3O5LA

Fk1 domain mutant a19t of fkbp51, crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 38
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5lA00
1NSGA 3VAWA 2DG9A 2IF4A 2LGOA 3O5GA 2PBCA 4ODPA 1ROTA 4DZ2A 1W26A 1Q6UA 2XPBA 3CGMA 4ODNA 1PINA 4JFIA 3O5EA 1D7JA 1TCOC 2PPOA 1D7IA 2Q5AA 3KAFA 1M5YA 4DH0A 5HW7A 3TC5A 3ODKA 5GPGA 1FJDA 3TDBA 1KT1A 2ZR5A 4U84A 5D75A 1JNSA 2M2AA 2PV2A 2XP4A 1A7XA 5DITA 2LJ4A 2MF9A 3NRKA 1L1PA 1JVWA 2KE0A 1ZK6A 3WH0A 3JYJA 2ZQTA 2D9FA 1FKBA 4DT4A 2RUCA 3KACA 1FKJA 2XP9A 1QPLA 4IPXA 4TYOA 2RQSA 2M1IA 2ZR4A 1NMVA 4DRKA 2ZQSA 2MLYA 3PA7A 3LUOA 3PRDA 1YATA 3KAHA 4BF8A 4MGVA 4TW6A 1Q1CA 2VCDA 4DROA 3IHZA 4G2PA 2F21A 3O5PA 2LPVA 4TNSA 3GPKA 5I98A 2KGJA 2OFNA 2UZ5A 3KABA 1J6YA 5HKGA 4FN2A 2PPPA 3NI6A 4IQCA 3KADA 1ROUA 5DIVA 5HW6A 3O5RA 2XPAA 3O5DA 1FKDA 2KI3A 4DRPA 2Y78A 1B6CA 3O5KA 1QPFA 4DRNA 4ODOA 5HUAA 2MLZA 4DRHA 3NTPA 1J4HA 2XP7A 4JFKA 4TW8A 3KZ7A 4W9QA 1R9HA 2F4EA 3PRBA 1BKFA 4N19A 3I6CA 5HT1A 3TCZA 3RGCA 1FKFA 2MLXA 1FAPA 2MNTA 3KAGA 1FKGA 3H9RB 2PV3A 3FAPA 3O5OA 2ZQUA 3O5LA 3UI5A 1FKLA 1F40A 2L2SA 2AWGA 1EQ3A 2FAPA 3JXVA 4MSPA 4R0XA 4LAXA 4QT3A 4C02B 5B8IC 2RURA 2DG4A 4TW7A 1KT0A 2ITKA 4U86A 3IKGA 4O2TA 4ODRA 1FKTA 1N1AA 3O5QA 4DRJA 2KO7A 3KCEA 1FKHA 4DRIA 4J4OA 3UQAA 1PBKA 1C9HA 2LKNA 2N87A 4LAYA 1D6OA 2ZQVA 4GIVA 4JFJA 4ODLA 4GGQA 3UQBA 2PPNA 1YW5A 3RFWA 3O5MA 2DG3A 2PV1A 2KR7A 2VN1A 1Q6HA 2JZVA 4ODQA 1JNTA 4W9OA 5HWCA 4TX0A 5BXJA 2F2DA 3IK8A 2XP5A 3IKDA 2MPHA 3CGNA 4DIPA 1U79A 5J6EA 4DRQA 5DIUA 3O5JA 1FKRA 4LAVA 4LAWA 4G50A 4QIBA 4U85A 3MDYB 3OOBA 3UI6A 3UQIA 4ODKA 1J4IA 4DRMA 1T11A 1FKIA 3KAIA 5HW8A 2KFWA 4DZ3A 4QT2A 1J4RA 1ZCNA 2RUDA 3B7XA 1FKSA 4J4NA 1Y0OA 2XP3A 1FD9A 3O5FA 1FKKA 1QZ2A 2XP6A 2M08A 2RSEA 2K8IA 4IQ2A 4ITZA 4JFMA 1D7HA 2FKEA 1P5QA 1EYMA 2XP8A 2ZR6A 3EY6A 2RUQA 3O5IA 4NNRA 4W9PA 4FAPA 1Q6IA 4JFLA 5HWBA 4ODMA 3UI4A 1BL4A 5HTGA 1NMWA 1HXVA 3UF8A 3JYMA 4JYSA 1F8AB
chains in the Genus database with same CATH superfamily
3VAWA 4IT4A 3O5GA 2DT3A 1O6IA 4ODNA 4JFIA 1ITXA 3O5EA 1M5YA 4S3JA 4ZPWR 4DWSC 1ZBKA 1E6ZA 4S3KA 2DT0A 1GPFA 1K9TA 1SR0A 3RM8A 2RUCA 1QPLA 4IPXA 2A3BA 2RQSA 4W5UA 2WLZA 1FFRA 4DRKA 1ZL1A 2ZQSA 4MNMA 3PRDA 3KAHA 1IX5A 4G2PA 2F21A 1HKMA 1WAWA 5I98A 1CTNA 1J6YA 4IQCA 4MPKA 1ROUA 3WL1A 2XPAA 4WKAA 2KI3A 3O5KA 1QPFA 3WD4A 3RM9A 4DRHA 2F23A 1J4HA 5DF0A 1E6PA 2F4EA 3AROA 5HT1A 1H0IA 4P8XA 4PTMA 2ETNA 2ESCA 2ZQUA 2L2SA 2WLYA 4Q22A 1LL7A 3ARZA 4LAXA 4QT3A 1W9VA 2RURA 2DG4A 4TW7A 2FDMA 4ODRA 1FKHA 4J4OA 3UQAA 1PBKA 1WNOA 5DO2A 1D6OA 4JFJA 4ODLA 1HKJA 2PPNA 2PN0A 2KR7A 2A3CA 5HWCA 4TX0A 5BXJA 3IK8A 3IKDA 