3O5LA

Fk1 domain mutant a19t of fkbp51, crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
source organism Homo sapiens
molecule tags Isomerase
total genus 38
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5lA00
2DG4A 2RURA 3KZ7A 3NI6A 4DRQA 4DZ2A 3KAIA 2MLZA 4ODQA 4ODRA 4IPXA 2XPAA 4ODNA 2K8IA 4G2PA 4QT2A 4O2TA 4W9QA 4BF8A 4DT4A 1FKJA 1J4IA 2DG9A 2PBCA 2XP3A 2ITKA 2KO7A 4U85A 2MLXA 3RFWA 1J6YA 3MDYB 1T11A 2MLYA 2RUQA 3UI6A 3UQIA 3KAGA 4QT3A 3VAWA 2Q5AA 1HXVA 4TW8A 2M1IA 2KR7A 4IQ2A 1Y0OA 4FAPA 2D9FA 3KABA 3NTPA 4DH0A 4GIVA 2KI3A 2PPNA 4DRMA 1BL4A 1FKFA 1N1AA 2ZQSA 1QZ2A 3O5JA 3ODKA 4DRKA 2JZVA 2Y78A 2N87A 5DITA 3PA7A 4LAWA 4QIBA 2PPOA 4ODPA 1F40A 2F4EA 4J4NA 1D7JA 5HT1A 3UQAA 3O5OA 2PV2A 3O5QA 1W26A 1NSGA 2OFNA 5BXJA 4W9OA 4ITZA 1Q6IA 4DIPA 3UQBA 2F21A 3KCEA 3O5GA 2KFWA 2KGJA 1FD9A 1ZCNA 2PPPA 3H9RB 4JYSA 1B6CA 4G50A 1A7XA 3CGNA 5J6EA 1JNSA 2M2AA 4W9PA 3O5KA 1FKLA 1FKDA 2ZR5A 4ODMA 1EQ3A 3KACA 1D7HA 4ODOA 1BKFA 3KADA 4ODLA 4U84A 1J4HA 3UI5A 3IK8A 4N19A 1Q6HA 1YW5A 2AWGA 3LUOA 3JXVA 4DZ3A 3UI4A 4U86A 2UZ5A 2LGOA 2LPVA 1QPLA 3NRKA 3WH0A 2ZR4A 4JFKA 3OOBA 4JFLA 3TCZA 3O5RA 2RQSA 4TX0A 1Q1CA 1YATA 4LAYA 2FKEA 1FKHA 1FKGA 4LAVA 2XP4A 1PINA 3PRDA 3EY6A 2RUDA 2F2DA 1FKIA 3O5FA 4NNRA 5D75A 3TC5A 5HW7A 2MPHA 3O5DA 1KT1A 2LJ4A 1D6OA 1FKBA 4LAXA 2MF9A 2VCDA 1M5YA 1P5QA 2ZQVA 3O5IA 1FJDA 4TYOA 1QPFA 1ROTA 3PRBA 5HW6A 2DG3A 4C02B 1R9HA 3O5EA 4DROA 1JVWA 5I98A 4MSPA 2XP9A 3IKDA 2LKNA 2MNTA 3B7XA 2XPBA 1FKRA 2RUCA 4JFMA 1FKTA 2L2SA 4FN2A 4R0XA 5DIVA 3TDBA 1NMWA 2XP7A 2VN1A 4JFIA 4MGVA 1FAPA 3JYJA 3FAPA 1KT0A 2XP5A 4IQCA 1D7IA 3IKGA 1EYMA 5HW8A 2RSEA 5HTGA 1F8AB 1FKKA 1TCOC 3KAFA 1PBKA 4TW6A 2KE0A 3CGMA 4ODKA 4DRIA 1U79A 1ROUA 3O5MA 1L1PA 2PV3A 2XP8A 3RGCA 2IF4A 2ZQTA 4GGQA 1ZK6A 4DRNA 5HKGA 1C9HA 1FKSA 5GPGA 5HWCA 3IHZA 4DRJA 2FAPA 4DRPA 5DIUA 2PV1A 4J4OA 1NMVA 5B8IC 5HWBA 5HUAA 3O5PA 1J4RA 4TNSA 3KAHA 3UF8A 2M08A 3GPKA 4DRHA 3O5LA 1JNTA 4JFJA 1Q6UA 3JYMA 4TW7A 2XP6A 3I6CA 2ZR6A 2ZQUA
chains in the Genus database with same CATH superfamily
2RURA 3KZ7A 4DZ2A 3KAIA 1EHNA 4IPXA 2FDMA 2XPAA 2K8IA 4G2PA 4O2TA 4BF8A 2DG9A 2XP3A 4KQZA 5JH8A 1T11A 2RUQA 4TW8A 3AS3A 1NWRA 1Y0OA 4FAPA 4MNMA 3KABA 4AY1A 3GTYX 2KI3A 2PPNA 4MNJA 1FKFA 4Q22A 1XHGA 2AOSA 3G6LA 3PR9A 2Y78A 3B8SA 3CHFA 3PRAA 4MNKA 4WIWA 4NSBA 4QIBA 3EIPA 1D7JA 3O5OA 2OFNA 4W9OA 1SYTA 1ZBCA 2KFWA 3H9RB 1B6CA 3ALGA 4G50A 5J6EA 2M2AA 1W1YA 2QF8A 1FKLA 4ODMA 1W9VA 4U84A 4LGXA 4XAKA 1Q6HA 4W5UA 1OGBA 2ZR4A 1LG2A 3ARYA 2DSWA 1Q1CA 2IUZA 2YBTA 3O5FA 4ML4A 1LG1A 1FKBA 4Z2GA 2O92A 1ROTA 3ARUA 2DG3A 4C02B 3O5EA 5I98A 2XP9A 2XPBA 