3O5OA

Fk1 domain mutant a19t of fkbp51, crystal form iii
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
128
structure length
128
Chain Sequence
GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peptidyl-prolyl cis-trans isomerase FKBP5
publication title Structural characterization of the PPIase domain of FKBP51, a cochaperone of human Hsp90.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 34
structure length 128
sequence length 128
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3o5oA00
1C9HA 3O5PA 3O5RA 3IKDA 4W9QA 4DRMA 1YATA 4ODRA 2MLZA 1D6OA 1FKHA 1FKBA 4J4OA 4DRPA 2MF9A 2XPAA 3O5DA 2MPHA 3MDYB 2Y78A 4R0XA 2KE0A 1Q6IA 4JFJA 4JFKA 3UQIA 1L1PA 3IK8A 1KT1A 3EY6A 3RFWA 3KADA 2LKNA 2RUDA 1FD9A 4JFMA 2IF4A 4IQCA 4C02B 2M08A 5DIUA 2OFNA 1JNTA 3O5OA 2XP6A 2LJ4A 2N87A 2ZR6A 4DRIA 5DIVA 3KABA 4LAYA 1J4HA 1M5YA 2M1IA 2RUQA 1NMVA 2DG4A 2ZQVA 3PA7A 4FN2A 4TYOA 4FAPA 1FKRA 3O5JA 5HKGA 2RSEA 3O5GA 2JZVA 1Q6UA 3JXVA 1J4IA 3KAGA 1A7XA 1FKFA 1QZ2A 1Q1CA 2PPOA 3ODKA 5J6EA 2PPNA 2PV2A 4DRHA 4DT4A 1J4RA 1NMWA 3JYJA 3TDBA 2LGOA 2ZR4A 5I98A 1EYMA 2PBCA 1B6CA 4TW6A 1D7JA 2F2DA 2M2AA 4GGQA 4ODLA 3PRDA 1U79A 2FKEA 1D7HA 2UZ5A 3KAHA 1PINA 4DROA 2KI3A 4ODOA 3O5EA 1FKIA 1JVWA 4ODKA 3KACA 4N19A 3RGCA 5HUAA 4MSPA 2RQSA 5HTGA 4DIPA 3CGNA 1Q6HA 2MLYA 2ZQUA 3NI6A 4NNRA 2MNTA 4U84A 3FAPA 4DZ2A 1T11A 3IHZA 2ZQSA 5GPGA 2PPPA 2RURA 3PRBA 1P5QA 2RUCA 1KT0A 4QT2A 4TNSA 1FKKA 1ROTA 4G2PA 1FKLA 3O5QA 1HXVA 2D9FA 4QIBA 4JFIA 5DITA 2KO7A 2Q5AA 2DG3A 3LUOA 4W9OA 2XPBA 2XP3A 5HW6A 2DG9A 4U85A 5BXJA 3UI6A 2VN1A 4G50A 3OOBA 4ODNA 5B8IC 2XP5A 3UQAA 2F4EA 4ITZA 3NTPA 3IKGA 3O5MA 1ROUA 1TCOC 1FAPA 5HW8A 4U86A 4MGVA 1FKJA 2PV1A 5HWCA 1NSGA 1FKDA 1N1AA 2MLXA 2XP8A 1BL4A 1BKFA 5HWBA 2XP7A 4O2TA 1QPLA 1FJDA 3NRKA 2L2SA 4DRNA 1FKGA 3H9RB 3I6CA 3TC5A 2F21A 1R9HA 3KAIA 4W9PA 3KZ7A 2K8IA 4IQ2A 4J4NA 3UQBA 3UF8A 1J6YA 1YW5A 2LPVA 2ITKA 5HT1A 4ODQA 4GIVA 1F8AB 3O5LA 3JYMA 1FKSA 1F40A 2XP9A 4BF8A 4DRKA 1QPFA 1EQ3A 1JNSA 3UI5A 5HW7A 1D7IA 1PBKA 4DZ3A 2KR7A 4TW8A 2KGJA 4QT3A 4TX0A 3VAWA 4DRQA 2ZQTA 2KFWA 1W26A 1Y0OA 4IPXA 3WH0A 3O5FA 4JFLA 4JYSA 3TCZA 4TW7A 4ODPA 3O5KA 4DRJA 3B7XA 4ODMA 3KCEA 4DH0A 1ZK6A 1FKTA 2AWGA 2XP4A 3KAFA 1ZCNA 2VCDA 3O5IA 4LAXA 2ZR5A 5D75A 2PV3A 3UI4A 3GPKA 2FAPA 4LAWA 4LAVA 3CGMA
chains in the Genus database with same CATH superfamily
