3O5JA

Fk1 domain of fkbp51, crystal form iii
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
124
structure length
124
Chain Sequence
ATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 31
structure length 124
sequence length 124
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5jA00
3KZ7A 3NTPA 4G50A 3O5LA 1Q1CA 2MNTA 4LAXA 2RURA 4ODNA 4J4OA 3UI5A 2ZQTA 2ZR4A 3EY6A 2DG3A 5DIVA 2RQSA 4ODOA 4R0XA 1L1PA 1A7XA 1NSGA 4MSPA 4FAPA 1HXVA 3I6CA 2F21A 3IK8A 4DRPA 3MDYB 2VN1A 5HW7A 4TX0A 2PV2A 1P5QA 4JFLA 1Q6IA 4C02B 5BXJA 2MLYA 1FKIA 5DITA 1PINA 2PV1A 1BKFA 1J4RA 3JXVA 4ODPA 1ZCNA 5I98A 1KT1A 1TCOC 4U85A 4DRIA 4TYOA 4LAWA 1YW5A 3O5FA 3PRBA 2D9FA 5HUAA 4JFKA 4NNRA 2PPPA 3ODKA 4BF8A 2MPHA 2DG9A 2M08A 3KAFA 2XP4A 2KFWA 3OOBA 4QT2A 5HWBA 1QZ2A 2KGJA 5D75A 1N1AA 3WH0A 3IKGA 1Q6HA 4U84A 2PPNA 1ROUA 1D6OA 2OFNA 2RUCA 2ZQUA 2XP6A 2Q5AA 3PRDA 4J4NA 5DIUA 2ZR6A 1NMVA 1ROTA 1Y0OA 3KAGA 2XP9A 1KT0A 1ZK6A 2XP5A 3LUOA 4TW6A 4DRKA 1M5YA 1EYMA 4DZ3A 3UI4A 5HW8A 3O5OA 3TC5A 5J6EA 2MF9A 1QPFA 3H9RB 3PA7A 4IQCA 1D7IA 2N87A 4W9QA 1PBKA 4QT3A 4JFJA 1BL4A 2KO7A 4N19A 4QIBA 1FKHA 3UI6A 2K8IA 2RUDA 1R9HA 1FKGA 3O5DA 3RFWA 1U79A 2FKEA 3VAWA 4JFMA 1F40A 4DROA 3JYJA 2XPBA 2KR7A 1FAPA 1C9HA 2PPOA 2ZQSA 5HW6A 1J6YA 4GGQA 4IPXA 5HTGA 2XP7A 3CGMA 5GPGA 3FAPA 3NI6A 3NRKA 4DRMA 2PBCA 3KAHA 4DRHA 1J4HA 5HWCA 2FAPA 4W9PA 4ITZA 4FN2A 3KADA 2LJ4A 3GPKA 3O5GA 4ODLA 1D7JA 2L2SA 2VCDA 3UF8A 4DRJA 1FKLA 2XP8A 4TW8A 4ODQA 1Q6UA 2M1IA 3IHZA 2ZR5A 2KI3A 2AWGA 4DT4A 2DG4A 3O5QA 4DRQA 2XP3A 3O5MA 5B8IC 3O5KA 2LKNA 3TCZA 1YATA 3B7XA 2UZ5A 1FKDA 4GIVA 4DRNA 2ITKA 3KACA 2XPAA 1B6CA 2RSEA 4O2TA 1F8AB 4ODRA 4U86A 4TW7A 4JFIA 3RGCA 3UQIA 4LAYA 2LPVA 1FKTA 4TNSA 1JNSA 4ODKA 2JZVA 1EQ3A 1W26A 4DIPA 1FKRA 3IKDA 1T11A 4W9OA 2MLZA 3O5RA 3O5PA 1FKKA 4ODMA 3O5IA 1D7HA 3UQBA 2MLXA 1JNTA 3CGNA 2IF4A 3O5EA 3KCEA 1FKSA 2KE0A 4MGVA 1FKFA 2M2AA 3TDBA 2PV3A 4DZ2A 2Y78A 3JYMA 3O5JA 4G2PA 5HT1A 4JYSA 2F4EA 2ZQVA 3KAIA 3UQAA 2LGOA 1FJDA 4LAVA 4IQ2A 2F2DA 2RUQA 1FKJA 1FKBA 4DH0A 3KABA 1J4IA 1FD9A 5HKGA 1QPLA 1NMWA 1JVWA
chains in the Genus database with same CATH superfamily
2DT2A 4G50A 3O5LA 1Q1CA 4Z2LA 1X6NA 4ODNA 2RURA 4ODOA 4R0XA 1UR9A 1HXVA 3AS1A 3PRAA 1ZBVA 3ALGA 1Q6IA 5BXJA 2MLYA 5DITA 2PV1A 1BKFA 3AROA 1KT1A 1TCOC 4WIWA 4Z2JA 3PRBA 5HUAA 4NNRA 4WKAA 2PPPA 1WB0A 3KAFA 3ARUA 2XP4A 4KQZA 4P8VA 1N1AA 3WH0A 1Q6HA 1ROUA 1D6OA 5DIUA 1NMVA 4TW6A 1Y0OA 1CTNA 1ZK6A 2XP5A 3LUOA 3OA5A 4DRKA 1M5YA 1EYMA 4DZ3A 5HW8A 2MF9A 4S3JA 3PA7A 4IQCA 1D7IA 1ZL1A 2N87A 4W9QA 4JFJA 1W1VA 1BL4A 2KO7A 1FKHA 1ZU8A 3UI6A 2RUDA 1ZBWA 3O5DA 3VAWA 1E15A 1ITXA 4DWSD 