2RUCA 4UDMA 4S3KA 4R0XA 3TDBA 1NMWA 2XP7A 1ZL1A 3JYJA 1FFQA 4P8WA 1W9UA 4KR0B 2WK2A 1PBKA 1LL7A 4DRIA 3RGCA 3BMBA 4QZVB 3B9DA 1HJVA 1NWUA 1ZK6A 5HWCA 4WKHA 4J4OA 2DSZA 2M08A 3GPKA 1W1PA 1JNTA 2XP6A 2DSVA 3CH9A 4DRQA 1ZBWA 1E15A 3ARTA 4Z2JA 4ODQA 1LL6A 4DT4A 3UI4A 2PBCA 1HKJA 1H0GA 2KO7A 3VAWA 2MLYA 1W1VA 4IT4A 3WIJA 2KR7A 1K9TA 4DWSC 4GIVA 3ARVA 1N1AA 4DRKA 1EIBA 1ZBVA 5DITA 3PA7A 1GPFA 4L72B 1HJXA 1LL4A 5BXJA 4ITZA 2PN0A 1Q6IA 4WK9A 2DT0A 3WD2A 4IT6A 1ZCNA 2A3CA 3AS1A 1LQ0A 5GPRA 3O5KA 1EDQA 3KACA 1D7HA 4ODLA 3UI5A 4MTVA 3IK8A 1YW5A 2ETNA 3LUOA 4DZ3A 2B31A 2LGOA 1QPLA 3NRKA 3B9EA 4JFKA 3OOBA 3FY1A 3RM9A 4WJXA 1YATA 1E9LA 1HKKA 4LAYA 1VF8A 2FKEA 1RD6A 4Q7NA 4LAVA 4DRNA 4NNRA 5HW7A 2A3EA 2RUDA 5D75A 4HBEA 2MPHA 3O5DA 3ARPA 1M5YA 3ARQA 2ZQVA 5DO2A 1UR9A 4DROA 3WD0A 2LKNA 4ZPVR 1FKTA 4ZS6A 3AS2A 4DWSD 4MGVA 1D2KA 2XP5A 4IQCA 2YBUA 5HTGA 4TW6A 1E6ZA 1WNOA 2KE0A 1U79A 3O5MA 2PV3A 2ZQTA 3WD1A 4Z2IA 1CTNA 5HKGA 1C9HA 3ALFA 3AQUA 4HARA 4L3NA 5DIUA 4DRPA 2PV1A 5HWBA 2EULA 1J4RA 3RMEA 1NWSA 2DT1A 1SR0A 1Q6UA 3JYMA 3QOKA 4TW7A 3I6CA 2WLYA 1ZBKA 4P8XA 3OA5A 4PTMA 2MLZA 1W1TA 4W9QA 1O6IA 2A3AA 4ODNA 3RFWA 1J4IA 4U85A 3UF8A 2ITKA 2WLZA 3MDYB 3UQIA 1E6PA 4NZCA 3KAGA 4QT3A 2Q5AA 3WKZA 4IQ2A 1ZB5A 4DRMA 2ZQSA 4HBOA 4URIA 1QZ2A 3CHDA 3ARZA 4MNLA 2PPOA 1F40A 1WB0A 5HT1A 4Z2HA 3CHEA 1NSGA 3FXYA 4DIPA 3KCEA 3O5GA 4ODRA 2PPPA 3ARXA 1JNSA 4P8VA 4WKFA 4W9PA 2ZR5A 1FKDA 4ODOA 3WQWA 1HKIA 2F23A 1HKMA 4N19A 1GUVA 3JXVA 2UZ5A 3WH0A 3TCZA 4JFLA 4S3JA 1X6NA 3B9AA 4ZPTR 4ZPWR 1LJYA 1FKHA 3AS0A 3EY6A 1FKIA 4LAXA 4P8UA 2G8ZA 3O5IA 1FJDA 4DWSB 3PRBA 3WD4A 1R9HA 1JVWA 4WKAA 3IKDA 4MAVA 3ARRA 1FKRA 1ITXA 4JFMA 3G6MA 4FN2A 2OLHA 4JFIA 2WM0A 1XRVA 1HJWA 1KT0A 3FAPA 1ZU8A 3IKGA 1EYMA 1FKKA 1TCOC 2ESCA 2XP8A 1UR8A 2IF4A 3CHCA 4GGQA 1FKSA 3BXWA 5DEZA 5GPGA 3IHZA 4DRJA 1NMVA 3O5PA 4Z2KA 3KAHA 5GQBA 3ARSA 2ZQUA 2DG4A 3NI6A 1FKJA 5HBFA 3GU0A 1W9PA 2DPEA 2MLXA 3UI6A 1HXVA 2DT3A 2M1IA 2D9FA 3WL0A 1GOIA 3NTPA 4DH0A 1BL4A 3O5JA 3ODKA 2JZVA 2N87A 1KFWA 1NH6A 4LAWA 3WL1A 1E6NA 4ODPA 2F4EA 4J4NA 3UQAA 1JNDA 2PV2A 3O5QA 1W26A 4Z2LA 3UQBA 3AROA 3WQVA 2F21A 4QT2A 2KGJA 1FD9A 1IX5A 1J6YA 4JYSA 1FFRA 1A7XA 2PI6A 3CGNA 3RM4A 1EQ3A 1JNEA 2DT2A 4DWSA 1BKFA 3KADA 1J4HA 2A3BA 2AWGA 4U86A 2LPVA 1X6LA 2RQSA 3O5RA 4TX0A 1FKGA 1GRJA 2XP4A 1JCHB 1PINA 3PRDA 2F2DA 3TC5A 3WD3A 1TFVA 2O9OA 1KT1A 2LJ4A 1D6OA 2MF9A 2VCDA 2DSUA 1P5QA 2G41A 2P4VA 4TYOA 1QPFA 2B5UB 1WAWA 5HW6A 5DF0A 1H0IA 4MSPA 2MNTA 3B7XA 2L2SA 5DIVA 1NWTA 2VN1A 3CZ8A 1FAPA 1D7IA 5HW8A 2RSEA 1F8AB 3KAFA 3CGMA 4ODKA 1ROUA 1L1PA 3RM8A 3ARWA 1E6RA 4MPKA 2FAPA 5B8IC 5HUAA 1E44A 1OGGA 4TNSA 1OWQA 4DRHA 3O5LA 4R5EA 4JFJA 3W4RA 2ZR6A