3O5PA 4KR0B 4W9QA 1W1TA 4ODRA 4MNMA 1RD6A 3OA5A 4MTVA 3BXWA 2KE0A 1Q6IA 2DPEA 1KT1A 1HKMA 2AOSA 2PI6A 4C02B 5DIUA 2OFNA 3O5OA 2F23A 4DRIA 5DIVA 1FFRA 3WD3A 1M5YA 5HBFA 1NMVA 4TYOA 4UDMA 3O5GA 1X6NA 2JZVA 3JXVA 4WKAA 3KAGA 1FKFA 1QZ2A 1Q1CA 5J6EA 2PV2A 1NH6A 3GU0A 4WIWA 1D7JA 3PRDA 2UZ5A 1D7HA 4S3JA 1PINA 2KI3A 2EULA 3O5EA 4DWSC 3RGCA 5HTGA 2ZQUA 3ARTA 1OGGA 2WK2A 3ALFA 3FAPA 4DZ2A 5GPGA 2RURA 1P5QA 2RUCA 4QT2A 5GQBA 4Z2GA 4S3KA 1FKKA 5DO2A 3WD4A 3AS1A 3EIPA 5DITA 1ZBCA 4HBOA 1LL7A 5BXJA 3UI6A 3ARRA 3OOBA 3GTYX 4ITZA 3NTPA 3G6LA 2DT0A 1FAPA 5HW8A 4MGVA 4L3NA 5HWBA 2YBTA 1GUVA 1E44A 3NRKA 3I6CA 4DRQA 2F21A 1R9HA 3KZ7A 4J4NA 1JNEA 1O6IA 1YW5A 4Z2IA 2LPVA 1OGBA 2ITKA 5HT1A 4ODQA 4LGXA 4GIVA 1F8AB 3JYMA 2XP9A 3RM4A 1X6LA 1SR0A 4MAVA 3UI5A 2A3BA 3VAWA 1LL6A 1ZBKA 3WH0A 3ARSA 1EDQA 4ODPA 4URIA 3FY1A 4ODMA 4DH0A 4KQZA 1ZCNA 4LAXA 4P8XA 3AQUA 3IKDA 1YATA 3WD1A 3WQWA 4DRPA 1E9LA 2XPAA 1CTNA 1E6RA 3UQIA 4WK9A 4NZCA 1W1YA 5DEZA 1FD9A 4MNLA 1JNTA 2XP6A 2LJ4A 2ZR6A 4Q7NA 3FXYA 2A3EA 2O92A 3ARYA 1W1PA 1J4HA 2M1IA 2RUQA 1ZB5A 2DG4A 2ZQVA 4LAYA 4MNKA 1VF8A 4Z2LA 5HKGA 2RSEA 3ARWA 1HJVA 1J4IA 3ODKA 4DT4A 1D2KA 3TDBA 2LGOA 5I98A 3AROA 4TW6A 2F2DA 2M2AA 4GGQA 4ODLA 2FKEA 4DROA 1FKIA 3ARQA 3B9DA 3KACA 4MSPA 1Q6HA 2MLYA 4U84A 2MNTA 2WM0A 2ZQSA 1IX5A 4Q22A 2PPPA 4QZVB 1NWTA 4TNSA 4G2PA 1HXVA 4QIBA 1EIBA 3CHFA 3G6MA 2DG3A 4W9OA 2XPBA 2XP3A 2VN1A 4ODNA 3UQAA 3O5MA 1ROUA 1TCOC 2DSZA 1FKJA 1GOIA 1BKFA 2XP7A 4O2TA 2L2SA 4DRNA 3UQBA 4W9PA 2G41A 1NWRA 1F40A 1EHNA 1QPFA 1NWUA 3AS3A 4TX0A 1W26A 4PTMA 3O5FA 4JYSA 4P8UA 4ZPVR 3KCEA 1ZK6A 4AY1A 1FKTA 1JNDA 3KAFA 3O5IA 3UI4A 2PV3A 1ZU8A 2ETNA 4LAWA 4WJXA 3CGMA 1XRVA 3O5RA 2MLZA 1D6OA 1FKHA 4J4OA 2MF9A 2A3CA 1H0GA 4MNJA 2MPHA 3MDYB 4R0XA 2WLYA 1K9TA 1L1PA 3EY6A 2RUDA 3ARPA 4JFMA 2IF4A 4IQCA 2M08A 4ZPTR 3PRAA 3WD2A 1TFVA 1LQ0A 2N87A 3ALGA 2DT3A 3KABA 1GRJA 3PA7A 3WQVA 1WB0A 1H0IA 1Q6UA 4HBEA 1A7XA 2PPOA 2PPNA 4DRHA 5GPRA 4L72B 1J4RA 1NMWA 3JYJA 2DT1A 2ZR4A 2A3AA 3CH9A 4ODOA 4ZPWR 4ZS6A 4IT4A 4NSBA 5DF0A 5HUAA 2RQSA 4P8WA 4DIPA 3NI6A 3AS0A 2P4VA 1W9UA 1ZL1A 1FKLA 2KO7A 2Q5AA 1SYTA 2IUZA 3CZ8A 2O9OA 3CHCA 4G50A 2F4EA 3B8SA 3IKGA 4U86A 1HKJA 2PV1A 1N1AA 1W1VA 1BL4A 1W9VA 1E6PA 1QPLA 1FJDA 1JCHB 3TC5A 1J6YA 4IQ2A 3B9AA 1ZBVA 1HJWA 2DSWA 2DT2A 1JNSA 3RM8A 5HW7A 1D7IA 1PBKA 1HKIA 2KR7A 4TW8A 2KGJA 2ZQTA 2KFWA 3TCZA 4DWSB 4DRJA 3PR9A 3B7XA 2AWGA 3AS2A 2G8ZA 1E15A 2ZR5A 3BMBA 5D75A 5JH8A 2DSVA 2FAPA 1UR9A 4DWSD 1C9HA 4DRMA 1XHGA 1FKBA 2B5UB 3RMEA 4MPKA 3ARZA 3O5DA 1LG1A 2Y78A 2B31A 1LG2A 4JFJA 4JFKA 4R5EA 3IK8A 3RFWA 3KADA 2LKNA 3WL0A 4IT6A 3WIJA 1OWQA 4FN2A 4FAPA 1FKRA 3O5JA 2YBUA 3W4RA 2WLZA 2ESCA 3ARUA 2OLHA 4W5UA 3B9EA 1EYMA 2PBCA 1B6CA 1U79A 3KAHA 4ODKA 1JVWA 4N19A 4P8VA 4WKFA 3CGNA 4NNRA 4DWSA 1T11A 3IHZA 3PRBA 1KT0A 1ROTA 1UR8A 2QF8A 4ML4A 2DSUA 3O5QA 2D9FA 4JFIA 3LUOA 5HW6A 2DG9A 4U85A 5B8IC 2XP5A 4Z2HA 1FFQA 5HWCA 1NSGA 1FKDA 1KFWA 2MLXA 2XP8A 3ARXA 3CHEA 3WL1A 1LJYA 1FKGA 3H9RB 3KAIA 1E6ZA 3ARVA 2K8IA 3UF8A 4Z2KA 3RM9A 1W9PA 3O5LA 4XAKA 1FKSA 3WKZA 3QOKA 4BF8A 4DRKA 1EQ3A 1ITXA 3CHDA 1LL4A 4DZ3A 1WAWA 4QT3A 4IPXA 1Y0OA 1HJXA 4JFLA 4Z2JA 4TW7A 1WNOA 3O5KA 2FDMA 3WD0A 2XP4A 1GPFA 2VCDA 1E6NA 1NWSA 2PN0A 4WKHA 4HARA 1ZBWA 3GPKA 1HKKA 4LAVA
