3O5LA

Fk1 domain mutant a19t of fkbp51, crystal form i
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 38
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5lA00
4ODPA 2F4EA 3O5KA 3IHZA 3LUOA 3O5GA 4G2PA 5HWCA 4DH0A 1R9HA 2ZQTA 3KABA 3O5OA 2ITKA 5DIVA 1NMVA 1FKJA 3CGNA 4QT3A 1FJDA 1D7JA 5GPGA 2XPBA 3IK8A 4ODLA 4QIBA 1P5QA 3O5PA 1B6CA 1FKFA 2ZQSA 5HT1A 4TYOA 4U84A 2RURA 4W9QA 2ZR6A 3RGCA 5HW8A 5BXJA 4GGQA 4JYSA 1Q6IA 2XP5A 3KAIA 1N1AA 2K8IA 1BL4A 2VN1A 4JFIA 1D7HA 4TNSA 4U86A 4DRJA 5HTGA 3IKGA 4C02B 2FAPA 2XP6A 1J4RA 3H9RB 2MLYA 3KZ7A 4ODNA 2KGJA 1FAPA 2RQSA 2N87A 3JXVA 3KAGA 3O5EA 4DRNA 4BF8A 1C9HA 2XP8A 2F21A 3IKDA 1NMWA 3O5LA 3PRDA 4LAVA 3GPKA 2FKEA 5D75A 1W26A 2MLXA 2XPAA 5J6EA 1ZCNA 1BKFA 1FKTA 1FKSA 1NSGA 1YW5A 3NRKA 1D6OA 1YATA 4IPXA 3RFWA 3KAFA 1FKDA 1FKHA 1ZK6A 3KADA 3O5IA 4W9PA 4DRIA 2LKNA 4TW7A 2LGOA 4NNRA 4DRQA 4TW6A 1EQ3A 2ZQUA 2IF4A 5HKGA 1J6YA 1J4HA 2VCDA 2RUCA 2XP4A 4IQCA 3CGMA 4J4NA 1JNTA 3O5RA 2AWGA 3EY6A 3UF8A 4DROA 1JVWA 2KE0A 1FKBA 1Q6UA 3NI6A 2XP9A 4MGVA 2F2DA 2PPPA 4N19A 3ODKA 2MLZA 4ODKA 1QPFA 2Q5AA 4JFKA 3PRBA 4ODMA 4TW8A 4O2TA 5HWBA 4DZ3A 1JNSA 1M5YA 5DITA 4JFLA 2M08A 3TDBA 3JYJA 2PV2A 4MSPA 1HXVA 1TCOC 4ODOA 1QZ2A 2DG3A 2M2AA 3B7XA 4ODRA 5DIUA 4DRHA 3UQAA 2LPVA 3UI6A 3MDYB 3UI4A 1QPLA 1T11A 4IQ2A 3TC5A 3FAPA 4R0XA 1ROUA 2UZ5A 2JZVA 1L1PA 2MNTA 2PPNA 4JFMA 3UQBA 4DT4A 2ZQVA 2DG4A 2PBCA 4FN2A 1FKGA 3O5DA 3UI5A 5HW7A 4U85A 5HW6A 2D9FA 4LAWA 5I98A 2LJ4A 2MF9A 1PBKA 3I6CA 2OFNA 2PPOA 2KFWA 1KT0A 2M1IA 3WH0A 4DRMA 4DRPA 4DZ2A 3KCEA 1F8AB 2RUDA 1EYMA 1Q6HA 3UQIA 1A7XA 4LAXA 4TX0A 3TCZA 2PV1A 4DRKA 5HUAA 2RSEA 3NTPA 1FKRA 4ITZA 2KO7A 4G50A 2XP7A 3VAWA 1PINA 4ODQA 4QT2A 1F40A 2RUQA 2ZR4A 1KT1A 1Y0OA 3KACA 2XP3A 1FKLA 3PA7A 2MPHA 3KAHA 3O5JA 1Q1CA 1ROTA 2L2SA 4W9OA 2KI3A 1FD9A 1U79A 3O5MA 4FAPA 4JFJA 4DIPA 4LAYA 3OOBA 4J4OA 1D7IA 1FKKA 2PV3A 2Y78A 3O5FA 2KR7A 2DG9A 2ZR5A 1FKIA 1J4IA 3JYMA 3O5QA 4GIVA 5B8IC
chains in the Genus database with same CATH superfamily
2F4EA 3O5KA 2G41A 2ZQTA 4WK9A 3CGNA 2XPBA 1P5QA 3RM4A 1FKFA 2ZQSA 4ZPTR 5HW8A 2F23A 2ETNA 1NWRA 5JH8A 4AY1A 4XAKA 4TNSA 4U86A 2A3BA 4C02B 2FAPA 2XP6A 2AOSA 3RM9A 1HKMA 1OWQA 2YBTA 4DRNA 2XP8A 1X6LA 3IKDA 3PRDA 1EDQA 1W26A 2XPAA 5J6EA 1ZCNA 1BKFA 3NRKA 2DSUA 1FKDA 4W9PA 3KADA 4DRIA 4TW7A 4MNLA 5HKGA 1J6YA 1J4HA 2VCDA 2DT2A 2AWGA 3EY6A 1JVWA 2DSWA 1FKBA 3AS3A 4ML4A 2PPPA 4N19A 2B5UB 1QPFA 5HWBA 4JFLA 1X6NA 3TDBA 1OGGA 2PV2A 3ARWA 1E15A 1QZ2A 2M2AA 3UI6A 1QPLA 1T11A 4IQ2A 3TC5A 2MNTA 2G8ZA 2PN0A 2PBCA 3O5DA 1E6RA 3UI5A 5HW7A 4U85A 5HW6A 1IX5A 2OFNA 2PPOA 1OGBA 3PR9A 1NH6A 3B8SA 1FKRA 