chains in the Genus database with same CATH topology
2RURA 3KZ7A 4DZ2A 3KAIA 1EHNA 4IPXA 2FDMA 2XPAA 2K8IA 4G2PA 4O2TA 4BF8A 2DG9A 2XP3A 4KQZA 5JH8A 1T11A 2RUQA 4TW8A 3AS3A 1NWRA 1Y0OA 4FAPA 4MNMA 3KABA 4AY1A 2KI3A 2PPNA 4MNJA 1FKFA 4Q22A 1XHGA 2AOSA 3G6LA 3PR9A 2Y78A 3B8SA 3CHFA 3PRAA 4MNKA 4WIWA 4NSBA 4QIBA 1D7JA 3O5OA 2OFNA 4W9OA 1SYTA 1ZBCA 2KFWA 3H9RB 1B6CA 3ALGA 4G50A 5J6EA 2M2AA 1W1YA 2QF8A 1FKLA 4ODMA 1W9VA 4U84A 4LGXA 4XAKA 1Q6HA 4W5UA 1OGBA 2ZR4A 1LG2A 3ARYA 2DSWA 1Q1CA 2IUZA 2YBTA 3O5FA 4ML4A 1LG1A 1FKBA 4Z2GA 2O92A 1ROTA 3ARUA 2DG3A 4C02B 3O5EA 5I98A 2XP9A 2XPBA 2RUCA 4S3KA 4R0XA 3TDBA 1NMWA 2XP7A 1ZL1A 3JYJA 1FFQA 4P8WA 1W9UA 4KR0B 2WK2A 1PBKA 1LL7A 4DRIA 3RGCA 4QZVB 3B9DA 1HJVA 1NWUA 1ZK6A 5HWCA 4WKHA 4J4OA 2DSZA 2M08A 3GPKA 1W1PA 1JNTA 2XP6A 2DSVA 3CH9A 4DRQA 1ZBWA 1E15A 3ARTA 4Z2JA 4ODQA 1LL6A 4DT4A 3UI4A 2PBCA 1HKJA 1H0GA 2KO7A 3VAWA 2MLYA 1W1VA 4IT4A 3WIJA 2KR7A 1K9TA 4DWSC 4GIVA 3ARVA 1N1AA 4DRKA 1EIBA 1ZBVA 5DITA 3PA7A 1GPFA 4L72B 1HJXA 1LL4A 5BXJA 4ITZA 4WK9A 1Q6IA 2DT0A 3WD2A 4IT6A 1ZCNA 2A3CA 3AS1A 1LQ0A 5GPRA 3O5KA 1EDQA 3KACA 1D7HA 4ODLA 3UI5A 4MTVA 3IK8A 1YW5A 3LUOA 4DZ3A 2B31A 2LGOA 1QPLA 3NRKA 3B9EA 4JFKA 3OOBA 3FY1A 3RM9A 4WJXA 1YATA 1E9LA 1HKKA 4LAYA 1VF8A 2FKEA 1RD6A 4Q7NA 4LAVA 4DRNA 4NNRA 5HW7A 2A3EA 2RUDA 5D75A 4HBEA 2MPHA 3O5DA 3ARPA 1M5YA 3ARQA 2ZQVA 5DO2A 1UR9A 4DROA 3WD0A 2LKNA 4ZPVR 1FKTA 4ZS6A 3AS2A 4DWSD 4MGVA 1D2KA 2XP5A 4IQCA 2YBUA 5HTGA 4TW6A 1E6ZA 1WNOA 2KE0A 1U79A 3O5MA 2PV3A 2ZQTA 3WD1A 4Z2IA 1CTNA 5HKGA 1C9HA 3ALFA 3AQUA 4HARA 4L3NA 5DIUA 4DRPA 2PV1A 5HWBA 1J4RA 3RMEA 1NWSA 2DT1A 1SR0A 1Q6UA 3JYMA 3QOKA 4TW7A 3I6CA 2WLYA 1ZBKA 4P8XA 3OA5A 4PTMA 2MLZA 1W1TA 4W9QA 1O6IA 2A3AA 4ODNA 3RFWA 1J4IA 4U85A 3UF8A 2ITKA 2WLZA 3MDYB 3UQIA 1E6PA 4NZCA 3KAGA 4QT3A 2Q5AA 3WKZA 4IQ2A 1ZB5A 4DRMA 2ZQSA 4HBOA 4URIA 1QZ2A 3CHDA 3ARZA 4MNLA 2PPOA 1F40A 1WB0A 5HT1A 4Z2HA 3CHEA 1NSGA 3FXYA 4DIPA 3KCEA 3O5GA 4ODRA 2PPPA 3ARXA 1JNSA 4P8VA 4WKFA 4W9PA 2ZR5A 1FKDA 4ODOA 3WQWA 1HKIA 1HKMA 4N19A 1GUVA 3JXVA 2UZ5A 3WH0A 3TCZA 4JFLA 4S3JA 1X6NA 3B9AA 4ZPTR 4ZPWR 1LJYA 1FKHA 3AS0A 3EY6A 1FKIA 4LAXA 4P8UA 2G8ZA 3O5IA 1FJDA 4DWSB 3PRBA 3WD4A 1R9HA 1JVWA 4WKAA 3IKDA 4MAVA 3ARRA 1FKRA 1ITXA 4JFMA 3G6MA 4FN2A 2OLHA 4JFIA 2WM0A 1XRVA 1HJWA 1KT0A 3FAPA 1ZU8A 3IKGA 1EYMA 1FKKA 1TCOC 2ESCA 2XP8A 1UR8A 2IF4A 3CHCA 4GGQA 1FKSA 3BXWA 5DEZA 5GPGA 3IHZA 4DRJA 1NMVA 3O5PA 4Z2KA 3KAHA 5GQBA 3ARSA 2ZQUA 2DG4A 3NI6A 1FKJA 5HBFA 1W9PA 2DPEA 2MLXA 3UI6A 1HXVA 2DT3A 2M1IA 2D9FA 3WL0A 1GOIA 3NTPA 4DH0A 1BL4A 3O5JA 3ODKA 