3O5OA

Fk1 domain mutant a19t of fkbp51, crystal form iii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
b'GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5oA00
2KO7A 2PPNA 3O5FA 3ODKA 3UQAA 3KAGA 3O5PA 1JVWA 1FKHA 4R0XA 1J4RA 2PPPA 4DROA 4DZ2A 3RFWA 1EQ3A 1D7JA 2MPHA 5I98A 2D9FA 4LAVA 3IHZA 2RUQA 2ITKA 2DG3A 2LPVA 5D75A 2F4EA 1ROUA 2M2AA 4IQ2A 1PINA 4NNRA 1Q6UA 2DG9A 2RUCA 1NMVA 2ZQSA 3KAIA 3O5DA 4BF8A 1F40A 1ZK6A 5HWCA 1FKSA 1FKJA 3NTPA 3PA7A 3O5MA 4ITZA 2KI3A 4LAXA 5GPGA 3RGCA 5J6EA 1M5YA 1FKIA 4JFJA 1Y0OA 2OFNA 1ROTA 4MGVA 3IKDA 1FKDA 3OOBA 1FKTA 4U84A 4ODKA 1TCOC 4DH0A 4DRQA 4TW6A 4ODQA 2Y78A 2RUDA 3B7XA 1U79A 3PRDA 1QZ2A 3KABA 3O5LA 3GPKA 1T11A 2DG4A 2L2SA 1JNTA 4C02B 4DRJA 5DITA 4DRKA 5BXJA 3EY6A 2MNTA 3IKGA 1A7XA 2AWGA 2F2DA 2LKNA 1D6OA 2XP7A 5HTGA 1FJDA 4W9PA 4DRMA 2ZR4A 3H9RB 2XP3A 1BKFA 3UF8A 1F8AB 1YW5A 1D7IA 2F21A 2XP9A 4MSPA 3VAWA 3NI6A 4TW7A 4DRIA 1FKKA 5HKGA 1J4HA 2XPBA 1J6YA 2MF9A 1L1PA 3O5QA 3UQBA 1Q6HA 4JFKA 4GIVA 2M08A 2RSEA 1PBKA 4W9QA 4G2PA 4TW8A 1FKLA 2VCDA 2XP5A 3UI6A 4ODRA 1D7HA 3JXVA 1C9HA 2ZQVA 4ODOA 4DIPA 3KZ7A 1YATA 3JYMA 3JYJA 2XPAA 1FKBA 5B8IC 4LAYA 4G50A 4QIBA 3TCZA 3I6CA 1FKFA 3O5KA 2RQSA 2VN1A 1R9HA 1B6CA 3CGMA 4J4OA 4N19A 3TDBA 3O5GA 4DRPA 2LGOA 2MLYA 3O5JA 5HWBA 4QT2A 4JFMA 3UI5A 5HUAA 4IQCA 4ODNA 3TC5A 1JNSA 3UQIA 3NRKA 1FAPA 2UZ5A 1J4IA 1QPLA 2ZR6A 3KAHA 2KFWA 3WH0A 2ZQTA 1P5QA 2PBCA 1Q1CA 2JZVA 4LAWA 4DZ3A 5HT1A 2PV2A 1FD9A 3KAFA 1FKGA 2N87A 1HXVA 3UI4A 2ZQUA 3O5EA 4TX0A 5HW8A 5DIVA 2LJ4A 3O5RA 4JYSA 4U85A 4W9OA 5HW6A 2M1IA 3KCEA 4QT3A 4TNSA 4GGQA 3PRBA 5HW7A 1ZCNA 1NSGA 1QPFA 4FN2A 4DT4A 1KT0A 1EYMA 2KE0A 2IF4A 1BL4A 3KADA 3LUOA 2PPOA 1W26A 4IPXA 4ODPA 2MLZA 2MLXA 1Q6IA 2PV3A 2XP8A 3O5OA 4ODMA 2ZR5A 3FAPA 2Q5AA 1NMWA 2RURA 3MDYB 1FKRA 4ODLA 4FAPA 2XP6A 4O2TA 2KR7A 1N1AA 3O5IA 1KT1A 2KGJA 4JFLA 2FAPA 2XP4A 2K8IA 4JFIA 3IK8A 4J4NA 3KACA 2FKEA 4U86A 4DRHA 2PV1A 4TYOA 5DIUA 4DRNA 3CGNA
chains in the Genus database with same CATH superfamily
4PTMA 1NH6A 3ODKA 3ARSA 2F23A 4KQZA 3RFWA 1E6RA 1D7JA 5I98A 1H0IA 4LAVA 3IHZA 2RUQA 3ARRA 2DG3A 5D75A 3AROA 2A3BA 2RUCA 2DG9A 1NMVA 3KAIA 4BF8A 3BMBA 1FKJA 3NTPA 3RGCA 2KI3A 3ARUA 5J6EA 1M5YA 4MGVA 3IKDA 1FKDA 2DT3A 3OOBA 1LG2A 4ODQA 3ARZA 2RUDA 1U79A 3PRDA 1QZ2A 1ZL1A 3KABA 4DRKA 1E9LA 3IKGA 4MNMA 4MTVA 4W9PA 2XP3A 2F21A 4Q7NA 2ETNA 1J4HA 2PN0A 2MF9A 1L1PA 3CH9A 4WK9A 3ARPA 1HKMA 1HKIA 1FKLA 3UI6A 2PI6A 4DIPA 1C9HA 3ARWA 3KZ7A 1YATA 4KR0B 2XPAA 1NWRA 1FKBA 2A3EA 4QIBA 3TCZA 3AQUA 4J4OA 3O5GA 1JNDA 3AS2A 5GPRA 5HWBA 5HUAA 3TC5A 3AS1A 3UQIA 4ZPWR 5GQBA 2IUZA 3KAHA 4WIWA 5DF0A 2PBCA 