2KR7A 1ZB5A 1FAPA 1C9HA 5HBFA 4GGQA 3ARWA 1IX5A 3ARSA 4AY1A 4ITZA 4FN2A 3GPKA 2YBUA 3ALFA 3UF8A 3QOKA 1TFVA 2ESCA 2OLHA 2PN0A 3G6MA 1FKDA 2ITKA 1LL7A 1B6CA 3WKZA 2JZVA 4IT6A 2WK2A 4DIPA 3IKDA 1O6IA 1F40A 1FKSA 2KE0A 2Y78A 3JYMA 4G2PA 2AOSA 4Q22A 4ZPVR 2DSWA 1FKJA 1QPLA 2YBTA 4XAKA 2ZQTA 2ZR4A 1L1PA 1NWRA 1A7XA 4C02B 1P5QA 1PINA 3B9EA 3CZ8A 3FY1A 3ARYA 4TYOA 3O5FA 2D9FA 4ZPWR 4BF8A 2MPHA 2DG9A 5GPRA 3ARZA 1QZ2A 2KGJA 3IKGA 2ZQUA 2XP6A 5DIVA 2ZR6A 5GQBA 2ETNA 2FDMA 3TC5A 1QPFA 1E6NA 3WD2A 1PBKA 4QT3A 4WKFA 4N19A 3RMEA 4P8XA 1HJVA 2K8IA 3WIJA 4QZVB 3JYJA 5HW6A 3CHDA 5HTGA 2A3BA 3NRKA 4WK9A 4DRHA 4PTMA 2VCDA 5JH8A 4ODQA 1Q6UA 3IHZA 4DT4A 1SYTA 4ZS6A 2O9OA 1HKJA 3O5MA 4DWSB 3B7XA 2UZ5A 3KACA 3B8SA 4ODRA 3WD3A 1E6ZA 4W5UA 3UQIA 2LPVA 4TNSA 1LJYA 4ODKA 4P8UA 2DSUA 1EQ3A 1W26A 4HARA 1W1YA 2G8ZA 3O5RA 3O5PA 3CHCA 3O5IA 1E6PA 2IF4A 4URIA 1FKFA 2IUZA 2M2AA 3WQVA 1GRJA 4JYSA 3KAIA 5DO2A 4LAVA 4IQ2A 2F2DA 1HKIA 1GPFA 3ODKA 3AS0A 5HT1A 1HKMA 3KZ7A 1FFQA 2MNTA 4J4OA 4KR0B 3EY6A 2DG3A 1H0GA 2RQSA 1GUVA 4MNLA 1NSGA 4FAPA 4MSPA 1NH6A 2F21A 3IK8A 2VN1A 1XRVA 4TX0A 2PV2A 4JFLA 1FKIA 4S3KA 4ODPA 3WQWA 5I98A 1KFWA 1YW5A 4JFKA 4QT2A 5D75A 1W1TA 1JCHB 3WD1A 1XHGA 2OFNA 2RUCA 3PRDA 4J4NA 1FJDA 3KAGA 1ROTA 2XP9A 3CH9A 3WL1A 1NWTA 1ZBKA 4L3NA 3GTYX 4Q7NA 2DT3A 4QIBA 1LQ0A 4DWSC 3WL0A 4DROA 3G6LA 2PPOA 2ZQSA 4MAVA 3RM4A 4IPXA 1OWQA 2XP7A 3CGMA 3WD4A 3NI6A 5DEZA 4P8WA 3KADA 2LJ4A 4ODLA 2B31A 2L2SA 2F23A 4DRJA 4MTVA 2XP8A 1NWUA 3WD0A 3AQUA 2M1IA 2ZR5A 3AS2A 4Z2GA 2AWGA 3O5QA 4DRQA 1HJWA 2LKNA 2O92A 1YATA 2DT1A 2RSEA 4U86A 1EHNA 1F8AB 4TW7A 1UR8A 4JFIA 3B9AA 3B9DA 1FKTA 1OGBA 2DSVA 2P4VA 4ML4A 1LG2A 1T11A 1WAWA 4W9OA 4ODMA 1W9VA 3UQBA 3CGNA 4MGVA 1K9TA 1ZBCA 1LL4A 3O5JA 3AS3A 1VF8A 3BXWA 4MNKA 4WJXA 2ZQVA 3UQAA 2RUQA 1D2KA 1RD6A 2QF8A 4DWSA 5HKGA 1NMWA 1JVWA 3CHEA 3FXYA 3NTPA 2G41A 1HKKA 3W4RA 4LAXA 3UI5A 3PR9A 3ARXA 1EIBA 3I6CA 4DRPA 3MDYB 5HW7A 1EDQA 2DT0A 4L72B 1HJXA 4WKHA 1SR0A 3ARTA 1J4RA 4ZPTR 3JXVA 2WLYA 3ARVA 1ZCNA 4U85A 4DRIA 4MNMA 4LAWA 4HBOA 4Z2KA 2M08A 1GOIA 2KFWA 3OOBA 5HWBA 4U84A 2PPNA 2Q5AA 1E9LA 1KT0A 1JNEA 4MNJA 3UI4A 3O5OA 5J6EA 3H9RB 1JNDA 3ARRA 1FD9A 4NSBA 1R9HA 1FKGA 1W9PA 3RFWA 1U79A 2FKEA 4JFMA 3RM9A 2WM0A 2XPBA 1J6YA 2EULA 1FFRA 2DSZA 5GPGA 3FAPA 4HBEA 4DRMA 2PBCA 3KAHA 2A3AA 1J4HA 5HWCA 2FAPA 4W9PA 3BMBA 3GU0A 1W1PA 1D7JA 1WNOA 1E6RA 1FKLA 4TW8A 1LL6A 1X6LA 2B5UB 2KI3A 4IT4A 2DG4A 2WLZA 2XP3A 4NZCA 5B8IC 3O5KA 4UDMA 3TCZA 4GIVA 5DF0A 4DRNA 2XPAA 3RM8A 4O2TA 3ARQA 3RGCA 4LGXA 4LAYA 2PI6A 1JNSA 1OGGA 1NWSA 4Z2IA 1FKRA 3EIPA 2MLZA 1FKKA 1D7HA 2MLXA 3ARPA 1JNTA 3O5EA 3TDBA 3KCEA 4DZ2A 2PV3A 1W9UA 1H0IA 1LG1A 4MPKA 3CHFA 4Z2HA 2F4EA 2LGOA 4R5EA 1FKBA 2A3EA 4DH0A 3KABA 1E44A 3O5GA 2A3CA 1J4IA 2DPEA
