3O5LA

Fk1 domain mutant a19t of fkbp51, crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
total genus 38
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5lA00
1YW5A 2Y78A 2FAPA 3GPKA 1D7HA 4GIVA 4JFJA 4R0XA 2XP7A 1D7IA 1KT1A 3KAIA 3KZ7A 2RUDA 4DZ2A 2DG4A 4TNSA 2RSEA 4DRMA 2F21A 1QZ2A 5HW6A 2KO7A 1D7JA 3FAPA 4IQCA 4QIBA 2F4EA 4LAWA 2FKEA 1JNTA 3TCZA 1Q1CA 2XP6A 4IPXA 1T11A 3VAWA 3O5PA 3CGNA 1BKFA 2MLXA 2OFNA 3IKGA 3ODKA 2ITKA 4G50A 1FKIA 4LAVA 1D6OA 2RUCA 4ODPA 4TX0A 4QT3A 2DG9A 4JFLA 4ODKA 3PRDA 5DITA 1N1AA 3TC5A 2MPHA 1BL4A 3KADA 2ZR6A 2PV3A 4GGQA 1J4RA 1A7XA 1YATA 3JYMA 4DRJA 3KCEA 1P5QA 5D75A 4DRNA 4DRPA 5HWBA 3UI6A 1FKRA 4FN2A 2ZQTA 5HKGA 2PPNA 4O2TA 2ZQVA 3O5KA 4N19A 1ZK6A 1ROUA 3PRBA 4U86A 4TW6A 1Q6UA 1R9HA 1U79A 1B6CA 2RQSA 2MNTA 3O5MA 3JXVA 3O5DA 4JFMA 2XP5A 3RGCA 3KAHA 4DRQA 5HUAA 1HXVA 2VN1A 3O5OA 2PBCA 3KAGA 3IHZA 2XP8A 3UQAA 3TDBA 2K8IA 1FKGA 2M2AA 1PINA 1QPLA 4DT4A 5HTGA 2LPVA 1FKLA 2DG3A 2L2SA 2ZQUA 3KACA 4C02B 3O5RA 5HWCA 4ODOA 3UF8A 1JNSA 2AWGA 2LJ4A 2N87A 3EY6A 4J4OA 4TYOA 1PBKA 1Y0OA 1FKTA 3O5FA 1Q6IA 4U84A 3LUOA 4DROA 5HW7A 2PPPA 2KE0A 4LAXA 3I6CA 2LKNA 1FKFA 3OOBA 3O5JA 2XPBA 2KFWA 4MGVA 1F8AB 4ODNA 3KABA 5DIVA 4DH0A 5J6EA 2KI3A 2XP3A 2D9FA 1NSGA 2ZQSA 1FD9A 3IK8A 3MDYB 2RUQA 5GPGA 3UQBA 4ITZA 5HW8A 1FKJA 1EQ3A 1FKBA 2XP9A 1J6YA 2M1IA 4JFIA 1FKHA 2MLYA 3O5QA 4NNRA 1FKKA 5DIUA 1C9HA 1ZCNA 2UZ5A 4MSPA 5HT1A 4J4NA 3UQIA 1L1PA 3O5IA 3RFWA 2LGOA 3B7XA 4W9QA 4DIPA 4ODRA 3IKDA 1F40A 4QT2A 3UI4A 4DRIA 4DRHA 2RURA 5BXJA 1M5YA 4ODQA 2MF9A 2ZR5A 4U85A 1W26A 3JYJA 4TW8A 4ODMA 2IF4A 2PV1A 1Q6HA 1ROTA 3NI6A 1FJDA 2XP4A 2PV2A 2M08A 5B8IC 5I98A 2JZVA 2KGJA 2MLZA 3H9RB 4IQ2A 3O5LA 2F2DA 4BF8A 3CGMA 1J4HA 4FAPA 3KAFA 1JVWA 4W9OA 2ZR4A 4DRKA 4ODLA 3NTPA 1QPFA 2VCDA 3UI5A 4TW7A 3WH0A 1NMVA 4W9PA 4G2PA 1FKDA 1EYMA 2Q5AA 3O5GA 1NMWA 1KT0A 2PPOA 1FAPA 3O5EA 4JFKA 4DZ3A 3NRKA 4JYSA 4LAYA 1J4IA 1TCOC 2XPAA 2KR7A 3PA7A 1FKSA
chains in the Genus database with same CATH superfamily
1YW5A 2Y78A 4PTMA 1KT1A 3KZ7A 2G8ZA 2RUDA 2RSEA 1HKIA 4IQCA 4WJXA 3FXYA 4Q22A 4QIBA 1UR8A 2XP6A 4MNLA 3O5PA 3CGNA 3IKGA 2OFNA 3VAWA 3ODKA 2ITKA 1FKIA 4ODPA 2RUCA 2DG9A 3G6MA 3ARWA 3AS0A 4MNKA 2O92A 4DRJA 4WK9A 4ZS6A 3UI6A 2ZQTA 2PPNA 4O2TA 1GOIA 4N19A 1ROUA 4U86A 4TW6A 3AS2A 2RQSA 3RGCA 3JXVA 2XP5A 3WD1A 1HXVA 2DT1A 1ZBVA 1HKJA 1ZBKA 3CHFA 2K8IA 5HTGA 1LJYA 1FKLA 4WKAA 3WD3A 2ZQUA 2ESCA 4C02B 1UR9A 3O5RA 5HWCA 4ODOA 4HARA 1JNSA 5GQBA 1Y0OA 1E44A 4WKFA 3AS1A 4ODNA 5J6EA 4DH0A 4ITZA 4AY1A 5HW8A 1GRJA 1FKBA 1ZBWA 2DSZA 3O5QA 2FDMA 5DIUA 4DWSC 3UQIA 4MSPA 3WIJA 3RFWA 4W9QA 4ODRA 3IKDA 