4UDMA 2MPHA 2A3EA 3CGNA 4URIA 1JNSA 5DIUA 3B8SA 4LAVA 3WIJA 4WKFA 1T11A 1GOIA 3ARWA 4HBEA 4J4NA 2XP3A 1FD9A 1FKKA 1QZ2A 4ITZA 1D7HA 2XP8A 3EY6A 4NNRA 2A3AA 4NZCA 2DT2A 1NMWA 3RMEA 2DG9A 2IF4A 4Z2LA 1ROTA 2G8ZA 3CHFA 3CGMA 1PINA 2YBUA 2PPOA 4DH0A 4IT6A 5HW7A 3TC5A 2DPEA 1NWRA 3WL0A 5GPGA 1KT1A 5GQBA 2DSZA 3ARYA 1EIBA 2PV2A 2XP4A 2MF9A 1JVWA 1NH6A 3WH0A 4DT4A 3KACA 4TYOA 2M1IA 2ZR4A 1NMVA 2MLYA 3PA7A 1YATA 4DROA 1TFVA 4R5EA 3GPKA 2OFNA 3ARVA 3KABA 3QOKA 4FN2A 4WK9A 2IUZA 1FKDA 1B6CA 3CH9A 3WD2A 3AS1A 4MAVA 4ODOA 1LG1A 2MLZA 1JNEA 3NTPA 4MTVA 2XP7A 1E15A 1R9HA 1XRVA 1H0GA 2P4VA 3O5LA 3FAPA 4Z2GA 3UI5A 2AWGA 2WK2A 2FAPA 4MSPA 1EDQA 5B8IC 1W1YA 3B9DA 1FKTA 1HJXA 4DRJA 2KO7A 4LGXA 1XHGA 4DRIA 1HKIA 2N87A 1UR8A 4GIVA 3UQBA 3WKZA 4GGQA 2PV1A 3ARPA 1Q6HA 1OGBA 2F2DA 5J6EA 2XP5A 4HBOA 3CZ8A 4NSBA 4DIPA 1FKRA 3GTYX 1HJWA 3BMBA 2YBTA 1ZB5A 4ODKA 3KAIA 5HW8A 4ML4A 1J4RA 1ZCNA 3WD1A 1FKSA 2AOSA 2DSUA 3O5FA 4WIWA 4IQ2A 2RSEA 4L72B 1X6LA 3CHDA 2WM0A 1VF8A 2ZR6A 1E6RA 1Q6IA 2DSWA 3AS2A 1X6NA 1NSGA 3ARTA 1W9UA 2LGOA 3OA5A 4ODPA 4DZ2A 5DEZA 4XAKA 2G41A 3ODKA 1W1VA 2ZR5A 4U84A 2M2AA 4Z2JA 3NRKA 4WJXA 1HKKA 1FKBA 2D9FA 3EIPA 3AQUA 2XP9A 3LUOA 4BF8A 4MGVA 4DWSD 2VCDA 1E6NA 2B5UB 2KGJA 1WB0A 2PPPA 3NI6A 3KADA 3G6MA 5DIVA 5HW6A 3O5DA 2B31A 4DRPA 3AS0A 1W9PA 3WQVA 4Q7NA 4DRNA 5GPRA 4JFKA 4W9QA 4N19A 3I6CA 3RGCA 3PRAA 1FKGA 1F40A 1NWUA 1E9LA 1ZBCA 3JXVA 3ALGA 2O92A 4P8VA 4P8UA 3WQWA 1HJVA 1KT0A 2ITKA 3IKGA 4O2TA 3O5QA 4Z2KA 3KCEA 1C9HA 2LKNA 4LAYA 3RFWA 2DG3A 1FFQA 1SYTA 2O9OA 2JZVA 3B9AA 3O5JA 3UI6A 4QIBA 4U85A 3MDYB 3ARXA 3W4RA 2KFWA 1LG2A 2RUDA 3B7XA 3GU0A 1Y0OA 4DWSB 1JCHB 2XP6A 2M08A 4JFMA 5HUAA 1P5QA 1EYMA 3WD0A 5HWBA 4ODMA 3UI4A 1BL4A 5HTGA 3UF8A 3JYMA 4JYSA 1F8AB 2PBCA 1NWTA 4P8WA 1W26A 1Q6UA 2XPBA 3RM4A 2OLHA 3FY1A 1D7JA 1TCOC 1D7IA 2Q5AA 3ALFA 1OGGA 4HARA 3AS3A 4MNKA 5HBFA 1FJDA 3TDBA 1E44A 5D75A 1L1PA 1A7XA 5DITA 2LJ4A 4WKHA 3CHCA 2PI6A 2KE0A 1ZK6A 3FXYA 3JYJA 4KR0B 2ZQTA 1LQ0A 1FKJA 1GRJA 1ZBVA 4MNLA 3ARRA 4L3NA 4TW6A 1Q1CA 3IHZA 3O5PA 2LPVA 4TNSA 4AY1A 4MNJA 2UZ5A 1NWSA 5HKGA 5JH8A 4ZPVR 1W1TA 3O5RA 3ARUA 1W1PA 2Y78A 4Z2HA 4TW8A 3KZ7A 3PRBA 1BKFA 3TCZA 1FKFA 2MLXA 1FAPA 2MNTA 3KAGA 2QF8A 3H9RB 2PV3A 3B9EA 3G6LA 3O5OA 4QZVB 1FKLA 1EQ3A 3ARSA 4KQZA 4R0XA 4ZS6A 4C02B 4ZPTR 3CHEA 4U86A 2DT1A 1N1AA 4DWSA 3PR9A 2EULA 1GUVA 2ZQVA 1LL6A 1YW5A 4Z2IA 3O5MA 3ARQA 2VN1A 1ZBWA 4ODQA 4W9OA 1JNTA 3BXWA 1U79A 4DRQA 4LAWA 4G50A 4DRMA 3UQIA 3OOBA 3WD3A 1J4IA 2DSVA 1FKIA 4DZ3A 4QT2A 1OWQA 1UR9A 1ZU8A 1RD6A 2K8IA 1JNDA 1LL4A 2FKEA 1D2KA 3O5IA 2RUQA 4W9PA 4FAPA 1EHNA 4JFLA 1KFWA 1HXVA 3KAFA 1LJYA