2RSEA 4G50A 3VAWA 2ZR4A 3PA7A 3WD0A 2DT1A 1FD9A 4JFJA 4DIPA 4WKHA 2ZR5A 1FKIA 4MTVA 3O5GA 4G2PA 1R9HA 3KABA 3ALFA 2ITKA 1FJDA 3WD3A 4ODLA 2A3EA 2DPEA 4IT6A 5HT1A 4TYOA 4GGQA 2XP5A 3KAIA 2K8IA 2VN1A 5HTGA 1HJWA 3EIPA 3IKGA 3H9RB 4UDMA 4Z2LA 2MLYA 1W9UA 4S3KA 2PI6A 2N87A 2IUZA 1C9HA 4BF8A 2F21A 1WNOA 4Q7NA 5D75A 1LJYA 1JNDA 1FKTA 3FXYA 1FKSA 1YATA 3ARSA 4IPXA 3RFWA 3ARVA 3CH9A 2LGOA 4TW6A 2ZQUA 1GUVA 3WQWA 2DT0A 4IQCA 4ZS6A 4DROA 3CHFA 4MGVA 4DWSA 2XP9A 2MLZA 4NZCA 3ARTA 4ODKA 4JFKA 3W4RA 4ODMA 4TW8A 3BMBA 3ARQA 1JNSA 3JYJA 4MSPA 1HXVA 4R5EA 1EIBA 4NSBA 4S3JA 1XRVA 3UI4A 4DWSC 1ZBCA 3FAPA 2WK2A 1TFVA 1L1PA 1ZBWA 1HKIA 1UR9A 2EULA 4DT4A 3UQBA 1SR0A 4FN2A 2DT3A 1K9TA 4LAWA 2MF9A 1PBKA 2WM0A 3CZ8A 3WL0A 2KFWA 1VF8A 4DZ2A 4IT4A 1Q6HA 4KR0B 1HKJA 1A7XA 5GQBA 4TX0A 3TCZA 1RD6A 4DWSD 4W5UA 4QT2A 1ZBVA 1Y0OA 3KACA 2XP3A 3KAHA 3AS0A 2WLZA 2A3AA 1ROTA 2L2SA 1W1TA 4FAPA 3OOBA 3CHEA 1D7IA 2Y78A 3O5FA 1FFQA 5B8IC 3JYMA 3IHZA 5HWCA 3G6LA 1FKJA 5GPGA 4P8XA 5DO2A 4W9QA 1ZBKA 2ZR6A 4WIWA 5BXJA 1FFRA 1Q6IA 1GOIA 1N1AA 1BL4A 1LG2A 1LL7A 3FY1A 4ODNA 3WIJA 1ZU8A 2RQSA 3B9AA 3KAGA 1NMWA 3WD1A 4DWSB 4ZPWR 2FKEA 4MAVA 1XHGA 4QZVB 3WL1A 1YW5A 1D6OA 1FKHA 3O5IA 1E6PA 4URIA 4WKFA 4NNRA 1EQ3A 1NWUA 1W9VA 2IF4A 2O9OA 2XP4A 1LL4A 3CGMA 4J4NA 1JNTA 3O5RA 3NI6A 2F2DA 4P8UA 1JNEA 1H0GA 3PRBA 1E9LA 1GRJA 3ARXA 5DITA 3QOKA 3WD4A 4ODOA 2DG3A 3B7XA 4ODRA 2FDMA 3ARZA 3MDYB 4R0XA 2B31A 2PPNA 4JFMA 3G6MA 2DG4A 1FKGA 2A3CA 1E44A 5I98A 1LG1A 3I6CA 4L3NA 1KT0A 2QF8A 4DRMA 4DRPA 5HBFA 3RM8A 3ALGA 1F8AB 1EYMA 3UQIA 1JCHB 4HARA 2PV1A 4P8VA 1HJXA 2WLYA 2KO7A 1E6ZA 4ODQA 4PTMA 1KT1A 1ZL1A 4HBOA 2MPHA 3O5JA 4W9OA 2KI3A 1WB0A 1HKKA 1U79A 1H0IA 1FKKA 2PV3A 4GIVA 4ODPA 4MNKA 3LUOA 4DH0A 3O5OA 2DSZA 3ARUA 5DIVA 1NMVA 3AS2A 4QT3A 1LQ0A 1D7JA 3IK8A 4QIBA 4L72B 1D2KA 1B6CA 3O5PA 1W1VA 1CTNA 4U84A 2RURA 5GPRA 3RGCA 3GU0A 1E6NA 4P8WA 4JYSA 4JFIA 1D7HA 1KFWA 1HJVA 4KQZA 4DRJA 1J4RA 3KZ7A 3WQVA 2KGJA 1FAPA 3O5EA 3JXVA 4LAVA 3O5LA 3WD2A 4WJXA 3GPKA 4ZPVR 3ARYA 3B9DA 2MLXA 3AROA 1NSGA 1W1YA 3KAFA 1ZK6A 2LKNA 4DRQA 4MPKA 3B9EA 2RUCA 3CHDA 3UF8A 2DSVA 2KE0A 1Q6UA 1WAWA 3ODKA 2P4VA 3RMEA 4HBEA 2Q5AA 2OLHA 4O2TA 4DZ3A 1M5YA 3AQUA 2M08A 4WKAA 4Q22A 1O6IA 1TCOC 4Z2KA 5DIUA 4DRHA 3ARRA 3UQAA 3GTYX 2LPVA 1W1PA 4MNJA 4MNMA 1ROUA 2UZ5A 1UR8A 2JZVA 1ZB5A 3CHCA 4Z2JA 4Z2IA 2ZQVA 1ITXA 2ESCA 3ARPA 1NWSA 2D9FA 2LJ4A 1NWTA 2M1IA 3WH0A 5DEZA 1LL6A 3KCEA 2RUDA 4LAXA 5HUAA 3OA5A 4DRKA 1GPFA 3NTPA 4Z2GA 2O92A 4ITZA 2XP7A 1PINA 1EHNA 2RUQA 1F40A 1SYTA 3AS1A 1FKLA 4Z2HA 1Q1CA 1W9PA 4LGXA 3WKZA 2YBUA 3O5MA 4LAYA 4J4OA 2KR7A 2DG9A 3O5QA 1J4IA 5DF0A 3PRAA 3BXWA