2JZVA 4P8VA 4ZS6A 3B9DA 2LJ4A 1HJWA 3WD3A 4DWSD 1W9VA 4TNSA 2DSVA 4DT4A 4NZCA 1CTNA 2XP8A 1Q6IA 1XHGA 3O5OA 4ODMA 2ZR5A 4Z2IA 2YBUA 4O2TA 1KT1A 1E6ZA 2KGJA 2FAPA 2AOSA 2K8IA 4W5UA 2DSUA 1K9TA 4J4NA 4NSBA 4U86A 1X6LA 2KO7A 2QF8A 3G6LA 3O5FA 3GTYX 3UQAA 3ARYA 3KAGA 3O5PA 1W9PA 4Z2GA 2ITKA 1RD6A 2WLZA 1ROUA 3B9AA 4NNRA 1ZK6A 5HWCA 1FKSA 4Z2LA 3PA7A 4ITZA 5GPGA 3WL0A 1LL6A 1ROTA 4P8XA 4WKFA 4U84A 1GOIA 3B7XA 1W1PA 1XRVA 4C02B 2DG4A 1OGGA 5DITA 4P8UA 1SYTA 2AWGA 2XP7A 3ARVA 4URIA 1W1YA 1BKFA 1F8AB 3ALGA 1GUVA 3O5QA 3UQBA 1Q6HA 2RSEA 4W9QA 3G6MA 4HBOA 4ODRA 3JXVA 1TFVA 3AS0A 4IT6A 3RM8A 2O92A 3I6CA 3PRAA 4N19A 1B6CA 3TDBA 4DRPA 2LGOA 1EHNA 4QT2A 1QPLA 1NWTA 2N87A 2ZQUA 2YBTA 2G8ZA 4GGQA 5HW7A 1ZCNA 4MPKA 4FN2A 1KT0A 2KE0A 4IPXA 1HKJA 4IT4A 1UR9A 3AS3A 4S3JA 3FAPA 2RURA 4ODLA 4FAPA 3RM9A 2XP6A 4MNJA 1O6IA 1N1AA 4JFLA 4R5EA 3ARXA 4JFIA 3B8SA 3KACA 4AY1A 4TYOA 5DIUA 4DRNA 3EIPA 1ZBCA 1LG1A 1SR0A 1JVWA 1FKHA 3WQWA 2PPPA 4DROA 4DZ2A 1EQ3A 2D9FA 1ZU8A 4Z2KA 3GU0A 2M2AA 1PINA 4MNKA 4L72B 4WKHA 3WD4A 1FKIA 2WLYA 1Y0OA 2OFNA 1W1VA 1TCOC 4DRQA 4L3NA 4TW6A 4P8WA 4DWSA 2WK2A 3W4RA 3O5LA 4DRJA 5BXJA 3EY6A 2DT0A 2MNTA 1A7XA 5HTGA 1FJDA 2ZR4A 4WKAA 3UF8A 1YW5A 2XP9A 1D7IA 3VAWA 1LQ0A 3NI6A 4TW7A 5HKGA 1FKKA 2XPBA 1J6YA 1ITXA 1OWQA 4JFKA 4GIVA 2M08A 2VCDA 4ODOA 2ZQVA 3WD2A 4UDMA 5B8IC 4LAYA 4MAVA 4G50A 3O5KA 1FKFA 3CGMA 2VN1A 1NWSA 4QZVB 1E15A 3CHFA 3O5JA 4MNLA 3WD0A 4JFMA 4ODNA 1NWUA 3NRKA 2UZ5A 3WIJA 2ZR6A 1EIBA 2KFWA 2ZQTA 1P5QA 1Q1CA 4LAWA 1ZBVA 5HT1A 1FD9A 3KAFA 3O5EA 4TX0A 4ZPTR 3B9EA 1JNEA 3WKZA 3CHCA 4JYSA 5HBFA 4DWSC 1FFRA 4ML4A 4U85A 4W9OA 1HJVA 1QPFA 2G41A 1BL4A 3KADA 1ZBKA 2MLZA 2MLXA 1LL4A 2PV3A 4HBEA 1NMWA 3MDYB 1W1TA 2KR7A 1JCHB 4S3KA 2O9OA 4Q22A 3IK8A 4HARA 5DEZA 2FKEA 2WM0A 3WD1A 2OLHA 2PPNA 2A3AA 1VF8A 4R0XA 1J4RA 2MPHA 1LL7A 3BXWA 4DWSB 2LPVA 2F4EA 3ALFA 4IQ2A 3RMEA 1Q6UA 2ZQSA 3ARTA 3O5DA 2DPEA 1F40A 4LAXA 3O5MA 4JFJA 5JH8A 2FDMA 4DH0A 1FKTA 4WJXA 4ODKA 4Z2HA 2Y78A 3CHDA 3FY1A 4LGXA 3GPKA 1T11A 1FFQA 1JNTA 2L2SA 2LKNA 2F2DA 1D6OA 1OGBA 4DRMA 1GRJA 3H9RB 1W9UA 4MSPA 4XAKA 4DRIA 1X6NA 1E44A 1EDQA 1PBKA 1GPFA 4G2PA 4TW8A 2DSWA 2XP5A 1KFWA 1D7HA 3JYMA 1ZB5A 3JYJA 1E6PA 4Z2JA 2RQSA 1R9HA 2P4VA 1WAWA 2DSZA 2MLYA 3ARQA 2EULA 3CZ8A 1ZBWA 4IQCA 5DO2A 3UI5A 1JNSA 1LJYA 1UR8A 3FXYA 1FAPA 1J4IA 1WB0A 3PR9A 2B31A 3WH0A 2A3CA 4DZ3A 2PV2A 1FKGA 1HXVA 3UI4A 1IX5A 3WQVA 5HW8A 3CHEA 5DIVA 3O5RA 4ZPVR 3OA5A 5HW6A 2M1IA 3RM4A 3KCEA 4QT3A 1HJXA 1E6NA 1HKKA 3PRBA 1WNOA 1NSGA 2DT2A 1EYMA 2DT1A 2IF4A 3LUOA 4ODPA 2PPOA 1W26A 1FKRA 2Q5AA 2B5UB 3QOKA 3WL1A 3O5IA 1H0GA 2XP4A 2ESCA 1D2KA 4DRHA 2PV1A 3CGNA