chains in the Genus database with same CATH topology
3VAWA 4IT4A 3O5GA 2DT3A 1O6IA 4ODNA 4JFIA 1ITXA 3O5EA 1M5YA 4S3JA 4ZPWR 4DWSC 1ZBKA 1E6ZA 4S3KA 2DT0A 1GPFA 1K9TA 1SR0A 3RM8A 2RUCA 1QPLA 4IPXA 2A3BA 2RQSA 4W5UA 2WLZA 1FFRA 4DRKA 1ZL1A 2ZQSA 4MNMA 3PRDA 3KAHA 1IX5A 4G2PA 2F21A 1HKMA 1WAWA 5I98A 1CTNA 1J6YA 4IQCA 4MPKA 1ROUA 3WL1A 2XPAA 4WKAA 2KI3A 3O5KA 1QPFA 3WD4A 3RM9A 4DRHA 1J4HA 5DF0A 1E6PA 2F4EA 3AROA 5HT1A 1H0IA 4P8XA 4PTMA 2ESCA 2ZQUA 2L2SA 2WLYA 4Q22A 1LL7A 3ARZA 4LAXA 4QT3A 1W9VA 2RURA 2DG4A 4TW7A 2FDMA 4ODRA 1FKHA 4J4OA 3UQAA 1PBKA 1WNOA 5DO2A 1D6OA 4JFJA 4ODLA 1HKJA 2PPNA 2KR7A 2A3CA 5HWCA 4TX0A 5BXJA 3IK8A 3IKDA 1JNSA 2MPHA 2A3EA 3CGNA 4URIA 5DIUA 3B8SA 4LAVA 3WIJA 4WKFA 1T11A 1GOIA 3ARWA 4HBEA 4J4NA 2XP3A 1FD9A 1FKKA 1QZ2A 4ITZA 1D7HA 2XP8A 3EY6A 4NNRA 2A3AA 4NZCA 2DT2A 1NMWA 3RMEA 2DG9A 2IF4A 4Z2LA 1ROTA 2G8ZA 3CHFA 3CGMA 1PINA 2YBUA 2PPOA 4DH0A 4IT6A 5HW7A 3TC5A 2DPEA 1NWRA 3WL0A 5GPGA 1KT1A 5GQBA 2DSZA 3ARYA 1EIBA 2PV2A 2XP4A 2MF9A 1JVWA 1NH6A 3WH0A 4DT4A 3KACA 4TYOA 2M1IA 2ZR4A 1NMVA 2MLYA 3PA7A 1YATA 4DROA 1TFVA 4R5EA 3GPKA 2OFNA 3ARVA 3KABA 3QOKA 4FN2A 4WK9A 2IUZA 1FKDA 1B6CA 3CH9A 3WD2A 3AS1A 4MAVA 4ODOA 1LG1A 2MLZA 1JNEA 3NTPA 4MTVA 2XP7A 1E15A 1R9HA 1XRVA 1H0GA 3O5LA 3FAPA 4Z2GA 3UI5A 2AWGA 2WK2A 2FAPA 4MSPA 1EDQA 5B8IC 1W1YA 3B9DA 1FKTA 1HJXA 4DRJA 2KO7A 4LGXA 1XHGA 4DRIA 1HKIA 2N87A 1UR8A 4GIVA 3UQBA 3WKZA 4GGQA 2PV1A 3ARPA 1Q6HA 1OGBA 2F2DA 5J6EA 2XP5A 4HBOA 3CZ8A 4NSBA 4DIPA 1FKRA 1HJWA 2YBTA 1ZB5A 4ODKA 3KAIA 5HW8A 4ML4A 1J4RA 1ZCNA 3WD1A 1FKSA 2AOSA 2DSUA 3O5FA 4WIWA 4IQ2A 2RSEA 4L72B 1X6LA 3CHDA 2WM0A 1VF8A 2ZR6A 1E6RA 1Q6IA 2DSWA 3AS2A 1X6NA 1NSGA 3ARTA 1W9UA 2LGOA 3OA5A 4ODPA 4DZ2A 5DEZA 4XAKA 2G41A 3ODKA 1W1VA 2ZR5A 4U84A 2M2AA 4Z2JA 3NRKA 4WJXA 1HKKA 1FKBA 2D9FA 3AQUA 2XP9A 3LUOA 4BF8A 4MGVA 4DWSD 2VCDA 1E6NA 2KGJA 1WB0A 2PPPA 3NI6A 3KADA 3G6MA 5DIVA 5HW6A 3O5DA 2B31A 4DRPA 3AS0A 1W9PA 3WQVA 4Q7NA 4DRNA 5GPRA 4JFKA 4W9QA 4N19A 3I6CA 3RGCA 3PRAA 1FKGA 1F40A 1NWUA 1E9LA 1ZBCA 3JXVA 3ALGA 2O92A 4P8VA 4P8UA 3WQWA 1HJVA 1KT0A 2ITKA 3IKGA 4O2TA 3O5QA 4Z2KA 3KCEA 1C9HA 2LKNA 4LAYA 3RFWA 2DG3A 1FFQA 1SYTA 2O9OA 2JZVA 3B9AA 3O5JA 3UI6A 4QIBA 4U85A 3MDYB 3ARXA 3W4RA 2KFWA 1LG2A 2RUDA 3B7XA 1Y0OA 4DWSB 2XP6A 2M08A 4JFMA 5HUAA 1P5QA 1EYMA 3WD0A 5HWBA 4ODMA 3UI4A 1BL4A 5HTGA 3UF8A 3JYMA 4JYSA 1F8AB 2PBCA 1NWTA 4P8WA 1W26A 1Q6UA 2XPBA 3RM4A 2OLHA 3FY1A 1D7JA 1TCOC 1D7IA 2Q5AA 3ALFA 1OGGA 4HARA 3AS3A 4MNKA 5HBFA 1FJDA 3TDBA 5D75A 1L1PA 1A7XA 5DITA 2LJ4A 4WKHA 3CHCA 2PI6A 2KE0A 1ZK6A 3FXYA 3JYJA 4KR0B 2ZQTA 1LQ0A 1FKJA 1ZBVA 4MNLA 3ARRA 