chains in the Genus database with same CATH topology
2DT2A 4G50A 3O5LA 1Q1CA 4Z2LA 1X6NA 4ODNA 2RURA 4ODOA 4R0XA 1UR9A 1HXVA 3AS1A 3PRAA 1ZBVA 3ALGA 1Q6IA 5BXJA 2MLYA 5DITA 2PV1A 1BKFA 3AROA 1KT1A 1TCOC 4WIWA 4Z2JA 3PRBA 5HUAA 4NNRA 4WKAA 2PPPA 1WB0A 3KAFA 3ARUA 2XP4A 4KQZA 4P8VA 1N1AA 3WH0A 1Q6HA 1ROUA 1D6OA 5DIUA 1NMVA 4TW6A 1Y0OA 1CTNA 1ZK6A 2XP5A 3LUOA 3OA5A 4DRKA 1M5YA 1EYMA 4DZ3A 5HW8A 2MF9A 4S3JA 3PA7A 4IQCA 1D7IA 1ZL1A 2N87A 4W9QA 4JFJA 1W1VA 1BL4A 2KO7A 1FKHA 1ZU8A 3UI6A 2RUDA 1ZBWA 3O5DA 3VAWA 1E15A 1ITXA 4DWSD 2KR7A 1ZB5A 1FAPA 1C9HA 5HBFA 4GGQA 3ARWA 1IX5A 3ARSA 4AY1A 4ITZA 4FN2A 3GPKA 2YBUA 3ALFA 3UF8A 3QOKA 1TFVA 2ESCA 2OLHA 3G6MA 1FKDA 2ITKA 1LL7A 1B6CA 3WKZA 2JZVA 4IT6A 2WK2A 4DIPA 3IKDA 1O6IA 1F40A 1FKSA 2KE0A 2Y78A 3JYMA 4G2PA 2AOSA 4Q22A 4ZPVR 2DSWA 1FKJA 1QPLA 2YBTA 4XAKA 2ZQTA 2ZR4A 1L1PA 1NWRA 1A7XA 4C02B 1P5QA 1PINA 3B9EA 3CZ8A 3FY1A 3ARYA 4TYOA 3O5FA 2D9FA 4ZPWR 4BF8A 2MPHA 2DG9A 5GPRA 3ARZA 1QZ2A 2KGJA 3IKGA 2ZQUA 2XP6A 5DIVA 2ZR6A 5GQBA 2FDMA 3TC5A 1QPFA 1E6NA 3WD2A 1PBKA 4QT3A 4WKFA 4N19A 3RMEA 4P8XA 1HJVA 2K8IA 3WIJA 4QZVB 3JYJA 5HW6A 3CHDA 5HTGA 2A3BA 3NRKA 4WK9A 4DRHA 4PTMA 2VCDA 5JH8A 4ODQA 1Q6UA 3IHZA 4DT4A 1SYTA 4ZS6A 2O9OA 1HKJA 3O5MA 4DWSB 3B7XA 2UZ5A 3KACA 3B8SA 4ODRA 3WD3A 1E6ZA 4W5UA 3UQIA 2LPVA 4TNSA 1LJYA 4ODKA 4P8UA 2DSUA 1EQ3A 1W26A 4HARA 1W1YA 2G8ZA 3O5RA 3O5PA 3CHCA 3O5IA 1E6PA 2IF4A 4URIA 1FKFA 2IUZA 2M2AA 3WQVA 4JYSA 3KAIA 5DO2A 4LAVA 4IQ2A 2F2DA 1HKIA 1GPFA 3ODKA 3AS0A 5HT1A 1HKMA 3KZ7A 1FFQA 2MNTA 4J4OA 4KR0B 3EY6A 2DG3A 1H0GA 2RQSA 1GUVA 4MNLA 1NSGA 4FAPA 4MSPA 1NH6A 2F21A 3IK8A 2VN1A 1XRVA 4TX0A 2PV2A 4JFLA 1FKIA 4S3KA 4ODPA 3WQWA 5I98A 1KFWA 1YW5A 4JFKA 4QT2A 5D75A 1W1TA 3WD1A 1XHGA 2OFNA 2RUCA 3PRDA 4J4NA 1FJDA 3KAGA 1ROTA 2XP9A 3CH9A 3WL1A 1NWTA 1ZBKA 4L3NA 4Q7NA 2DT3A 4QIBA 1LQ0A 4DWSC 3WL0A 4DROA 3G6LA 2PPOA 2ZQSA 4MAVA 3RM4A 4IPXA 1OWQA 2XP7A 3CGMA 3WD4A 3NI6A 5DEZA 4P8WA 3KADA 2LJ4A 4ODLA 2B31A 2L2SA 4DRJA 4MTVA 2XP8A 1NWUA 3WD0A 3AQUA 2M1IA 2ZR5A 3AS2A 4Z2GA 2AWGA 3O5QA 4DRQA 1HJWA 2LKNA 2O92A 1YATA 2DT1A 2RSEA 4U86A 1EHNA 1F8AB 4TW7A 1UR8A 4JFIA 3B9AA 3B9DA 1FKTA 1OGBA 2DSVA 4ML4A 1LG2A 1T11A 1WAWA 4W9OA 4ODMA 1W9VA 3UQBA 3CGNA 4MGVA 1K9TA 1ZBCA 1LL4A 3O5JA 3AS3A 1VF8A 3BXWA 4MNKA 4WJXA 2ZQVA 3UQAA 2RUQA 1D2KA 1RD6A 2QF8A 4DWSA 5HKGA 1NMWA 1JVWA 3CHEA 3FXYA 3NTPA 2G41A 1HKKA 3W4RA 4LAXA 3UI5A 3PR9A 3ARXA 1EIBA 3I6CA 4DRPA 3MDYB 5HW7A 1EDQA 2DT0A 4L72B 1HJXA 4WKHA 1SR0A 3ARTA 1J4RA 4ZPTR 3JXVA 2WLYA 3ARVA 1ZCNA 