chains in the Genus database with same CATH topology
4PTMA 1NH6A 3ODKA 3ARSA 4KQZA 3RFWA 1E6RA 1D7JA 5I98A 1H0IA 4LAVA 3IHZA 2RUQA 3ARRA 2DG3A 5D75A 3AROA 2A3BA 2RUCA 2DG9A 1NMVA 3KAIA 4BF8A 1FKJA 3NTPA 3RGCA 2KI3A 3ARUA 5J6EA 1M5YA 4MGVA 3IKDA 1FKDA 2DT3A 3OOBA 1LG2A 4ODQA 3ARZA 2RUDA 1U79A 3PRDA 1QZ2A 1ZL1A 3KABA 4DRKA 1E9LA 3IKGA 4MNMA 4MTVA 4W9PA 2XP3A 2F21A 4Q7NA 1J4HA 2MF9A 1L1PA 3CH9A 4WK9A 3ARPA 1HKMA 1HKIA 1FKLA 3UI6A 2PI6A 4DIPA 1C9HA 3ARWA 3KZ7A 1YATA 4KR0B 2XPAA 1NWRA 1FKBA 2A3EA 4QIBA 3TCZA 3AQUA 4J4OA 3O5GA 1JNDA 3AS2A 5GPRA 5HWBA 5HUAA 3TC5A 3AS1A 3UQIA 4ZPWR 5GQBA 2IUZA 3KAHA 4WIWA 5DF0A 2PBCA 2JZVA 4P8VA 4ZS6A 3B9DA 2LJ4A 1HJWA 3WD3A 4DWSD 1W9VA 4TNSA 2DSVA 4DT4A 4NZCA 1CTNA 2XP8A 1Q6IA 1XHGA 3O5OA 4ODMA 2ZR5A 4Z2IA 2YBUA 4O2TA 1KT1A 1E6ZA 2KGJA 2FAPA 2AOSA 2K8IA 4W5UA 2DSUA 1K9TA 4J4NA 4NSBA 4U86A 1X6LA 2KO7A 2QF8A 3G6LA 3O5FA 3UQAA 3ARYA 3KAGA 3O5PA 1W9PA 4Z2GA 2ITKA 1RD6A 2WLZA 1ROUA 3B9AA 4NNRA 1ZK6A 5HWCA 1FKSA 4Z2LA 3PA7A 4ITZA 5GPGA 3WL0A 1LL6A 1ROTA 4P8XA 4WKFA 4U84A 1GOIA 3B7XA 1W1PA 1XRVA 4C02B 2DG4A 1OGGA 5DITA 4P8UA 1SYTA 2AWGA 2XP7A 3ARVA 4URIA 1W1YA 1BKFA 1F8AB 3ALGA 1GUVA 3O5QA 3UQBA 1Q6HA 2RSEA 4W9QA 3G6MA 4HBOA 4ODRA 3JXVA 1TFVA 3AS0A 4IT6A 3RM8A 2O92A 3I6CA 3PRAA 4N19A 1B6CA 3TDBA 4DRPA 2LGOA 1EHNA 4QT2A 1QPLA 1NWTA 2N87A 2ZQUA 2YBTA 2G8ZA 4GGQA 5HW7A 1ZCNA 4MPKA 4FN2A 1KT0A 2KE0A 4IPXA 1HKJA 4IT4A 1UR9A 3AS3A 4S3JA 3FAPA 2RURA 4ODLA 4FAPA 3RM9A 2XP6A 4MNJA 1O6IA 1N1AA 4JFLA 4R5EA 3ARXA 4JFIA 3B8SA 3KACA 4AY1A 4TYOA 5DIUA 4DRNA 1ZBCA 1LG1A 1SR0A 1JVWA 1FKHA 3WQWA 2PPPA 4DROA 4DZ2A 1EQ3A 2D9FA 1ZU8A 4Z2KA 2M2AA 1PINA 4MNKA 4L72B 4WKHA 3WD4A 1FKIA 2WLYA 1Y0OA 2OFNA 1W1VA 1TCOC 4DRQA 4L3NA 4TW6A 4P8WA 4DWSA 2WK2A 3W4RA 3O5LA 4DRJA 5BXJA 3EY6A 2DT0A 2MNTA 1A7XA 5HTGA 1FJDA 2ZR4A 4WKAA 3UF8A 1YW5A 2XP9A 1D7IA 3VAWA 1LQ0A 3NI6A 4TW7A 5HKGA 1FKKA 2XPBA 1J6YA 1ITXA 1OWQA 4JFKA 4GIVA 2M08A 2VCDA 4ODOA 2ZQVA 3WD2A 5B8IC 4LAYA 4MAVA 4G50A 3O5KA 1FKFA 3CGMA 2VN1A 1NWSA 4QZVB 1E15A 3CHFA 3O5JA 4MNLA 3WD0A 4JFMA 4ODNA 1NWUA 3NRKA 2UZ5A 3WIJA 2ZR6A 1EIBA 2KFWA 2ZQTA 1P5QA 1Q1CA 4LAWA 1ZBVA 5HT1A 1FD9A 3KAFA 3O5EA 4TX0A 4ZPTR 3B9EA 1JNEA 3WKZA 3CHCA 4JYSA 5HBFA 4DWSC 1FFRA 4ML4A 4U85A 4W9OA 1HJVA 1QPFA 2G41A 1BL4A 3KADA 1ZBKA 2MLZA 2MLXA 1LL4A 2PV3A 4HBEA 1NMWA 3MDYB 1W1TA 2KR7A 4S3KA 2O9OA 4Q22A 3IK8A 4HARA 5DEZA 2FKEA 2WM0A 3WD1A 2OLHA 2PPNA 2A3AA 1VF8A 4R0XA 1J4RA 2MPHA 1LL7A 3BXWA 4DWSB 2LPVA 2F4EA 3ALFA 4IQ2A 3RMEA 1Q6UA 2ZQSA 3ARTA 3O5DA 2DPEA 1F40A 4LAXA 3O5MA 4JFJA 5JH8A 2FDMA 4DH0A 1FKTA 4WJXA 4ODKA 4Z2HA 2Y78A 3CHDA 