4QT2A 1X6LA 4DRIA 4DRHA 2RURA 1M5YA 4ODQA 4TW8A 4Z2KA 1ROTA 1FJDA 1WNOA 2M08A 1W1VA 1H0GA 1W9VA 1J4HA 4W9OA 3UI5A 4TW7A 4MNJA 4W9PA 2Q5AA 3ARUA 4IT4A 1HKKA 2PPOA 3B8SA 2A3AA 1TCOC 2KR7A 1E6NA 2FAPA 1D7HA 3CHDA 3PRAA 4TNSA 1OWQA 2KO7A 3BXWA 2F4EA 2FKEA 1Q1CA 5DO2A 4IPXA 4LAVA 4QT3A 4JFLA 3PRDA 1J4RA 1WAWA 3JYMA 1YATA 3KCEA 5HWBA 1JCHB 2B5UB 1OGGA 3AS3A 3RM8A 3O5KA 2B31A 4JFMA 3O5MA 4P8WA 4S3JA 2PBCA 1OGBA 3UQAA 3TDBA 1FKGA 1PINA 1QPLA 2O9OA 2LPVA 2DG3A 4Z2GA 2AWGA 2N87A 4J4OA 4TYOA 4IT6A 1FKTA 5DEZA 2WLYA 4U84A 1E6PA 2KE0A 4LAXA 2LKNA 1FFRA 2XPBA 1F8AB 4XAKA 4HBEA 2XP3A 1NSGA 2RUQA 4P8VA 4WIWA 3FY1A 1SR0A 1HJXA 4MNMA 1J6YA 3CHCA 2M1IA 4JFIA 1FFQA 1FKKA 4ZPVR 5HT1A 5GPRA 3AQUA 1L1PA 3O5IA 2WK2A 3B7XA 4ML4A 2DSWA 3B9EA 4DIPA 1RD6A 3ARPA 1IX5A 5BXJA 1LQ0A 1E15A 1W26A 1EDQA 4DWSD 2PV1A 4R5EA 1GPFA 3G6LA 1E9LA 1E6ZA 5B8IC 2EULA 4FAPA 1LG1A 2DSVA 4DRKA 2ZR4A 3GU0A 1QPFA 4ZPWR 3WH0A 4P8XA 4G2PA 1EYMA 4MAVA 1NMWA 3RM4A 1KT0A 1O6IA 1FAPA 3O5EA 4DZ3A 3NRKA 4DWSA 1J4IA 3PA7A 1NWRA 4LGXA 3GPKA 4GIVA 1WB0A 2WM0A 3KAIA 3ARSA 2DG4A 4DRMA 1K9TA 2F21A 5HW6A 1HKMA 4Z2IA 4LAWA 1W9PA 1JNTA 3ALFA 1T11A 4G50A 3ARXA 2P4VA 3GTYX 3TC5A 3RMEA 2PV3A 4QZVB 1P5QA 5D75A 3WKZA 3ARTA 4FN2A 5HKGA 2G41A 1ZK6A 1Q6UA 1R9HA 1U79A 1B6CA 2MNTA 2AOSA 3O5OA 1ZBCA 4P8UA 3IHZA 3ARQA 2M2AA 2PN0A 4Z2HA 4DT4A 3KACA 1KFWA 3CZ8A 4WKHA 4KR0B 4W5UA 3O5FA 4DROA 5HW7A 1NH6A 3I6CA 4L3NA 3OOBA 5DIVA 1GUVA 2KFWA 4MGVA 3WQWA 2KI3A 4DWSB 4ZPTR 1FD9A 1FKJA 3B9AA 1NWSA 1EQ3A 2XP9A 2A3EA 3WD4A 4Z2LA 1C9HA 1ZB5A 1ZCNA 4J4NA 2ETNA 4S3KA 2OLHA 4NZCA 4L72B 3UI4A 2WLZA 3ARRA 1VF8A 4MTVA 4U85A 5JH8A 3JYJA 1ZU8A 4KQZA 2IF4A 1HJVA 3NI6A 2XP4A 2F23A 5I98A 1XRVA 2JZVA 2KGJA 2MLZA 3H9RB 4IQ2A 3O5LA 4Q7NA 4HBOA 2A3CA 3CGMA 3WL1A 1NWTA 4ODLA 2VCDA 3CHEA 1FKDA 2IUZA 5HBFA 1W1YA 2YBUA 1LG2A 3PR9A 1JNEA 1H0IA 1NWUA 3QOKA 1W1TA 4JFJA 1XHGA 4R0XA 2XP7A 1D7IA 4DZ2A 1E6RA 1QZ2A 1D7JA 3FAPA 4MPKA 2DT0A 3AROA 3TCZA 1BKFA 2MLXA 1EIBA 1D6OA 4ODKA 3B9DA 5DITA 1N1AA 2MPHA 3WL0A 1BL4A 3ALGA 3KADA 2ZR6A 4GGQA 3CH9A 3RM9A 1A7XA 1JNDA 4DRNA 4DRPA 3W4RA 3WQVA 1FKRA 1ZL1A 3BMBA 2ZQVA 2DT3A 3PRBA 3EIPA 1LL4A 1TFVA 3O5DA 5HUAA 3KAHA 4DRQA 2VN1A 3KAGA 2XP8A 1EHNA 2PI6A 2L2SA 5DF0A 3WD2A 3UF8A 2LJ4A 3EY6A 1PBKA 4NSBA 1SYTA 1Q6IA 3LUOA 2PPPA 1X6NA 4Z2JA 1FKFA 3O5JA 2A3BA 3KABA 2D9FA 1LL7A 2ZQSA 1LL6A 3IK8A 3MDYB 5GPGA 3UQBA 4URIA 1FKHA 2MLYA 4NNRA 1W1PA 2UZ5A 1HJWA 3OA5A 2LGOA 1F40A 1ITXA 2DT2A 2DSUA 2MF9A 2ZR5A 3ARZA 4ODMA 1Q6HA 2PV2A 4UDMA 2QF8A 1CTNA 2F2DA 4BF8A 2DPEA 2YBTA 3KAFA 1JVWA 1D2KA 3NTPA 1W9UA 1NMVA 3WD0A 3O5GA 3ARVA 4JFKA 3ARYA 4JYSA 4LAYA 2XPAA 4TX0A 1FKSA