4U85A 4DRIA 4MNMA 4LAWA 4HBOA 4Z2KA 2M08A 1GOIA 2KFWA 3OOBA 5HWBA 4U84A 2PPNA 2Q5AA 1E9LA 1KT0A 1JNEA 4MNJA 3UI4A 3O5OA 5J6EA 3H9RB 1JNDA 3ARRA 4NSBA 1R9HA 1FKGA 1W9PA 3RFWA 1U79A 2FKEA 4JFMA 3RM9A 2WM0A 2XPBA 1J6YA 1FFRA 2DSZA 5GPGA 3FAPA 4HBEA 4DRMA 2PBCA 3KAHA 2A3AA 1J4HA 5HWCA 2FAPA 4W9PA 1W1PA 1D7JA 1WNOA 1E6RA 1FKLA 4TW8A 1LL6A 1X6LA 2KI3A 4IT4A 2DG4A 2WLZA 2XP3A 4NZCA 5B8IC 3O5KA 3TCZA 4GIVA 5DF0A 4DRNA 2XPAA 3RM8A 4O2TA 3ARQA 3RGCA 4LGXA 4LAYA 2PI6A 1JNSA 1OGGA 1NWSA 4Z2IA 1FKRA 2MLZA 1FKKA 1D7HA 2MLXA 3ARPA 1JNTA 3O5EA 3TDBA 3KCEA 4DZ2A 2PV3A 1W9UA 1H0IA 1LG1A 4MPKA 3CHFA 4Z2HA 2F4EA 2LGOA 4R5EA 1FKBA 2A3EA 4DH0A 3KABA 1FD9A 3O5GA 2A3CA 1J4IA 2DPEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZ7 A;  3NTP A;  4G50 A;  3O5L A;  1Q1C A;  2MNT A;  4LAX A;  2RUR A;  4ODN A;  4J4O A;  3UI5 A;  2ZQT A;  2ZR4 A;  3EY6 A;  2DG3 A;  5DIV A;  2RQS A;  4ODO A;  4R0X A;  1L1P A;  1A7X A;  1NSG A;  4MSP A;  4FAP A;  1HXV A;  3I6C A;  2F21 A;  3IK8 A;  4DRP A;  3MDY B;  2VN1 A;  5HW7 A;  4TX0 A;  2PV2 A;  1P5Q A;  4JFL A;  1Q6I A;  4C02 B;  5BXJ A;  2MLY A;  1FKI A;  5DIT A;  1PIN A;  2PV1 A;  1BKF A;  1J4R A;  3JXV A;  4ODP A;  1ZCN A;  5I98 A;  1KT1 A;  1TCO C;  4U85 A;  4DRI A;  4TYO A;  4LAW A;  1YW5 A;  3O5F A;  3PRB A;  2D9F A;  5HUA A;  4JFK A;  4NNR A;  2PPP A;  3ODK A;  4BF8 A;  2MPH A;  2DG9 A;  2M08 A;  3KAF A;  2XP4 A;  2KFW A;  3OOB A;  4QT2 A;  5HWB A;  1QZ2 A;  2KGJ A;  5D75 A;  1N1A A;  3WH0 A;  3IKG A;  1Q6H A;  4U84 A;  2PPN A;  1ROU A;  1D6O A;  2OFN A;  2RUC A;  2ZQU A;  2XP6 A;  2Q5A A;  3PRD A;  4J4N A;  5DIU A;  2ZR6 A;  1NMV A;  1ROT A;  1Y0O A;  3KAG A;  2XP9 A;  1KT0 A;  1ZK6 A;  2XP5 A;  3LUO A;  4TW6 A;  4DRK A;  1M5Y A;  1EYM A;  4DZ3 A;  3UI4 A;  5HW8 A;  3O5O A;  3TC5 A;  5J6E A;  2MF9 A;  1QPF A;  3H9R B;  3PA7 A;  4IQC A;  1D7I A;  2N87 A;  4W9Q A;  1PBK A;  4QT3 A;  4JFJ A;  1BL4 A;  2KO7 A;  4N19 A;  4QIB A;  1FKH A;  3UI6 A;  2K8I A;  2RUD A;  1R9H A;  1FKG A;  3O5D A;  3RFW A;  1U79 A;  2FKE A;  3VAW A;  4JFM A;  1F40 A;  4DRO A;  3JYJ A;  2XPB A;  2KR7 A;  1FAP A;  1C9H A;  2PPO A;  2ZQS A;  5HW6 A;  1J6Y A;  4GGQ A;  4IPX A;  5HTG A;  2XP7 A;  3CGM A;  5GPG A;  3FAP A;  3NI6 A;  3NRK A;  4DRM A;  2PBC A;  3KAH A;  4DRH A;  1J4H A;  5HWC A;  2FAP A;  4W9P A;  4ITZ A;  4FN2 A;  3KAD A;  2LJ4 A;  3GPK A;  3O5G A;  4ODL A;  1D7J A;  2L2S A;  2VCD A;  3UF8 A;  4DRJ A;  1FKL A;  2XP8 A;  4TW8 A;  4ODQ A;  1Q6U A;  2M1I A;  3IHZ A;  2ZR5 A;  2KI3 A;  2AWG A;  4DT4 A;  2DG4 A;  3O5Q A;  4DRQ A;  2XP3 A;  3O5M A;  5B8I C;  3O5K A;  2LKN A;  3TCZ A;  