chains in the Genus database with same CATH topology
3O5PA 4KR0B 4W9QA 1W1TA 4ODRA 4MNMA 1RD6A 3OA5A 4MTVA 3BXWA 2KE0A 1Q6IA 2DPEA 1KT1A 1HKMA 2AOSA 2PI6A 4C02B 5DIUA 2OFNA 3O5OA 4DRIA 5DIVA 1FFRA 3WD3A 1M5YA 5HBFA 1NMVA 4TYOA 3O5GA 1X6NA 2JZVA 3JXVA 4WKAA 3KAGA 1FKFA 1QZ2A 1Q1CA 5J6EA 2PV2A 1NH6A 4WIWA 1D7JA 3PRDA 2UZ5A 1D7HA 4S3JA 1PINA 2KI3A 3O5EA 4DWSC 3RGCA 5HTGA 2ZQUA 3ARTA 1OGGA 2WK2A 3ALFA 3FAPA 4DZ2A 5GPGA 2RURA 1P5QA 2RUCA 4QT2A 5GQBA 4Z2GA 4S3KA 1FKKA 5DO2A 3WD4A 3AS1A 5DITA 1ZBCA 4HBOA 1LL7A 5BXJA 3UI6A 3ARRA 3OOBA 4ITZA 3NTPA 3G6LA 2DT0A 1FAPA 5HW8A 4MGVA 4L3NA 5HWBA 2YBTA 1GUVA 3NRKA 3I6CA 4DRQA 2F21A 1R9HA 3KZ7A 4J4NA 1JNEA 1O6IA 1YW5A 4Z2IA 2LPVA 1OGBA 2ITKA 5HT1A 4ODQA 4LGXA 4GIVA 1F8AB 3JYMA 2XP9A 3RM4A 1X6LA 1SR0A 4MAVA 3UI5A 2A3BA 3VAWA 1LL6A 1ZBKA 3WH0A 3ARSA 1EDQA 4ODPA 4URIA 3FY1A 4ODMA 4DH0A 4KQZA 1ZCNA 4LAXA 4P8XA 3AQUA 3IKDA 1YATA 3WD1A 3WQWA 4DRPA 1E9LA 2XPAA 1CTNA 1E6RA 3UQIA 4WK9A 4NZCA 1W1YA 5DEZA 1FD9A 4MNLA 1JNTA 2XP6A 2LJ4A 2ZR6A 4Q7NA 3FXYA 2A3EA 2O92A 3ARYA 1W1PA 1J4HA 2M1IA 2RUQA 1ZB5A 2DG4A 2ZQVA 4LAYA 4MNKA 1VF8A 4Z2LA 5HKGA 2RSEA 3ARWA 1HJVA 1J4IA 3ODKA 4DT4A 1D2KA 3TDBA 2LGOA 5I98A 3AROA 4TW6A 2F2DA 2M2AA 4GGQA 4ODLA 2FKEA 4DROA 1FKIA 3ARQA 3B9DA 3KACA 4MSPA 1Q6HA 2MLYA 4U84A 2MNTA 2WM0A 2ZQSA 1IX5A 4Q22A 2PPPA 4QZVB 1NWTA 4TNSA 4G2PA 1HXVA 4QIBA 1EIBA 3CHFA 3G6MA 2DG3A 4W9OA 2XPBA 2XP3A 2VN1A 4ODNA 3UQAA 3O5MA 1ROUA 1TCOC 2DSZA 1FKJA 1GOIA 1BKFA 2XP7A 4O2TA 2L2SA 4DRNA 3UQBA 4W9PA 2G41A 1NWRA 1F40A 1EHNA 1QPFA 1NWUA 3AS3A 4TX0A 1W26A 4PTMA 3O5FA 4JYSA 4P8UA 4ZPVR 3KCEA 1ZK6A 4AY1A 1FKTA 1JNDA 3KAFA 3O5IA 3UI4A 2PV3A 1ZU8A 4LAWA 4WJXA 3CGMA 1XRVA 3O5RA 2MLZA 1D6OA 1FKHA 4J4OA 2MF9A 2A3CA 1H0GA 4MNJA 2MPHA 3MDYB 4R0XA 2WLYA 1K9TA 1L1PA 3EY6A 2RUDA 3ARPA 4JFMA 2IF4A 4IQCA 2M08A 4ZPTR 3PRAA 3WD2A 1TFVA 1LQ0A 2N87A 3ALGA 2DT3A 3KABA 3PA7A 3WQVA 1WB0A 1H0IA 1Q6UA 4HBEA 1A7XA 2PPOA 2PPNA 4DRHA 5GPRA 4L72B 1J4RA 1NMWA 3JYJA 2DT1A 2ZR4A 2A3AA 3CH9A 4ODOA 4ZPWR 4ZS6A 4IT4A 4NSBA 5DF0A 5HUAA 2RQSA 4P8WA 4DIPA 3NI6A 3AS0A 1W9UA 1ZL1A 1FKLA 2KO7A 2Q5AA 1SYTA 2IUZA 3CZ8A 2O9OA 3CHCA 4G50A 2F4EA 3B8SA 3IKGA 4U86A 1HKJA 2PV1A 1N1AA 1W1VA 1BL4A 1W9VA 1E6PA 1QPLA 1FJDA 3TC5A 1J6YA 4IQ2A 3B9AA 1ZBVA 1HJWA 2DSWA 2DT2A 1JNSA 3RM8A 5HW7A 1D7IA 1PBKA 1HKIA 2KR7A 4TW8A 2KGJA 2ZQTA 2KFWA 3TCZA 4DWSB 4DRJA 3PR9A 3B7XA 2AWGA 