3O5TB

Structure of drag-glnz complex with adp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
100
Chain Sequence
MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dinitrogenase reductase activacting glicohydrolase
publication title Crystal structure of the GlnZ-DraG complex reveals a different form of PII-target interaction
pubmed doi rcsb
source organism Azospirillum brasilense
molecule tags Hydrolase/transcription
total genus 23
structure length 100
sequence length 112
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o5tB00
1NH7A 1UFLA 2J9DE 3AH6A 3O5TB 2RD5C 1Q1KA 4Y65A 2XZWA 1VHFA 3NCPA 1VFJA 2EG1A 2V5HG 4CO4A 4C3KA 4CO2A 2O67A 2GNKA 1PILA 5L9NA 4OZLA 1UKUA 3M05A 4IYQA 1QY7A 4RWWA 5D4PA 1OSCA 2PIIA 5D4OA 4D3HA 1GNKA 2ZFHA 2VD3A 2NUHA 3AHPA 1V6HA 1V3SA 2DCLA 3X3UA 3HLUA 1XK8A 3CE8A 5D4NA 3DFEA 4NYOA 1V9OA 4OZJA 4RX6A 2NUUG 4YB7A 4OZNA 3TA0A 2NS1B 2ZOMA 1NZAA 1O51A 4CO3A 3LF0A 2GW8A 5D4LA 4C3MA 2O66A 2EG2A 4CO0A 1UL3A 1O5JA 4CO1A 1KR4A 4USIA 3BZQA 3T9ZA 3N5BA 2CZ4A 3NCQA 4D3GA 1NAQA 4WK1A 1UMJA 4USHA 1HWUA 4YB5A 3NCRA 3AA8A 1V3RA 2J9DA 3AA9A 1NH8A 4CNZA 2J9EA 3O8WA 5DS7A 2XULA 2J9CA 2Z0GA 1J2VA 2XG8A 4CNYA 3L7PA 4WK3A 3TA2A 4R25A 3TA1A 4CO5A 3OPKA 3MHYA 4RLEA 4ZK7M 1P1LA 4RWXA 4Y6IA 4E98A 4NYPA 4USJC 5DRKA 4AFFA 2GX8A 3GSDA 2XBPA 1H3DA 4YB6A 2JJ4D 4C3LA 2E66A
chains in the Genus database with same CATH superfamily
3MM6A 2E7XA 1NSQA 3MEGA 3HFKA 4X66F 1U2CA 4EZ6A 3DOMA 1IR1A 2J76E 5LSLA 3HD2A 1HNXF 4DWIA 2WBRA 1G6BA 1B70B 1VC0A 2ATCB 1OSCA 4LBIA 2CXEA 1FERA 1NK0A 4I67A 3V6JA 1JQGA 2CPFA 3MOZA 1FTCA 2ZOMA 2KHDA 2GVDB 2H4YB 3A3PB 2MY8A 1W7WA 3J81j 3G4SS 2BM1A 1CSJA 2E5JA 4ED5A 1DURA 2W2NP 4P72A 3QT8A 1XMOJ 3PEJA 3K17A 2VFTA 3KK2A 1ZS6A 2CQBA 1M0SA 3G2XA 2V34A 1HBUB 1UEKA 2HVEA 1VBXA 2P9CA 5KFJA 4LF4F 1ZTTA 2CNLB 3V2UC 3JSMB 3M6XA 2I5JA 1FI4A 2F8EX 1LW0B 2DGTA 2XYPB 4RWXA 3QMQA 2C2EA 2DHGA 2M8HA 1F6TA 5DRKA 5IZHA 4NLWA 2MPUA 2JLFA 3D66A 4K4XA 2NXJA 3EJMA 3A8IA 3V81B 1IKYA 2D9OA 1SKUB 1Q86T 1ACMB 4FYWB 1W26A 3ZZTA 3M8RA 3R8YA 2PMHA 3T6JA 3TZWA 3PKMA 3EZOA 5IT9Y 3BGRB 4W90B 5H9FK 2Q6CA 4AYBD 3P4UB 1RT6A 5ETKA 1WACA 4IO9Q 3G8SA 2CYYA 4Y00A 2CQDA 2O66A 3GR1A 1UL3A 1UW9A 4MT1A 3FCHA 3KLHA 2OFHX 2RB7A 4OI0A 1WG1A 5ETMA 5A76A 3F73A 1DLOB 3WX4A 3FMBA 2ZC3A 3H4DA 2X3DA 5CYQB 1I94J 2RH3A 2Z57B 4PRFA 4M5KA 2HGMA 2R7SA 4USVA 5C42A 2UUCF 1OIAA 4FS1A 4ZP8A 2X51A 3M32B 3NOCA 5LSOA 1HHTP 1REVA 3IMQJ 2XSJB 4DMZA 2YWKA 1CJTB 3RAMA 4AQYJ 1S0VA 2ZBIA 3MGJA 1MU2A 2L41A 3TJAA 4DUYJ 1PSDA 2VHGA 3OFFA 5HO4A 1BQMA 2OPQA 3M4XA 5IC6B 3BN4A 1G1XA 4YS2A 5IV4A 3VTIA 5ETNA 3CCES 4Y0FA 4DCPB 4JI1J 4N8NA 3ZZRA 2K7JA 2UUBJ 3W2WB 4F8RA 3CC2S 5CAAA 4X84A 4MKBA 2CZ4A 1WUUA 2ZZNA 2ABYA 2MKSA 2CPEA 4WK1A 4QYZJ 3S1TA 4IFVA 2OPRA 2DR6A 5K20B 1KVJA 5KG6A 3PRDA 3DRPA 4ZHRA 1U26A 3IBFB 2YWEA 4LFCJ 1FRLA 3LPYA 2ILZA 1UEVA 4CLWA 1HBNA 3H5SA 4B3MJ 2HSEB 3HSZA 4QW9A 2YKNB 4QCLA 3FCVA 1FKAF 2HFUA 3DDIA 4NE9C 5HATA 3I6PA 1RYRA 3TEHB 3GB0A 2XO6A 4G1QA 1C4AA 2VG7B 5KFDA 4ANEA 1JJ2R 4HI2A 2Y8YA 1MW7A 5A8KB 2W4CA 4HR2A 4KSEB 3ZXWA 4B08A 3H42A 5HROB 2WVFA 3DMJA 5JXSA 2HURA 1I1GA 1RT2B 3MPDA 5E33A 