1YAT A;  3B7X A;  2UZ5 A;  1FKD A;  4GIV A;  4DRN A;  2ITK A;  3KAC A;  2XPA A;  1B6C A;  2RSE A;  4O2T A;  1F8A B;  4ODR A;  4U86 A;  4TW7 A;  4JFI A;  3RGC A;  3UQI A;  4LAY A;  2LPV A;  1FKT A;  4TNS A;  1JNS A;  4ODK A;  2JZV A;  1EQ3 A;  1W26 A;  4DIP A;  1FKR A;  3IKD A;  1T11 A;  4W9O A;  2MLZ A;  3O5R A;  3O5P A;  1FKK A;  4ODM A;  3O5I A;  1D7H A;  3UQB A;  2MLX A;  1JNT A;  3CGN A;  2IF4 A;  3O5E A;  3KCE A;  1FKS A;  2KE0 A;  4MGV A;  1FKF A;  2M2A A;  3TDB A;  2PV3 A;  4DZ2 A;  2Y78 A;  3JYM A;  3O5J A;  4G2P A;  5HT1 A;  4JYS A;  2F4E A;  2ZQV A;  3KAI A;  3UQA A;  2LGO A;  1FJD A;  4LAV A;  4IQ2 A;  2F2D A;  2RUQ A;  1FKJ A;  1FKB A;  4DH0 A;  3KAB A;  1J4I A;  1FD9 A;  5HKG A;  1QPL A;  1NMW A;  1JVW A; 
#chains in the Genus database with same CATH topology
 2DT2 A;  4G50 A;  3O5L A;  1Q1C A;  4Z2L A;  1X6N A;  4ODN A;  2RUR A;  4ODO A;  4R0X A;  1UR9 A;  1HXV A;  3AS1 A;  3PRA A;  1ZBV A;  3ALG A;  1Q6I A;  5BXJ A;  2MLY A;  5DIT A;  2PV1 A;  1BKF A;  3ARO A;  1KT1 A;  1TCO C;  4WIW A;  4Z2J A;  3PRB A;  5HUA A;  4NNR A;  4WKA A;  2PPP A;  1WB0 A;  3KAF A;  3ARU A;  2XP4 A;  4KQZ A;  4P8V A;  1N1A A;  3WH0 A;  1Q6H A;  1ROU A;  1D6O A;  5DIU A;  1NMV A;  4TW6 A;  1Y0O A;  1CTN A;  1ZK6 A;  2XP5 A;  3LUO A;  3OA5 A;  4DRK A;  1M5Y A;  1EYM A;  4DZ3 A;  5HW8 A;  2MF9 A;  4S3J A;  3PA7 A;  4IQC A;  1D7I A;  1ZL1 A;  2N87 A;  4W9Q A;  4JFJ A;  1W1V A;  1BL4 A;  2KO7 A;  1FKH A;  1ZU8 A;  3UI6 A;  2RUD A;  1ZBW A;  3O5D A;  3VAW A;  1E15 A;  1ITX A;  4DWS D;  2KR7 A;  1ZB5 A;  1FAP A;  1C9H A;  5HBF A;  4GGQ A;  3ARW A;  1IX5 A;  3ARS A;  4AY1 A;  4ITZ A;  4FN2 A;  3GPK A;  2YBU A;  3ALF A;  3UF8 A;  3QOK A;  1TFV A;  2ESC A;  2OLH A;  2PN0 A;  3G6M A;  1FKD A;  2ITK A;  1LL7 A;  1B6C A;  3WKZ A;  2JZV A;  4IT6 A;  2WK2 A;  4DIP A;  3IKD A;  1O6I A;  1F40 A;  1FKS A;  2KE0 A;  2Y78 A;  3JYM A;  4G2P A;  2AOS A;  4Q22 A;  4ZPV R;  2DSW A;  1FKJ A;  1QPL A;  2YBT A;  4XAK A;  2ZQT A;  2ZR4 A;  1L1P A;  1NWR A;  1A7X A;  4C02 B;  1P5Q A;  1PIN A;  3B9E A;  3CZ8 A;  3FY1 A;  3ARY A;  4TYO A;  3O5F A;  2D9F A;  4ZPW R;  4BF8 A;  2MPH A;  2DG9 A;  5GPR A;  3ARZ A;  1QZ2 A;  2KGJ A;  3IKG A;  2ZQU A;  2XP6 A;  5DIV A;  2ZR6 A;  5GQB A;  2ETN A;  2FDM A;  3TC5 A;  1QPF A;  1E6N A;  3WD2 A;  1PBK A;  4QT3 A;  4WKF A;  4N19 A;  3RME A;  4P8X A;  1HJV A;  2K8I A;  3WIJ A;  4QZV B;  3JYJ A;  5HW6 A;  3CHD A;  5HTG A;  2A3B A;  3NRK A;  4WK9 A;  4DRH A;  4PTM A;  2VCD A;  5JH8 A;  4ODQ A;  1Q6U A;  3IHZ A;  4DT4 A;  1SYT A;  4ZS6 A;  2O9O A;  1HKJ A;  3O5M A;  4DWS B;  3B7X A;  