3AS2A 2G8ZA 1E15A 2ZR5A 5D75A 5JH8A 2DSVA 2FAPA 1UR9A 4DWSD 1C9HA 4DRMA 1XHGA 1FKBA 3RMEA 4MPKA 3ARZA 3O5DA 1LG1A 2Y78A 2B31A 1LG2A 4JFJA 4JFKA 4R5EA 3IK8A 3RFWA 3KADA 2LKNA 3WL0A 4IT6A 3WIJA 1OWQA 4FN2A 4FAPA 1FKRA 3O5JA 2YBUA 3W4RA 2WLZA 2ESCA 3ARUA 2OLHA 4W5UA 3B9EA 1EYMA 2PBCA 1B6CA 1U79A 3KAHA 4ODKA 1JVWA 4N19A 4P8VA 4WKFA 3CGNA 4NNRA 4DWSA 1T11A 3IHZA 3PRBA 1KT0A 1ROTA 1UR8A 2QF8A 4ML4A 2DSUA 3O5QA 2D9FA 4JFIA 3LUOA 5HW6A 2DG9A 4U85A 5B8IC 2XP5A 4Z2HA 1FFQA 5HWCA 1NSGA 1FKDA 1KFWA 2MLXA 2XP8A 3ARXA 3CHEA 3WL1A 1LJYA 1FKGA 3H9RB 3KAIA 1E6ZA 3ARVA 2K8IA 3UF8A 4Z2KA 3RM9A 1W9PA 3O5LA 4XAKA 1FKSA 3WKZA 3QOKA 4BF8A 4DRKA 1EQ3A 1ITXA 3CHDA 1LL4A 4DZ3A 1WAWA 4QT3A 4IPXA 1Y0OA 1HJXA 4JFLA 4Z2JA 4TW7A 1WNOA 3O5KA 2FDMA 3WD0A 2XP4A 1GPFA 2VCDA 1E6NA 1NWSA 4WKHA 4HARA 1ZBWA 3GPKA 1HKKA 4LAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9H A;  3O5P A;  3O5R A;  3IKD A;  4W9Q A;  4DRM A;  1YAT A;  4ODR A;  2MLZ A;  1D6O A;  1FKH A;  1FKB A;  4J4O A;  4DRP A;  2MF9 A;  2XPA A;  3O5D A;  2MPH A;  3MDY B;  2Y78 A;  4R0X A;  2KE0 A;  1Q6I A;  4JFJ A;  4JFK A;  3UQI A;  1L1P A;  3IK8 A;  1KT1 A;  3EY6 A;  3RFW A;  3KAD A;  2LKN A;  2RUD A;  1FD9 A;  4JFM A;  2IF4 A;  4IQC A;  4C02 B;  2M08 A;  5DIU A;  2OFN A;  1JNT A;  3O5O A;  2XP6 A;  2LJ4 A;  2N87 A;  2ZR6 A;  4DRI A;  5DIV A;  3KAB A;  4LAY A;  1J4H A;  1M5Y A;  2M1I A;  2RUQ A;  1NMV A;  2DG4 A;  2ZQV A;  3PA7 A;  4FN2 A;  4TYO A;  4FAP A;  1FKR A;  3O5J A;  5HKG A;  2RSE A;  3O5G A;  2JZV A;  1Q6U A;  3JXV A;  1J4I A;  3KAG A;  1A7X A;  1FKF A;  1QZ2 A;  1Q1C A;  2PPO A;  3ODK A;  5J6E A;  2PPN A;  2PV2 A;  4DRH A;  4DT4 A;  1J4R A;  1NMW A;  3JYJ A;  3TDB A;  2LGO A;  2ZR4 A;  5I98 A;  1EYM A;  2PBC A;  1B6C A;  4TW6 A;  1D7J A;  2F2D A;  2M2A A;  4GGQ A;  4ODL A;  3PRD A;  1U79 A;  2FKE A;  1D7H A;  2UZ5 A;  3KAH A;  1PIN A;  4DRO A;  2KI3 A;  4ODO A;  3O5E A;  1FKI A;  1JVW A;  4ODK A;  3KAC A;  4N19 A;  3RGC A;  5HUA A;  4MSP A;  2RQS A;  5HTG A;  4DIP A;  3CGN A;  1Q6H A;  2MLY A;  2ZQU A;  3NI6 A;  4NNR A;  2MNT A;  4U84 A;  3FAP A;  4DZ2 A;  1T11 A;  3IHZ A;  2ZQS A;  5GPG A;  2PPP A;  2RUR A;  3PRB A;  1P5Q A;  2RUC A;  1KT0 A;  4QT2 A;  4TNS A;  1FKK A;  1ROT A;  4G2P A;  1FKL A;  3O5Q A;  1HXV A;  2D9F A;  4QIB A;  4JFI A;  5DIT A;  2KO7 A;  2Q5A A;  2DG3 A;  3LUO A;  4W9O A;  2XPB A;  2XP3 A;  5HW6 A;  2DG9 A;  4U85 A;  5BXJ A;  3UI6 A;  2VN1 A;  4G50 A;  3OOB A;  4ODN A;  5B8I C;  2XP5 A;  3UQA A;  2F4E A;  4ITZ A;  3NTP A;  3IKG A;  3O5M A;  1ROU A;  1TCO C;  1FAP A;  5HW8 A;  4U86 A;  4MGV A;  1FKJ A;  2PV1 A;  5HWC A;  1NSG A;  1FKD A;  