3B4MA 4Y2MA 4MK8A 2G13A 3FGVA 4PPZA 3GJSB 3RRHA 1SC3B 3BBCA 1R31A 1MSWD 1RT5A 4NXMF 1Q8BA 4DR5J 1S79A 1WHWA 4B9VA 5THWA 3DC2A 1KQGB 4KC5A 2PGCA 1YIJS 2D3O1 2MZSA 3MECA 5IM0A 4DCJB 4JV2A 2V9WA 1E6VA 2KM8C 2AYMA 1PBUA 1HW9A 3J7YI 3GMGA 5DJBA 3DI6A 2WONA 1Y5LB 1FVSA 1H3DA 4NL5A 2BJDA 3MM8A 5I3PA 2W9BA 1HQUB 4B02A 4QPTA 2D3OR 4FF3A 4A8QA 1QLNA 2DNGA 2B5JA 3BREA 1CS4A 2HS4A 1C4CA 1F3FA 2AEJA 3IR6B 3EZUA 2E5IA 2VA3A 4KKOA 2R2SA 2YBVA 2IC3B 3D1QA 4I2PA 4OZ1A 3KUHA 1HWIA 2QYGA 4C3MA 2FY8A 4PKDB 1OO0B 1JLEA 2GHWA 4IG3B 1S99A 4NOHA 4RU9A 1L5UA 4Y28C 3BPSP 1BMQB 2BW7A 2HKEA 2ZH3A 3CCWA 5F8LA 4FYXB 3MM5B 1Q82T 3E2EA 2CG4A 5DDPC 2ZHOA 2D41A 3L7OA 1UVLA 1XNQF 4HHJA 2XS2A 5F8JA 4DL7A 3K57A 1UVNA 3GFHA 1BHNA 1WSVA 2W24A 2UVVA 3L7UA 4FYDA 5L38A 3ZZUA 2NQPA 1VBZA 4QPXA 2ZWOA 2ZHBA 2VODA 1BLUA 2IVMA 3ET6B 1T9UA 2KKHA 2XYHB 4AXIA 1V3ZA 3RYLA 3TJ8A 1M5HA 3MR5A 1S77D 1S1TA 4LREA 3GWCA 2GAHC 1ZYQA 4JYAJ 4M5HA 2XLIA 1HQEA 2RQMA 3MR3A 4CO3A 2MQ8A 1UZDA 1X9SA 5KG1A 3KLEB 1SBRA 4GVLA 2W8KA 2FZGB 1IVZA 1GMWA 3K59A 1S7HA 3FDSA 4DL4A 3CD5A 1T7PA 4A8XA 3H59A 1NH8A 2KB2A 2F8MA 2ZOFA 5JVHQ 2E29A 3A8EA 2AF6A 2CQHA 3NG8A 4OYAA 3KJFB 1WC5A 4WFZA 3DDKA 4RLEA 5E2QA 2LEAA 3Q8SB 1IKWB 4RW7B 3WDOA 4Z37A 3NLCA 4MFBB 4DG1B 2V4JA 2UXDF 2GJFA 1NDLA 1SQGA 4C8NA 5FJ4A 1H74A 1B7YB 4ZP7A 4LBPA 1J5EJ 5B0BA 2AYBA 4KGXB 2K3KA 3KK3B 2IFXA 1XJWB 3K7RA 4IDKB 1XNRJ 4ES3A 2ERRA 3UCUP 2MKHA 1RBOB 4HHUA 3R6GB 3QGIA 1KOHA 9ATCB 4JI0J 3DGPB 3WZ0A 4NCAA 5H9EK 1D9DA 3FK4A 1WHYA 5HJYA 1HW8A 4DR4F 4KJIA 2FLLA 2EW9A 4LSZB 4QWAA 1G4CA 4RKUC 3H7HB 1YWXA 4DOZA 2HQ3A 2AV5A 4ZVRB 1XERA 1RACB 3HF5A 1F60B 1RT3A 2HFOA 1KONA 1U24A 2V2ZA 1S59A 3JTPA 3I5BA 2C2OB 4DPWA 1T9TA 4ECQA 1K0VA 4LSLA 4R0EA 1S76D 1GTHA 2V8DA 4CLLA 5HBMB 2ALYB 2XZWA 1MN7A 4OX9F 2MMYA 4H4KC 1YLXA 4J9VA 2LYVA 2HHSA 2DT9A 5J1PA 3ONQA 1DQ9A 3RGIA 1U6BA 1QE1A 3ZTPA 1YBTA 5F3ZA 3CDEA 1PAEX 3LP2B 4EEYA 4DR1F 3W3SA 2EBGA 1WD6A 4USKA 3DM2B 2YKMA 3RAQA 1FJGJ 4URQU 1PGZA 2MZTA 4Q8FA 1Q79A 3G6YA 1M1KT 5KG0A 5HQLA 2OD6A 1FKPA 1P1TA 2WB1D 2AX1A 5EDWA 4UF4A 5B0DA 4Y3CA 1WDDA 2C3YA 4DQSA 4I7FB 4RW4A 2KJVA 1OY6A 2HRUA 3OL9A 2WZ1A 4B9MA 2BM0A 4ZIWA 4DJBA 2H4WB 5KG4A 2V4QA 1HPZA 3H2VE 4LF6F 2X1GA 2WHOA 3KKFA 3D67A 5HLFB 4JP8A 3ZC4A 2K1RA 2Q3PA 3DOKB 2YQ3A 2EFOA 1RHRB 2QC3A 4ZOSA 1RBLA 1TL7B 3IRXA 1LWEB 4J90A 2CQCA 2FIUA 3MI7X 2KT5A 2UUAF 4NLYA 3BO2A 4JI5J 2CPZA 4RX6A 3I0SA 2CJQA 1RTJB 2IM0A 1EQ0A 5I42B 3CJ3A 1N54B 1W2BR 5B0GA 2ZUGA 4DDFA 3DGVA 3TAPA 2B3TB 5E5NA 3WHIA 3N5BA 3UI3A 4CLFA 2ZITA 5CD4A 5J2QA 3JSBA 2Q79A 4DV1F 2AGQA 1VK8A 5CZXA 3Q2TC 4ZMMA 3Q2SC 2FZKB 2J6TA 3VAKA 3KLGB 3DU5A 4J9UE 1FWKA 3MUMP 4OI3A 2QE5A 3D1OA 4DS5A 2NREA 4RBVA 4V19X 3QT7A 2FHKA 2PA3A 4TY8A 3QJJA 3LP0B 3FEZA 1FVQA 2RRAA 2GA7A 1QAXA 4NI2B 2F3JA 1BQXA 2KG1A 2KFNA 3JB9k 3C16B 2OJ3A 3AQOA 3SDEA 4DSKA 2HS3A 2JC1A 5F8NA 5KG7A 1CQMA 4ED2A 3F56A 1TAUA 2J0SD 2DGSA 1VDHA 1WF1A 5IQ6A 3PFEA 2DNMA 1WEYA 2A6OA 4YQWA 3MTJA 1YK9A 2HMIB 4ELVA 3NGRA 1MLAA 2XHCA 3MEDB 3VALA 2HBYB 3IGVA 1FJEB 4JI4J 3N6NA 4YDDB 2F9JA 4RL1A 4QIWD 1T95A 1WC6A 2BJ9A 1NJZA 1U6FA 2YNGA 4DZDA 4RW8A 5T7LB 4KT0C 2C2KB 2DGUA 2XO7A 5KG2A 5U47A 1WI6A 