chains in the Genus database with same CATH topology
1YW5A 2Y78A 4PTMA 1KT1A 3KZ7A 2G8ZA 2RUDA 2RSEA 1HKIA 4IQCA 4WJXA 3FXYA 4Q22A 4QIBA 1UR8A 2XP6A 4MNLA 3O5PA 3CGNA 3IKGA 2OFNA 3VAWA 3ODKA 2ITKA 1FKIA 4ODPA 2RUCA 2DG9A 3G6MA 3ARWA 3AS0A 4MNKA 2O92A 4DRJA 4WK9A 4ZS6A 3UI6A 2ZQTA 2PPNA 4O2TA 1GOIA 4N19A 1ROUA 4U86A 4TW6A 3AS2A 2RQSA 3RGCA 3JXVA 2XP5A 3WD1A 1HXVA 2DT1A 1ZBVA 1HKJA 1ZBKA 3CHFA 2K8IA 5HTGA 1LJYA 1FKLA 4WKAA 3WD3A 2ZQUA 2ESCA 4C02B 1UR9A 3O5RA 5HWCA 4ODOA 4HARA 1JNSA 5GQBA 1Y0OA 4WKFA 3AS1A 4ODNA 5J6EA 4DH0A 4ITZA 4AY1A 5HW8A 1FKBA 1ZBWA 2DSZA 3O5QA 2FDMA 5DIUA 4DWSC 3UQIA 4MSPA 3WIJA 3RFWA 4W9QA 4ODRA 3IKDA 4QT2A 1X6LA 4DRIA 4DRHA 2RURA 1M5YA 4ODQA 4TW8A 4Z2KA 1ROTA 1FJDA 1WNOA 2M08A 1W1VA 1H0GA 1W9VA 1J4HA 4W9OA 3UI5A 4TW7A 4MNJA 4W9PA 2Q5AA 3ARUA 4IT4A 1HKKA 2PPOA 3B8SA 2A3AA 1TCOC 2KR7A 1E6NA 2FAPA 1D7HA 3CHDA 3PRAA 4TNSA 1OWQA 2KO7A 3BXWA 2F4EA 2FKEA 1Q1CA 5DO2A 4IPXA 4LAVA 4QT3A 4JFLA 3PRDA 1J4RA 1WAWA 3JYMA 1YATA 3KCEA 5HWBA 1OGGA 3AS3A 3RM8A 3O5KA 2B31A 4JFMA 3O5MA 4P8WA 4S3JA 2PBCA 1OGBA 3UQAA 3TDBA 1FKGA 1PINA 1QPLA 2O9OA 2LPVA 2DG3A 4Z2GA 2AWGA 2N87A 4J4OA 4TYOA 4IT6A 1FKTA 5DEZA 2WLYA 4U84A 1E6PA 2KE0A 4LAXA 2LKNA 1FFRA 2XPBA 1F8AB 4XAKA 4HBEA 2XP3A 1NSGA 2RUQA 4P8VA 4WIWA 3FY1A 1SR0A 1HJXA 4MNMA 1J6YA 3CHCA 2M1IA 4JFIA 1FFQA 1FKKA 4ZPVR 5HT1A 5GPRA 3AQUA 1L1PA 3O5IA 2WK2A 3B7XA 4ML4A 2DSWA 3B9EA 4DIPA 1RD6A 3ARPA 1IX5A 5BXJA 1LQ0A 1E15A 1W26A 1EDQA 4DWSD 2PV1A 4R5EA 1GPFA 3G6LA 1E9LA 1E6ZA 5B8IC 4FAPA 1LG1A 2DSVA 4DRKA 2ZR4A 1QPFA 4ZPWR 3WH0A 4P8XA 4G2PA 1EYMA 4MAVA 1NMWA 3RM4A 1KT0A 1O6IA 1FAPA 3O5EA 4DZ3A 3NRKA 4DWSA 1J4IA 3PA7A 1NWRA 4LGXA 3GPKA 4GIVA 1WB0A 2WM0A 3KAIA 3ARSA 2DG4A 4DRMA 1K9TA 2F21A 5HW6A 1HKMA 4Z2IA 4LAWA 1W9PA 1JNTA 3ALFA 1T11A 4G50A 3ARXA 3TC5A 3RMEA 2PV3A 4QZVB 1P5QA 5D75A 3WKZA 3ARTA 4FN2A 5HKGA 2G41A 1ZK6A 1Q6UA 1R9HA 1U79A 1B6CA 2MNTA 2AOSA 3O5OA 1ZBCA 4P8UA 3IHZA 3ARQA 2M2AA 4Z2HA 4DT4A 3KACA 1KFWA 3CZ8A 4WKHA 4KR0B 4W5UA 3O5FA 4DROA 5HW7A 1NH6A 3I6CA 4L3NA 3OOBA 5DIVA 1GUVA 2KFWA 4MGVA 3WQWA 2KI3A 4DWSB 4ZPTR 1FD9A 1FKJA 3B9AA 1NWSA 1EQ3A 2XP9A 2A3EA 3WD4A 4Z2LA 1C9HA 1ZB5A 1ZCNA 4J4NA 4S3KA 2OLHA 4NZCA 4L72B 3UI4A 2WLZA 3ARRA 1VF8A 4MTVA 4U85A 5JH8A 3JYJA 1ZU8A 4KQZA 2IF4A 1HJVA 3NI6A 2XP4A 5I98A 1XRVA 2JZVA 2KGJA 2MLZA 3H9RB 4IQ2A 3O5LA 4Q7NA 4HBOA 2A3CA 3CGMA 3WL1A 1NWTA 4ODLA 2VCDA 3CHEA 1FKDA 2IUZA 5HBFA 1W1YA 2YBUA 1LG2A 3PR9A 1JNEA 1H0IA 1NWUA 3QOKA 1W1TA 4JFJA 1XHGA 4R0XA 2XP7A 1D7IA 4DZ2A 1E6RA 1QZ2A 1D7JA 3FAPA 4MPKA 2DT0A 3AROA 3TCZA 1BKFA 2MLXA 1EIBA 1D6OA 4ODKA 3B9DA 5DITA 1N1AA 