1N1A A;  2MLX A;  2XP8 A;  1BL4 A;  1BKF A;  5HWB A;  2XP7 A;  4O2T A;  1QPL A;  1FJD A;  3NRK A;  2L2S A;  4DRN A;  1FKG A;  3H9R B;  3I6C A;  3TC5 A;  2F21 A;  1R9H A;  3KAI A;  4W9P A;  3KZ7 A;  2K8I A;  4IQ2 A;  4J4N A;  3UQB A;  3UF8 A;  1J6Y A;  1YW5 A;  2LPV A;  2ITK A;  5HT1 A;  4ODQ A;  4GIV A;  1F8A B;  3O5L A;  3JYM A;  1FKS A;  1F40 A;  2XP9 A;  4BF8 A;  4DRK A;  1QPF A;  1EQ3 A;  1JNS A;  3UI5 A;  5HW7 A;  1D7I A;  1PBK A;  4DZ3 A;  2KR7 A;  4TW8 A;  2KGJ A;  4QT3 A;  4TX0 A;  3VAW A;  4DRQ A;  2ZQT A;  2KFW A;  1W26 A;  1Y0O A;  4IPX A;  3WH0 A;  3O5F A;  4JFL A;  4JYS A;  3TCZ A;  4TW7 A;  4ODP A;  3O5K A;  4DRJ A;  3B7X A;  4ODM A;  3KCE A;  4DH0 A;  1ZK6 A;  1FKT A;  2AWG A;  2XP4 A;  3KAF A;  1ZCN A;  2VCD A;  3O5I A;  4LAX A;  2ZR5 A;  5D75 A;  2PV3 A;  3UI4 A;  3GPK A;  2FAP A;  4LAW A;  4LAV A;  3CGM A; 
#chains in the Genus database with same CATH topology
 3O5P A;  4KR0 B;  4W9Q A;  1W1T A;  4ODR A;  4MNM A;  1RD6 A;  3OA5 A;  4MTV A;  3BXW A;  2KE0 A;  1Q6I A;  2DPE A;  1KT1 A;  1HKM A;  2AOS A;  2PI6 A;  4C02 B;  5DIU A;  2OFN A;  3O5O A;  2F23 A;  4DRI A;  5DIV A;  1FFR A;  3WD3 A;  1M5Y A;  5HBF A;  1NMV A;  4TYO A;  4UDM A;  3O5G A;  1X6N A;  2JZV A;  3JXV A;  4WKA A;  3KAG A;  1FKF A;  1QZ2 A;  1Q1C A;  5J6E A;  2PV2 A;  1NH6 A;  3GU0 A;  4WIW A;  1D7J A;  3PRD A;  2UZ5 A;  1D7H A;  4S3J A;  1PIN A;  2KI3 A;  2EUL A;  3O5E A;  4DWS C;  3RGC A;  5HTG A;  2ZQU A;  3ART A;  1OGG A;  2WK2 A;  3ALF A;  3FAP A;  4DZ2 A;  5GPG A;  2RUR A;  1P5Q A;  2RUC A;  4QT2 A;  5GQB A;  4Z2G A;  4S3K A;  1FKK A;  5DO2 A;  3WD4 A;  3AS1 A;  3EIP A;  5DIT A;  1ZBC A;  4HBO A;  1LL7 A;  5BXJ A;  3UI6 A;  3ARR A;  3OOB A;  3GTY X;  4ITZ A;  3NTP A;  3G6L A;  2DT0 A;  1FAP A;  5HW8 A;  4MGV A;  4L3N A;  5HWB A;  2YBT A;  1GUV A;  1E44 A;  3NRK A;  3I6C A;  4DRQ A;  2F21 A;  1R9H A;  3KZ7 A;  4J4N A;  1JNE A;  1O6I A;  1YW5 A;  4Z2I A;  2LPV A;  1OGB A;  2ITK A;  5HT1 A;  4ODQ A;  4LGX A;  4GIV A;  1F8A B;  3JYM A;  2XP9 A;  3RM4 A;  1X6L A;  1SR0 A;  4MAV A;  3UI5 A;  2A3B A;  3VAW A;  1LL6 A;  1ZBK A;  3WH0 A;  3ARS A;  1EDQ A;  4ODP A;  4URI A;  3FY1 A;  4ODM A;  4DH0 A;  4KQZ A;  1ZCN A;  4LAX A;  4P8X A;  3AQU A;  3IKD A;  1YAT A;  3WD1 A;  3WQW A;  4DRP A;  1E9L A;  2XPA A;  1CTN A;  1E6R A;  3UQI A;  4WK9 A;  4NZC A;  1W1Y A;  5DEZ A;  1FD9 A;  4MNL A;  1JNT A;  2XP6 A;  2LJ4 A;  2ZR6 A;  4Q7N A;  3FXY A;  2A3E A;  2O92 A;  3ARY A;  1W1P A;  1J4H A;  2M1I A;  2RUQ A;  1ZB5 A;  2DG4 A;  2ZQV A;  4LAY A;  4MNK A;  1VF8 A;  4Z2L A;  5HKG A;  2RSE A;  3ARW A;  1HJV A;  1J4I A;  3ODK A;  4DT4 A;  