3FY1A 4LGXA 3GPKA 1T11A 1FFQA 1JNTA 2L2SA 2LKNA 2F2DA 1D6OA 1OGBA 4DRMA 3H9RB 1W9UA 4MSPA 4XAKA 4DRIA 1X6NA 1EDQA 1PBKA 1GPFA 4G2PA 4TW8A 2DSWA 2XP5A 1KFWA 1D7HA 3JYMA 1ZB5A 3JYJA 1E6PA 4Z2JA 2RQSA 1R9HA 1WAWA 2DSZA 2MLYA 3ARQA 5DO2A 3CZ8A 1ZBWA 4IQCA 3UI5A 1JNSA 1LJYA 1UR8A 3FXYA 1FAPA 1J4IA 1WB0A 3PR9A 2B31A 3WH0A 2A3CA 4DZ3A 2PV2A 1FKGA 1HXVA 3UI4A 1IX5A 3WQVA 5HW8A 3CHEA 5DIVA 3O5RA 4ZPVR 3OA5A 5HW6A 2M1IA 3RM4A 3KCEA 4QT3A 1HJXA 1E6NA 1HKKA 3PRBA 1WNOA 1NSGA 2DT2A 1EYMA 2DT1A 2IF4A 3LUOA 4ODPA 2PPOA 1W26A 1FKRA 2Q5AA 3QOKA 3WL1A 3O5IA 1H0GA 2XP4A 2ESCA 1D2KA 4DRHA 2PV1A 3CGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KO7 A;  2PPN A;  3O5F A;  3ODK A;  3UQA A;  3KAG A;  3O5P A;  1JVW A;  1FKH A;  4R0X A;  1J4R A;  2PPP A;  4DRO A;  4DZ2 A;  3RFW A;  1EQ3 A;  1D7J A;  2MPH A;  5I98 A;  2D9F A;  4LAV A;  3IHZ A;  2RUQ A;  2ITK A;  2DG3 A;  2LPV A;  5D75 A;  2F4E A;  1ROU A;  2M2A A;  4IQ2 A;  1PIN A;  4NNR A;  1Q6U A;  2DG9 A;  2RUC A;  1NMV A;  2ZQS A;  3KAI A;  3O5D A;  4BF8 A;  1F40 A;  1ZK6 A;  5HWC A;  1FKS A;  1FKJ A;  3NTP A;  3PA7 A;  3O5M A;  4ITZ A;  2KI3 A;  4LAX A;  5GPG A;  3RGC A;  5J6E A;  1M5Y A;  1FKI A;  4JFJ A;  1Y0O A;  2OFN A;  1ROT A;  4MGV A;  3IKD A;  1FKD A;  3OOB A;  1FKT A;  4U84 A;  4ODK A;  1TCO C;  4DH0 A;  4DRQ A;  4TW6 A;  4ODQ A;  2Y78 A;  2RUD A;  3B7X A;  1U79 A;  3PRD A;  1QZ2 A;  3KAB A;  3O5L A;  3GPK A;  1T11 A;  2DG4 A;  2L2S A;  1JNT A;  4C02 B;  4DRJ A;  5DIT A;  4DRK A;  5BXJ A;  3EY6 A;  2MNT A;  3IKG A;  1A7X A;  2AWG A;  2F2D A;  2LKN A;  1D6O A;  2XP7 A;  5HTG A;  1FJD A;  4W9P A;  4DRM A;  2ZR4 A;  3H9R B;  2XP3 A;  1BKF A;  3UF8 A;  1F8A B;  1YW5 A;  1D7I A;  2F21 A;  2XP9 A;  4MSP A;  3VAW A;  3NI6 A;  4TW7 A;  4DRI A;  1FKK A;  5HKG A;  1J4H A;  2XPB A;  1J6Y A;  2MF9 A;  1L1P A;  3O5Q A;  3UQB A;  1Q6H A;  4JFK A;  4GIV A;  2M08 A;  2RSE A;  1PBK A;  4W9Q A;  4G2P A;  4TW8 A;  1FKL A;  2VCD A;  2XP5 A;  3UI6 A;  4ODR A;  1D7H A;  3JXV A;  1C9H A;  2ZQV A;  4ODO A;  4DIP A;  3KZ7 A;  1YAT A;  3JYM A;  3JYJ A;  2XPA A;  1FKB A;  5B8I C;  4LAY A;  4G50 A;  4QIB A;  3TCZ A;  3I6C A;  1FKF A;  3O5K A;  2RQS A;  2VN1 A;  1R9H A;  1B6C A;  3CGM A;  4J4O A;  4N19 A;  3TDB A;  3O5G A;  4DRP A;  2LGO A;  2MLY A;  3O5J A;  5HWB A;  4QT2 A;  4JFM A;  3UI5 A;  5HUA A;  4IQC A;  4ODN A;  3TC5 A;  1JNS A;  3UQI A;  3NRK A;  1FAP A;  2UZ5 A;  1J4I A;  1QPL A;  2ZR6 A;  3KAH A;  2KFW A;  3WH0 A;  2ZQT A;  1P5Q A;  2PBC A;  1Q1C A;  2JZV A;  4LAW A;  4DZ3 A;  5HT1 A;  2PV2 A;  1FD9 A;  3KAF A;  1FKG A;  2N87 A;  1HXV A;  