  4TYO A;  2ZQS A;  3UI6 A;  2DSV A;  1E9L A;  2PV1 A;  4IQ2 A;  2KI3 A;  4FN2 A;  1B6C A;  5HBF A;  1NH6 A;  4DRK A;  2IF4 A;  1FKI A;  1GUV A;  3EY6 A;  3RM8 A;  5HW8 A;  3WD0 A;  1Q6H A;  3CHE A;  3G6M A;  1HKI A;  2M2A A;  4L3N A;  3JYJ A;  1J4R A;  4MNJ A;  3CH9 A;  5J6E A;  3WL1 A;  2G41 A;  1FKJ A;  4J4N A;  3G6L A;  1E6Z A;  1ZBC A;  2LPV A;  3B8S A;  2UZ5 A;  1PIN A;  1HXV A;  1HJX A;  1FJD A;  2OLH A;  1FKB A;  1CTN A;  4DRJ A;  2YBT A;  1E15 A;  1W1V A;  1HKJ A;  3BXW A;  3WQV A;  1LL6 A;  1XRV A;  4JFM A;  1FAP A;  3NRK A;  1NWR A;  4ZS6 A;  4ZPW R;  4HAR A;  3WD1 A;  2DT1 A;  1BKF A;  2AOS A;  5HW7 A;  3WD4 A;  2IUZ A;  3WD2 A;  2ZQV A;  4Z2L A;  2DT3 A;  4NZC A;  3FXY A;  4TX0 A;  4Z2K A;  3RM4 A;  3KZ7 A;  3O5J A;  4WIW A;  4MGV A;  4MTV A;  1W26 A;  3ARO A;  3O5P A;  4ODL A;  1T11 A;  5GQB A;  4DWS D;  5D75 A;  2XP9 A;  3H9R B;  2KO7 A;  1QZ2 A;  3ARX A;  2ZR4 A;  1WNO A;  1E6R A;  1UR8 A;  3GPK A;  3VAW A;  4GGQ A;  3ALF A;  4IT6 A;  4LAX A;  4LAV A;  2DG9 A;  3WH0 A;  5DIV A;  4U84 A;  3TC5 A;  3UQI A;  4DH0 A;  4N19 A;  4MNL A;  1FKT A;  1Y0O A;  1EIB A;  3ARV A;  3I6C A;  5JH8 A;  3IKD A;  3WIJ A;  3CHC A;  3UQB A;  4HBO A;  2XP4 A;  3IHZ A;  2XP8 A;  1YAT A;  4ODO A;  4WKA A;  3O5E A;  4TW6 A;  5I98 A;  2F2D A;  1X6N A;  2ZR5 A;  4LAY A;  1ZK6 A;  2QF8 A;  2ZQT A;  3PR9 A;  3RME A;  2DSZ A;  2LKN A;  3KAH A;  2XP5 A;  4DZ2 A;  1W1Y A;  1FKG A;  4JFI A;  2MF9 A;  1X6L A;  1OGG A;  2DT2 A;  1Q6I A;  1H0I A;  3FY1 A;  4Z2I A;  4GIV A;  4P8X A;  4ZPT R;  5DIT A;  2MLX A;  3B7X A;  1BL4 A;  2D9F A;  1A7X A;  4Q22 A;  1JNS A;  2KGJ A;  4ODP A;  2XPB A;  1FKF A;  2DG4 A;  1ROT A;  4C02 B;  5DF0 A;  2A3A A;  2WK2 A;  4DIP A;  4KR0 B;  5DIU A;  4MAV A;  1LG2 A;  4JFK A;  3OOB A;  3NI6 A;  4MNM A;  1D7H A;  1JVW A;  3ARW A;  4MPK A;  3UQA A;  5HTG A;  2RUQ A;  1FKK A;  1UR9 A;  1W1T A;  4DRM A;  1O6I A;  3UI4 A;  2VCD A;  4DRO A;  4JYS A;  4DZ3 A;  2RUD A;  2DSW A;  4QZV B;  1F40 A;  5HWB A;  2FDM A;  1WB0 A;  4WK9 A;  4ODN A;  4R0X A;  1M5Y A;  1LG1 A;  1GPF A;  4W9O A;  2O9O A;  4S3K A;  4P8V A;  2DG3 A;  3CHD A;  4S3J A;  