chains in the Genus database with same CATH topology
2F4EA 3O5KA 2G41A 2ZQTA 4WK9A 3CGNA 2XPBA 1P5QA 3RM4A 1FKFA 2ZQSA 4ZPTR 5HW8A 1NWRA 5JH8A 4AY1A 4XAKA 4TNSA 4U86A 2A3BA 4C02B 2FAPA 2XP6A 2AOSA 3RM9A 1HKMA 1OWQA 2YBTA 4DRNA 2XP8A 1X6LA 3IKDA 3PRDA 1EDQA 1W26A 2XPAA 5J6EA 1ZCNA 1BKFA 3NRKA 2DSUA 1FKDA 4W9PA 3KADA 4DRIA 4TW7A 4MNLA 5HKGA 1J6YA 1J4HA 2VCDA 2DT2A 2AWGA 3EY6A 1JVWA 2DSWA 1FKBA 3AS3A 4ML4A 2PPPA 4N19A 1QPFA 5HWBA 4JFLA 1X6NA 3TDBA 1OGGA 2PV2A 3ARWA 1E15A 1QZ2A 2M2AA 3UI6A 1QPLA 1T11A 4IQ2A 3TC5A 2MNTA 2G8ZA 2PBCA 3O5DA 1E6RA 3UI5A 5HW7A 4U85A 5HW6A 1IX5A 2OFNA 2PPOA 1OGBA 3PR9A 1NH6A 3B8SA 1FKRA 2RSEA 4G50A 3VAWA 2ZR4A 3PA7A 3WD0A 2DT1A 1FD9A 4JFJA 4DIPA 4WKHA 2ZR5A 1FKIA 4MTVA 3O5GA 4G2PA 1R9HA 3KABA 3ALFA 2ITKA 1FJDA 3WD3A 4ODLA 2A3EA 2DPEA 4IT6A 5HT1A 4TYOA 4GGQA 2XP5A 3KAIA 2K8IA 2VN1A 5HTGA 1HJWA 3IKGA 3H9RB 4Z2LA 2MLYA 1W9UA 4S3KA 2PI6A 2N87A 2IUZA 1C9HA 4BF8A 2F21A 1WNOA 4Q7NA 5D75A 1LJYA 1JNDA 1FKTA 3FXYA 1FKSA 1YATA 3ARSA 4IPXA 3RFWA 3ARVA 3CH9A 2LGOA 4TW6A 2ZQUA 1GUVA 3WQWA 2DT0A 4IQCA 4ZS6A 4DROA 3CHFA 4MGVA 4DWSA 2XP9A 2MLZA 4NZCA 3ARTA 4ODKA 4JFKA 3W4RA 4ODMA 4TW8A 3ARQA 1JNSA 3JYJA 4MSPA 1HXVA 4R5EA 1EIBA 4NSBA 4S3JA 1XRVA 3UI4A 4DWSC 1ZBCA 3FAPA 2WK2A 1TFVA 1L1PA 1ZBWA 1HKIA 1UR9A 3UQBA 4DT4A 1SR0A 4FN2A 2DT3A 1K9TA 4LAWA 2MF9A 1PBKA 2WM0A 3CZ8A 3WL0A 2KFWA 1VF8A 4DZ2A 4IT4A 1Q6HA 4KR0B 1HKJA 1A7XA 5GQBA 4TX0A 3TCZA 1RD6A 4DWSD 4W5UA 4QT2A 1ZBVA 1Y0OA 3KACA 2XP3A 3KAHA 3AS0A 2WLZA 2A3AA 1ROTA 2L2SA 1W1TA 4FAPA 3OOBA 3CHEA 1D7IA 2Y78A 3O5FA 1FFQA 5B8IC 3JYMA 3IHZA 5HWCA 3G6LA 1FKJA 5GPGA 4P8XA 5DO2A 4W9QA 1ZBKA 2ZR6A 4WIWA 5BXJA 1FFRA 1Q6IA 1GOIA 1N1AA 1BL4A 1LG2A 1LL7A 3FY1A 4ODNA 3WIJA 1ZU8A 2RQSA 3B9AA 3KAGA 1NMWA 3WD1A 4DWSB 4ZPWR 2FKEA 4MAVA 1XHGA 4QZVB 3WL1A 1YW5A 1D6OA 1FKHA 3O5IA 1E6PA 4URIA 4WKFA 4NNRA 1EQ3A 1NWUA 1W9VA 2IF4A 2O9OA 2XP4A 1LL4A 3CGMA 4J4NA 1JNTA 3O5RA 3NI6A 2F2DA 4P8UA 1JNEA 1H0GA 3PRBA 1E9LA 3ARXA 5DITA 3QOKA 3WD4A 4ODOA 2DG3A 3B7XA 4ODRA 2FDMA 3ARZA 3MDYB 4R0XA 2B31A 2PPNA 4JFMA 3G6MA 2DG4A 1FKGA 2A3CA 5I98A 1LG1A 3I6CA 4L3NA 1KT0A 2QF8A 4DRMA 4DRPA 5HBFA 3RM8A 3ALGA 1F8AB 1EYMA 3UQIA 4HARA 2PV1A 4P8VA 1HJXA 2WLYA 2KO7A 1E6ZA 4ODQA 4PTMA 1KT1A 1ZL1A 4HBOA 2MPHA 3O5JA 4W9OA 2KI3A 1WB0A 1HKKA 1U79A 1H0IA 1FKKA 2PV3A 4GIVA 4ODPA 4MNKA 3LUOA 4DH0A 3O5OA 2DSZA 3ARUA 5DIVA 1NMVA 3AS2A 4QT3A 1LQ0A 1D7JA 3IK8A 4QIBA 4L72B 1D2KA 1B6CA 3O5PA 1W1VA 1CTNA 4U84A 2RURA 5GPRA 3RGCA 1E6NA 4P8WA 4JYSA 4JFIA 1D7HA 1KFWA 1HJVA 4KQZA 4DRJA 1J4RA 3KZ7A 3WQVA 2KGJA 3O5EA 1FAPA 3JXVA 4LAVA 3O5LA 3WD2A 4WJXA 3GPKA 