2UZ5 A;  3KAC A;  3B8S A;  4ODR A;  3WD3 A;  1E6Z A;  4W5U A;  3UQI A;  2LPV A;  4TNS A;  1LJY A;  4ODK A;  4P8U A;  2DSU A;  1EQ3 A;  1W26 A;  4HAR A;  1W1Y A;  2G8Z A;  3O5R A;  3O5P A;  3CHC A;  3O5I A;  1E6P A;  2IF4 A;  4URI A;  1FKF A;  2IUZ A;  2M2A A;  3WQV A;  1GRJ A;  4JYS A;  3KAI A;  5DO2 A;  4LAV A;  4IQ2 A;  2F2D A;  1HKI A;  1GPF A;  3ODK A;  3AS0 A;  5HT1 A;  1HKM A;  3KZ7 A;  1FFQ A;  2MNT A;  4J4O A;  4KR0 B;  3EY6 A;  2DG3 A;  1H0G A;  2RQS A;  1GUV A;  4MNL A;  1NSG A;  4FAP A;  4MSP A;  1NH6 A;  2F21 A;  3IK8 A;  2VN1 A;  1XRV A;  4TX0 A;  2PV2 A;  4JFL A;  1FKI A;  4S3K A;  4ODP A;  3WQW A;  5I98 A;  1KFW A;  1YW5 A;  4JFK A;  4QT2 A;  5D75 A;  1W1T A;  1JCH B;  3WD1 A;  1XHG A;  2OFN A;  2RUC A;  3PRD A;  4J4N A;  1FJD A;  3KAG A;  1ROT A;  2XP9 A;  3CH9 A;  3WL1 A;  1NWT A;  1ZBK A;  4L3N A;  3GTY X;  4Q7N A;  2DT3 A;  4QIB A;  1LQ0 A;  4DWS C;  3WL0 A;  4DRO A;  3G6L A;  2PPO A;  2ZQS A;  4MAV A;  3RM4 A;  4IPX A;  1OWQ A;  2XP7 A;  3CGM A;  3WD4 A;  3NI6 A;  5DEZ A;  4P8W A;  3KAD A;  2LJ4 A;  4ODL A;  2B31 A;  2L2S A;  2F23 A;  4DRJ A;  4MTV A;  2XP8 A;  1NWU A;  3WD0 A;  3AQU A;  2M1I A;  2ZR5 A;  3AS2 A;  4Z2G A;  2AWG A;  3O5Q A;  4DRQ A;  1HJW A;  2LKN A;  2O92 A;  1YAT A;  2DT1 A;  2RSE A;  4U86 A;  1EHN A;  1F8A B;  4TW7 A;  1UR8 A;  4JFI A;  3B9A A;  3B9D A;  1FKT A;  1OGB A;  2DSV A;  2P4V A;  4ML4 A;  1LG2 A;  1T11 A;  1WAW A;  4W9O A;  4ODM A;  1W9V A;  3UQB A;  3CGN A;  4MGV A;  1K9T A;  1ZBC A;  1LL4 A;  3O5J A;  3AS3 A;  1VF8 A;  3BXW A;  4MNK A;  4WJX A;  2ZQV A;  3UQA A;  2RUQ A;  1D2K A;  1RD6 A;  2QF8 A;  4DWS A;  5HKG A;  1NMW A;  1JVW A;  3CHE A;  3FXY A;  3NTP A;  2G41 A;  1HKK A;  3W4R A;  4LAX A;  3UI5 A;  3PR9 A;  3ARX A;  1EIB A;  3I6C A;  4DRP A;  3MDY B;  5HW7 A;  1EDQ A;  2DT0 A;  4L72 B;  1HJX A;  4WKH A;  1SR0 A;  3ART A;  1J4R A;  4ZPT R;  3JXV A;  2WLY A;  3ARV A;  1ZCN A;  4U85 A;  4DRI A;  4MNM A;  4LAW A;  4HBO A;  4Z2K A;  2M08 A;  1GOI A;  2KFW A;  3OOB A;  5HWB A;  4U84 A;  2PPN A;  2Q5A A;  1E9L A;  1KT0 A;  1JNE A;  4MNJ A;  3UI4 A;  3O5O A;  5J6E A;  3H9R B;  1JND A;  3ARR A;  1FD9 A;  4NSB A;  1R9H A;  1FKG A;  1W9P A;  3RFW A;  1U79 A;  2FKE A;  4JFM A;  3RM9 A;  2WM0 A;  2XPB A;  1J6Y A;  2EUL A;  1FFR A;  2DSZ A;  5GPG A;  3FAP A;  4HBE A;  4DRM A;  2PBC A;  3KAH A;  2A3A A;  1J4H A;  5HWC A;  2FAP A;  4W9P A;  3BMB A;  3GU0 A;  1W1P A;  1D7J A;  1WNO A;  1E6R A;  1FKL A;  4TW8 A;  1LL6 A;  1X6L A;  2B5U B;  2KI3 A;  4IT4 A;  2DG4 A;  2WLZ A;  2XP3 A;  4NZC A;  5B8I C;  3O5K A;  4UDM A;  3TCZ A;  4GIV A;  