1D2K A;  3TDB A;  2LGO A;  5I98 A;  3ARO A;  4TW6 A;  2F2D A;  2M2A A;  4GGQ A;  4ODL A;  2FKE A;  4DRO A;  1FKI A;  3ARQ A;  3B9D A;  3KAC A;  4MSP A;  1Q6H A;  2MLY A;  4U84 A;  2MNT A;  2WM0 A;  2ZQS A;  1IX5 A;  4Q22 A;  2PPP A;  4QZV B;  1NWT A;  4TNS A;  4G2P A;  1HXV A;  4QIB A;  1EIB A;  3CHF A;  3G6M A;  2DG3 A;  4W9O A;  2XPB A;  2XP3 A;  2VN1 A;  4ODN A;  3UQA A;  3O5M A;  1ROU A;  1TCO C;  2DSZ A;  1FKJ A;  1GOI A;  1BKF A;  2XP7 A;  4O2T A;  2L2S A;  4DRN A;  3UQB A;  4W9P A;  2G41 A;  1NWR A;  1F40 A;  1EHN A;  1QPF A;  1NWU A;  3AS3 A;  4TX0 A;  1W26 A;  4PTM A;  3O5F A;  4JYS A;  4P8U A;  4ZPV R;  3KCE A;  1ZK6 A;  4AY1 A;  1FKT A;  1JND A;  3KAF A;  3O5I A;  3UI4 A;  2PV3 A;  1ZU8 A;  2ETN A;  4LAW A;  4WJX A;  3CGM A;  1XRV A;  3O5R A;  2MLZ A;  1D6O A;  1FKH A;  4J4O A;  2MF9 A;  2A3C A;  1H0G A;  4MNJ A;  2MPH A;  3MDY B;  4R0X A;  2WLY A;  1K9T A;  1L1P A;  3EY6 A;  2RUD A;  3ARP A;  4JFM A;  2IF4 A;  4IQC A;  2M08 A;  4ZPT R;  3PRA A;  3WD2 A;  1TFV A;  1LQ0 A;  2N87 A;  3ALG A;  2DT3 A;  3KAB A;  1GRJ A;  3PA7 A;  3WQV A;  1WB0 A;  1H0I A;  1Q6U A;  4HBE A;  1A7X A;  2PPO A;  2PPN A;  4DRH A;  5GPR A;  4L72 B;  1J4R A;  1NMW A;  3JYJ A;  2DT1 A;  2ZR4 A;  2A3A A;  3CH9 A;  4ODO A;  4ZPW R;  4ZS6 A;  4IT4 A;  4NSB A;  5DF0 A;  5HUA A;  2RQS A;  4P8W A;  4DIP A;  3NI6 A;  3AS0 A;  2P4V A;  1W9U A;  1ZL1 A;  1FKL A;  2KO7 A;  2Q5A A;  1SYT A;  2IUZ A;  3CZ8 A;  2O9O A;  3CHC A;  4G50 A;  2F4E A;  3B8S A;  3IKG A;  4U86 A;  1HKJ A;  2PV1 A;  1N1A A;  1W1V A;  1BL4 A;  1W9V A;  1E6P A;  1QPL A;  1FJD A;  1JCH B;  3TC5 A;  1J6Y A;  4IQ2 A;  3B9A A;  1ZBV A;  1HJW A;  2DSW A;  2DT2 A;  1JNS A;  3RM8 A;  5HW7 A;  1D7I A;  1PBK A;  1HKI A;  2KR7 A;  4TW8 A;  2KGJ A;  2ZQT A;  2KFW A;  3TCZ A;  4DWS B;  4DRJ A;  3PR9 A;  3B7X A;  2AWG A;  3AS2 A;  2G8Z A;  1E15 A;  2ZR5 A;  3BMB A;  5D75 A;  5JH8 A;  2DSV A;  2FAP A;  1UR9 A;  4DWS D;  1C9H A;  4DRM A;  1XHG A;  1FKB A;  2B5U B;  3RME A;  4MPK A;  3ARZ A;  3O5D A;  1LG1 A;  2Y78 A;  2B31 A;  1LG2 A;  4JFJ A;  4JFK A;  4R5E A;  3IK8 A;  3RFW A;  3KAD A;  2LKN A;  3WL0 A;  4IT6 A;  3WIJ A;  1OWQ A;  4FN2 A;  4FAP A;  1FKR A;  3O5J A;  2YBU A;  3W4R A;  2WLZ A;  2ESC A;  3ARU A;  2OLH A;  4W5U A;  3B9E A;  1EYM A;  2PBC A;  1B6C A;  1U79 A;  3KAH A;  4ODK A;  1JVW A;  4N19 A;  4P8V A;  4WKF A;  3CGN A;  4NNR A;  4DWS A;  1T11 A;  3IHZ A;  3PRB A;  1KT0 A;  1ROT A;  1UR8 A;  2QF8 A;  4ML4 A;  2DSU A;  3O5Q A;  2D9F A;  4JFI A;  3LUO A;  5HW6 A;  2DG9 A;  4U85 A;  5B8I C;  2XP5 A;  4Z2H A;  1FFQ A;  5HWC A;  1NSG A;  1FKD A;  1KFW A;  2MLX A;  