2FLOA 3AB2B 1H98A 4F4KA 1FDAA 4LFAF 2Y1LB 1MWQA 4TU9A 4OYMA 2U2FA 3S01A 3GG0A 2XY7A 5KFNA 4KHPJ 2DK2A 2HVIA 4I2QB 1GNKA 1RWXB 1F5AA 2FYXA 2QYCA 1PJ7A 1DTQA 3VAFA 1GQEA 4FYYB 2EFVA 3TA0A 4DL6A 1RTDB 3GR0A 2IM2A 4YR2A 1X8DA 3BR9A 3T9ZA 3DLEA 4A4JA 4QU6A 3FBEA 2GAGC 4CLTA 1SJ1A 2C3UA 4KRWA 2HNYB 1FXLA 2MZQA 4DV2F 4QIVA 2I1RA 3IRWP 3ISNC 5B09A 2HHPA 3C19A 1HLWA 3O3LA 2R2TA 4LF8F 3MAQA 3G6XA 3K8VA 1T05A 2GIQA 1KDNA 2ZVSA 5AXLA 5JMNA 2DHXA 5C5JA 2R7TA 3CCTA 3HHLD 3MMCB 2D7SA 1G3OA 2EG1A 2DHAA 1U48A 1SB6A 2FJAB 2M0GB 4EBEA 1TUWA 2OEMA 3O2IA 1RJJA 2DRBA 4DS4A 2C3MA 4X4NA 2V4RA 3GYGA 2H5JB 4V1Ak 1PO6A 1RHMB 3C6UB 3VGVA 1V9OA 4OYIA 2JL9A 4NLUA 5G0RB 3C6TA 2R2UA 3TO8A 2AGPA 4WKRA 1RSCA 4HEA9 4ECZA 2KZZA 4AL6A 2LA6A 3C46A 2DRAA 3RZAA 1YBAA 2ZVIA 5LJ3Y 3K58A 3G8QA 2DR5A 2DR9A 3MR7A 3Q23A 1S0NA 2MKIA 4ZPAA 4DL0C 5M2RA 4CNZA 1JLGB 2WVBA 4HVZA 3RUBL 3K2YA 2M88A 3WX8A 2PMZD 5IQQA 4QBUA 4K4VA 4GKKJ 1JKHA 1RISA 1TR0A 3IWNC 2V94A 3OR2A 4A8KA 1T94A 1RWNB 1KKHA 3AXKA 1REVB 1F9FA 4RZRA 4M5IA 1U1RA 4BHQA 4FPIA 4K8RA 3CO9A 4Q45A 2RKIB 3H5XA 2HNZB 2ZNYA 1KLMA 2JHEA 1LWFA 1L3UA 1Q5VA 5FIIA 4FDFA 1VBYA 4RUBA 2AW0A 2OTLS 2OH2A 3PX6A 1L3KA 4F36A 2B4OA 1JLAA 2XWYA 1TV6B 4OZJA 5GMKa 3WQPA 4DUZF 2MB0B 4ITSA 5KFFA 4WU3A 4PWUA 5D4LA 2ROGA 1CLFA 2QA4S 5ITHA 2XCPA 2DCUB 4ECVA 3KUEA 3M30B 4U7CA 4O4RA 3FFIB 2PFDA 2LU2A 1WEZA 3O6QA 3RB4A 2GZOA 1NJIT 3OV7A 2CZVC 2EFPA 1HBNB 5K8PA 3TUPA 1BUXA 1WOOA 2C42A 4IQMA 1WHVA 4H4OB 3ZNJ1 2VDHA 3JSYA 1JLQB 3BDEA 1Q95G 1WKJA 4KH1B 3SV3A 3M2RA 3I0RB 1S6UA 2DXEA 3M8SA 3TP2A 4IKAA 3UDCA 1XBWA 2RQKA 4R5PB 1S9EB 4KGZB 1U1OA 2GMJA 1KRPA 4ECWA 2FY1A 3CUNA 2QV6A 1RAGB 2E7WA 4P10A 1VQ6S 1FWPA 1K1SA 3Q89A 1Q8KA 4X4TA 3UD3P 3SIPB 1XWLA 2RU9A 2QEXS 2XLKA 4BC7A 5KFKA 3PO4A 2I9SA 4QIGA 1NNDA 3KJVB 1FKOB 1N56A 3VAGA 2XY5A 4P9SA 1TL1A 2C2RA 4NLDA 2LQ8A 2FHMA 4HH0A 1TKTB 5EUHA 1X31C 2P5VA 4W98A 2P6TA 4YHHJ 5LMUF 3CMQA 4IFYB 5CQGA 5EX3A 4DPOA 2PI5A 4UQTA 1A7GE 3WIUA 3MD1A 3J7Z5 1SC4B 3Q86A 4W4MA 4FXVA 1VBKA 2GCFA 3I9V9 2FJXA 3TUJC 1MN9A 3MMAA 4FXWA 3D2WA 3I32A 3DKDA 2W9BB 3KLIB 5F8MA 3HVAA 1HNZJ 2EK6A 1HD0A 1EQMA 4ZVSB 1FTRA 2B5JB 2O3DA 1PILA 1C0TA 2UXBJ 3EPGA 2PO4A 3LW5C 3M05A 4YDXA 5KT5A 3V4MA 4C2MA 4X2BA 4P73A 2MZJA 3IP0A 1LNQA 1RT1A 1YDLA 3SFGA 3OL6A 2PD1A 1N36F 3B54A 5ETLA 2R7UA 2CG8A 1S6PB 3BSNA 4CQ1A 3ITHA 4ANDA 2WVDA 4ZJOA 3BR8A 2DGOA 2HFVA 4EBDA 2HLUA 3K5LA 4KGMA 4JV1A 1QM9A 3DNCA 3SCLE 4M95A 4HTJA 5DGBA 1HD1A 3TR5A 3G71S 3M9OB 2DVIA 3OPKA 3KYLA 5AXMA 1CULA 4YB1P 1GK8A 2J0WA 1DHMA 5A8WA 5C25B 4DEZA 2H3EB 4LF7F 1LK7A 2VOPA 2XC9A 1P9YA 1VHFA 4AD6A 2R7OA 2BXJA 2GMHA 1HBMB 1HBOA 1HR0F 3J81U 1CVJA 1SL2A 2XMVA 2BE2A 3PEHA 3M7VA 1VQ8S 3CCLS 2BQRA 3P5BP 3UR3C 3P6YC 2RJZA 1K73T 1X4EA 3A3NB 1N5YA 3VAJA 3QT6A 3EXCX 1U0HB 1ZPVA 2ASDA 1VQOS 2QMXA 3R7SB 1H0HB 1VQ7S 2Z4PA 1CBKA 1S48A 1GXUA 2P6SA 5DZ7A 2ROEA 3OFHA 1HA1A 3SEOA 2FJDB 2KM8B 1OMSA 3T5LA 1WI8A 3W2VB 4NMXA 5AE1A 5IC4B 3NAIA 3PJ9A 4ECSA 1F9HA 2DNKA 3UO0A 3GIMA 1DTTA 2GHPA 1CQNA 1WC4A 4PG4A 2ZM6F 1NSPA 5KT6A 4NLRA 2J8SA 3CDWA 4NZ7A 5ETVA 5A2QU 1RLCL 3N79A 3Q24A 2DR8A 3I82A 4USTA 2YKPA 3M1VB 3BF4A 2HHHJ 3G82A 2M52A 1TL4A 