4ZPVR 3ARYA 3B9DA 2MLXA 3AROA 1NSGA 1W1YA 3KAFA 1ZK6A 2LKNA 4DRQA 4MPKA 3B9EA 2RUCA 3CHDA 3UF8A 2DSVA 2KE0A 1Q6UA 1WAWA 3ODKA 3RMEA 4HBEA 2Q5AA 2OLHA 4O2TA 4DZ3A 1M5YA 3AQUA 2M08A 4WKAA 4Q22A 1O6IA 1TCOC 4Z2KA 5DIUA 4DRHA 3ARRA 3UQAA 2LPVA 1W1PA 4MNJA 4MNMA 1ROUA 2UZ5A 1UR8A 2JZVA 1ZB5A 3CHCA 4Z2JA 4Z2IA 2ZQVA 1ITXA 2ESCA 3ARPA 1NWSA 2D9FA 2LJ4A 1NWTA 2M1IA 3WH0A 5DEZA 1LL6A 3KCEA 2RUDA 4LAXA 5HUAA 3OA5A 4DRKA 1GPFA 3NTPA 4Z2GA 2O92A 4ITZA 2XP7A 1PINA 1EHNA 2RUQA 1F40A 1SYTA 3AS1A 1FKLA 4Z2HA 1Q1CA 1W9PA 4LGXA 3WKZA 2YBUA 3O5MA 4LAYA 4J4OA 2KR7A 2DG9A 3O5QA 1J4IA 5DF0A 3PRAA 3BXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ODP A;  2F4E A;  3O5K A;  3IHZ A;  3LUO A;  3O5G A;  4G2P A;  5HWC A;  4DH0 A;  1R9H A;  2ZQT A;  3KAB A;  3O5O A;  2ITK A;  5DIV A;  1NMV A;  1FKJ A;  3CGN A;  4QT3 A;  1FJD A;  1D7J A;  5GPG A;  2XPB A;  3IK8 A;  4ODL A;  4QIB A;  1P5Q A;  3O5P A;  1B6C A;  1FKF A;  2ZQS A;  5HT1 A;  4TYO A;  4U84 A;  2RUR A;  4W9Q A;  2ZR6 A;  3RGC A;  5HW8 A;  5BXJ A;  4GGQ A;  4JYS A;  1Q6I A;  2XP5 A;  3KAI A;  1N1A A;  2K8I A;  1BL4 A;  2VN1 A;  4JFI A;  1D7H A;  4TNS A;  4U86 A;  4DRJ A;  5HTG A;  3IKG A;  4C02 B;  2FAP A;  2XP6 A;  1J4R A;  3H9R B;  2MLY A;  3KZ7 A;  4ODN A;  2KGJ A;  1FAP A;  2RQS A;  2N87 A;  3JXV A;  3KAG A;  3O5E A;  4DRN A;  4BF8 A;  1C9H A;  2XP8 A;  2F21 A;  3IKD A;  1NMW A;  3O5L A;  3PRD A;  4LAV A;  3GPK A;  2FKE A;  5D75 A;  1W26 A;  2MLX A;  2XPA A;  5J6E A;  1ZCN A;  1BKF A;  1FKT A;  1FKS A;  1NSG A;  1YW5 A;  3NRK A;  1D6O A;  1YAT A;  4IPX A;  3RFW A;  3KAF A;  1FKD A;  1FKH A;  1ZK6 A;  3KAD A;  3O5I A;  4W9P A;  4DRI A;  2LKN A;  4TW7 A;  2LGO A;  4NNR A;  4DRQ A;  4TW6 A;  1EQ3 A;  2ZQU A;  2IF4 A;  5HKG A;  1J6Y A;  1J4H A;  2VCD A;  2RUC A;  2XP4 A;  4IQC A;  3CGM A;  4J4N A;  1JNT A;  3O5R A;  2AWG A;  3EY6 A;  3UF8 A;  4DRO A;  1JVW A;  2KE0 A;  1FKB A;  1Q6U A;  3NI6 A;  2XP9 A;  4MGV A;  2F2D A;  2PPP A;  4N19 A;  3ODK A;  2MLZ A;  4ODK A;  1QPF A;  2Q5A A;  4JFK A;  3PRB A;  4ODM A;  4TW8 A;  4O2T A;  5HWB A;  4DZ3 A;  1JNS A;  1M5Y A;  5DIT A;  4JFL A;  2M08 A;  3TDB A;  3JYJ A;  2PV2 A;  4MSP A;  1HXV A;  1TCO C;  4ODO A;  1QZ2 A;  2DG3 A;  2M2A A;  3B7X A;  4ODR A;  5DIU A;  4DRH A;  3UQA A;  2LPV A;  3UI6 A;  3MDY B;  3UI4 A;  1QPL A;  1T11 A;  4IQ2 A;  3TC5 A;  3FAP A;  4R0X A;  1ROU A;  2UZ5 A;  2JZV A;  1L1P A;  2MNT A;  2PPN A;  4JFM A;  3UQB A;  4DT4 A;  2ZQV A;  2DG4 A;  2PBC A;  4FN2 A;  1FKG A;  3O5D A;  3UI5 A;  5HW7 A;  4U85 A;  5HW6 A;  2D9F A;  4LAW A;  5I98 A;  2LJ4 A;  2MF9 A;  1PBK A;  