1IX5 A;  1FKS A;  5HWC A;  1Q1C A;  4DWS C;  2RUC A;  4AY1 A;  5HW6 A;  1KFW A;  3IKG A;  3O5F A;  2F4E A;  2Y78 A;  5DEZ A;  1ZU8 A;  2PV3 A;  1ZBV A;  4ODK A;  3AS2 A;  2M08 A;  3ART A;  2A3E A;  1ROU A;  3AQU A;  3PA7 A;  1ZL1 A;  4LAW A;  1D6O A;  3ARZ A;  2PPN A;  3WQW A;  4U86 A;  4Z2J A;  1EQ3 A;  2VN1 A;  3CZ8 A;  2DPE A;  3W4R A;  3O5L A;  3O5D A;  2WLZ A;  4ODQ A;  4DRN A;  1EYM A;  4J4O A;  1J6Y A;  3O5Q A;  1TCO C;  3WKZ A;  3O5I A;  4WJX A;  3AS0 A;  1W9U A;  1ZCN A;  4DWS A;  4ODR A;  4Q7N A;  1NWS A;  3PRA A;  1W9P A;  1OWQ A;  2WLY A;  2MPH A;  3O5O A;  1K9T A;  3UF8 A;  3WL0 A;  1ZB5 A;  3PRD A;  3ARS A;  1W9V A;  4L72 B;  1TFV A;  3ARQ A;  1QPF A;  4XAK A;  1JND A;  3WD3 A;  1D7J A;  3NTP A;  3AS3 A;  3FAP A;  2RQS A;  4QIB A;  1YW5 A;  5HKG A;  4TW7 A;  2DSU A;  2KR7 A;  1QPL A;  3ODK A;  4ZPV R;  4MNK A;  4ML4 A;  3AS1 A;  2XPA A;  4NNR A;  2N87 A;  3CGN A;  2KFW A;  2ZQU A;  1LQ0 A;  1NMW A;  2MLY A;  2M1I A;  2DT0 A;  1W1P A;  3IK8 A;  1U79 A;  4DRH A;  1KT1 A;  2KE0 A;  3PRB A;  5GPR A;  3KAF A;  4Z2G A;  2Q5A A;  3O5G A;  1HJV A;  3TDB A;  1P5Q A;  2LGO A;  4URI A;  1RD6 A;  5DO2 A;  2G8Z A;  1FKR A;  2L2S A;  2AWG A;  4Z2H A;  1E6P A;  2PPO A;  1NWT A;  2RUR A;  2ITK A;  2F21 A;  4DRQ A;  4IT4 A;  1GOI A;  3B9D A;  4BF8 A;  1Q6U A;  4G2P A;  1LL4 A;  4O2T A;  3KAB A;  3O5R A;  5BXJ A;  4JFJ A;  4DT4 A;  4DWS B;  4P8W A;  2JZV A;  4LGX A;  5B8I C;  2PV2 A;  2XP6 A;  1FKL A;  3RGC A;  3ARU A;  3B9A A;  3B9E A;  1VF8 A;  4WKH A;  1NWU A;  1EDQ A;  1SYT A;  1L1P A;  4KQZ A;  3OA5 A;  1EHN A;  1WAW A;  1D2K A;  1R9H A;  1N1A A;  2XP3 A;  1ZBK A;  1OGB A;  2O92 A;  1JNT A;  3ARP A;  3QOK A;  4IPX A;  2PBC A;  2PPP A;  2A3B A;  4R5E A;  5HT1 A;  1C9H A;  4HBE A;  4ITZ A;  1LL7 A;  3KAC A;  1FKD A;  3CGM A;  2MNT A;  4JFL A;  1NMV A;  4WKF A;  3ALG A;  2MLZ A;  4IQC A;  1J4I A;  1E6N A;  5GPG A;  1HJW A;  4QT2 A;  4DRP A;  1F8A B;  4QT3 A;  4PTM A;  4G50 A;  1XHG A;  3JYM A;  4FAP A;  4MSP A;  1FKH A;  2ESC A;  1ITX A;  3ARR A;  1J4H A;  2OFN A;  4P8U A;  3KAG A;  4U85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...