2JZVA 2N87A 1KFWA 1NH6A 4LAWA 3WL1A 1E6NA 4ODPA 2F4EA 4J4NA 3UQAA 1JNDA 2PV2A 3O5QA 1W26A 4Z2LA 3UQBA 3AROA 3WQVA 2F21A 4QT2A 2KGJA 1FD9A 1IX5A 1J6YA 4JYSA 1FFRA 1A7XA 2PI6A 3CGNA 3RM4A 1EQ3A 1JNEA 2DT2A 4DWSA 1BKFA 3KADA 1J4HA 2A3BA 2AWGA 4U86A 2LPVA 1X6LA 2RQSA 3O5RA 4TX0A 1FKGA 2XP4A 1PINA 3PRDA 2F2DA 3TC5A 3WD3A 1TFVA 2O9OA 1KT1A 2LJ4A 1D6OA 2MF9A 2VCDA 2DSUA 1P5QA 2G41A 4TYOA 1QPFA 1WAWA 5HW6A 5DF0A 1H0IA 4MSPA 2MNTA 3B7XA 2L2SA 5DIVA 1NWTA 2VN1A 3CZ8A 1FAPA 1D7IA 5HW8A 2RSEA 1F8AB 3KAFA 3CGMA 4ODKA 1ROUA 1L1PA 3RM8A 3ARWA 1E6RA 4MPKA 2FAPA 5B8IC 5HUAA 1OGGA 4TNSA 1OWQA 4DRHA 3O5LA 4R5EA 4JFJA 3W4RA 2ZR6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DG4 A;  2RUR A;  3KZ7 A;  3NI6 A;  4DRQ A;  4DZ2 A;  3KAI A;  2MLZ A;  4ODQ A;  4ODR A;  4IPX A;  2XPA A;  4ODN A;  2K8I A;  4G2P A;  4QT2 A;  4O2T A;  4W9Q A;  4BF8 A;  4DT4 A;  1FKJ A;  1J4I A;  2DG9 A;  2PBC A;  2XP3 A;  2ITK A;  2KO7 A;  4U85 A;  2MLX A;  3RFW A;  1J6Y A;  3MDY B;  1T11 A;  2MLY A;  2RUQ A;  3UI6 A;  3UQI A;  3KAG A;  4QT3 A;  3VAW A;  2Q5A A;  1HXV A;  4TW8 A;  2M1I A;  2KR7 A;  4IQ2 A;  1Y0O A;  4FAP A;  2D9F A;  3KAB A;  3NTP A;  4DH0 A;  4GIV A;  2KI3 A;  2PPN A;  4DRM A;  1BL4 A;  1FKF A;  1N1A A;  2ZQS A;  1QZ2 A;  3O5J A;  3ODK A;  4DRK A;  2JZV A;  2Y78 A;  2N87 A;  5DIT A;  3PA7 A;  4LAW A;  4QIB A;  2PPO A;  4ODP A;  1F40 A;  2F4E A;  4J4N A;  1D7J A;  5HT1 A;  3UQA A;  3O5O A;  2PV2 A;  3O5Q A;  1W26 A;  1NSG A;  2OFN A;  5BXJ A;  4W9O A;  4ITZ A;  1Q6I A;  4DIP A;  3UQB A;  2F21 A;  3KCE A;  3O5G A;  2KFW A;  2KGJ A;  1FD9 A;  1ZCN A;  2PPP A;  3H9R B;  4JYS A;  1B6C A;  4G50 A;  1A7X A;  3CGN A;  5J6E A;  1JNS A;  2M2A A;  4W9P A;  3O5K A;  1FKL A;  1FKD A;  2ZR5 A;  4ODM A;  1EQ3 A;  3KAC A;  1D7H A;  4ODO A;  1BKF A;  3KAD A;  4ODL A;  4U84 A;  1J4H A;  3UI5 A;  3IK8 A;  4N19 A;  1Q6H A;  1YW5 A;  2AWG A;  3LUO A;  3JXV A;  4DZ3 A;  3UI4 A;  4U86 A;  2UZ5 A;  2LGO A;  2LPV A;  1QPL A;  3NRK A;  3WH0 A;  2ZR4 A;  4JFK A;  3OOB A;  4JFL A;  3TCZ A;  3O5R A;  2RQS A;  4TX0 A;  1Q1C A;  1YAT A;  4LAY A;  2FKE A;  1FKH A;  1FKG A;  4LAV A;  2XP4 A;  1PIN A;  3PRD A;  3EY6 A;  2RUD A;  2F2D A;  1FKI A;  3O5F A;  4NNR A;  5D75 A;  3TC5 A;  5HW7 A;  2MPH A;  3O5D A;  1KT1 A;  2LJ4 A;  1D6O A;  1FKB A;  4LAX A;  2MF9 A;  2VCD A;  1M5Y A;  1P5Q A;  2ZQV A;  3O5I A;  1FJD A;  4TYO A;  1QPF A;  1ROT A;  3PRB A;  5HW6 A;  2DG3 A;  4C02 B;  1R9H A;  3O5E A;  4DRO A;  1JVW A;  5I98 A;  4MSP A;  2XP9 A;  3IKD A;  2LKN A;  2MNT A;  3B7X A;  2XPB A;  1FKR A;  2RUC A;  4JFM A;  1FKT A;  2L2S A;  