3I6C A;  2OFN A;  2PPO A;  2KFW A;  1KT0 A;  2M1I A;  3WH0 A;  4DRM A;  4DRP A;  4DZ2 A;  3KCE A;  1F8A B;  2RUD A;  1EYM A;  1Q6H A;  3UQI A;  1A7X A;  4LAX A;  4TX0 A;  3TCZ A;  2PV1 A;  4DRK A;  5HUA A;  2RSE A;  3NTP A;  1FKR A;  4ITZ A;  2KO7 A;  4G50 A;  2XP7 A;  3VAW A;  1PIN A;  4ODQ A;  4QT2 A;  1F40 A;  2RUQ A;  2ZR4 A;  1KT1 A;  1Y0O A;  3KAC A;  2XP3 A;  1FKL A;  3PA7 A;  2MPH A;  3KAH A;  3O5J A;  1Q1C A;  1ROT A;  2L2S A;  4W9O A;  2KI3 A;  1FD9 A;  1U79 A;  3O5M A;  4FAP A;  4JFJ A;  4DIP A;  4LAY A;  3OOB A;  4J4O A;  1D7I A;  1FKK A;  2PV3 A;  2Y78 A;  3O5F A;  2KR7 A;  2DG9 A;  2ZR5 A;  1FKI A;  1J4I A;  3JYM A;  3O5Q A;  4GIV A;  5B8I C; 
#chains in the Genus database with same CATH topology
 2F4E A;  3O5K A;  2G41 A;  2ZQT A;  4WK9 A;  3CGN A;  2XPB A;  1P5Q A;  3RM4 A;  1FKF A;  2ZQS A;  4ZPT R;  5HW8 A;  2F23 A;  2ETN A;  1NWR A;  5JH8 A;  4AY1 A;  4XAK A;  4TNS A;  4U86 A;  2A3B A;  4C02 B;  2FAP A;  2XP6 A;  2AOS A;  3RM9 A;  1HKM A;  1OWQ A;  2YBT A;  4DRN A;  2XP8 A;  1X6L A;  3IKD A;  3PRD A;  1EDQ A;  1W26 A;  2XPA A;  5J6E A;  1ZCN A;  1BKF A;  3NRK A;  2DSU A;  1FKD A;  4W9P A;  3KAD A;  4DRI A;  4TW7 A;  4MNL A;  5HKG A;  1J6Y A;  1J4H A;  2VCD A;  2DT2 A;  2AWG A;  3EY6 A;  1JVW A;  2DSW A;  1FKB A;  3AS3 A;  4ML4 A;  2PPP A;  4N19 A;  2B5U B;  1QPF A;  5HWB A;  4JFL A;  1X6N A;  3TDB A;  1OGG A;  2PV2 A;  3ARW A;  1E15 A;  1QZ2 A;  2M2A A;  3UI6 A;  1QPL A;  1T11 A;  4IQ2 A;  3TC5 A;  2MNT A;  2G8Z A;  2PN0 A;  2PBC A;  3O5D A;  1E6R A;  3UI5 A;  5HW7 A;  4U85 A;  5HW6 A;  1IX5 A;  2OFN A;  2PPO A;  1OGB A;  3PR9 A;  1NH6 A;  3B8S A;  1FKR A;  2RSE A;  4G50 A;  3VAW A;  2ZR4 A;  3PA7 A;  3WD0 A;  2DT1 A;  1FD9 A;  4JFJ A;  4DIP A;  4WKH A;  2ZR5 A;  1FKI A;  4MTV A;  3O5G A;  4G2P A;  1R9H A;  3KAB A;  3ALF A;  2ITK A;  1FJD A;  3WD3 A;  4ODL A;  2A3E A;  2DPE A;  4IT6 A;  5HT1 A;  4TYO A;  4GGQ A;  2XP5 A;  3KAI A;  2K8I A;  2VN1 A;  5HTG A;  1HJW A;  3EIP A;  3IKG A;  3H9R B;  4UDM A;  4Z2L A;  2MLY A;  1W9U A;  4S3K A;  2PI6 A;  2N87 A;  2IUZ A;  1C9H A;  4BF8 A;  2F21 A;  1WNO A;  4Q7N A;  5D75 A;  1LJY A;  1JND A;  1FKT A;  3FXY A;  1FKS A;  1YAT A;  3ARS A;  4IPX A;  3RFW A;  3ARV A;  3CH9 A;  2LGO A;  4TW6 A;  2ZQU A;  1GUV A;  3WQW A;  2DT0 A;  4IQC A;  4ZS6 A;  4DRO A;  3CHF A;  4MGV A;  4DWS A;  2XP9 A;  2MLZ A;  4NZC A;  3ART A;  4ODK A;  4JFK A;  3W4R A;  4ODM A;  4TW8 A;  3BMB A;  3ARQ A;  1JNS A;  3JYJ A;  4MSP A;  1HXV A;  4R5E A;  1EIB A;  4NSB A;  4S3J A;  1XRV A;  3UI4 A;  4DWS C;  1ZBC A;  3FAP A;  2WK2 A;  