4L3NA 4TW6A 1Q1CA 3IHZA 3O5PA 2LPVA 4TNSA 4AY1A 4MNJA 2UZ5A 1NWSA 5HKGA 5JH8A 4ZPVR 1W1TA 3O5RA 3ARUA 1W1PA 2Y78A 4Z2HA 4TW8A 3KZ7A 3PRBA 1BKFA 3TCZA 1FKFA 2MLXA 1FAPA 2MNTA 3KAGA 2QF8A 3H9RB 2PV3A 3O5OA 3B9EA 3G6LA 4QZVB 1FKLA 1EQ3A 3ARSA 4KQZA 4R0XA 4ZS6A 4C02B 4ZPTR 3CHEA 4U86A 2DT1A 1N1AA 4DWSA 3PR9A 1GUVA 2ZQVA 1LL6A 1YW5A 4Z2IA 3O5MA 3ARQA 2VN1A 1ZBWA 4ODQA 4W9OA 1JNTA 3BXWA 1U79A 4DRQA 4LAWA 4G50A 4DRMA 3UQIA 3OOBA 3WD3A 1J4IA 2DSVA 1FKIA 4DZ3A 4QT2A 1OWQA 1UR9A 1ZU8A 1RD6A 2K8IA 1JNDA 1LL4A 2FKEA 1D2KA 3O5IA 2RUQA 4W9PA 4FAPA 1EHNA 4JFLA 1KFWA 1HXVA 3KAFA 1LJYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSG A;  3VAW A;  2DG9 A;  2IF4 A;  2LGO A;  3O5G A;  2PBC A;  4ODP A;  1ROT A;  4DZ2 A;  1W26 A;  1Q6U A;  2XPB A;  3CGM A;  4ODN A;  1PIN A;  4JFI A;  3O5E A;  1D7J A;  1TCO C;  2PPO A;  1D7I A;  2Q5A A;  3KAF A;  1M5Y A;  4DH0 A;  5HW7 A;  3TC5 A;  3ODK A;  5GPG A;  1FJD A;  3TDB A;  1KT1 A;  2ZR5 A;  4U84 A;  5D75 A;  1JNS A;  2M2A A;  2PV2 A;  2XP4 A;  1A7X A;  5DIT A;  2LJ4 A;  2MF9 A;  3NRK A;  1L1P A;  1JVW A;  2KE0 A;  1ZK6 A;  3WH0 A;  3JYJ A;  2ZQT A;  2D9F A;  1FKB A;  4DT4 A;  2RUC A;  3KAC A;  1FKJ A;  2XP9 A;  1QPL A;  4IPX A;  4TYO A;  2RQS A;  2M1I A;  2ZR4 A;  1NMV A;  4DRK A;  2ZQS A;  2MLY A;  3PA7 A;  3LUO A;  3PRD A;  1YAT A;  3KAH A;  4BF8 A;  4MGV A;  4TW6 A;  1Q1C A;  2VCD A;  4DRO A;  3IHZ A;  4G2P A;  2F21 A;  3O5P A;  2LPV A;  4TNS A;  3GPK A;  5I98 A;  2KGJ A;  2OFN A;  2UZ5 A;  3KAB A;  1J6Y A;  5HKG A;  4FN2 A;  2PPP A;  3NI6 A;  4IQC A;  3KAD A;  1ROU A;  5DIV A;  5HW6 A;  3O5R A;  2XPA A;  3O5D A;  1FKD A;  2KI3 A;  4DRP A;  2Y78 A;  1B6C A;  3O5K A;  1QPF A;  4DRN A;  4ODO A;  5HUA A;  2MLZ A;  4DRH A;  3NTP A;  1J4H A;  2XP7 A;  4JFK A;  4TW8 A;  3KZ7 A;  4W9Q A;  1R9H A;  2F4E A;  3PRB A;  1BKF A;  4N19 A;  3I6C A;  5HT1 A;  3TCZ A;  3RGC A;  1FKF A;  2MLX A;  1FAP A;  2MNT A;  3KAG A;  1FKG A;  3H9R B;  2PV3 A;  3FAP A;  3O5O A;  2ZQU A;  3O5L A;  3UI5 A;  1FKL A;  1F40 A;  2L2S A;  2AWG A;  1EQ3 A;  2FAP A;  3JXV A;  4MSP A;  4R0X A;  4LAX A;  4QT3 A;  4C02 B;  5B8I C;  2RUR A;  2DG4 A;  4TW7 A;  1KT0 A;  2ITK A;  4U86 A;  3IKG A;  4O2T A;  4ODR A;  1FKT A;  1N1A A;  3O5Q A;  4DRJ A;  2KO7 A;  3KCE A;  1FKH A;  4DRI A;  4J4O A;  3UQA A;  1PBK A;  1C9H A;  2LKN A;  2N87 A;  4LAY A;  1D6O A;  2ZQV A;  4GIV A;  4JFJ A;  4ODL A;  4GGQ A;  3UQB A;  2PPN A;  1YW5 A;  3RFW A;  3O5M A;  2DG3 A;  2PV1 A;  2KR7 A;  2VN1 A;  1Q6H A;  2JZV A;  4ODQ A;  1JNT A;  4W9O A;  5HWC A;  4TX0 A;  5BXJ A;  2F2D A;  3IK8 A;  2XP5 