3UI4 A;  2ZQU A;  3O5E A;  4TX0 A;  5HW8 A;  5DIV A;  2LJ4 A;  3O5R A;  4JYS A;  4U85 A;  4W9O A;  5HW6 A;  2M1I A;  3KCE A;  4QT3 A;  4TNS A;  4GGQ A;  3PRB A;  5HW7 A;  1ZCN A;  1NSG A;  1QPF A;  4FN2 A;  4DT4 A;  1KT0 A;  1EYM A;  2KE0 A;  2IF4 A;  1BL4 A;  3KAD A;  3LUO A;  2PPO A;  1W26 A;  4IPX A;  4ODP A;  2MLZ A;  2MLX A;  1Q6I A;  2PV3 A;  2XP8 A;  3O5O A;  4ODM A;  2ZR5 A;  3FAP A;  2Q5A A;  1NMW A;  2RUR A;  3MDY B;  1FKR A;  4ODL A;  4FAP A;  2XP6 A;  4O2T A;  2KR7 A;  1N1A A;  3O5I A;  1KT1 A;  2KGJ A;  4JFL A;  2FAP A;  2XP4 A;  2K8I A;  4JFI A;  3IK8 A;  4J4N A;  3KAC A;  2FKE A;  4U86 A;  4DRH A;  2PV1 A;  4TYO A;  5DIU A;  4DRN A;  3CGN A; 
#chains in the Genus database with same CATH topology
 4PTM A;  1NH6 A;  3ODK A;  3ARS A;  2F23 A;  4KQZ A;  3RFW A;  1E6R A;  1D7J A;  5I98 A;  1H0I A;  4LAV A;  3IHZ A;  2RUQ A;  3ARR A;  2DG3 A;  5D75 A;  3ARO A;  2A3B A;  2RUC A;  2DG9 A;  1NMV A;  3KAI A;  4BF8 A;  3BMB A;  1FKJ A;  3NTP A;  3RGC A;  2KI3 A;  3ARU A;  5J6E A;  1M5Y A;  4MGV A;  3IKD A;  1FKD A;  2DT3 A;  3OOB A;  1LG2 A;  4ODQ A;  3ARZ A;  2RUD A;  1U79 A;  3PRD A;  1QZ2 A;  1ZL1 A;  3KAB A;  4DRK A;  1E9L A;  3IKG A;  4MNM A;  4MTV A;  4W9P A;  2XP3 A;  2F21 A;  4Q7N A;  2ETN A;  1J4H A;  2PN0 A;  2MF9 A;  1L1P A;  3CH9 A;  4WK9 A;  3ARP A;  1HKM A;  1HKI A;  1FKL A;  3UI6 A;  2PI6 A;  4DIP A;  1C9H A;  3ARW A;  3KZ7 A;  1YAT A;  4KR0 B;  2XPA A;  1NWR A;  1FKB A;  2A3E A;  4QIB A;  3TCZ A;  3AQU A;  4J4O A;  3O5G A;  1JND A;  3AS2 A;  5GPR A;  5HWB A;  5HUA A;  3TC5 A;  3AS1 A;  3UQI A;  4ZPW R;  5GQB A;  2IUZ A;  3KAH A;  4WIW A;  5DF0 A;  2PBC A;  2JZV A;  4P8V A;  4ZS6 A;  3B9D A;  2LJ4 A;  1HJW A;  3WD3 A;  4DWS D;  1W9V A;  4TNS A;  2DSV A;  4DT4 A;  4NZC A;  1CTN A;  2XP8 A;  1Q6I A;  1XHG A;  3O5O A;  4ODM A;  2ZR5 A;  4Z2I A;  2YBU A;  4O2T A;  1KT1 A;  1E6Z A;  2KGJ A;  2FAP A;  2AOS A;  2K8I A;  4W5U A;  2DSU A;  1K9T A;  4J4N A;  4NSB A;  4U86 A;  1X6L A;  2KO7 A;  2QF8 A;  3G6L A;  3O5F A;  3GTY X;  3UQA A;  3ARY A;  3KAG A;  3O5P A;  1W9P A;  4Z2G A;  2ITK A;  1RD6 A;  2WLZ A;  1ROU A;  3B9A A;  4NNR A;  1ZK6 A;  5HWC A;  1FKS A;  4Z2L A;  3PA7 A;  4ITZ A;  5GPG A;  3WL0 A;  1LL6 A;  1ROT A;  4P8X A;  4WKF A;  4U84 A;  1GOI A;  3B7X A;  1W1P A;  1XRV A;  4C02 B;  2DG4 A;  1OGG A;  5DIT A;  4P8U A;  1SYT A;  2AWG A;  2XP7 A;  3ARV A;  4URI A;  1W1Y A;  1BKF A;  1F8A B;  3ALG A;  1GUV A;  3O5Q A;  3UQB A;  1Q6H A;  2RSE A;  4W9Q A;  3G6M A;  4HBO A;  4ODR A;  3JXV A;  1TFV A;  3AS0 A;  4IT6 A;  3RM8 A;  2O92 A;  3I6C A;  