1TFV A;  1L1P A;  1ZBW A;  1HKI A;  1UR9 A;  2EUL A;  4DT4 A;  3UQB A;  1SR0 A;  4FN2 A;  2DT3 A;  1K9T A;  4LAW A;  2MF9 A;  1PBK A;  2WM0 A;  3CZ8 A;  3WL0 A;  2KFW A;  1VF8 A;  4DZ2 A;  4IT4 A;  1Q6H A;  4KR0 B;  1HKJ A;  1A7X A;  5GQB A;  4TX0 A;  3TCZ A;  1RD6 A;  4DWS D;  4W5U A;  4QT2 A;  1ZBV A;  1Y0O A;  3KAC A;  2XP3 A;  3KAH A;  3AS0 A;  2WLZ A;  2A3A A;  1ROT A;  2L2S A;  1W1T A;  4FAP A;  3OOB A;  3CHE A;  1D7I A;  2Y78 A;  3O5F A;  1FFQ A;  5B8I C;  3JYM A;  3IHZ A;  5HWC A;  3G6L A;  1FKJ A;  5GPG A;  4P8X A;  5DO2 A;  4W9Q A;  1ZBK A;  2ZR6 A;  4WIW A;  5BXJ A;  1FFR A;  1Q6I A;  1GOI A;  1N1A A;  1BL4 A;  1LG2 A;  1LL7 A;  3FY1 A;  4ODN A;  3WIJ A;  1ZU8 A;  2RQS A;  3B9A A;  3KAG A;  1NMW A;  3WD1 A;  4DWS B;  4ZPW R;  2FKE A;  4MAV A;  1XHG A;  4QZV B;  3WL1 A;  1YW5 A;  1D6O A;  1FKH A;  3O5I A;  1E6P A;  4URI A;  4WKF A;  4NNR A;  1EQ3 A;  1NWU A;  1W9V A;  2IF4 A;  2O9O A;  2XP4 A;  1LL4 A;  3CGM A;  4J4N A;  1JNT A;  3O5R A;  3NI6 A;  2F2D A;  4P8U A;  1JNE A;  1H0G A;  3PRB A;  1E9L A;  1GRJ A;  3ARX A;  5DIT A;  3QOK A;  3WD4 A;  4ODO A;  2DG3 A;  3B7X A;  4ODR A;  2FDM A;  3ARZ A;  3MDY B;  4R0X A;  2B31 A;  2PPN A;  4JFM A;  3G6M A;  2DG4 A;  1FKG A;  2A3C A;  1E44 A;  5I98 A;  1LG1 A;  3I6C A;  4L3N A;  1KT0 A;  2QF8 A;  4DRM A;  4DRP A;  5HBF A;  3RM8 A;  3ALG A;  1F8A B;  1EYM A;  3UQI A;  1JCH B;  4HAR A;  2PV1 A;  4P8V A;  1HJX A;  2WLY A;  2KO7 A;  1E6Z A;  4ODQ A;  4PTM A;  1KT1 A;  1ZL1 A;  4HBO A;  2MPH A;  3O5J A;  4W9O A;  2KI3 A;  1WB0 A;  1HKK A;  1U79 A;  1H0I A;  1FKK A;  2PV3 A;  4GIV A;  4ODP A;  4MNK A;  3LUO A;  4DH0 A;  3O5O A;  2DSZ A;  3ARU A;  5DIV A;  1NMV A;  3AS2 A;  4QT3 A;  1LQ0 A;  1D7J A;  3IK8 A;  4QIB A;  4L72 B;  1D2K A;  1B6C A;  3O5P A;  1W1V A;  1CTN A;  4U84 A;  2RUR A;  5GPR A;  3RGC A;  3GU0 A;  1E6N A;  4P8W A;  4JYS A;  4JFI A;  1D7H A;  1KFW A;  1HJV A;  4KQZ A;  4DRJ A;  1J4R A;  3KZ7 A;  3WQV A;  2KGJ A;  1FAP A;  3O5E A;  3JXV A;  4LAV A;  3O5L A;  3WD2 A;  4WJX A;  3GPK A;  4ZPV R;  3ARY A;  3B9D A;  2MLX A;  3ARO A;  1NSG A;  1W1Y A;  3KAF A;  1ZK6 A;  2LKN A;  4DRQ A;  4MPK A;  3B9E A;  2RUC A;  3CHD A;  3UF8 A;  2DSV A;  2KE0 A;  1Q6U A;  1WAW A;  3ODK A;  2P4V A;  3RME A;  4HBE A;  2Q5A A;  2OLH A;  4O2T A;  4DZ3 A;  1M5Y A;  3AQU A;  2M08 A;  4WKA A;  4Q22 A;  1O6I A;  1TCO C;  4Z2K A;  5DIU A;  4DRH A;  3ARR A;  3UQA A;  3GTY X;  2LPV A;  1W1P A;  4MNJ A;  4MNM A;  1ROU A;  2UZ5 A;  1UR8 A;  2JZV A;  1ZB5 A;  3CHC A;  4Z2J A;  4Z2I A;  2ZQV A;  1ITX A;  2ESC A;  3ARP A;  1NWS A;  2D9F A;  2LJ4 A;  1NWT A;  2M1I A;  3WH0 A;  5DEZ A;  1LL6 A;  3KCE A;  2RUD A;  4LAX A;  5HUA A;  3OA5 A;  4DRK A;  1GPF A;  3NTP A;  4Z2G A;  2O92 A;  4ITZ A;  2XP7 A;  1PIN A;  1EHN A;  2RUQ A;  1F40 A;  1SYT A;  3AS1 A;  1FKL A;  4Z2H A;  1Q1C A;  1W9P A;  4LGX A;  3WKZ A;  2YBU A;  3O5M A;  4LAY A;  4J4O A;  2KR7 A;  2DG9 A;  3O5Q A;  1J4I A;  5DF0 A;  3PRA A;  3BXW A; 