A;  3IKD A;  2MPH A;  3CGN A;  4DIP A;  1U79 A;  5J6E A;  4DRQ A;  5DIU A;  3O5J A;  1FKR A;  4LAV A;  4LAW A;  4G50 A;  4QIB A;  4U85 A;  3MDY B;  3OOB A;  3UI6 A;  3UQI A;  4ODK A;  1J4I A;  4DRM A;  1T11 A;  1FKI A;  3KAI A;  5HW8 A;  2KFW A;  4DZ3 A;  4QT2 A;  1J4R A;  1ZCN A;  2RUD A;  3B7X A;  1FKS A;  4J4N A;  1Y0O A;  2XP3 A;  1FD9 A;  3O5F A;  1FKK A;  1QZ2 A;  2XP6 A;  2M08 A;  2RSE A;  2K8I A;  4IQ2 A;  4ITZ A;  4JFM A;  1D7H A;  2FKE A;  1P5Q A;  1EYM A;  2XP8 A;  2ZR6 A;  3EY6 A;  2RUQ A;  3O5I A;  4NNR A;  4W9P A;  4FAP A;  1Q6I A;  4JFL A;  5HWB A;  4ODM A;  3UI4 A;  1BL4 A;  5HTG A;  1NMW A;  1HXV A;  3UF8 A;  3JYM A;  4JYS A;  1F8A B; 
#chains in the Genus database with same CATH topology
 3VAW A;  4IT4 A;  3O5G A;  2DT3 A;  1O6I A;  4ODN A;  4JFI A;  1ITX A;  3O5E A;  1M5Y A;  4S3J A;  4ZPW R;  4DWS C;  1ZBK A;  1E6Z A;  4S3K A;  2DT0 A;  1GPF A;  1K9T A;  1SR0 A;  3RM8 A;  2RUC A;  1QPL A;  4IPX A;  2A3B A;  2RQS A;  4W5U A;  2WLZ A;  1FFR A;  4DRK A;  1ZL1 A;  2ZQS A;  4MNM A;  3PRD A;  3KAH A;  1IX5 A;  4G2P A;  2F21 A;  1HKM A;  1WAW A;  5I98 A;  1CTN A;  1J6Y A;  4IQC A;  4MPK A;  1ROU A;  3WL1 A;  2XPA A;  4WKA A;  2KI3 A;  3O5K A;  1QPF A;  3WD4 A;  3RM9 A;  4DRH A;  2F23 A;  1J4H A;  5DF0 A;  1E6P A;  2F4E A;  3ARO A;  5HT1 A;  1H0I A;  4P8X A;  4PTM A;  2ETN A;  2ESC A;  2ZQU A;  2L2S A;  2WLY A;  4Q22 A;  1LL7 A;  3ARZ A;  4LAX A;  4QT3 A;  1W9V A;  2RUR A;  2DG4 A;  4TW7 A;  2FDM A;  4ODR A;  1FKH A;  4J4O A;  3UQA A;  1PBK A;  1WNO A;  5DO2 A;  1D6O A;  4JFJ A;  4ODL A;  1HKJ A;  2PPN A;  2PN0 A;  2KR7 A;  2A3C A;  5HWC A;  4TX0 A;  5BXJ A;  3IK8 A;  3IKD A;  4UDM A;  2MPH A;  2A3E A;  3CGN A;  4URI A;  1JNS A;  5DIU A;  3B8S A;  4LAV A;  3WIJ A;  4WKF A;  1T11 A;  1GOI A;  3ARW A;  4HBE A;  4J4N A;  2XP3 A;  1FD9 A;  1FKK A;  1QZ2 A;  4ITZ A;  1D7H A;  2XP8 A;  3EY6 A;  4NNR A;  2A3A A;  4NZC A;  2DT2 A;  1NMW A;  3RME A;  2DG9 A;  2IF4 A;  4Z2L A;  1ROT A;  2G8Z A;  3CHF A;  3CGM A;  1PIN A;  2YBU A;  2PPO A;  4DH0 A;  4IT6 A;  5HW7 A;  3TC5 A;  2DPE A;  1NWR A;  3WL0 A;  5GPG A;  1KT1 A;  5GQB A;  2DSZ A;  3ARY A;  1EIB A;  2PV2 A;  2XP4 A;  2MF9 A;  1JVW A;  1NH6 A;  3WH0 A;  4DT4 A;  3KAC A;  4TYO A;  2M1I A;  2ZR4 A;  1NMV A;  2MLY A;  3PA7 A;  1YAT A;  4DRO A;  1TFV A;  4R5E A;  3GPK A;  2OFN A;  3ARV A;  3KAB A;  3QOK A;  4FN2 A;  4WK9 A;  2IUZ A;  1FKD A;  1B6C A;  3CH9 A;  3WD2 A;  3AS1 A;  4MAV A;  4ODO A;  1LG1 A;  2MLZ A;  1JNE A;  3NTP A;  4MTV A;  2XP7 A;  1E15 A;  1R9H A;  1XRV A;  1H0G A;  2P4V A;  3O5L A;  3FAP A;  