2XP8 A;  3ARX A;  3CHE A;  3WL1 A;  1LJY A;  1FKG A;  3H9R B;  3KAI A;  1E6Z A;  3ARV A;  2K8I A;  3UF8 A;  4Z2K A;  3RM9 A;  1W9P A;  3O5L A;  4XAK A;  1FKS A;  3WKZ A;  3QOK A;  4BF8 A;  4DRK A;  1EQ3 A;  1ITX A;  3CHD A;  1LL4 A;  4DZ3 A;  1WAW A;  4QT3 A;  4IPX A;  1Y0O A;  1HJX A;  4JFL A;  4Z2J A;  4TW7 A;  1WNO A;  3O5K A;  2FDM A;  3WD0 A;  2XP4 A;  1GPF A;  2VCD A;  1E6N A;  1NWS A;  2PN0 A;  4WKH A;  4HAR A;  1ZBW A;  3GPK A;  1HKK A;  4LAV A; 
#chains in the Genus database with same CATH homology
 3O5P A;  4KR0 B;  4W9Q A;  1W1T A;  4ODR A;  4MNM A;  1RD6 A;  3OA5 A;  4MTV A;  3BXW A;  2KE0 A;  1Q6I A;  2DPE A;  1KT1 A;  1HKM A;  2AOS A;  2PI6 A;  4C02 B;  5DIU A;  2OFN A;  3O5O A;  4DRI A;  5DIV A;  1FFR A;  3WD3 A;  1M5Y A;  5HBF A;  1NMV A;  4TYO A;  3O5G A;  1X6N A;  2JZV A;  3JXV A;  4WKA A;  3KAG A;  1FKF A;  1QZ2 A;  1Q1C A;  5J6E A;  2PV2 A;  1NH6 A;  4WIW A;  1D7J A;  3PRD A;  2UZ5 A;  1D7H A;  4S3J A;  1PIN A;  2KI3 A;  3O5E A;  4DWS C;  3RGC A;  5HTG A;  2ZQU A;  3ART A;  1OGG A;  2WK2 A;  3ALF A;  3FAP A;  4DZ2 A;  5GPG A;  2RUR A;  1P5Q A;  2RUC A;  4QT2 A;  5GQB A;  4Z2G A;  4S3K A;  1FKK A;  5DO2 A;  3WD4 A;  3AS1 A;  5DIT A;  1ZBC A;  4HBO A;  1LL7 A;  5BXJ A;  3UI6 A;  3ARR A;  3OOB A;  4ITZ A;  3NTP A;  3G6L A;  2DT0 A;  1FAP A;  5HW8 A;  4MGV A;  4L3N A;  5HWB A;  2YBT A;  1GUV A;  3NRK A;  3I6C A;  4DRQ A;  2F21 A;  1R9H A;  3KZ7 A;  4J4N A;  1JNE A;  1O6I A;  1YW5 A;  4Z2I A;  2LPV A;  1OGB A;  2ITK A;  5HT1 A;  4ODQ A;  4LGX A;  4GIV A;  1F8A B;  3JYM A;  2XP9 A;  3RM4 A;  1X6L A;  1SR0 A;  4MAV A;  3UI5 A;  2A3B A;  3VAW A;  1LL6 A;  1ZBK A;  3WH0 A;  3ARS A;  1EDQ A;  4ODP A;  4URI A;  3FY1 A;  4ODM A;  4DH0 A;  4KQZ A;  1ZCN A;  4LAX A;  4P8X A;  3AQU A;  3IKD A;  1YAT A;  3WD1 A;  3WQW A;  4DRP A;  1E9L A;  2XPA A;  1CTN A;  1E6R A;  3UQI A;  4WK9 A;  4NZC A;  1W1Y A;  5DEZ A;  1FD9 A;  4MNL A;  1JNT A;  2XP6 A;  2LJ4 A;  2ZR6 A;  4Q7N A;  3FXY A;  2A3E A;  2O92 A;  3ARY A;  1W1P A;  1J4H A;  2M1I A;  2RUQ A;  1ZB5 A;  2DG4 A;  2ZQV A;  4LAY A;  4MNK A;  1VF8 A;  4Z2L A;  5HKG A;  2RSE A;  3ARW A;  1HJV A;  1J4I A;  3ODK A;  4DT4 A;  1D2K A;  3TDB A;  2LGO A;  5I98 A;  3ARO A;  4TW6 A;  2F2D A;  2M2A A;  4GGQ A;  4ODL A;  2FKE A;  4DRO A;  1FKI A;  3ARQ A;  3B9D A;  3KAC A;  4MSP A;  1Q6H A;  2MLY A;  4U84 A;  2MNT A;  2WM0 A;  2ZQS A;  1IX5 A;  4Q22 A;  2PPP A;  4QZV B;  1NWT A;  4TNS A;  4G2P A;  1HXV A;  4QIB A;  1EIB A;  3CHF A;  3G6M A;  2DG3 A;  4W9O A;  2XPB A;  2XP3 A;  2VN1 A;  4ODN A;  3UQA A;  3O5M A;  1ROU A;  1TCO C;  2DSZ A;  1FKJ A;  1GOI A;  1BKF A;  2XP7 