4O44A 4WU2A 1TMMA 3D68A 5KT3A 1RLDA 4U67Q 5KOWA 4IOCQ 3PG9A 3NBPB 2ASYA 4DR2J 3KK1A 2W9CA 2VJVA 2HAFA 1L3TA 1UPMB 2AZ1A 3X1LB 3MDFA 3THVA 2JWNA 3CJKA 4YR0A 2MDAA 2AWZA 2B51A 5LL6d 3P8BB 1F9EB 3PYFA 4NMLA 1T9YA 3KNGA 1VLYA 2KXNB 4QWEA 4MH8A 2YWFA 2AX0A 3TNVA 4O3NA 1QAJA 2CADA 2Z0GA 4X65F 2FUG9 3GU0A 2Z56B 1RB0A 3VZIA 3HO1A 3RB3A 3RRKA 1TVRB 2EBEA 1FXRA 4XDDA 3KHRA 1AFJA 1LWXA 3LALA 3C14B 4K7QA 4YB6A 4KO0B 3IBWA 3AH6A 4TNOA 3CSKA 1VCTA 1NK4A 1ZAVA 2L9WA 3Q8RB 1JXEA 2JNJA 1U49A 4ED3A 2CQ2A 1WEXA 4YY3J 3TZXA 3GCWP 1QE1B 1Y11A 3IR5B 2CQGA 4U9RA 1NJYA 3SQGB 4KB7A 2FHJD 3QLHB 4DQQA 1RA7A 4RNOA 4B9TA 2JEGA 2F8HA 1LFWA 3U1NA 3FRYA 3QAEA 2LKZA 3GPAA 1EAYC 1WC0A 2CPJA 5KFTA 3G6ES 2D3ZA 1U47A 2RDDA 2ZOGA 2XMKA 1NAQA 2RNEA 2QA1A 2J7WA 3MEEB 1EKSA 3LTOA 2E7VA 4O3PA 3KMQA 4LR7A 5JJBA 4ZPTR 2G0IA 3CMAS 1VIXA 4DUTA 5BYQA 2B4VA 2DKOB 4DPXA 4PG8A 5J2PB 3H98A 2KZMA 2AIRB 5DETA 2DNYA 1VRUB 1SJRA 5B0AA 3ISZA 3TYTA 1KTQA 4KV8A 1UETA 2C2DA 2ZNZA 3I9ZA 4PQUB 2OPPB 3HHDA 2I6WA 2JVRA 2GVZB 2YWWA 3CCUS 2E1MC 3CJ2A 4JI6J 1RE1B 3SXLA 5SZTA 2MGZB 1HNIA 1KQSR 2RT3A 2EC0A 5HAOA 1VIOA 1B64A 3K0JA 1A0OB 2MKYA 4ZVOB 3G87A 1YI2S 4F02A 2DH9A 1URRA 2GO8A 3DXBA 1OPZA 3TZZA 1C2PA 4DL5A 2NUUG 5A0YA 4OZ3A 2K06A 4DV0J 3TW0A 4RUHA 5LSRA 2V8GA 4O3RA 4EZ9A 4RW9A 2ZH1A 2W2QP 5J2QB 3MUVP 1BQNA 1JK9B 4NX9A 4WE1A 3QZ8A 1CPZA 3BGFA 2BKOA 2GIFA 3SQOP 2HQIA 3T1YJ 1OJ4A 1MMNA 1QUPA 4ZVGA 4Z7CA 2QMWA 4Q43A 4P2XA 3I31A 1SC6A 1UTAA 2BV3A 1YG0A 4UOFA 4WBFA 2KXHA 3V4IB 2HVDA 3BYRA 1OY9A 3ADAC 4AL7A 4WJBA 3EPIA 2QLXA 5LMNF 1A6LA 5DM7Q 4OYZA 4OYXA 5C24A 2GFFA 3W5XA 4WYWA 2RF2A 2DXDA 1C0UB 2R7QA 2NSBA 4MJKA 1FFSB 2POKA 1H73A 3NNCA 2R2RA 4ECUA 1HHQA 3VGUA 3SSQA 1NXIA 4YP3A 1DY3A 3MWBA 4EK2A 3V6DA 2ADBA 2Z58B 2XLJA 2AD9A 1D8YA 3HVTB 4EO8A 2UVWA 4JI8F 2N3LA 5L39A 3W1YC 2F1FA 9RUBA 5KFUA 5HP1B 1FK9A 1J5OA 4YOEA 3CD0A 4DR6J 2FGOA 1JXLA 4DV3J 1FA0A 4EYIB 2BABA 3D9BA 3BQ1A 5T14A 2Z30B 4CH7A 4FS2A 1O8BA 1KLNA 2OPSB 1FWLA 3CT9A 3CJ8A 3QSIA 2CQ0A 3KTQA 3E51A 4WKYA 4B9SA 5KFWA 4TN2A 1KQKA 1TK5A 4DSJA 2IRUA 3KHGA 3LAKA 4NA3A 1CC7A 1KNZA 2PFFB 2UVUA 4C8LA 2E9TA 1GTEA 4MKVA 2ASLA 4OI4A 1U8WA 4DL3A 3QO9A 4DR7F 3H4BA 4LQ9A 2IAJB 4FF4A 3L3CA 2JEIA 5KFGA 1WC3A 3FJ2A 4IH7A 3OFGA 1A9NB 2NYHA 3D3CJ 5KFEA 1FRJA 1WC1A 4C8ZA 4CP5A 3KLFB 1U1MA 3VF0B 2HIYA 1SH0A 5FDLB 5E3PA 1FD8A 4R25A 4IOBA 3CNQP 2W7OA 2WW8A 1S0OA 3BPDA 3EVWA 1CJVB 4UUWA 3DRXA 3OVAA 3OBIA 5K8MA 1HYSB 4ZITA 1Y5NB 3SI8A 1FJ7A 1T03A 4IQXA 2E5HA 3D1HA 1EETB 2B7CB 5K5MA 1PC5A 3QFHA 2LP4A 3AXMA 5GMDA 1WKLA 1FEHA 3K5PA 4X4VA 2E1PA 3MPYA 4NXNJ 3BH6B 1QVFR 2ZJRQ 2PE8A 3T5JA 2WBMA 4DU7A 2IDLA 4PWDB 1ZM9A 1H72C 3VQTA 2YNIA 1CJUA 2ZBPA 2F65A 3FBFA 3QIPB 1N6QB 1UWAA 3I56S 5CYMB 2HNDB 4NLSA 2XQCA 3U27A 4Q7AA 3M8PA 3M2UA 2VFRA 4F4AA 5I3UB 1R6YA 2VZ9A 4U8VA 2XS7A 4XDCA 5D8HB 3KFWX 1RTHB 5KT7A 5CA5A 1S1XA 3FZBA 4PUOB 1PAUB 1JIHA 1JKHB 3UNGC 3MPWA 1RAFB 3PNIA 1X9WA 5E3AA 4MTPA 3J81Y 2A18A 1RCOB 4DN9A 2W9AA 1T02A 2Z2MA 8AT1B 2XMMA 5AJ3J 2VC1A 4YUDA 1WSRA 2HHVA 1XIQA 3IG1B 4KYZA 4J5OA 2W2OP 2WK4A 2KRBA 3BO4A 3CCJS 2ZDPA 5CYJA 1HNVA 4ZCKA 3NMAA 3M8ZA 1YQHA 2MQMA 3LWLA 2HZVA 1YITS 1VC5A 4OFZA 4O0NA 