#chains in the Genus database with same CATH homology
 2F4E A;  3O5K A;  2G41 A;  2ZQT A;  4WK9 A;  3CGN A;  2XPB A;  1P5Q A;  3RM4 A;  1FKF A;  2ZQS A;  4ZPT R;  5HW8 A;  1NWR A;  5JH8 A;  4AY1 A;  4XAK A;  4TNS A;  4U86 A;  2A3B A;  4C02 B;  2FAP A;  2XP6 A;  2AOS A;  3RM9 A;  1HKM A;  1OWQ A;  2YBT A;  4DRN A;  2XP8 A;  1X6L A;  3IKD A;  3PRD A;  1EDQ A;  1W26 A;  2XPA A;  5J6E A;  1ZCN A;  1BKF A;  3NRK A;  2DSU A;  1FKD A;  4W9P A;  3KAD A;  4DRI A;  4TW7 A;  4MNL A;  5HKG A;  1J6Y A;  1J4H A;  2VCD A;  2DT2 A;  2AWG A;  3EY6 A;  1JVW A;  2DSW A;  1FKB A;  3AS3 A;  4ML4 A;  2PPP A;  4N19 A;  1QPF A;  5HWB A;  4JFL A;  1X6N A;  3TDB A;  1OGG A;  2PV2 A;  3ARW A;  1E15 A;  1QZ2 A;  2M2A A;  3UI6 A;  1QPL A;  1T11 A;  4IQ2 A;  3TC5 A;  2MNT A;  2G8Z A;  2PBC A;  3O5D A;  1E6R A;  3UI5 A;  5HW7 A;  4U85 A;  5HW6 A;  1IX5 A;  2OFN A;  2PPO A;  1OGB A;  3PR9 A;  1NH6 A;  3B8S A;  1FKR A;  2RSE A;  4G50 A;  3VAW A;  2ZR4 A;  3PA7 A;  3WD0 A;  2DT1 A;  1FD9 A;  4JFJ A;  4DIP A;  4WKH A;  2ZR5 A;  1FKI A;  4MTV A;  3O5G A;  4G2P A;  1R9H A;  3KAB A;  3ALF A;  2ITK A;  1FJD A;  3WD3 A;  4ODL A;  2A3E A;  2DPE A;  4IT6 A;  5HT1 A;  4TYO A;  4GGQ A;  2XP5 A;  3KAI A;  2K8I A;  2VN1 A;  5HTG A;  1HJW A;  3IKG A;  3H9R B;  4Z2L A;  2MLY A;  1W9U A;  4S3K A;  2PI6 A;  2N87 A;  2IUZ A;  1C9H A;  4BF8 A;  2F21 A;  1WNO A;  4Q7N A;  5D75 A;  1LJY A;  1JND A;  1FKT A;  3FXY A;  1FKS A;  1YAT A;  3ARS A;  4IPX A;  3RFW A;  3ARV A;  3CH9 A;  2LGO A;  4TW6 A;  2ZQU A;  1GUV A;  3WQW A;  2DT0 A;  4IQC A;  4ZS6 A;  4DRO A;  3CHF A;  4MGV A;  4DWS A;  2XP9 A;  2MLZ A;  4NZC A;  3ART A;  4ODK A;  4JFK A;  3W4R A;  4ODM A;  4TW8 A;  3ARQ A;  1JNS A;  3JYJ A;  4MSP A;  1HXV A;  4R5E A;  1EIB A;  4NSB A;  4S3J A;  1XRV A;  3UI4 A;  4DWS C;  1ZBC A;  3FAP A;  2WK2 A;  1TFV A;  1L1P A;  1ZBW A;  1HKI A;  1UR9 A;  3UQB A;  4DT4 A;  1SR0 A;  4FN2 A;  2DT3 A;  1K9T A;  4LAW A;  2MF9 A;  1PBK A;  2WM0 A;  3CZ8 A;  3WL0 A;  2KFW A;  1VF8 A;  4DZ2 A;  4IT4 A;  1Q6H A;  4KR0 B;  1HKJ A;  1A7X A;  5GQB A;  4TX0 A;  3TCZ A;  1RD6 A;  4DWS D;  4W5U A;  4QT2 A;  1ZBV A;  1Y0O A;  3KAC A;  2XP3 A;  3KAH A;  3AS0 A;  2WLZ A;  2A3A A;  