5DF0 A;  4DRN A;  2XPA A;  3RM8 A;  4O2T A;  3ARQ A;  3RGC A;  4LGX A;  4LAY A;  2PI6 A;  1JNS A;  1OGG A;  1NWS A;  4Z2I A;  1FKR A;  3EIP A;  2MLZ A;  1FKK A;  1D7H A;  2MLX A;  3ARP A;  1JNT A;  3O5E A;  3TDB A;  3KCE A;  4DZ2 A;  2PV3 A;  1W9U A;  1H0I A;  1LG1 A;  4MPK A;  3CHF A;  4Z2H A;  2F4E A;  2LGO A;  4R5E A;  1FKB A;  2A3E A;  4DH0 A;  3KAB A;  1E44 A;  3O5G A;  2A3C A;  1J4I A;  2DPE A; 
#chains in the Genus database with same CATH homology
 2DT2 A;  4G50 A;  3O5L A;  1Q1C A;  4Z2L A;  1X6N A;  4ODN A;  2RUR A;  4ODO A;  4R0X A;  1UR9 A;  1HXV A;  3AS1 A;  3PRA A;  1ZBV A;  3ALG A;  1Q6I A;  5BXJ A;  2MLY A;  5DIT A;  2PV1 A;  1BKF A;  3ARO A;  1KT1 A;  1TCO C;  4WIW A;  4Z2J A;  3PRB A;  5HUA A;  4NNR A;  4WKA A;  2PPP A;  1WB0 A;  3KAF A;  3ARU A;  2XP4 A;  4KQZ A;  4P8V A;  1N1A A;  3WH0 A;  1Q6H A;  1ROU A;  1D6O A;  5DIU A;  1NMV A;  4TW6 A;  1Y0O A;  1CTN A;  1ZK6 A;  2XP5 A;  3LUO A;  3OA5 A;  4DRK A;  1M5Y A;  1EYM A;  4DZ3 A;  5HW8 A;  2MF9 A;  4S3J A;  3PA7 A;  4IQC A;  1D7I A;  1ZL1 A;  2N87 A;  4W9Q A;  4JFJ A;  1W1V A;  1BL4 A;  2KO7 A;  1FKH A;  1ZU8 A;  3UI6 A;  2RUD A;  1ZBW A;  3O5D A;  3VAW A;  1E15 A;  1ITX A;  4DWS D;  2KR7 A;  1ZB5 A;  1FAP A;  1C9H A;  5HBF A;  4GGQ A;  3ARW A;  1IX5 A;  3ARS A;  4AY1 A;  4ITZ A;  4FN2 A;  3GPK A;  2YBU A;  3ALF A;  3UF8 A;  3QOK A;  1TFV A;  2ESC A;  2OLH A;  3G6M A;  1FKD A;  2ITK A;  1LL7 A;  1B6C A;  3WKZ A;  2JZV A;  4IT6 A;  2WK2 A;  4DIP A;  3IKD A;  1O6I A;  1F40 A;  1FKS A;  2KE0 A;  2Y78 A;  3JYM A;  4G2P A;  2AOS A;  4Q22 A;  4ZPV R;  2DSW A;  1FKJ A;  1QPL A;  2YBT A;  4XAK A;  2ZQT A;  2ZR4 A;  1L1P A;  1NWR A;  1A7X A;  4C02 B;  1P5Q A;  1PIN A;  3B9E A;  3CZ8 A;  3FY1 A;  3ARY A;  4TYO A;  3O5F A;  2D9F A;  4ZPW R;  4BF8 A;  2MPH A;  2DG9 A;  5GPR A;  3ARZ A;  1QZ2 A;  2KGJ A;  3IKG A;  2ZQU A;  2XP6 A;  5DIV A;  2ZR6 A;  5GQB A;  2FDM A;  3TC5 A;  1QPF A;  1E6N A;  3WD2 A;  1PBK A;  4QT3 A;  4WKF A;  4N19 A;  3RME A;  4P8X A;  1HJV A;  2K8I A;  3WIJ A;  4QZV B;  3JYJ A;  5HW6 A;  3CHD A;  5HTG A;  2A3B A;  3NRK A;  4WK9 A;  4DRH A;  4PTM A;  2VCD A;  5JH8 A;  4ODQ A;  1Q6U A;  3IHZ A;  4DT4 A;  1SYT A;  4ZS6 A;  2O9O A;  1HKJ A;  3O5M A;  4DWS B;  3B7X A;  2UZ5 A;  3KAC A;  3B8S A;  4ODR A;  3WD3 A;  1E6Z A;  4W5U A;  3UQI A;  2LPV A;  4TNS A;  1LJY A;  4ODK A;  4P8U A;  2DSU A;  1EQ3 A;  1W26 A;  4HAR A;  1W1Y A;  2G8Z A;  3O5R A;  3O5P A;  3CHC A;  3O5I A;  1E6P A;  2IF4 A;  4URI A;  1FKF A;  2IUZ A;  2M2A A;  3WQV A;  4JYS A;  3KAI A;  5DO2 A;  4LAV A;  4IQ2 A;  2F2D A;  1HKI A;  1GPF A;  3ODK