4FN2 A;  4R0X A;  5DIV A;  3TDB A;  1NMW A;  2XP7 A;  2VN1 A;  4JFI A;  4MGV A;  1FAP A;  3JYJ A;  3FAP A;  1KT0 A;  2XP5 A;  4IQC A;  1D7I A;  3IKG A;  1EYM A;  5HW8 A;  2RSE A;  5HTG A;  1F8A B;  1FKK A;  1TCO C;  3KAF A;  1PBK A;  4TW6 A;  2KE0 A;  3CGM A;  4ODK A;  4DRI A;  1U79 A;  1ROU A;  3O5M A;  1L1P A;  2PV3 A;  2XP8 A;  3RGC A;  2IF4 A;  2ZQT A;  4GGQ A;  1ZK6 A;  4DRN A;  5HKG A;  1C9H A;  1FKS A;  5GPG A;  5HWC A;  3IHZ A;  4DRJ A;  2FAP A;  4DRP A;  5DIU A;  2PV1 A;  4J4O A;  1NMV A;  5B8I C;  5HWB A;  5HUA A;  3O5P A;  1J4R A;  4TNS A;  3KAH A;  3UF8 A;  2M08 A;  3GPK A;  4DRH A;  3O5L A;  1JNT A;  4JFJ A;  1Q6U A;  3JYM A;  4TW7 A;  2XP6 A;  3I6C A;  2ZR6 A;  2ZQU A; 
#chains in the Genus database with same CATH topology
 2RUR A;  3KZ7 A;  4DZ2 A;  3KAI A;  1EHN A;  4IPX A;  2FDM A;  2XPA A;  2K8I A;  4G2P A;  4O2T A;  4BF8 A;  2DG9 A;  2XP3 A;  4KQZ A;  5JH8 A;  1T11 A;  2RUQ A;  4TW8 A;  3AS3 A;  1NWR A;  1Y0O A;  4FAP A;  4MNM A;  3KAB A;  4AY1 A;  3GTY X;  2KI3 A;  2PPN A;  4MNJ A;  1FKF A;  4Q22 A;  1XHG A;  2AOS A;  3G6L A;  3PR9 A;  2Y78 A;  3B8S A;  3CHF A;  3PRA A;  4MNK A;  4WIW A;  4NSB A;  4QIB A;  3EIP A;  1D7J A;  3O5O A;  2OFN A;  4W9O A;  1SYT A;  1ZBC A;  2KFW A;  3H9R B;  1B6C A;  3ALG A;  4G50 A;  5J6E A;  2M2A A;  1W1Y A;  2QF8 A;  1FKL A;  4ODM A;  1W9V A;  4U84 A;  4LGX A;  4XAK A;  1Q6H A;  4W5U A;  1OGB A;  2ZR4 A;  1LG2 A;  3ARY A;  2DSW A;  1Q1C A;  2IUZ A;  2YBT A;  3O5F A;  4ML4 A;  1LG1 A;  1FKB A;  4Z2G A;  2O92 A;  1ROT A;  3ARU A;  2DG3 A;  4C02 B;  3O5E A;  5I98 A;  2XP9 A;  2XPB A;  2RUC A;  4UDM A;  4S3K A;  4R0X A;  3TDB A;  1NMW A;  2XP7 A;  1ZL1 A;  3JYJ A;  1FFQ A;  4P8W A;  1W9U A;  4KR0 B;  2WK2 A;  1PBK A;  1LL7 A;  4DRI A;  3RGC A;  3BMB A;  4QZV B;  3B9D A;  1HJV A;  1NWU A;  1ZK6 A;  5HWC A;  4WKH A;  4J4O A;  2DSZ A;  2M08 A;  3GPK A;  1W1P A;  1JNT A;  2XP6 A;  2DSV A;  3CH9 A;  4DRQ A;  1ZBW A;  1E15 A;  3ART A;  4Z2J A;  4ODQ A;  1LL6 A;  4DT4 A;  3UI4 A;  2PBC A;  1HKJ A;  1H0G A;  2KO7 A;  3VAW A;  2MLY A;  1W1V A;  4IT4 A;  3WIJ A;  2KR7 A;  1K9T A;  4DWS C;  4GIV A;  3ARV A;  1N1A A;  4DRK A;  1EIB A;  1ZBV A;  5DIT A;  3PA7 A;  1GPF A;  4L72 B;  1HJX A;  1LL4 A;  5BXJ A;  4ITZ A;  2PN0 A;  1Q6I A;  4WK9 A;  2DT0 A;  3WD2 A;  4IT6 A;  1ZCN A;  2A3C A;  3AS1 A;  1LQ0 A;  5GPR A;  3O5K A;  1EDQ A;  3KAC A;  1D7H A;  4ODL A;  3UI5 A;  4MTV A;  3IK8 A;  1YW5 A;  2ETN A;  3LUO A;  4DZ3 A;  2B31 A;  2LGO A;  1QPL A;  3NRK A;  3B9E A;  4JFK A;  3OOB A;  3FY1 A;  3RM9 A;  4WJX A;  1YAT A;  1E9L A;  1HKK A;  