1ROT A;  2L2S A;  1W1T A;  4FAP A;  3OOB A;  3CHE A;  1D7I A;  2Y78 A;  3O5F A;  1FFQ A;  5B8I C;  3JYM A;  3IHZ A;  5HWC A;  3G6L A;  1FKJ A;  5GPG A;  4P8X A;  5DO2 A;  4W9Q A;  1ZBK A;  2ZR6 A;  4WIW A;  5BXJ A;  1FFR A;  1Q6I A;  1GOI A;  1N1A A;  1BL4 A;  1LG2 A;  1LL7 A;  3FY1 A;  4ODN A;  3WIJ A;  1ZU8 A;  2RQS A;  3B9A A;  3KAG A;  1NMW A;  3WD1 A;  4DWS B;  4ZPW R;  2FKE A;  4MAV A;  1XHG A;  4QZV B;  3WL1 A;  1YW5 A;  1D6O A;  1FKH A;  3O5I A;  1E6P A;  4URI A;  4WKF A;  4NNR A;  1EQ3 A;  1NWU A;  1W9V A;  2IF4 A;  2O9O A;  2XP4 A;  1LL4 A;  3CGM A;  4J4N A;  1JNT A;  3O5R A;  3NI6 A;  2F2D A;  4P8U A;  1JNE A;  1H0G A;  3PRB A;  1E9L A;  3ARX A;  5DIT A;  3QOK A;  3WD4 A;  4ODO A;  2DG3 A;  3B7X A;  4ODR A;  2FDM A;  3ARZ A;  3MDY B;  4R0X A;  2B31 A;  2PPN A;  4JFM A;  3G6M A;  2DG4 A;  1FKG A;  2A3C A;  5I98 A;  1LG1 A;  3I6C A;  4L3N A;  1KT0 A;  2QF8 A;  4DRM A;  4DRP A;  5HBF A;  3RM8 A;  3ALG A;  1F8A B;  1EYM A;  3UQI A;  4HAR A;  2PV1 A;  4P8V A;  1HJX A;  2WLY A;  2KO7 A;  1E6Z A;  4ODQ A;  4PTM A;  1KT1 A;  1ZL1 A;  4HBO A;  2MPH A;  3O5J A;  4W9O A;  2KI3 A;  1WB0 A;  1HKK A;  1U79 A;  1H0I A;  1FKK A;  2PV3 A;  4GIV A;  4ODP A;  4MNK A;  3LUO A;  4DH0 A;  3O5O A;  2DSZ A;  3ARU A;  5DIV A;  1NMV A;  3AS2 A;  4QT3 A;  1LQ0 A;  1D7J A;  3IK8 A;  4QIB A;  4L72 B;  1D2K A;  1B6C A;  3O5P A;  1W1V A;  1CTN A;  4U84 A;  2RUR A;  5GPR A;  3RGC A;  1E6N A;  4P8W A;  4JYS A;  4JFI A;  1D7H A;  1KFW A;  1HJV A;  4KQZ A;  4DRJ A;  1J4R A;  3KZ7 A;  3WQV A;  2KGJ A;  3O5E A;  1FAP A;  3JXV A;  4LAV A;  3O5L A;  3WD2 A;  4WJX A;  3GPK A;  4ZPV R;  3ARY A;  3B9D A;  2MLX A;  3ARO A;  1NSG A;  1W1Y A;  3KAF A;  1ZK6 A;  2LKN A;  4DRQ A;  4MPK A;  3B9E A;  2RUC A;  3CHD A;  3UF8 A;  2DSV A;  2KE0 A;  1Q6U A;  1WAW A;  3ODK A;  3RME A;  4HBE A;  2Q5A A;  2OLH A;  4O2T A;  4DZ3 A;  1M5Y A;  3AQU A;  2M08 A;  4WKA A;  4Q22 A;  1O6I A;  1TCO C;  4Z2K A;  5DIU A;  4DRH A;  3ARR A;  3UQA A;  2LPV A;  1W1P A;  4MNJ A;  4MNM A;  1ROU A;  2UZ5 A;  1UR8 A;  2JZV A;  1ZB5 A;  3CHC A;  4Z2J A;  4Z2I A;  2ZQV A;  1ITX A;  2ESC A;  3ARP A;  1NWS A;  2D9F A;  2LJ4 A;  1NWT A;  2M1I A;  3WH0 A;  5DEZ A;  1LL6 A;  3KCE A;  2RUD A;  4LAX A;  5HUA A;  3OA5 A;  4DRK A;  1GPF A;  3NTP A;  4Z2G A;  2O92 A;  4ITZ A;  2XP7 A;  1PIN A;  1EHN A;  2RUQ A;  1F40 A;  1SYT A;  3AS1 A;  1FKL A;  4Z2H A;  1Q1C A;  1W9P A;  4LGX A;  3WKZ A;  2YBU A;  3O5M A;  4LAY A;  4J4O A;  2KR7 A;  2DG9 A;  3O5Q A;  1J4I A;  5DF0 A;  3PRA A;  3BXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...