2MPHA 3WL0A 1BL4A 3ALGA 3KADA 2ZR6A 4GGQA 3CH9A 3RM9A 1A7XA 1JNDA 4DRNA 4DRPA 3W4RA 3WQVA 1FKRA 1ZL1A 2ZQVA 2DT3A 3PRBA 1LL4A 1TFVA 3O5DA 5HUAA 3KAHA 4DRQA 2VN1A 3KAGA 2XP8A 1EHNA 2PI6A 2L2SA 5DF0A 3WD2A 3UF8A 2LJ4A 3EY6A 1PBKA 4NSBA 1SYTA 1Q6IA 3LUOA 2PPPA 1X6NA 4Z2JA 1FKFA 3O5JA 2A3BA 3KABA 2D9FA 1LL7A 2ZQSA 1LL6A 3IK8A 3MDYB 5GPGA 3UQBA 4URIA 1FKHA 2MLYA 4NNRA 1W1PA 2UZ5A 1HJWA 3OA5A 2LGOA 1F40A 1ITXA 2DT2A 2DSUA 2MF9A 2ZR5A 3ARZA 4ODMA 1Q6HA 2PV2A 2QF8A 1CTNA 2F2DA 4BF8A 2DPEA 2YBTA 3KAFA 1JVWA 1D2KA 3NTPA 1W9UA 1NMVA 3WD0A 3O5GA 3ARVA 4JFKA 3ARYA 4JYSA 4LAYA 2XPAA 4TX0A 1FKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW5 A;  2Y78 A;  2FAP A;  3GPK A;  1D7H A;  4GIV A;  4JFJ A;  4R0X A;  2XP7 A;  1D7I A;  1KT1 A;  3KAI A;  3KZ7 A;  2RUD A;  4DZ2 A;  2DG4 A;  4TNS A;  2RSE A;  4DRM A;  2F21 A;  1QZ2 A;  5HW6 A;  2KO7 A;  1D7J A;  3FAP A;  4IQC A;  4QIB A;  2F4E A;  4LAW A;  2FKE A;  1JNT A;  3TCZ A;  1Q1C A;  2XP6 A;  4IPX A;  1T11 A;  3VAW A;  3O5P A;  3CGN A;  1BKF A;  2MLX A;  2OFN A;  3IKG A;  3ODK A;  2ITK A;  4G50 A;  1FKI A;  4LAV A;  1D6O A;  2RUC A;  4ODP A;  4TX0 A;  4QT3 A;  2DG9 A;  4JFL A;  4ODK A;  3PRD A;  5DIT A;  1N1A A;  3TC5 A;  2MPH A;  1BL4 A;  3KAD A;  2ZR6 A;  2PV3 A;  4GGQ A;  1J4R A;  1A7X A;  1YAT A;  3JYM A;  4DRJ A;  3KCE A;  1P5Q A;  5D75 A;  4DRN A;  4DRP A;  5HWB A;  3UI6 A;  1FKR A;  4FN2 A;  2ZQT A;  5HKG A;  2PPN A;  4O2T A;  2ZQV A;  3O5K A;  4N19 A;  1ZK6 A;  1ROU A;  3PRB A;  4U86 A;  4TW6 A;  1Q6U A;  1R9H A;  1U79 A;  1B6C A;  2RQS A;  2MNT A;  3O5M A;  3JXV A;  3O5D A;  4JFM A;  2XP5 A;  3RGC A;  3KAH A;  4DRQ A;  5HUA A;  1HXV A;  2VN1 A;  3O5O A;  2PBC A;  3KAG A;  3IHZ A;  2XP8 A;  3UQA A;  3TDB A;  2K8I A;  1FKG A;  2M2A A;  1PIN A;  1QPL A;  4DT4 A;  5HTG A;  2LPV A;  1FKL A;  2DG3 A;  2L2S A;  2ZQU A;  3KAC A;  4C02 B;  3O5R A;  5HWC A;  4ODO A;  3UF8 A;  1JNS A;  2AWG A;  2LJ4 A;  2N87 A;  3EY6 A;  4J4O A;  4TYO A;  1PBK A;  1Y0O A;  1FKT A;  3O5F A;  1Q6I A;  4U84 A;  3LUO A;  4DRO A;  5HW7 A;  2PPP A;  2KE0 A;  4LAX A;  3I6C A;  2LKN A;  1FKF A;  3OOB A;  3O5J A;  2XPB A;  2KFW A;  4MGV A;  1F8A B;  4ODN A;  3KAB A;  5DIV A;  4DH0 A;  5J6E A;  2KI3 A;  2XP3 A;  2D9F A;  1NSG A;  2ZQS A;  1FD9 A;  3IK8 A;  3MDY B;  2RUQ A;  5GPG A;  3UQB A;  4ITZ A;  5HW8 A;  1FKJ A;  1EQ3 A;  1FKB A;  2XP9 A;  1J6Y A;  2M1I A;  4JFI A;  1FKH A;  2MLY A;  3O5Q A;  4NNR A;  1FKK A;  5DIU A;  1C9H A;  1ZCN A;  2UZ5 A;  4MSP A;  5HT1 A;  4J4N A;  3UQI A;  1L1P A;  3O5I A;  3RFW A;  2LGO A;  3B7X A;  4W9Q A;  4DIP A;  4ODR A;  