4LAY A;  1VF8 A;  2FKE A;  1RD6 A;  4Q7N A;  4LAV A;  4DRN A;  4NNR A;  5HW7 A;  2A3E A;  2RUD A;  5D75 A;  4HBE A;  2MPH A;  3O5D A;  3ARP A;  1M5Y A;  3ARQ A;  2ZQV A;  5DO2 A;  1UR9 A;  4DRO A;  3WD0 A;  2LKN A;  4ZPV R;  1FKT A;  4ZS6 A;  3AS2 A;  4DWS D;  4MGV A;  1D2K A;  2XP5 A;  4IQC A;  2YBU A;  5HTG A;  4TW6 A;  1E6Z A;  1WNO A;  2KE0 A;  1U79 A;  3O5M A;  2PV3 A;  2ZQT A;  3WD1 A;  4Z2I A;  1CTN A;  5HKG A;  1C9H A;  3ALF A;  3AQU A;  4HAR A;  4L3N A;  5DIU A;  4DRP A;  2PV1 A;  5HWB A;  2EUL A;  1J4R A;  3RME A;  1NWS A;  2DT1 A;  1SR0 A;  1Q6U A;  3JYM A;  3QOK A;  4TW7 A;  3I6C A;  2WLY A;  1ZBK A;  4P8X A;  3OA5 A;  4PTM A;  2MLZ A;  1W1T A;  4W9Q A;  1O6I A;  2A3A A;  4ODN A;  3RFW A;  1J4I A;  4U85 A;  3UF8 A;  2ITK A;  2WLZ A;  3MDY B;  3UQI A;  1E6P A;  4NZC A;  3KAG A;  4QT3 A;  2Q5A A;  3WKZ A;  4IQ2 A;  1ZB5 A;  4DRM A;  2ZQS A;  4HBO A;  4URI A;  1QZ2 A;  3CHD A;  3ARZ A;  4MNL A;  2PPO A;  1F40 A;  1WB0 A;  5HT1 A;  4Z2H A;  3CHE A;  1NSG A;  3FXY A;  4DIP A;  3KCE A;  3O5G A;  4ODR A;  2PPP A;  3ARX A;  1JNS A;  4P8V A;  4WKF A;  4W9P A;  2ZR5 A;  1FKD A;  4ODO A;  3WQW A;  1HKI A;  2F23 A;  1HKM A;  4N19 A;  1GUV A;  3JXV A;  2UZ5 A;  3WH0 A;  3TCZ A;  4JFL A;  4S3J A;  1X6N A;  3B9A A;  4ZPT R;  4ZPW R;  1LJY A;  1FKH A;  3AS0 A;  3EY6 A;  1FKI A;  4LAX A;  4P8U A;  2G8Z A;  3O5I A;  1FJD A;  4DWS B;  3PRB A;  3WD4 A;  1R9H A;  1JVW A;  4WKA A;  3IKD A;  4MAV A;  3ARR A;  1FKR A;  1ITX A;  4JFM A;  3G6M A;  4FN2 A;  2OLH A;  4JFI A;  2WM0 A;  1XRV A;  1HJW A;  1KT0 A;  3FAP A;  1ZU8 A;  3IKG A;  1EYM A;  1FKK A;  1TCO C;  2ESC A;  2XP8 A;  1UR8 A;  2IF4 A;  3CHC A;  4GGQ A;  1FKS A;  3BXW A;  5DEZ A;  5GPG A;  3IHZ A;  4DRJ A;  1NMV A;  3O5P A;  4Z2K A;  3KAH A;  5GQB A;  3ARS A;  2ZQU A;  2DG4 A;  3NI6 A;  1FKJ A;  5HBF A;  3GU0 A;  1W9P A;  2DPE A;  2MLX A;  3UI6 A;  1HXV A;  2DT3 A;  2M1I A;  2D9F A;  3WL0 A;  1GOI A;  3NTP A;  4DH0 A;  1BL4 A;  3O5J A;  3ODK A;  2JZV A;  2N87 A;  1KFW A;  1NH6 A;  4LAW A;  3WL1 A;  1E6N A;  4ODP A;  2F4E A;  4J4N A;  3UQA A;  1JND A;  2PV2 A;  3O5Q A;  1W26 A;  4Z2L A;  3UQB A;  3ARO A;  3WQV A;  2F21 A;  4QT2 A;  2KGJ A;  1FD9 A;  1IX5 A;  1J6Y A;  4JYS A;  1FFR A;  1A7X A;  2PI6 A;  3CGN A;  3RM4 A;  1EQ3 A;  1JNE A;  2DT2 A;  4DWS A;  1BKF A;  3KAD A;  1J4H A;  2A3B A;  2AWG A;  4U86 A;  2LPV A;  1X6L A;  2RQS A;  3O5R A;  4TX0 A;  1FKG A;  1GRJ A;  2XP4 A;  1JCH B;  1PIN A;  3PRD A;  2F2D A;  3TC5 A;  3WD3 A;  1TFV A;  2O9O A;  1KT1 A;  2LJ4 A;  1D6O A;  2MF9 A;  2VCD A;  2DSU A;  1P5Q A;  2G41 A;  2P4V