4K4ZA 1VQ9S 1B4SA 4P2MA 3C2PA 4QR1A 1PIEA 3MZIA 1KN6A 3OSPA 3MM9A 4LQ3A 4DV4F 2AQ4A 1OPIA 2NXEA 2X1BA 1SJ3P 5KFRA 2M8DB 4WCEQ 3PO5A 2BQUA 4O3OA 1P8GA 4ANCA 1KFSA 4C9DA 4J37A 3MR6A 5F41A 4F26A 5J2NB 4NLVA 5K14B 2FVPA 1IM4A 4I56A 1AZSB 4DR3J 3GONA 3MMBA 1GAOA 3E01A 1JB0C 4LR9A 3MURP 4K2JA 2Q43A 2FJWA 1PJ5A 1SL0A 1RABB 3P45B 4A8WA 3BKTA 3OSNA 2PI4A 2MKJA 2CJKA 4OZLA 4MKYA 4ZP6A 4K4YA 2BKNA 2CPDA 4AE5A 4C7QA 2HFSA 3H20A 3LUYA 4DFKA 3VVTA 2VF3A 3LWMA 1YZ7A 4GKJJ 4N47A 1S5ZA 2B6AA 1RWOB 1U1KA 4NEYA 3IAM9 4W92B 2CQ4A 4TYBA 3OR1A 3UE2A 2BRKA 3Q8VA 4L76A 2HWHA 4ZP9A 3BQ0A 4IG0A 1C1BB 2GIRA 2BJ8A 2KO1A 4WPAA 2HS0A 3H2UB 4C0BA 1YHQS 4WP9A 3M2VA 3SCJE 4B3TF 3G8TA 1KWMA 3GSIA 2B9XA 2M4MA 3UDLA 3QJLA 2YNHB 5SUHA 2HWIA 3DYAA 3DRRB 2WCXA 3NGDA 4X4OA 2UUWA 3KXDA 3ZO7A 1FRHA 2RUSA 3MUTP 2KFZA 4M1KA 2V68A 2IYIA 4ID5A 2B8QA 1JLBA 3F0NA 4KE5A 2W8LA 5KFSA 1R8BA 1SH2A 5IT0A 2CJ9A 2QO3A 2ZH8A 2EC2A 1R0AB 1K8AT 1HIYA 2GS8A 2R3VA 5IV3A 2DNQA 2JFDA 5B0EA 4KR0B 3DLJA 2ZD1A 2B7BB 2MLYA 2ZH9A 4TXSA 1KC8T 3AFGA 3HPOA 4X4RA 2QL9B 1N32J 1PYOB 2DH7A 5KFAA 4DPUA 4DV6J 1SQFA 6FD1A 2VG6A 2H65B 1TUVA 1R3NA 1RQ0A 1B0TA 3MEKA 7FDRA 1PC4A 2KVIA 4MYTA 1QUVA 2VPXB 2BVZA 3OUYA 3CJTA 1H7XA 1S6QB 3CJ5A 3J7AN 4QJVA 3N01A 2E5GA 2VQFJ 2HHTA 4CTAA 2CVIA 2M2BA 5KAKA 2KG0A 4NA2A 1S9FA 3TJ9A 4EBCA 1DBDA 2VA2A 3BB5A 3HVWA 2GNKA 5A8RA 2BE2B 3VVUA 4UZBA 2R42A 1UVIA 4MK9A 1KFDA 5D4OA 4GVBA 4M5DA 3PYGA 2VG5A 2AJ1A 1XC9A 5GADU 4X64J 1JLFB 4YFUA 1Q78A 4CH0S 2BE9B 4OZNA 4G1PA 1FX4A 1NZAA 3THTA 4ER8A 3OHBA 2BOAA 4UOHA 3KG0A 2QFJA 1YJ7A 4F0MA 2CWKA 5D78A 1QSSA 2FQQB 4V19J 5DM6Q 1NO8A 4UT4A 5DLGA 3SMZA 1FDNA 2MZRA 5J1EA 1LW2A 1RT4B 4ED4A 4CNYA 4C11A 3JS9A 3TANA 4B3RF 4AXJA 3VV2B 4DL2A 2HHXA 1YJNS 2V8HA 4B3SF 4EI2A 1EP4B 2V67A 2UVRA 2VUGA 2R7WA 4CYUA 4RNNA 2DY9A 1T3OA 2H48B 2WOMB 4C3KA 2OELA 2DPIA 1AFIA 3V6KA 2YKAA 2AJQA 4RWWA 5ETPA 3S7RA 4D3HA 1U2FA 5D0HA 4E0DA 2OMLA 5E41A 4K0KF 2VIHA 4WTOB 1HNWJ 4PAAA 1FNXH 3RRGA 4RW6B 4BC9A 1RAEB 1N0VC 1VGYA 3OHAA 2P8IA 1WOSA 2CFXA 3TZYA 2OEKA 3TARA 1QSLA 4JI7F 2EI5A 2J0XA 1VQ5S 5L9XA 3HSJA 3CVKA 4LRFA 3Q22A 3PIPQ 5DGAA 3GV8B 4CCHA 2E1RA 3R2CJ 1T9VA 2LECA 1P9QC 2N82B 3DOLA 1U0SA 2C1EB 5HMYA 2R7VA 2PC6A 3EE3A 4DBQA 3ILJA 2VB6A 2QSWA 4X62F 1S1UA 3DLGB 4BDPA 1VJQA 1E6YB 4Y6IA 2MQOA 1XQIA 1SJ4P 4DV5F 1RXOB 3TEGA 3KHHA 2E44A 1JLCA 4KGKA 2XY6A 1QJHA 1TKXB 3QBCA 4F3OA 3HZEA 1YRTA 5BR8F 3HHLA 2JFKA 2X1AA 4QQBA 1PBAA 4H4MA 2CZ9A 1S9GB 2ZJPQ 4U95A 3EICA 2YTCA 2NXUA 3U02A 4E2FB 4M8LA 1JJHA 4OZ0A 4OQJA 3BBFA 1NCLA 4DV7F 2DB1A 3CDBA 4LFBJ 2B9WA 2CRLA 5F8HA 3Q83A 4OLPA 3PRVA 1HI8A 4LJMA 1B3TA 2XNRA 4E8UA 2Y1RI 4OI6A 3PCOB 3CXCR 1TQLA 3ZNUA 2B9YA 2DNHA 1RTIB 1U1QA 4P2FA 4NASA 4HKQA 3IR7B 2GVDA 4N5SA 5DDOC 5F8IA 4QWDA 4J9QA 3M6WA 3OTDA 2SXLA 3JQKA 4F04B 3ENVA 1NPKA 2HRYA 2GC8A 3T3FA 1N48A 3CCRS 1HBUA 2V2KA 4AL5A 4HI1A 1RWMB 2WTFA 5J2MB 5HMXA 4UOGA 4MMOA 1V5VA 3W7BA 1LW0A 4NXNF 2J8AA 3TI0A 1QY7A 3CCVS 1RWPB 2RE1A 5DZ6A 4F4XA 5EN1A 1G7CB 2LDIA 4RNMA 3V81A 4DX5A 2YPYA 1LWCA 1KVIA 4L3NA 4EFAC 3MCOA 2XMTA 4FN5A 5EWFA 1NK5A 1N88A 3GFZA 2A2DA 3UD4P 1Q7YT 3OTEA 2HFNA 1RWUA 5GVQA 3I96A 3BGRA 5ETTA 2YH0A 