3PRA A;  4N19 A;  1B6C A;  3TDB A;  4DRP A;  2LGO A;  1EHN A;  4QT2 A;  1QPL A;  1NWT A;  2N87 A;  2ZQU A;  2YBT A;  2G8Z A;  4GGQ A;  5HW7 A;  1ZCN A;  4MPK A;  4FN2 A;  1KT0 A;  2KE0 A;  4IPX A;  1HKJ A;  4IT4 A;  1UR9 A;  3AS3 A;  4S3J A;  3FAP A;  2RUR A;  4ODL A;  4FAP A;  3RM9 A;  2XP6 A;  4MNJ A;  1O6I A;  1N1A A;  4JFL A;  4R5E A;  3ARX A;  4JFI A;  3B8S A;  3KAC A;  4AY1 A;  4TYO A;  5DIU A;  4DRN A;  3EIP A;  1ZBC A;  1LG1 A;  1SR0 A;  1JVW A;  1FKH A;  3WQW A;  2PPP A;  4DRO A;  4DZ2 A;  1EQ3 A;  2D9F A;  1ZU8 A;  4Z2K A;  3GU0 A;  2M2A A;  1PIN A;  4MNK A;  4L72 B;  4WKH A;  3WD4 A;  1FKI A;  2WLY A;  1Y0O A;  2OFN A;  1W1V A;  1TCO C;  4DRQ A;  4L3N A;  4TW6 A;  4P8W A;  4DWS A;  2WK2 A;  3W4R A;  3O5L A;  4DRJ A;  5BXJ A;  3EY6 A;  2DT0 A;  2MNT A;  1A7X A;  5HTG A;  1FJD A;  2ZR4 A;  4WKA A;  3UF8 A;  1YW5 A;  2XP9 A;  1D7I A;  3VAW A;  1LQ0 A;  3NI6 A;  4TW7 A;  5HKG A;  1FKK A;  2XPB A;  1J6Y A;  1ITX A;  1OWQ A;  4JFK A;  4GIV A;  2M08 A;  2VCD A;  4ODO A;  2ZQV A;  3WD2 A;  4UDM A;  5B8I C;  4LAY A;  4MAV A;  4G50 A;  3O5K A;  1FKF A;  3CGM A;  2VN1 A;  1NWS A;  4QZV B;  1E15 A;  3CHF A;  3O5J A;  4MNL A;  3WD0 A;  4JFM A;  4ODN A;  1NWU A;  3NRK A;  2UZ5 A;  3WIJ A;  2ZR6 A;  1EIB A;  2KFW A;  2ZQT A;  1P5Q A;  1Q1C A;  4LAW A;  1ZBV A;  5HT1 A;  1FD9 A;  3KAF A;  3O5E A;  4TX0 A;  4ZPT R;  3B9E A;  1JNE A;  3WKZ A;  3CHC A;  4JYS A;  5HBF A;  4DWS C;  1FFR A;  4ML4 A;  4U85 A;  4W9O A;  1HJV A;  1QPF A;  2G41 A;  1BL4 A;  3KAD A;  1ZBK A;  2MLZ A;  2MLX A;  1LL4 A;  2PV3 A;  4HBE A;  1NMW A;  3MDY B;  1W1T A;  2KR7 A;  1JCH B;  4S3K A;  2O9O A;  4Q22 A;  3IK8 A;  4HAR A;  5DEZ A;  2FKE A;  2WM0 A;  3WD1 A;  2OLH A;  2PPN A;  2A3A A;  1VF8 A;  4R0X A;  1J4R A;  2MPH A;  1LL7 A;  3BXW A;  4DWS B;  2LPV A;  2F4E A;  3ALF A;  4IQ2 A;  3RME A;  1Q6U A;  2ZQS A;  3ART A;  3O5D A;  2DPE A;  1F40 A;  4LAX A;  3O5M A;  4JFJ A;  5JH8 A;  2FDM A;  4DH0 A;  1FKT A;  4WJX A;  4ODK A;  4Z2H A;  2Y78 A;  3CHD A;  3FY1 A;  4LGX A;  3GPK A;  1T11 A;  1FFQ A;  1JNT A;  2L2S A;  2LKN A;  2F2D A;  1D6O A;  1OGB A;  4DRM A;  1GRJ A;  3H9R B;  1W9U A;  4MSP A;  4XAK A;  4DRI A;  1X6N A;  1E44 A;  1EDQ A;  1PBK A;  1GPF A;  4G2P A;  4TW8 A;  2DSW A;  2XP5 A;  1KFW A;  1D7H A;  3JYM A;  1ZB5 A;  3JYJ A;  1E6P A;  4Z2J A;  2RQS A;  1R9H A;  2P4V A;  1WAW A;  2DSZ A;  2MLY A;  3ARQ A;  2EUL A;  3CZ8 A;  1ZBW A;  4IQC A;  5DO2 A;  3UI5 A;  1JNS A;  1LJY A;  1UR8 A;  3FXY A;  1FAP A;  1J4I A;  1WB0 A;  3PR9 A;  2B31 A;  3WH0 A;  2A3C A;  4DZ3 A;  2PV2 A;  1FKG A;  1HXV A;  3UI4 A;  1IX5 A;  3WQV A;  5HW8 A;  3CHE A;  5DIV A;  3O5R A;  4ZPV R;  3OA5 A;  5HW6 A;  2M1I A;  3RM4 A;  3KCE A;  4QT3 A;  1HJX A;  1E6N A;  1HKK A;  3PRB A;  1WNO A;  1NSG A;  2DT2 A;  1EYM A;  2DT1 A;  2IF4 A;  3LUO A;  4ODP A;  2PPO A;  1W26 A;  1FKR A;  2Q5A A;  2B5U B;  3QOK A;  3WL1 A;  3O5I A;  1H0G A;  2XP4 A;  2ESC A;  1D2K A;  4DRH A;  2PV1 A;  3CGN A; 