A;  4TYO A;  1QPF A;  2B5U B;  1WAW A;  5HW6 A;  5DF0 A;  1H0I A;  4MSP A;  2MNT A;  3B7X A;  2L2S A;  5DIV A;  1NWT A;  2VN1 A;  3CZ8 A;  1FAP A;  1D7I A;  5HW8 A;  2RSE A;  1F8A B;  3KAF A;  3CGM A;  4ODK A;  1ROU A;  1L1P A;  3RM8 A;  3ARW A;  1E6R A;  4MPK A;  2FAP A;  5B8I C;  5HUA A;  1E44 A;  1OGG A;  4TNS A;  1OWQ A;  4DRH A;  3O5L A;  4R5E A;  4JFJ A;  3W4R A;  2ZR6 A; 
#chains in the Genus database with same CATH homology
 2RUR A;  3KZ7 A;  4DZ2 A;  3KAI A;  1EHN A;  4IPX A;  2FDM A;  2XPA A;  2K8I A;  4G2P A;  4O2T A;  4BF8 A;  2DG9 A;  2XP3 A;  4KQZ A;  5JH8 A;  1T11 A;  2RUQ A;  4TW8 A;  3AS3 A;  1NWR A;  1Y0O A;  4FAP A;  4MNM A;  3KAB A;  4AY1 A;  2KI3 A;  2PPN A;  4MNJ A;  1FKF A;  4Q22 A;  1XHG A;  2AOS A;  3G6L A;  3PR9 A;  2Y78 A;  3B8S A;  3CHF A;  3PRA A;  4MNK A;  4WIW A;  4NSB A;  4QIB A;  1D7J A;  3O5O A;  2OFN A;  4W9O A;  1SYT A;  1ZBC A;  2KFW A;  3H9R B;  1B6C A;  3ALG A;  4G50 A;  5J6E A;  2M2A A;  1W1Y A;  2QF8 A;  1FKL A;  4ODM A;  1W9V A;  4U84 A;  4LGX A;  4XAK A;  1Q6H A;  4W5U A;  1OGB A;  2ZR4 A;  1LG2 A;  3ARY A;  2DSW A;  1Q1C A;  2IUZ A;  2YBT A;  3O5F A;  4ML4 A;  1LG1 A;  1FKB A;  4Z2G A;  2O92 A;  1ROT A;  3ARU A;  2DG3 A;  4C02 B;  3O5E A;  5I98 A;  2XP9 A;  2XPB A;  2RUC A;  4S3K A;  4R0X A;  3TDB A;  1NMW A;  2XP7 A;  1ZL1 A;  3JYJ A;  1FFQ A;  4P8W A;  1W9U A;  4KR0 B;  2WK2 A;  1PBK A;  1LL7 A;  4DRI A;  3RGC A;  4QZV B;  3B9D A;  1HJV A;  1NWU A;  1ZK6 A;  5HWC A;  4WKH A;  4J4O A;  2DSZ A;  2M08 A;  3GPK A;  1W1P A;  1JNT A;  2XP6 A;  2DSV A;  3CH9 A;  4DRQ A;  1ZBW A;  1E15 A;  3ART A;  4Z2J A;  4ODQ A;  1LL6 A;  4DT4 A;  3UI4 A;  2PBC A;  1HKJ A;  1H0G A;  2KO7 A;  3VAW A;  2MLY A;  1W1V A;  4IT4 A;  3WIJ A;  2KR7 A;  1K9T A;  4DWS C;  4GIV A;  3ARV A;  1N1A A;  4DRK A;  1EIB A;  1ZBV A;  5DIT A;  3PA7 A;  1GPF A;  4L72 B;  1HJX A;  1LL4 A;  5BXJ A;  4ITZ A;  4WK9 A;  1Q6I A;  2DT0 A;  3WD2 A;  4IT6 A;  1ZCN A;  2A3C A;  3AS1 A;  1LQ0 A;  5GPR A;  3O5K A;  1EDQ A;  3KAC A;  1D7H A;  4ODL A;  3UI5 A;  4MTV A;  3IK8 A;  1YW5 A;  3LUO A;  4DZ3 A;  2B31 A;  2LGO A;  1QPL A;  3NRK A;  3B9E A;  4JFK A;  3OOB A;  3FY1 A;  3RM9 A;  4WJX A;  1YAT A;  1E9L A;  1HKK A;  4LAY A;  1VF8 A;  2FKE A;  1RD6 A;  4Q7N A;  4LAV A;  4DRN A;  4NNR A;  5HW7 A;  2A3E A;  2RUD A;  5D75 A;  4HBE A;  2MPH A;  3O5D A;  3ARP A;  1M5Y A;  3ARQ A;  2ZQV A;  5DO2 A;  1UR9 A;  4DRO A;  3WD0 A;  2LKN A;  4ZPV R;  1FKT A;  4ZS6 A;  3AS2 A;  4DWS D;  4MGV A;  1D2K A;  2XP5 A;  4IQC A;  2YBU A;  5HTG A;  4TW6 A;  1E6Z A;  1WNO A;  2KE0 A;  1U79 A;  3O5M