A;  3AS0 A;  5HT1 A;  1HKM A;  3KZ7 A;  1FFQ A;  2MNT A;  4J4O A;  4KR0 B;  3EY6 A;  2DG3 A;  1H0G A;  2RQS A;  1GUV A;  4MNL A;  1NSG A;  4FAP A;  4MSP A;  1NH6 A;  2F21 A;  3IK8 A;  2VN1 A;  1XRV A;  4TX0 A;  2PV2 A;  4JFL A;  1FKI A;  4S3K A;  4ODP A;  3WQW A;  5I98 A;  1KFW A;  1YW5 A;  4JFK A;  4QT2 A;  5D75 A;  1W1T A;  3WD1 A;  1XHG A;  2OFN A;  2RUC A;  3PRD A;  4J4N A;  1FJD A;  3KAG A;  1ROT A;  2XP9 A;  3CH9 A;  3WL1 A;  1NWT A;  1ZBK A;  4L3N A;  4Q7N A;  2DT3 A;  4QIB A;  1LQ0 A;  4DWS C;  3WL0 A;  4DRO A;  3G6L A;  2PPO A;  2ZQS A;  4MAV A;  3RM4 A;  4IPX A;  1OWQ A;  2XP7 A;  3CGM A;  3WD4 A;  3NI6 A;  5DEZ A;  4P8W A;  3KAD A;  2LJ4 A;  4ODL A;  2B31 A;  2L2S A;  4DRJ A;  4MTV A;  2XP8 A;  1NWU A;  3WD0 A;  3AQU A;  2M1I A;  2ZR5 A;  3AS2 A;  4Z2G A;  2AWG A;  3O5Q A;  4DRQ A;  1HJW A;  2LKN A;  2O92 A;  1YAT A;  2DT1 A;  2RSE A;  4U86 A;  1EHN A;  1F8A B;  4TW7 A;  1UR8 A;  4JFI A;  3B9A A;  3B9D A;  1FKT A;  1OGB A;  2DSV A;  4ML4 A;  1LG2 A;  1T11 A;  1WAW A;  4W9O A;  4ODM A;  1W9V A;  3UQB A;  3CGN A;  4MGV A;  1K9T A;  1ZBC A;  1LL4 A;  3O5J A;  3AS3 A;  1VF8 A;  3BXW A;  4MNK A;  4WJX A;  2ZQV A;  3UQA A;  2RUQ A;  1D2K A;  1RD6 A;  2QF8 A;  4DWS A;  5HKG A;  1NMW A;  1JVW A;  3CHE A;  3FXY A;  3NTP A;  2G41 A;  1HKK A;  3W4R A;  4LAX A;  3UI5 A;  3PR9 A;  3ARX A;  1EIB A;  3I6C A;  4DRP A;  3MDY B;  5HW7 A;  1EDQ A;  2DT0 A;  4L72 B;  1HJX A;  4WKH A;  1SR0 A;  3ART A;  1J4R A;  4ZPT R;  3JXV A;  2WLY A;  3ARV A;  1ZCN A;  4U85 A;  4DRI A;  4MNM A;  4LAW A;  4HBO A;  4Z2K A;  2M08 A;  1GOI A;  2KFW A;  3OOB A;  5HWB A;  4U84 A;  2PPN A;  2Q5A A;  1E9L A;  1KT0 A;  1JNE A;  4MNJ A;  3UI4 A;  3O5O A;  5J6E A;  3H9R B;  1JND A;  3ARR A;  4NSB A;  1R9H A;  1FKG A;  1W9P A;  3RFW A;  1U79 A;  2FKE A;  4JFM A;  3RM9 A;  2WM0 A;  2XPB A;  1J6Y A;  1FFR A;  2DSZ A;  5GPG A;  3FAP A;  4HBE A;  4DRM A;  2PBC A;  3KAH A;  2A3A A;  1J4H A;  5HWC A;  2FAP A;  4W9P A;  1W1P A;  1D7J A;  1WNO A;  1E6R A;  1FKL A;  4TW8 A;  1LL6 A;  1X6L A;  2KI3 A;  4IT4 A;  2DG4 A;  2WLZ A;  2XP3 A;  4NZC A;  5B8I C;  3O5K A;  3TCZ A;  4GIV A;  5DF0 A;  4DRN A;  2XPA A;  3RM8 A;  4O2T A;  3ARQ A;  3RGC A;  4LGX A;  4LAY A;  2PI6 A;  1JNS A;  1OGG A;  1NWS A;  4Z2I A;  1FKR A;  2MLZ A;  1FKK A;  1D7H A;  2MLX A;  3ARP A;  1JNT A;  3O5E A;  3TDB A;  3KCE A;  4DZ2 A;  2PV3 A;  1W9U A;  1H0I A;  1LG1 A;  4MPK A;  3CHF A;  4Z2H A;  2F4E A;  2LGO A;  4R5E A;  1FKB A;  2A3E A;  4DH0 A;  3KAB A;  1FD9 A;  3O5G A;  2A3C A;  1J4I A;  2DPE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...