#chains in the Genus database with same CATH homology
 4PTM A;  1NH6 A;  3ODK A;  3ARS A;  4KQZ A;  3RFW A;  1E6R A;  1D7J A;  5I98 A;  1H0I A;  4LAV A;  3IHZ A;  2RUQ A;  3ARR A;  2DG3 A;  5D75 A;  3ARO A;  2A3B A;  2RUC A;  2DG9 A;  1NMV A;  3KAI A;  4BF8 A;  1FKJ A;  3NTP A;  3RGC A;  2KI3 A;  3ARU A;  5J6E A;  1M5Y A;  4MGV A;  3IKD A;  1FKD A;  2DT3 A;  3OOB A;  1LG2 A;  4ODQ A;  3ARZ A;  2RUD A;  1U79 A;  3PRD A;  1QZ2 A;  1ZL1 A;  3KAB A;  4DRK A;  1E9L A;  3IKG A;  4MNM A;  4MTV A;  4W9P A;  2XP3 A;  2F21 A;  4Q7N A;  1J4H A;  2MF9 A;  1L1P A;  3CH9 A;  4WK9 A;  3ARP A;  1HKM A;  1HKI A;  1FKL A;  3UI6 A;  2PI6 A;  4DIP A;  1C9H A;  3ARW A;  3KZ7 A;  1YAT A;  4KR0 B;  2XPA A;  1NWR A;  1FKB A;  2A3E A;  4QIB A;  3TCZ A;  3AQU A;  4J4O A;  3O5G A;  1JND A;  3AS2 A;  5GPR A;  5HWB A;  5HUA A;  3TC5 A;  3AS1 A;  3UQI A;  4ZPW R;  5GQB A;  2IUZ A;  3KAH A;  4WIW A;  5DF0 A;  2PBC A;  2JZV A;  4P8V A;  4ZS6 A;  3B9D A;  2LJ4 A;  1HJW A;  3WD3 A;  4DWS D;  1W9V A;  4TNS A;  2DSV A;  4DT4 A;  4NZC A;  1CTN A;  2XP8 A;  1Q6I A;  1XHG A;  3O5O A;  4ODM A;  2ZR5 A;  4Z2I A;  2YBU A;  4O2T A;  1KT1 A;  1E6Z A;  2KGJ A;  2FAP A;  2AOS A;  2K8I A;  4W5U A;  2DSU A;  1K9T A;  4J4N A;  4NSB A;  4U86 A;  1X6L A;  2KO7 A;  2QF8 A;  3G6L A;  3O5F A;  3UQA A;  3ARY A;  3KAG A;  3O5P A;  1W9P A;  4Z2G A;  2ITK A;  1RD6 A;  2WLZ A;  1ROU A;  3B9A A;  4NNR A;  1ZK6 A;  5HWC A;  1FKS A;  4Z2L A;  3PA7 A;  4ITZ A;  5GPG A;  3WL0 A;  1LL6 A;  1ROT A;  4P8X A;  4WKF A;  4U84 A;  1GOI A;  3B7X A;  1W1P A;  1XRV A;  4C02 B;  2DG4 A;  1OGG A;  5DIT A;  4P8U A;  1SYT A;  2AWG A;  2XP7 A;  3ARV A;  4URI A;  1W1Y A;  1BKF A;  1F8A B;  3ALG A;  1GUV A;  3O5Q A;  3UQB A;  1Q6H A;  2RSE A;  4W9Q A;  3G6M A;  4HBO A;  4ODR A;  3JXV A;  1TFV A;  3AS0 A;  4IT6 A;  3RM8 A;  2O92 A;  3I6C A;  3PRA A;  4N19 A;  1B6C A;  3TDB A;  4DRP A;  2LGO A;  1EHN A;  4QT2 A;  1QPL A;  1NWT A;  2N87 A;  2ZQU A;  2YBT A;  2G8Z A;  4GGQ A;  5HW7 A;  1ZCN A;  4MPK A;  4FN2 A;  1KT0 A;  2KE0 A;  4IPX A;  1HKJ A;  4IT4 A;  1UR9 A;  3AS3 A;  4S3J A;  3FAP A;  2RUR A;  4ODL A;  4FAP A;  3RM9 A;  2XP6 A;  4MNJ A;  1O6I A;  1N1A A;  4JFL A;  4R5E A;  