A;  2PV3 A;  2ZQT A;  3WD1 A;  4Z2I A;  1CTN A;  5HKG A;  1C9H A;  3ALF A;  3AQU A;  4HAR A;  4L3N A;  5DIU A;  4DRP A;  2PV1 A;  5HWB A;  1J4R A;  3RME A;  1NWS A;  2DT1 A;  1SR0 A;  1Q6U A;  3JYM A;  3QOK A;  4TW7 A;  3I6C A;  2WLY A;  1ZBK A;  4P8X A;  3OA5 A;  4PTM A;  2MLZ A;  1W1T A;  4W9Q A;  1O6I A;  2A3A A;  4ODN A;  3RFW A;  1J4I A;  4U85 A;  3UF8 A;  2ITK A;  2WLZ A;  3MDY B;  3UQI A;  1E6P A;  4NZC A;  3KAG A;  4QT3 A;  2Q5A A;  3WKZ A;  4IQ2 A;  1ZB5 A;  4DRM A;  2ZQS A;  4HBO A;  4URI A;  1QZ2 A;  3CHD A;  3ARZ A;  4MNL A;  2PPO A;  1F40 A;  1WB0 A;  5HT1 A;  4Z2H A;  3CHE A;  1NSG A;  3FXY A;  4DIP A;  3KCE A;  3O5G A;  4ODR A;  2PPP A;  3ARX A;  1JNS A;  4P8V A;  4WKF A;  4W9P A;  2ZR5 A;  1FKD A;  4ODO A;  3WQW A;  1HKI A;  1HKM A;  4N19 A;  1GUV A;  3JXV A;  2UZ5 A;  3WH0 A;  3TCZ A;  4JFL A;  4S3J A;  1X6N A;  3B9A A;  4ZPT R;  4ZPW R;  1LJY A;  1FKH A;  3AS0 A;  3EY6 A;  1FKI A;  4LAX A;  4P8U A;  2G8Z A;  3O5I A;  1FJD A;  4DWS B;  3PRB A;  3WD4 A;  1R9H A;  1JVW A;  4WKA A;  3IKD A;  4MAV A;  3ARR A;  1FKR A;  1ITX A;  4JFM A;  3G6M A;  4FN2 A;  2OLH A;  4JFI A;  2WM0 A;  1XRV A;  1HJW A;  1KT0 A;  3FAP A;  1ZU8 A;  3IKG A;  1EYM A;  1FKK A;  1TCO C;  2ESC A;  2XP8 A;  1UR8 A;  2IF4 A;  3CHC A;  4GGQ A;  1FKS A;  3BXW A;  5DEZ A;  5GPG A;  3IHZ A;  4DRJ A;  1NMV A;  3O5P A;  4Z2K A;  3KAH A;  5GQB A;  3ARS A;  2ZQU A;  2DG4 A;  3NI6 A;  1FKJ A;  5HBF A;  1W9P A;  2DPE A;  2MLX A;  3UI6 A;  1HXV A;  2DT3 A;  2M1I A;  2D9F A;  3WL0 A;  1GOI A;  3NTP A;  4DH0 A;  1BL4 A;  3O5J A;  3ODK A;  2JZV A;  2N87 A;  1KFW A;  1NH6 A;  4LAW A;  3WL1 A;  1E6N A;  4ODP A;  2F4E A;  4J4N A;  3UQA A;  1JND A;  2PV2 A;  3O5Q A;  1W26 A;  4Z2L A;  3UQB A;  3ARO A;  3WQV A;  2F21 A;  4QT2 A;  2KGJ A;  1FD9 A;  1IX5 A;  1J6Y A;  4JYS A;  1FFR A;  1A7X A;  2PI6 A;  3CGN A;  3RM4 A;  1EQ3 A;  1JNE A;  2DT2 A;  4DWS A;  1BKF A;  3KAD A;  1J4H A;  2A3B A;  2AWG A;  4U86 A;  2LPV A;  1X6L A;  2RQS A;  3O5R A;  4TX0 A;  1FKG A;  2XP4 A;  1PIN A;  3PRD A;  2F2D A;  3TC5 A;  3WD3 A;  1TFV A;  2O9O A;  1KT1 A;  2LJ4 A;  1D6O A;  2MF9 A;  2VCD A;  2DSU A;  1P5Q A;  2G41 A;  4TYO A;  1QPF A;  1WAW A;  5HW6 A;  5DF0 A;  1H0I A;  4MSP A;  2MNT A;  3B7X A;  2L2S A;  5DIV A;  1NWT A;  2VN1 A;  3CZ8 A;  1FAP A;  1D7I A;  5HW8 A;  2RSE A;  1F8A B;  3KAF A;  3CGM A;  4ODK A;  1ROU A;  1L1P A;  3RM8 A;  3ARW A;  1E6R A;  4MPK A;  2FAP A;  5B8I C;  5HUA A;  1OGG A;  4TNS A;  1OWQ A;  4DRH A;  3O5L A;  4R5E A;  4JFJ A;  3W4R A;  2ZR6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...