3B8HA 1NRKA 4MKAA 2QJ3A 4CIOA 4XIUA 2ZH5A 4KAIA 1BWVA 2XI3A 2FTRA 3IC1A 2DNOA 1IBKF 2BX6A 3P96A 3FC9A 2DNPA 1UVKA 2VU5A 1VMBA 3ENWA 1DLOA 2D3UA 2VQEF 2L08A 2VC0A 1RKJA 5CYQA 4CT9A 1LXNA 3HP6A 1QAIA 3M8QB 3KJNB 1GXTA 4CO4A 1CEZA 4ZDNA 1MG7A 2G4BA 2W1BA 2WW4A 1QTMA 2EWHA 3JQJA 3M32A 5B0CA 2XSJA 2LEPA 1JXVA 3HLUA 2IIHA 2ZWPA 5D4NA 3DRSB 5EWGA 4Q0BB 1CJTA 3UCZP 3P3DA 5JUMA 4ICLB 4CLUA 2E1CA 2J6SA 2LQ5A 3CCSS 2AMCB 5K8NA 2H5EA 2HQGA 1YVFA 4Z2XA 5GADI 2ZH4A 1ULRA 3UN5A 4F0KA 3KWMA 4U96A 3OTOJ 1KHWA 1Z1ZA 1RTZA 3IN5A 3SZ2A 3W2WA 2M5YA 3IS9B 2DJWA 2KJWA 2ACYA 5L8RC 4TYAA 5D3GB 4K59A 3T6BA 2ATLA 1VJWA 2FPHX 5KT4A 4X4PA 2Q1LA 1EKRA 2E5LF 2B8PA 2IMOA 4C98A 1FXDA 3JTOA 3PVXA 4DQPA 2UP1A 1F1BB 1FEEA 3HDSA 3D3BJ 2RAQA 5L9NA 1SXLA 1M5PC 1BXNA 3EYZA 1SUQB 3FSYA 3TVZA 2YKNA 2XWXA 3HFZB 4OYBA 1NBEB 1N33J 1NZ8A 5DG7A 5AT1B 3X3UA 1T9XA 2OMOA 3QT5A 2BACA 4KQZA 2VG7A 4FBTA 1O51A 2XNQA 4X66J 3VAHA 4ZVTB 1ICEB 4QR2A 5A8KA 1S6OA 2R7RA 3MR2A 1KR4A 5LXRA 1LOUA 1HNXJ 1TK0A 1HWUA 1RT2A 3AA9A 3PR4A 3J7ZT 4WIQA 2KT3A 3OQ2A 3CTRA 3NRBA 2J7UA 4GMKA 2J5AA 1VRTB 1OQ6A 2LVWA 1Q5YA 4O23A 1N34F 4CH1A 4ZVQB 2HQCA 2RS8A 4KY3A 3K5MA 1ZA1B 2G1HA 2PEHA 2JSXA 3JAMU 1X4AA 4CI0B 2HBZB 4N8OA 3UFCX 5BJRA 3EVOA 2DTJA 4ZCLA 1TZ0A 4LF4J 1Q4RA 2Y1JA 2DD8S 1T0TV 1S1VB 4LF9F 2E9RX 4NLTA 1TKZB 3DLKB 4LRAA 3IXQA 4TY9A 4TQSA 1HQUA 4ZS6A 1NDPA 4IO1A 1VLOA 3NS7B 4F3MA 3AD9C 2KN4A 4TU8A 4CM2A 1ROFA 3RU0A 2O1PA 4NCGB 4A48A 4Z7YA 4DX8H 1Q16B 3GILA 5C7PA 2R7XA 2IC3A 4LF2A 1RADB 3R5AA 6FDRA 2MQPA 2UXCF 4I0WA 5IT9U 4WXWA 2BW2A 3HD1A 3PX4A 3WC2A 1HMVB 3KUGA 4XPCA 1J27A 2UU9F 3BBBA 1XMQF 3B6BA 4IG3A 1P1LA 3O1LA 4KTQA 1N5TA 2Y9HA 1VQPS 4HACB 2EFNA 2NSCA 1RU2A 4X4QA 2ZKTA 1M90T 1X4DA 4KFBB 2JJ4D 2F4VF 2HRTA 3QIDA 1IBMF 2NCKL 3MM5A 3J7A1 2ZBRA 1TELA 2OUGA 3GIIA 4M63A 4WZMA 1UFKA 2IPOB 3MFIA 3CC7S 2NUHA 3M6VA 4R8UB 2UUCJ 4GO5X 2F9DA 4AT1B 3UQSA 2HQDA 3AOCA 5IWAF 3ENAA 2G0CA 3MFHA 1ZETA 3ET6A 3PR5B 5KFVA 2K3IA 2IRXA 4LSNB 2MKKA 4WFYA 2HVHA 2LDYA 3QZ7A 1Q53A 4LF1A 4KHMA 3TRGA 5B0FA 3HFVA 3QGPA 3FBBA 3VR1A 4UW2A 4ZPBA 3HULA 4TLRA 1WHXA 4U7UD 1N5QA 1UWBB 2YY3A 4PABA 5KFLA 4OHZA 3PW4A 3S8SA 5FLXY 4JI2F 3W62A 1HWKA 3PW2A 4XPEA 1Y9OA 2FVCA 1M1HA 2MLXA 4IR9A 2VKZG 4F67A 2IBOA 4ETZA 1N5SA 4JV5F 1SV5B 3VZHA 2YX7A 1R7IA 5L46A 3PJWA 4M5GA 1IKWA 3TUIC 3BM7A 4RW7A 1IBLF 4MFBA 4DG1A 2GHVC 2XMAA 2NPFA 3T1HF 2DXFA 3W66A 4QOTA 2FHJA 1F0XA 4LMZA 3DFEA 4F3QA 2Z2ZA 1GEHA 3TAMB 3KK3A 5HMZA 2ZDOA 1X5PA 4IDKA 1FE4A 4QYZK 3GYXB 1WORA 3QNWB 1U8SA 3FKBA 4FF2A 3DGPA 2R9LA 1W2IA 4MIWA 2M3DA 4J9OA 1IWAA 3RBZA 1HWLA 3M2VB 4ID8A 1WOPA 4K5RA 3FCWA 3MM7B 3D6TB 3HMJG 3R6LB 1GT8A 3ISND 2FZCB 3JYTB 3DYAB 2GMLA 1ZZFA 4ED1A 2DY1A 4NXMJ 5HK4A 4WP3A 3PJXA 4ZVUB 1VHIA 5K8OA 3UN3A 2GJ2A 5GAGU 1XMOF 3GJRB 4QZVB 4HYKA 3DRYA 1IKXB 1RWVB 4ZJQA 3VHQA 4O4GB 2XS5A 2FB0A 2QRRA 2DCLA 5HBMA 4BBYA 2CNKB 3GIJA 5KT2A 5DQIA 2J7KA 5H9FJ 4B3OB 2FC8A 3AODA 1N5VA 2YNFB 1R8CA 1WF2A 2UV8A 1VS3A 2KL8A 3RW7A 1YZ6A 2VG6B 3CGIA 2A10A 2ZUAA 2VKRA 3LP2A 3BO3A 2BJ3A 3FVYA 3NGUA 4NA1A 3DM2A 3OLBA 3EMTA 4LRBA 1S49A 2YQ0A 3QGGA 2KI2A 2R8HA 4F2RA 5AE3A 5CABA 3KG4A 1KS2A 1Y3KA 4F7VA 4Y34A 4PG7A 1HFEL 