A;  4O2T A;  2L2S A;  4DRN A;  3UQB A;  4W9P A;  2G41 A;  1NWR A;  1F40 A;  1EHN A;  1QPF A;  1NWU A;  3AS3 A;  4TX0 A;  1W26 A;  4PTM A;  3O5F A;  4JYS A;  4P8U A;  4ZPV R;  3KCE A;  1ZK6 A;  4AY1 A;  1FKT A;  1JND A;  3KAF A;  3O5I A;  3UI4 A;  2PV3 A;  1ZU8 A;  4LAW A;  4WJX A;  3CGM A;  1XRV A;  3O5R A;  2MLZ A;  1D6O A;  1FKH A;  4J4O A;  2MF9 A;  2A3C A;  1H0G A;  4MNJ A;  2MPH A;  3MDY B;  4R0X A;  2WLY A;  1K9T A;  1L1P A;  3EY6 A;  2RUD A;  3ARP A;  4JFM A;  2IF4 A;  4IQC A;  2M08 A;  4ZPT R;  3PRA A;  3WD2 A;  1TFV A;  1LQ0 A;  2N87 A;  3ALG A;  2DT3 A;  3KAB A;  3PA7 A;  3WQV A;  1WB0 A;  1H0I A;  1Q6U A;  4HBE A;  1A7X A;  2PPO A;  2PPN A;  4DRH A;  5GPR A;  4L72 B;  1J4R A;  1NMW A;  3JYJ A;  2DT1 A;  2ZR4 A;  2A3A A;  3CH9 A;  4ODO A;  4ZPW R;  4ZS6 A;  4IT4 A;  4NSB A;  5DF0 A;  5HUA A;  2RQS A;  4P8W A;  4DIP A;  3NI6 A;  3AS0 A;  1W9U A;  1ZL1 A;  1FKL A;  2KO7 A;  2Q5A A;  1SYT A;  2IUZ A;  3CZ8 A;  2O9O A;  3CHC A;  4G50 A;  2F4E A;  3B8S A;  3IKG A;  4U86 A;  1HKJ A;  2PV1 A;  1N1A A;  1W1V A;  1BL4 A;  1W9V A;  1E6P A;  1QPL A;  1FJD A;  3TC5 A;  1J6Y A;  4IQ2 A;  3B9A A;  1ZBV A;  1HJW A;  2DSW A;  2DT2 A;  1JNS A;  3RM8 A;  5HW7 A;  1D7I A;  1PBK A;  1HKI A;  2KR7 A;  4TW8 A;  2KGJ A;  2ZQT A;  2KFW A;  3TCZ A;  4DWS B;  4DRJ A;  3PR9 A;  3B7X A;  2AWG A;  3AS2 A;  2G8Z A;  1E15 A;  2ZR5 A;  5D75 A;  5JH8 A;  2DSV A;  2FAP A;  1UR9 A;  4DWS D;  1C9H A;  4DRM A;  1XHG A;  1FKB A;  3RME A;  4MPK A;  3ARZ A;  3O5D A;  1LG1 A;  2Y78 A;  2B31 A;  1LG2 A;  4JFJ A;  4JFK A;  4R5E A;  3IK8 A;  3RFW A;  3KAD A;  2LKN A;  3WL0 A;  4IT6 A;  3WIJ A;  1OWQ A;  4FN2 A;  4FAP A;  1FKR A;  3O5J A;  2YBU A;  3W4R A;  2WLZ A;  2ESC A;  3ARU A;  2OLH A;  4W5U A;  3B9E A;  1EYM A;  2PBC A;  1B6C A;  1U79 A;  3KAH A;  4ODK A;  1JVW A;  4N19 A;  4P8V A;  4WKF A;  3CGN A;  4NNR A;  4DWS A;  1T11 A;  3IHZ A;  3PRB A;  1KT0 A;  1ROT A;  1UR8 A;  2QF8 A;  4ML4 A;  2DSU A;  3O5Q A;  2D9F A;  4JFI A;  3LUO A;  5HW6 A;  2DG9 A;  4U85 A;  5B8I C;  2XP5 A;  4Z2H A;  1FFQ A;  5HWC A;  1NSG A;  1FKD A;  1KFW A;  2MLX A;  2XP8 A;  3ARX A;  3CHE A;  3WL1 A;  1LJY A;  1FKG A;  3H9R B;  3KAI A;  1E6Z A;  3ARV A;  2K8I A;  3UF8 A;  4Z2K A;  3RM9 A;  1W9P A;  3O5L A;  4XAK A;  1FKS A;  3WKZ A;  3QOK A;  4BF8 A;  4DRK A;  1EQ3 A;  1ITX A;  3CHD A;  1LL4 A;  4DZ3 A;  1WAW A;  4QT3 A;  4IPX A;  1Y0O A;  1HJX A;  4JFL A;  4Z2J A;  4TW7 A;  1WNO A;  3O5K A;  2FDM A;  3WD0 A;  2XP4 A;  1GPF A;  2VCD A;  1E6N A;  1NWS A;  4WKH A;  4HAR A;  1ZBW A;  3GPK A;  1HKK A;  4LAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...