4Z2G A;  3UI5 A;  2AWG A;  2WK2 A;  2FAP A;  4MSP A;  1EDQ A;  5B8I C;  1W1Y A;  3B9D A;  1FKT A;  1HJX A;  4DRJ A;  2KO7 A;  4LGX A;  1XHG A;  4DRI A;  1HKI A;  2N87 A;  1UR8 A;  4GIV A;  3UQB A;  3WKZ A;  4GGQ A;  2PV1 A;  3ARP A;  1Q6H A;  1OGB A;  2F2D A;  5J6E A;  2XP5 A;  4HBO A;  3CZ8 A;  4NSB A;  4DIP A;  1FKR A;  3GTY X;  1HJW A;  3BMB A;  2YBT A;  1ZB5 A;  4ODK A;  3KAI A;  5HW8 A;  4ML4 A;  1J4R A;  1ZCN A;  3WD1 A;  1FKS A;  2AOS A;  2DSU A;  3O5F A;  4WIW A;  4IQ2 A;  2RSE A;  4L72 B;  1X6L A;  3CHD A;  2WM0 A;  1VF8 A;  2ZR6 A;  1E6R A;  1Q6I A;  2DSW A;  3AS2 A;  1X6N A;  1NSG A;  3ART A;  1W9U A;  2LGO A;  3OA5 A;  4ODP A;  4DZ2 A;  5DEZ A;  4XAK A;  2G41 A;  3ODK A;  1W1V A;  2ZR5 A;  4U84 A;  2M2A A;  4Z2J A;  3NRK A;  4WJX A;  1HKK A;  1FKB A;  2D9F A;  3EIP A;  3AQU A;  2XP9 A;  3LUO A;  4BF8 A;  4MGV A;  4DWS D;  2VCD A;  1E6N A;  2B5U B;  2KGJ A;  1WB0 A;  2PPP A;  3NI6 A;  3KAD A;  3G6M A;  5DIV A;  5HW6 A;  3O5D A;  2B31 A;  4DRP A;  3AS0 A;  1W9P A;  3WQV A;  4Q7N A;  4DRN A;  5GPR A;  4JFK A;  4W9Q A;  4N19 A;  3I6C A;  3RGC A;  3PRA A;  1FKG A;  1F40 A;  1NWU A;  1E9L A;  1ZBC A;  3JXV A;  3ALG A;  2O92 A;  4P8V A;  4P8U A;  3WQW A;  1HJV A;  1KT0 A;  2ITK A;  3IKG A;  4O2T A;  3O5Q A;  4Z2K A;  3KCE A;  1C9H A;  2LKN A;  4LAY A;  3RFW A;  2DG3 A;  1FFQ A;  1SYT A;  2O9O A;  2JZV A;  3B9A A;  3O5J A;  3UI6 A;  4QIB A;  4U85 A;  3MDY B;  3ARX A;  3W4R A;  2KFW A;  1LG2 A;  2RUD A;  3B7X A;  3GU0 A;  1Y0O A;  4DWS B;  1JCH B;  2XP6 A;  2M08 A;  4JFM A;  5HUA A;  1P5Q A;  1EYM A;  3WD0 A;  5HWB A;  4ODM A;  3UI4 A;  1BL4 A;  5HTG A;  3UF8 A;  3JYM A;  4JYS A;  1F8A B;  2PBC A;  1NWT A;  4P8W A;  1W26 A;  1Q6U A;  2XPB A;  3RM4 A;  2OLH A;  3FY1 A;  1D7J A;  1TCO C;  1D7I A;  2Q5A A;  3ALF A;  1OGG A;  4HAR A;  3AS3 A;  4MNK A;  5HBF A;  1FJD A;  3TDB A;  1E44 A;  5D75 A;  1L1P A;  1A7X A;  5DIT A;  2LJ4 A;  4WKH A;  3CHC A;  2PI6 A;  2KE0 A;  1ZK6 A;  3FXY A;  3JYJ A;  4KR0 B;  2ZQT A;  1LQ0 A;  1FKJ A;  1GRJ A;  1ZBV A;  4MNL A;  3ARR A;  4L3N A;  4TW6 A;  1Q1C A;  3IHZ A;  3O5P A;  2LPV A;  4TNS A;  4AY1 A;  4MNJ A;  2UZ5 A;  1NWS A;  5HKG A;  5JH8 A;  4ZPV R;  1W1T A;  3O5R A;  3ARU A;  1W1P A;  2Y78 A;  4Z2H A;  4TW8 A;  3KZ7 A;  3PRB A;  1BKF A;  3TCZ A;  1FKF A;  2MLX A;  1FAP A;  2MNT A;  3KAG A;  2QF8 A;  3H9R B;  2PV3 A;  3B9E A;  3G6L A;  3O5O A;  4QZV B;  1FKL A;  1EQ3 A;  3ARS A;  4KQZ A;  4R0X A;  4ZS6 A;  4C02 B;  4ZPT R;  3CHE A;  4U86 A;  2DT1 A;  1N1A A;  4DWS A;  3PR9 A;  2EUL A;  1GUV A;  2ZQV A;  1LL6 A;  1YW5 A;  4Z2I A;  3O5M A;  3ARQ A;  2VN1 A;  1ZBW A;  4ODQ A;  4W9O A;  1JNT A;  3BXW A;  1U79 A;  4DRQ A;  4LAW A;  4G50 A;  4DRM A;  3UQI A;  3OOB A;  3WD3 A;  1J4I A;  2DSV A;  1FKI A;  4DZ3 A;  4QT2 A;  1OWQ A;  1UR9 A;  1ZU8 A;  1RD6 A;  2K8I A;  1JND A;  1LL4 A;  2FKE A;  1D2K A;  3O5I A;  2RUQ A;  4W9P A;  4FAP A;  1EHN A;  4JFL A;  1KFW A;  1HXV A;  3KAF A;  1LJY A; 