3IKD A;  1F40 A;  4QT2 A;  3UI4 A;  4DRI A;  4DRH A;  2RUR A;  5BXJ A;  1M5Y A;  4ODQ A;  2MF9 A;  2ZR5 A;  4U85 A;  1W26 A;  3JYJ A;  4TW8 A;  4ODM A;  2IF4 A;  2PV1 A;  1Q6H A;  1ROT A;  3NI6 A;  1FJD A;  2XP4 A;  2PV2 A;  2M08 A;  5B8I C;  5I98 A;  2JZV A;  2KGJ A;  2MLZ A;  3H9R B;  4IQ2 A;  3O5L A;  2F2D A;  4BF8 A;  3CGM A;  1J4H A;  4FAP A;  3KAF A;  1JVW A;  4W9O A;  2ZR4 A;  4DRK A;  4ODL A;  3NTP A;  1QPF A;  2VCD A;  3UI5 A;  4TW7 A;  3WH0 A;  1NMV A;  4W9P A;  4G2P A;  1FKD A;  1EYM A;  2Q5A A;  3O5G A;  1NMW A;  1KT0 A;  2PPO A;  1FAP A;  3O5E A;  4JFK A;  4DZ3 A;  3NRK A;  4JYS A;  4LAY A;  1J4I A;  1TCO C;  2XPA A;  2KR7 A;  3PA7 A;  1FKS A; 
#chains in the Genus database with same CATH topology
 1YW5 A;  2Y78 A;  4PTM A;  1KT1 A;  3KZ7 A;  2G8Z A;  2RUD A;  2RSE A;  1HKI A;  4IQC A;  4WJX A;  3FXY A;  4Q22 A;  4QIB A;  1UR8 A;  2XP6 A;  4MNL A;  3O5P A;  3CGN A;  3IKG A;  2OFN A;  3VAW A;  3ODK A;  2ITK A;  1FKI A;  4ODP A;  2RUC A;  2DG9 A;  3G6M A;  3ARW A;  3AS0 A;  4MNK A;  2O92 A;  4DRJ A;  4WK9 A;  4ZS6 A;  3UI6 A;  2ZQT A;  2PPN A;  4O2T A;  1GOI A;  4N19 A;  1ROU A;  4U86 A;  4TW6 A;  3AS2 A;  2RQS A;  3RGC A;  3JXV A;  2XP5 A;  3WD1 A;  1HXV A;  2DT1 A;  1ZBV A;  1HKJ A;  1ZBK A;  3CHF A;  2K8I A;  5HTG A;  1LJY A;  1FKL A;  4WKA A;  3WD3 A;  2ZQU A;  2ESC A;  4C02 B;  1UR9 A;  3O5R A;  5HWC A;  4ODO A;  4HAR A;  1JNS A;  5GQB A;  1Y0O A;  1E44 A;  4WKF A;  3AS1 A;  4ODN A;  5J6E A;  4DH0 A;  4ITZ A;  4AY1 A;  5HW8 A;  1GRJ A;  1FKB A;  1ZBW A;  2DSZ A;  3O5Q A;  2FDM A;  5DIU A;  4DWS C;  3UQI A;  4MSP A;  3WIJ A;  3RFW A;  4W9Q A;  4ODR A;  3IKD A;  4QT2 A;  1X6L A;  4DRI A;  4DRH A;  2RUR A;  1M5Y A;  4ODQ A;  4TW8 A;  4Z2K A;  1ROT A;  1FJD A;  1WNO A;  2M08 A;  1W1V A;  1H0G A;  1W9V A;  1J4H A;  4W9O A;  3UI5 A;  4TW7 A;  4MNJ A;  4W9P A;  2Q5A A;  3ARU A;  4IT4 A;  1HKK A;  2PPO A;  3B8S A;  2A3A A;  1TCO C;  2KR7 A;  1E6N A;  2FAP A;  1D7H A;  3CHD A;  3PRA A;  4TNS A;  1OWQ A;  2KO7 A;  3BXW A;  2F4E A;  2FKE A;  1Q1C A;  5DO2 A;  4IPX A;  4LAV A;  4QT3 A;  4JFL A;  3PRD A;  1J4R A;  1WAW A;  3JYM A;  1YAT A;  3KCE A;  5HWB A;  1JCH B;  2B5U B;  1OGG A;  3AS3 A;  3RM8 A;  3O5K A;  2B31 A;  4JFM A;  3O5M A;  4P8W A;  4S3J A;  2PBC A;  1OGB A;  3UQA A;  3TDB A;  1FKG A;  1PIN A;  1QPL A;  2O9O A;  2LPV A;  2DG3 A;  4Z2G A;  2AWG A;  2N87 A;  4J4O A;  4TYO A;  4IT6 A;  1FKT A;  5DEZ A;  2WLY A;  4U84 A;  1E6P A;  2KE0 A;  4LAX A;  2LKN A;  1FFR A;  2XPB A;  1F8A B;  4XAK A;  4HBE A;  2XP3 A;  1NSG A;  2RUQ A;  4P8V A;  4WIW A;  3FY1 