3ARX A;  4JFI A;  3B8S A;  3KAC A;  4AY1 A;  4TYO A;  5DIU A;  4DRN A;  1ZBC A;  1LG1 A;  1SR0 A;  1JVW A;  1FKH A;  3WQW A;  2PPP A;  4DRO A;  4DZ2 A;  1EQ3 A;  2D9F A;  1ZU8 A;  4Z2K A;  2M2A A;  1PIN A;  4MNK A;  4L72 B;  4WKH A;  3WD4 A;  1FKI A;  2WLY A;  1Y0O A;  2OFN A;  1W1V A;  1TCO C;  4DRQ A;  4L3N A;  4TW6 A;  4P8W A;  4DWS A;  2WK2 A;  3W4R A;  3O5L A;  4DRJ A;  5BXJ A;  3EY6 A;  2DT0 A;  2MNT A;  1A7X A;  5HTG A;  1FJD A;  2ZR4 A;  4WKA A;  3UF8 A;  1YW5 A;  2XP9 A;  1D7I A;  3VAW A;  1LQ0 A;  3NI6 A;  4TW7 A;  5HKG A;  1FKK A;  2XPB A;  1J6Y A;  1ITX A;  1OWQ A;  4JFK A;  4GIV A;  2M08 A;  2VCD A;  4ODO A;  2ZQV A;  3WD2 A;  5B8I C;  4LAY A;  4MAV A;  4G50 A;  3O5K A;  1FKF A;  3CGM A;  2VN1 A;  1NWS A;  4QZV B;  1E15 A;  3CHF A;  3O5J A;  4MNL A;  3WD0 A;  4JFM A;  4ODN A;  1NWU A;  3NRK A;  2UZ5 A;  3WIJ A;  2ZR6 A;  1EIB A;  2KFW A;  2ZQT A;  1P5Q A;  1Q1C A;  4LAW A;  1ZBV A;  5HT1 A;  1FD9 A;  3KAF A;  3O5E A;  4TX0 A;  4ZPT R;  3B9E A;  1JNE A;  3WKZ A;  3CHC A;  4JYS A;  5HBF A;  4DWS C;  1FFR A;  4ML4 A;  4U85 A;  4W9O A;  1HJV A;  1QPF A;  2G41 A;  1BL4 A;  3KAD A;  1ZBK A;  2MLZ A;  2MLX A;  1LL4 A;  2PV3 A;  4HBE A;  1NMW A;  3MDY B;  1W1T A;  2KR7 A;  4S3K A;  2O9O A;  4Q22 A;  3IK8 A;  4HAR A;  5DEZ A;  2FKE A;  2WM0 A;  3WD1 A;  2OLH A;  2PPN A;  2A3A A;  1VF8 A;  4R0X A;  1J4R A;  2MPH A;  1LL7 A;  3BXW A;  4DWS B;  2LPV A;  2F4E A;  3ALF A;  4IQ2 A;  3RME A;  1Q6U A;  2ZQS A;  3ART A;  3O5D A;  2DPE A;  1F40 A;  4LAX A;  3O5M A;  4JFJ A;  5JH8 A;  2FDM A;  4DH0 A;  1FKT A;  4WJX A;  4ODK A;  4Z2H A;  2Y78 A;  3CHD A;  3FY1 A;  4LGX A;  3GPK A;  1T11 A;  1FFQ A;  1JNT A;  2L2S A;  2LKN A;  2F2D A;  1D6O A;  1OGB A;  4DRM A;  3H9R B;  1W9U A;  4MSP A;  4XAK A;  4DRI A;  1X6N A;  1EDQ A;  1PBK A;  1GPF A;  4G2P A;  4TW8 A;  2DSW A;  2XP5 A;  1KFW A;  1D7H A;  3JYM A;  1ZB5 A;  3JYJ A;  1E6P A;  4Z2J A;  2RQS A;  1R9H A;  1WAW A;  2DSZ A;  2MLY A;  3ARQ A;  5DO2 A;  3CZ8 A;  1ZBW A;  4IQC A;  3UI5 A;  1JNS A;  1LJY A;  1UR8 A;  3FXY A;  1FAP A;  1J4I A;  1WB0 A;  3PR9 A;  2B31 A;  3WH0 A;  2A3C A;  4DZ3 A;  2PV2 A;  1FKG A;  1HXV A;  3UI4 A;  1IX5 A;  3WQV A;  5HW8 A;  3CHE A;  5DIV A;  3O5R A;  4ZPV R;  3OA5 A;  5HW6 A;  2M1I A;  3RM4 A;  3KCE A;  4QT3 A;  1HJX A;  1E6N A;  1HKK A;  3PRB A;  1WNO A;  1NSG A;  2DT2 A;  1EYM A;  2DT1 A;  2IF4 A;  3LUO A;  4ODP A;  2PPO A;  1W26 A;  1FKR A;  2Q5A A;  3QOK A;  3WL1 A;  3O5I A;  1H0G A;  2XP4 A;  2ESC A;  1D2K A;  4DRH A;  2PV1 A;  3CGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...