#chains in the Genus database with same CATH homology
 3VAW A;  4IT4 A;  3O5G A;  2DT3 A;  1O6I A;  4ODN A;  4JFI A;  1ITX A;  3O5E A;  1M5Y A;  4S3J A;  4ZPW R;  4DWS C;  1ZBK A;  1E6Z A;  4S3K A;  2DT0 A;  1GPF A;  1K9T A;  1SR0 A;  3RM8 A;  2RUC A;  1QPL A;  4IPX A;  2A3B A;  2RQS A;  4W5U A;  2WLZ A;  1FFR A;  4DRK A;  1ZL1 A;  2ZQS A;  4MNM A;  3PRD A;  3KAH A;  1IX5 A;  4G2P A;  2F21 A;  1HKM A;  1WAW A;  5I98 A;  1CTN A;  1J6Y A;  4IQC A;  4MPK A;  1ROU A;  3WL1 A;  2XPA A;  4WKA A;  2KI3 A;  3O5K A;  1QPF A;  3WD4 A;  3RM9 A;  4DRH A;  1J4H A;  5DF0 A;  1E6P A;  2F4E A;  3ARO A;  5HT1 A;  1H0I A;  4P8X A;  4PTM A;  2ESC A;  2ZQU A;  2L2S A;  2WLY A;  4Q22 A;  1LL7 A;  3ARZ A;  4LAX A;  4QT3 A;  1W9V A;  2RUR A;  2DG4 A;  4TW7 A;  2FDM A;  4ODR A;  1FKH A;  4J4O A;  3UQA A;  1PBK A;  1WNO A;  5DO2 A;  1D6O A;  4JFJ A;  4ODL A;  1HKJ A;  2PPN A;  2KR7 A;  2A3C A;  5HWC A;  4TX0 A;  5BXJ A;  3IK8 A;  3IKD A;  1JNS A;  2MPH A;  2A3E A;  3CGN A;  4URI A;  5DIU A;  3B8S A;  4LAV A;  3WIJ A;  4WKF A;  1T11 A;  1GOI A;  3ARW A;  4HBE A;  4J4N A;  2XP3 A;  1FD9 A;  1FKK A;  1QZ2 A;  4ITZ A;  1D7H A;  2XP8 A;  3EY6 A;  4NNR A;  2A3A A;  4NZC A;  2DT2 A;  1NMW A;  3RME A;  2DG9 A;  2IF4 A;  4Z2L A;  1ROT A;  2G8Z A;  3CHF A;  3CGM A;  1PIN A;  2YBU A;  2PPO A;  4DH0 A;  4IT6 A;  5HW7 A;  3TC5 A;  2DPE A;  1NWR A;  3WL0 A;  5GPG A;  1KT1 A;  5GQB A;  2DSZ A;  3ARY A;  1EIB A;  2PV2 A;  2XP4 A;  2MF9 A;  1JVW A;  1NH6 A;  3WH0 A;  4DT4 A;  3KAC A;  4TYO A;  2M1I A;  2ZR4 A;  1NMV A;  2MLY A;  3PA7 A;  1YAT A;  4DRO A;  1TFV A;  4R5E A;  3GPK A;  2OFN A;  3ARV A;  3KAB A;  3QOK A;  4FN2 A;  4WK9 A;  2IUZ A;  1FKD A;  1B6C A;  3CH9 A;  3WD2 A;  3AS1 A;  4MAV A;  4ODO A;  1LG1 A;  2MLZ A;  1JNE A;  3NTP A;  4MTV A;  2XP7 A;  1E15 A;  1R9H A;  1XRV A;  1H0G A;  3O5L A;  3FAP A;  4Z2G A;  3UI5 A;  2AWG A;  2WK2 A;  2FAP A;  4MSP A;  1EDQ A;  5B8I C;  1W1Y A;  3B9D A;  1FKT A;  1HJX A;  4DRJ A;  2KO7 A;  4LGX A;  1XHG A;  4DRI A;  1HKI A;  2N87 A;  1UR8 A;  4GIV A;  3UQB A;  3WKZ A;  4GGQ A;  2PV1 A;  3ARP A;  1Q6H A;  1OGB A;  2F2D A;  5J6E A;  2XP5 A;  4HBO A;  3CZ8 A;  4NSB A;  4DIP A;  1FKR A;  1HJW A;  2YBT