1WKKA 4CM0A 1DQAA 4I7FA 4J9PA 2XSFA 2RD5C 3MTKA 3NOGA 1KQFB 1EX8A 1N52B 1YBUA 2DEJA 2BANB 5F9NA 2ZE2B 2RS2A 5HLFA 1XNQJ 2VG5B 3MAHA 4LF5J 3DOKA 2LEBA 1H38A 2QLFB 3HI9A 1I94F 2H5IB 3KG1A 5L1JA 3OTCA 1IKVB 1TL7A 2PA8D 3S6EA 1LWEA 4XK8C 1C1CB 1UEUA 5KG3A 3C15B 4IOAQ 3D54A 1HWJA 3CCZA 1P6TA 4Y2KA 1RTJA 2CIMA 5I42A 1FO1A 4USWA 4AQYF 4OHWA 4QWBA 4PXCA 1TKDA 1TTHB 2ILYA 4DUYF 4NYPA 2LFVA 5ETSA 2XHWA 4AFFA 3RR7A 2QT7A 2P2CB 4C3LA 5AXKA 2PT0A 4PCQA 4F4WA 5KFYA 2FVRA 1RU1A 1PCAA 1UFLA 2OHDA 5IFMA 4JI1F 2AJ2A 4RNHA 5KG5A 1SJQA 2UUBF 2IJRA 3ENQA 3KLGA 3W61A 2YXLA 1X4HA 3UVJA 1LK5A 5HL7Q 2RUGA 4EGLA 2MYFA 2BQ3A 2CJBA 4HLBA 4NI2A 1T3NA 1YJUA 3BSCA 3CE8A 2UXDJ 3LP1B 2M7SA 4WYLA 1VQNS 2NS1B 4LFCF 3C16A 3RG6A 1DZ5A 3SBMA 4J9NA 3RB6A 4B3MF 2DHSA 3K89A 5KFHA 3KNAA 3SSSA 3L95X 1SH3A 4D3GA 1FESA 4LUBA 3KDOA 3HZGA 1R27B 4YN3B 1UAWA 2LCWA 3MM6B 3ILOA 4PG5A 2FVQA 4FVMA 2VBXA 1RGVA 3MEGB 3PYEA 2QL7B 2HMIA 3DOMB 4X4UA 1S1UB 4YEAA 5KTQA 4C48A 1RK8A 2YX4A 4CLKA 1S72S 1RZMA 1F2GA 4DR4J 1D8ZA 2MTLA 1FX2A 3CJQA 2N7CA 4DPYA 4XAKA 3DCAA 4IH6A 1Y0HA 3FUYA 4GC7A 1FRKA 5KFIA 2BBEA 4DR5F 3LAMA 3KK2B 2WAQD 3R7BB 1VOMA 4WFBQ 1WG4A 1SKRA 3J80U 4L75A 4C97A 2DGVA 1B99A 4OX9J 4I2QA 4OIXA 4CT8A 2I5JB 3ELHA 3JQMA 1KSPA 4J9KA 1U1NA 1WELA 4ZVPB 4WIIA 2UZAA 4IRDA 1VYAA 4DR1J 1RTDA 1IKYB 2Y1IA 3JAMY 2IVYA 4OV6A 4XTTA 1QSYA 3D0HE 3UDVA 1K0TA 1NKBA 2YH1A 3OFEA 3NWRA 3RBDA 2HNYA 2OP5A 4JOUA 2MQQA 1RT6B 3A12A 3BGUA 2O67A 2ZH7A 4QIFA 3HM9A 2RDIA 2R8IA 2CQ3A 1FHTA 3KLHB 1IQZA 4LF6J 1KP6A 4DX6A 3M8YA 1LWCB 3KOAA 3R7NB 2N4DA 2YX1A 3CDAA 3MMCA 5GAGI 2E9ZA 4Y2CA 4URGA 4K4TA 4LVOP 1FFWB 1KVKA 2BOPA 3NL0A 1X4CA 3PY8A 4CO0A 1NK7A 2DNRA 3BS9A 2CQPA 1TFWA 1U45A 5C42B 3C6UA 4DF8A 2GGPA 5G0RA 2D9PA 2UUAJ 2IJFA 3DHXA 2EKNA 3I4HX 1TAQA 3TWZA 2I0XA 2XZDB 4NRUA 4WWSA 3D5MA 4ERDA 4A46A 1MU2B 3N28A 1JWWA 2AZ3A 1S0MA 2MJNA 1NHVA 2L9NA 4NLGA 1JLGA 4JYAF 2W4PA 1KBRA 2RSQA 1NHKL 1BQMB 3MPVA 2OPQB 1ZM4A 4L73A 4DV1J 4ZVFA 4FF1A 2A0FB 1VI7A 2DO4A 2AU0A 4OYWA 2DEIA 4OI1A 2KVQE 1EARA 3DXSX 5GAHU 1BY9A 4C8YA 1X5OA 4P52A 4J7CA 4IFVB 2OPRB 4G65A 2IM3A 2H51B 2WSCC 4O0IA 2RKIA 2HNZA 3WBZA 3DRPB 4ZHRB 1IWGA 2HBRB 3GV7B 3MXHP 1FT8A 1VQLS 5H9EJ 2LLZA 2B43A 3ICLA 4K5SA 3CD7A 5LT5A 1TV6A 1UFWA 3N4WA 2J6UA 4KPYA 1J5EF 3BKUA 1K47A 1U02A 2X1FA 5F0UA 2EKYA 2U1AA 1XNRF 4G1QB 4LVNP 2XI2A 3R1LA 2M70A 1XMBA 2YPZA 3IGNA 2HG4A 3PHEA 3M30A 1AXQA 4P75A 1G2EA 4JI0F 1H2VZ 3D6MB 3FFIA 3ZZZA 3CCQS 5FD1A 2CQIA 4ZPDA 3ZTSA 3NNAA 3DMJB 3PM9A 4JBCA 2DGQA 2HK3A 1LKZA 4B9LA 2KT2A 4H4OA 1JLQA 4C0HA 2GQCA 1RT5B 1V3SA 3I0RA 2LMIA 1OYEA 1O0PA 2M9KA 2W7PA 3FEYB 3LGHA 4R5PA 1S9EA 4LFAJ 5F8GA 1BGXT 4B17A 2QTWA 3IBCB 4CO1A 3MECB 4C8OA 2JLGA 5IM0B 5ETOA 4UUXA 2OIHA 3U1MA 1E6VB 4USHA 5D77A 4ZLLA 5HVGA 3DI6B 2WONB 1NSKL 4UTGA 5L1KA 2HBQB 3CJRA 1HI1A 3MM8B 1J2VA 1LEOA 1FKOA 3KJVA 5D0GA 2VBYA 1AB8A 3HKWA 1LFPA 4B9NA 3NS6A 2RRBA 3BJYA 4FXDA 1CS4B 3E8OA 1XEZA 4USMA 4A47A 1TKTA 1TP7A 4O3QA 2VL1A 5KFPA 1Z2LA 1Y10A 4IFYA 1JMTA 3AJ1A 1FJGF 3BSAA 2ZC4A 3W5ZA 4N7TA 3V5RA 4KKOB 3W63A 4M5MA 4I2PB 1UA1A 3BKFA 4DV2J 3OD2A 1U2RA 2W4DA 2RRNA 4ED8A 1YRUA 1JLEB 2JZ5A 4LF8J 3OJSA 4ZN1A 4BLGA 