A;  1SR0 A;  1HJX A;  4MNM A;  1J6Y A;  3CHC A;  2M1I A;  4JFI A;  1FFQ A;  1FKK A;  4ZPV R;  5HT1 A;  5GPR A;  3AQU A;  1L1P A;  3O5I A;  2WK2 A;  3B7X A;  4ML4 A;  2DSW A;  3B9E A;  4DIP A;  1RD6 A;  3ARP A;  1IX5 A;  5BXJ A;  1LQ0 A;  1E15 A;  1W26 A;  1EDQ A;  4DWS D;  2PV1 A;  4R5E A;  1GPF A;  3G6L A;  1E9L A;  1E6Z A;  5B8I C;  2EUL A;  4FAP A;  1LG1 A;  2DSV A;  4DRK A;  2ZR4 A;  3GU0 A;  1QPF A;  4ZPW R;  3WH0 A;  4P8X A;  4G2P A;  1EYM A;  4MAV A;  1NMW A;  3RM4 A;  1KT0 A;  1O6I A;  1FAP A;  3O5E A;  4DZ3 A;  3NRK A;  4DWS A;  1J4I A;  3PA7 A;  1NWR A;  4LGX A;  3GPK A;  4GIV A;  1WB0 A;  2WM0 A;  3KAI A;  3ARS A;  2DG4 A;  4DRM A;  1K9T A;  2F21 A;  5HW6 A;  1HKM A;  4Z2I A;  4LAW A;  1W9P A;  1JNT A;  3ALF A;  1T11 A;  4G50 A;  3ARX A;  2P4V A;  3GTY X;  3TC5 A;  3RME A;  2PV3 A;  4QZV B;  1P5Q A;  5D75 A;  3WKZ A;  3ART A;  4FN2 A;  5HKG A;  2G41 A;  1ZK6 A;  1Q6U A;  1R9H A;  1U79 A;  1B6C A;  2MNT A;  2AOS A;  3O5O A;  1ZBC A;  4P8U A;  3IHZ A;  3ARQ A;  2M2A A;  2PN0 A;  4Z2H A;  4DT4 A;  3KAC A;  1KFW A;  3CZ8 A;  4WKH A;  4KR0 B;  4W5U A;  3O5F A;  4DRO A;  5HW7 A;  1NH6 A;  3I6C A;  4L3N A;  3OOB A;  5DIV A;  1GUV A;  2KFW A;  4MGV A;  3WQW A;  2KI3 A;  4DWS B;  4ZPT R;  1FD9 A;  1FKJ A;  3B9A A;  1NWS A;  1EQ3 A;  2XP9 A;  2A3E A;  3WD4 A;  4Z2L A;  1C9H A;  1ZB5 A;  1ZCN A;  4J4N A;  2ETN A;  4S3K A;  2OLH A;  4NZC A;  4L72 B;  3UI4 A;  2WLZ A;  3ARR A;  1VF8 A;  4MTV A;  4U85 A;  5JH8 A;  3JYJ A;  1ZU8 A;  4KQZ A;  2IF4 A;  1HJV A;  3NI6 A;  2XP4 A;  2F23 A;  5I98 A;  1XRV A;  2JZV A;  2KGJ A;  2MLZ A;  3H9R B;  4IQ2 A;  3O5L A;  4Q7N A;  4HBO A;  2A3C A;  3CGM A;  3WL1 A;  1NWT A;  4ODL A;  2VCD A;  3CHE A;  1FKD A;  2IUZ A;  5HBF A;  1W1Y A;  2YBU A;  1LG2 A;  3PR9 A;  1JNE A;  1H0I A;  1NWU A;  3QOK A;  1W1T A;  4JFJ A;  1XHG A;  4R0X A;  2XP7 A;  1D7I A;  4DZ2 A;  1E6R A;  1QZ2 A;  1D7J A;  3FAP A;  4MPK A;  2DT0 A;  3ARO A;  3TCZ A;  1BKF A;  2MLX A;  1EIB A;  1D6O A;  4ODK A;  3B9D A;  5DIT A;  1N1A A;  2MPH A;  3WL0 A;  1BL4 A;  3ALG A;  3KAD A;  2ZR6 A;  4GGQ A;  3CH9 A;  3RM9 A;  1A7X A;  1JND A;  4DRN A;  4DRP A;  3W4R A;  3WQV A;  1FKR A;  1ZL1 A;  3BMB A;  2ZQV A;  2DT3 A;  3PRB A;  3EIP A;  1LL4 A;  1TFV A;  3O5D A;  5HUA A;  3KAH A;  4DRQ A;  2VN1 A;  3KAG A;  2XP8 A;  1EHN A;  2PI6 A;  2L2S A;  5DF0 A;  3WD2 A;  3UF8 A;  2LJ4 A;  3EY6 A;  1PBK A;  4NSB A;  1SYT A;  1Q6I A;  3LUO A;  2PPP A;  1X6N A;  4Z2J A;  1FKF A;  3O5J A;  2A3B A;  3KAB A;  2D9F A;  1LL7 A;  2ZQS A;  1LL6 A;  3IK8 A;  3MDY B;  5GPG A;  3UQB A;  4URI A;  1FKH A;  2MLY A;  4NNR A;  1W1P A;  2UZ5 A;  1HJW A;  3OA5 A;  2LGO A;  1F40 A;  1ITX A;  2DT2 A;  2DSU A;  2MF9 A;  2ZR5 A;  3ARZ A;  4ODM A;  1Q6H A;  2PV2 A;  4UDM A;  2QF8 A;  1CTN A;  2F2D A;  4BF8 A;  2DPE A;  2YBT A;  3KAF A;  1JVW A;  1D2K A;  3NTP A;  1W9U A;  1NMV A;  3WD0 A;  3O5G A;  3ARV A;  4JFK A;  3ARY A;  4JYS A;  4LAY A;  2XPA A;  4TX0 A;  1FKS A; 