A;  1ZB5 A;  4ODK A;  3KAI A;  5HW8 A;  4ML4 A;  1J4R A;  1ZCN A;  3WD1 A;  1FKS A;  2AOS A;  2DSU A;  3O5F A;  4WIW A;  4IQ2 A;  2RSE A;  4L72 B;  1X6L A;  3CHD A;  2WM0 A;  1VF8 A;  2ZR6 A;  1E6R A;  1Q6I A;  2DSW A;  3AS2 A;  1X6N A;  1NSG A;  3ART A;  1W9U A;  2LGO A;  3OA5 A;  4ODP A;  4DZ2 A;  5DEZ A;  4XAK A;  2G41 A;  3ODK A;  1W1V A;  2ZR5 A;  4U84 A;  2M2A A;  4Z2J A;  3NRK A;  4WJX A;  1HKK A;  1FKB A;  2D9F A;  3AQU A;  2XP9 A;  3LUO A;  4BF8 A;  4MGV A;  4DWS D;  2VCD A;  1E6N A;  2KGJ A;  1WB0 A;  2PPP A;  3NI6 A;  3KAD A;  3G6M A;  5DIV A;  5HW6 A;  3O5D A;  2B31 A;  4DRP A;  3AS0 A;  1W9P A;  3WQV A;  4Q7N A;  4DRN A;  5GPR A;  4JFK A;  4W9Q A;  4N19 A;  3I6C A;  3RGC A;  3PRA A;  1FKG A;  1F40 A;  1NWU A;  1E9L A;  1ZBC A;  3JXV A;  3ALG A;  2O92 A;  4P8V A;  4P8U A;  3WQW A;  1HJV A;  1KT0 A;  2ITK A;  3IKG A;  4O2T A;  3O5Q A;  4Z2K A;  3KCE A;  1C9H A;  2LKN A;  4LAY A;  3RFW A;  2DG3 A;  1FFQ A;  1SYT A;  2O9O A;  2JZV A;  3B9A A;  3O5J A;  3UI6 A;  4QIB A;  4U85 A;  3MDY B;  3ARX A;  3W4R A;  2KFW A;  1LG2 A;  2RUD A;  3B7X A;  1Y0O A;  4DWS B;  2XP6 A;  2M08 A;  4JFM A;  5HUA A;  1P5Q A;  1EYM A;  3WD0 A;  5HWB A;  4ODM A;  3UI4 A;  1BL4 A;  5HTG A;  3UF8 A;  3JYM A;  4JYS A;  1F8A B;  2PBC A;  1NWT A;  4P8W A;  1W26 A;  1Q6U A;  2XPB A;  3RM4 A;  2OLH A;  3FY1 A;  1D7J A;  1TCO C;  1D7I A;  2Q5A A;  3ALF A;  1OGG A;  4HAR A;  3AS3 A;  4MNK A;  5HBF A;  1FJD A;  3TDB A;  5D75 A;  1L1P A;  1A7X A;  5DIT A;  2LJ4 A;  4WKH A;  3CHC A;  2PI6 A;  2KE0 A;  1ZK6 A;  3FXY A;  3JYJ A;  4KR0 B;  2ZQT A;  1LQ0 A;  1FKJ A;  1ZBV A;  4MNL A;  3ARR A;  4L3N A;  4TW6 A;  1Q1C A;  3IHZ A;  3O5P A;  2LPV A;  4TNS A;  4AY1 A;  4MNJ A;  2UZ5 A;  1NWS A;  5HKG A;  5JH8 A;  4ZPV R;  1W1T A;  3O5R A;  3ARU A;  1W1P A;  2Y78 A;  4Z2H A;  4TW8 A;  3KZ7 A;  3PRB A;  1BKF A;  3TCZ A;  1FKF A;  2MLX A;  1FAP A;  2MNT A;  3KAG A;  2QF8 A;  3H9R B;  2PV3 A;  3O5O A;  3B9E A;  3G6L A;  4QZV B;  1FKL A;  1EQ3 A;  3ARS A;  4KQZ A;  4R0X A;  4ZS6 A;  4C02 B;  4ZPT R;  3CHE A;  4U86 A;  2DT1 A;  1N1A A;  4DWS A;  3PR9 A;  1GUV A;  2ZQV A;  1LL6 A;  1YW5 A;  4Z2I A;  3O5M A;  3ARQ A;  2VN1 A;  1ZBW A;  4ODQ A;  4W9O A;  1JNT A;  3BXW A;  1U79 A;  4DRQ A;  4LAW A;  4G50 A;  4DRM A;  3UQI A;  3OOB A;  3WD3 A;  1J4I A;  2DSV A;  1FKI A;  4DZ3 A;  4QT2 A;  1OWQ A;  1UR9 A;  1ZU8 A;  1RD6 A;  2K8I A;  1JND A;  1LL4 A;  2FKE A;  1D2K A;  3O5I A;  2RUQ A;  4W9P A;  4FAP A;  1EHN A;  4JFL A;  1KFW A;  1HXV A;  3KAF A;  1LJY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...