#chains in the Genus database with same CATH homology
 1YW5 A;  2Y78 A;  4PTM A;  1KT1 A;  3KZ7 A;  2G8Z A;  2RUD A;  2RSE A;  1HKI A;  4IQC A;  4WJX A;  3FXY A;  4Q22 A;  4QIB A;  1UR8 A;  2XP6 A;  4MNL A;  3O5P A;  3CGN A;  3IKG A;  2OFN A;  3VAW A;  3ODK A;  2ITK A;  1FKI A;  4ODP A;  2RUC A;  2DG9 A;  3G6M A;  3ARW A;  3AS0 A;  4MNK A;  2O92 A;  4DRJ A;  4WK9 A;  4ZS6 A;  3UI6 A;  2ZQT A;  2PPN A;  4O2T A;  1GOI A;  4N19 A;  1ROU A;  4U86 A;  4TW6 A;  3AS2 A;  2RQS A;  3RGC A;  3JXV A;  2XP5 A;  3WD1 A;  1HXV A;  2DT1 A;  1ZBV A;  1HKJ A;  1ZBK A;  3CHF A;  2K8I A;  5HTG A;  1LJY A;  1FKL A;  4WKA A;  3WD3 A;  2ZQU A;  2ESC A;  4C02 B;  1UR9 A;  3O5R A;  5HWC A;  4ODO A;  4HAR A;  1JNS A;  5GQB A;  1Y0O A;  4WKF A;  3AS1 A;  4ODN A;  5J6E A;  4DH0 A;  4ITZ A;  4AY1 A;  5HW8 A;  1FKB A;  1ZBW A;  2DSZ A;  3O5Q A;  2FDM A;  5DIU A;  4DWS C;  3UQI A;  4MSP A;  3WIJ A;  3RFW A;  4W9Q A;  4ODR A;  3IKD A;  4QT2 A;  1X6L A;  4DRI A;  4DRH A;  2RUR A;  1M5Y A;  4ODQ A;  4TW8 A;  4Z2K A;  1ROT A;  1FJD A;  1WNO A;  2M08 A;  1W1V A;  1H0G A;  1W9V A;  1J4H A;  4W9O A;  3UI5 A;  4TW7 A;  4MNJ A;  4W9P A;  2Q5A A;  3ARU A;  4IT4 A;  1HKK A;  2PPO A;  3B8S A;  2A3A A;  1TCO C;  2KR7 A;  1E6N A;  2FAP A;  1D7H A;  3CHD A;  3PRA A;  4TNS A;  1OWQ A;  2KO7 A;  3BXW A;  2F4E A;  2FKE A;  1Q1C A;  5DO2 A;  4IPX A;  4LAV A;  4QT3 A;  4JFL A;  3PRD A;  1J4R A;  1WAW A;  3JYM A;  1YAT A;  3KCE A;  5HWB A;  1OGG A;  3AS3 A;  3RM8 A;  3O5K A;  2B31 A;  4JFM A;  3O5M A;  4P8W A;  4S3J A;  2PBC A;  1OGB A;  3UQA A;  3TDB A;  1FKG A;  1PIN A;  1QPL A;  2O9O A;  2LPV A;  2DG3 A;  4Z2G A;  2AWG A;  2N87 A;  4J4O A;  4TYO A;  4IT6 A;  1FKT A;  5DEZ A;  2WLY A;  4U84 A;  1E6P A;  2KE0 A;  4LAX A;  2LKN A;  1FFR A;  2XPB A;  1F8A B;  4XAK A;  4HBE A;  2XP3 A;  1NSG A;  2RUQ A;  4P8V A;  4WIW A;  3FY1 A;  1SR0 A;  1HJX A;  4MNM A;  1J6Y A;  3CHC A;  2M1I A;  4JFI A;  1FFQ A;  1FKK A;  4ZPV R;  5HT1 A;  5GPR A;  3AQU A;  1L1P A;  3O5I A;  2WK2 A;  3B7X A;  4ML4 A;  2DSW A;  3B9E A;  4DIP A;  1RD6 A;  3ARP A;  1IX5 A;  5BXJ A;  1LQ0 A;  1E15 A;  1W26 A;  1EDQ A;  4DWS D;  2PV1 A;  4R5E A;  1GPF A;  3G6L A;  1E9L A;  1E6Z A;  5B8I C;  4FAP A;  1LG1 A;  2DSV A;  4DRK A;  2ZR4 A;  1QPF A;  4ZPW R;  3WH0 A;  4P8X A;  4G2P A;  1EYM A;  4MAV A;  1NMW A;  3RM4 A;  1KT0 A;  1O6I A;  1FAP A;  3O5E A;  4DZ3 A;  3NRK A;  4DWS A;  1J4I A;  3PA7 A;  1NWR A;  4LGX A;  3GPK A;  4GIV A;  1WB0 A;  2WM0 A;  3KAI A;  3ARS A;  2DG4 A;  4DRM A;  1K9T A;  2F21 A;  5HW6 A;  1HKM A;  4Z2I A;  4LAW A;  1W9P A;  1JNT A;  3ALF A;  1T11 A;  4G50 A;  3ARX A;  3TC5 A;  3RME A;  2PV3 A;  4QZV B;  1P5Q A;  5D75 A;  3WKZ A;  3ART A;  4FN2 A;  5HKG A;  2G41 A;  1ZK6 A;  1Q6U A;  1R9H A;  1U79 A;  1B6C A;  2MNT A;  2AOS A;  3O5O A;  1ZBC A;  4P8U A;  3IHZ A;  3ARQ A;  2M2A A;  4Z2H A;  4DT4 A;  3KAC A;  1KFW A;  3CZ8 A;  4WKH A;  4KR0 B;  4W5U A;  3O5F A;  4DRO A;  5HW7 A;  1NH6 A;  3I6C A;  4L3N A;  3OOB A;  5DIV A;  1GUV A;  2KFW A;  4MGV A;  3WQW A;  2KI3 A;  4DWS B;  4ZPT R;  1FD9 A;  1FKJ A;  3B9A A;  1NWS A;  1EQ3 A;  2XP9 A;  2A3E A;  3WD4 A;  4Z2L A;  1C9H A;  1ZB5 A;  1ZCN A;  4J4N A;  4S3K A;  2OLH A;  4NZC A;  4L72 B;  3UI4 A;  2WLZ A;  3ARR A;  1VF8 A;  4MTV A;  4U85 A;  5JH8 A;  3JYJ A;  1ZU8 A;  4KQZ A;  2IF4 A;  1HJV A;  3NI6 A;  2XP4 A;  5I98 A;  1XRV A;  2JZV A;  2KGJ A;  2MLZ A;  3H9R B;  4IQ2 A;  3O5L A;  4Q7N A;  4HBO A;  2A3C A;  3CGM A;  3WL1 A;  1NWT A;  4ODL A;  2VCD A;  3CHE A;  1FKD A;  2IUZ A;  5HBF A;  1W1Y A;  2YBU A;  1LG2 A;  3PR9 A;  1JNE A;  1H0I A;  1NWU A;  3QOK A;  1W1T A;  4JFJ A;  1XHG A;  4R0X A;  2XP7 A;  1D7I A;  4DZ2 A;  1E6R A;  1QZ2 A;  1D7J A;  3FAP A;  4MPK A;  2DT0 A;  3ARO A;  3TCZ A;  1BKF A;  2MLX A;  1EIB A;  1D6O A;  4ODK A;  3B9D A;  5DIT A;  1N1A A;  2MPH A;  3WL0 A;  1BL4 A;  3ALG A;  3KAD A;  2ZR6 A;  4GGQ A;  3CH9 A;  3RM9 A;  1A7X A;  1JND A;  4DRN A;  4DRP A;  3W4R A;  3WQV A;  1FKR A;  1ZL1 A;  2ZQV A;  2DT3 A;  3PRB A;  1LL4 A;  1TFV A;  3O5D A;  5HUA A;  3KAH A;  4DRQ A;  2VN1 A;  3KAG A;  2XP8 A;  1EHN A;  2PI6 A;  2L2S A;  5DF0 A;  3WD2 A;  3UF8 A;  2LJ4 A;  3EY6 A;  1PBK A;  4NSB A;  1SYT A;  1Q6I A;  3LUO A;  2PPP A;  1X6N A;  4Z2J A;  1FKF A;  3O5J A;  2A3B A;  3KAB A;  2D9F A;  1LL7 A;  2ZQS A;  1LL6 A;  3IK8 A;  3MDY B;  5GPG A;  3UQB A;  4URI A;  1FKH A;  2MLY A;  4NNR A;  1W1P A;  2UZ5 A;  1HJW A;  3OA5 A;  2LGO A;  1F40 A;  1ITX A;  2DT2 A;  2DSU A;  2MF9 A;  2ZR5 A;  3ARZ A;  4ODM A;  1Q6H A;  2PV2 A;  2QF8 A;  1CTN A;  2F2D A;  4BF8 A;  2DPE A;  2YBT A;  3KAF A;  1JVW A;  1D2K A;  3NTP A;  1W9U A;  1NMV A;  3WD0 A;  3O5G A;  3ARV A;  4JFK A;  3ARY A;  4JYS A;  4LAY A;  2XPA A;  4TX0 A;  1FKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...