3KLIA 1N0UA 2VPZB 3G6VA 2VICA 2APOA 2V69A 4NPOA 7FD1A 2HQFA 5IS2A 2W2PP 3Q8QB 4ENOA 3TQEA 4URSA 2VFSA 3QAUA 3WIVA 4UY85 4A8OA 1MMLA 3TVKA 5C2CA 1S6PA 4TKTA 4EO6A 1RHUB 4FNIA 3KDNA 2HHQA 4OZ2A 4JI5F 4DLGA 2KHCA 2W01A 1UP1A 1S1TB 4A8SA 2XMJA 3W8GA 4JI3J 1HQEB 2PN6A 3IWLA 3N5FA 1TL5A 5HMWA 4LF5F 2PSZA 5C25A 4OX7A 3C8YA 2FHOB 3K8WA 4DQIA 1VQYA 3W9JA 3QPIA 1VISA 1HBMA 3K5OA 2MXYA 3LGMA 3UDEA 2IM1A 2YWHA 2QGFB 4ZPCA 3QATA 2W2MP 3TQ1A 1IR0A 3PW5A 3Q0AA 3BDPA 2MSSA 2CDQA 1R8HA 2CPYA 2IMWP 4UOCA 4S0MA 3W5YA 2V4JB 1U0HA 5HVHA 2HZCA 2MEWA 2CNNB 4DUZJ 4QR0A 2CPHA 3MCMA 5A6PA 1SIWB 4PR6A 4ED6A 3L4BC 3G9CA 5DG9A 4U6PA 3VWSA 5D0RA 3OL8A 5LXYA 3GV5B 5F3TA 4PG6A 1AROP 5B7WA 3VCDA 1NH7A 1T9WA 3T5KA 2LQJA 3W2VA 2YKOA 2RMLA 3EGNA 1URNA 2F40A 2UV8G 2VH7A 1IXKA 3C3LA 4FVCA 4ZCIA 2ZFHA 4JI4F 2BJEA 2AKWB 4F25A 2IA6A 1RWWB 2C28A 3MD3A 2WSEC 3AY0A 2Y8WA 3HJFA 3GZ7A 4LRDA 5GAHI 1RT3B 3M1VA 3POTA 3BGOP 3SCIE 4F4ZA 1N4LA 2VONA 4WTYA 3BZQA 1PYSB 2LXUA 5KFBA 2BYCA 4BWJA 1ZAXA 3NBPA 3IFEA 4LSLB 1NDCA 3NWGA 3H40A 3CJ4A 2D69A 4MK7A 3C66A 4KHPF 3HT0A 1RAJA 4HDGA 4BCAA 4ZJLA 4DI6A 1GX6A 4C8KA 4J9RA 3RBEA 1XR5A 2CPIA 2JEFA 3GG1A 4NZ6A 4Y65A 1TVRA 4J91A 3GFXA 1D3WA 3T41A 2V5HG 5LMUJ 3AT1B 2YKMB 1YJWS 3C14A 1UKUA 4F50A 3J80Y 1UJ6A 4KO0A 3W65A 1FKPB 2XTJP 1BC6A 3DU6A 1ZPWX 4PYDA 4CLYA 3EGWB 2ZHAA 4UZCA 4RW4B 5HVFA 4P6QA 1X5SA 2VDIA 3CCMS 3PXGa 3SQGA 2DITA 2EXUA 3QLHA 4I6WA 3MCSA 1HPZB 3W9IA 3AA8A 5D6GA 3CD6S 1CJKA 1SJFA 2IHR1 3NEKA 4CWBA 3FNNA 1N36J 1S1WA 4PEOA 2K1RB 5B08A 4OX6A 3CIZA 1NKCA 3QWPA 4HH1A 1FNMA 4E98A 2VASA 3R5CA 3IRXB 3MEEA 8RUCA 4ZVEA 1UZHA 3RR8A 2QA4G 3GLJA 2ALZA 2HWTA 4ZA1A 5J2PA 2AYEA 3I0SB 2VBZA 3QQCD 1VRUA 3N9UC 2LXIA 2KU7A 3OT9A 5KOXA 3FMWA 1FRMA 2KRRA 5HQ8A 1TMJA 3D28A 2EFGA 1IR2A 4ZLPA 4PQUA 2OPPA 2GVZA 2I38A 2MQNA 3BN7A 2MGZA 4LF7J 3KMSA 4GKKF 3SCKE 2RQ4A 4JV0A 1Q8LA 1HR0J 2MQLA 3H2LA 2BDPA 1GXLA 3GYNA 1NJWA 3H0PA 3TVYA 4YB5A 2C3OA 4CLPA 1FCAA 1I51B 4TY8B 4HDHA 1RYSA 1WNEA 4DN0A 4EU0A 1VK3A 2BE7D 2XZTB 4K4WA 5E0OA 1TL3A 3RB0A 3SDEB 1CC8A 4PPDA 1O6XA 1QTNB 4PZVA 2E66A 3T1AA 1H7WA 1Q1KA 1ELOA 4NCBA 4PXDA 2R8KA 3D7SB 4NLPA 3OXFA 5BXIA 1EIYB 1KTVA 2Y3YA 3UVJB 1KHVA 1RAOA 2XGQA 2F7VA 5D4PA 4H4KA 3VGSA 4OLOA 3N6LA 4LIRA 3V4IA 2HGLA 2ZM6J 3CEDA 1RA6A 2G2OA 3BEGB 3OLAA 4WFNQ 2ZZMA 1MROA 2BJ1A 2IJNA 4KPCA 2YNGB 4RW8B 1JJCB 1Y4ZB 2QMUB 1C0UA 3A3OB 3VAMA 3EXYA 4RJVA 2HVZA 2AHOB 3PIOQ 1RDRA 5ADZA 6AT1B 5CCMA 4P2SA 1I5OB 1HARA 2B4UA 4ILLA 2XBPA 1CG2A 3IM8A 4XO0A 5LJ5Y 3HVTA 3O5TB 1DTQB 3HX9A 4X65J 2N7YA 1QVGR 5HP1A 2EEYA 2YVSA 5T41A 3CMES 1MNEA 3D0IE 3MCNA 1DFDA 2P9EA 3DLEB 2B9EA 4YHHF 4GO7X 2OPSA 5F0WA 1SKWA 1R8AA 5BYRA 4Y2IA 3R27A 4L72B 4FYVB 2MZ1A 4I64A 4J9MA 1S7IA 5I3QA 2EK1A 2NLWA 1NPRA 1GMVA 1Y00A 1BE4A 2ZKUA 3LO3A 3G96A 2DRDA 1Y7PA 1SC1B 1UCNA 3ILIA 4KIAA 1T05B 1HNZF 3L09A 2IAJA 1YTYA 3WC0A 4NLQA 2LXFA 1HL6A 2LA4A 1QD1A 1FDBA 2UXBF 1YGYA 4IUFA 3Q8YA 2W7AA 1UJ4A 3CF5Q 1M1GA 1F2HA 3IWXA 1K9MT 3UR0A 3ZZ0A 4RUAA 3JSRA 2V9KA 1RT7A 3KLFA 4QU7A 3DDNA 4M5NA 4KBIA 1UVJA 2OEJA 2V8PA 5FDLA 3NCPA 4RPFA 4UQGA 4ECRA 4N76A 3C6TB 1CJVA 2G9OA 3MOJB 5H1SV 4IRKA 1HYSA 2AP6A 3TX8A 4DCOB 4ED0A 2DO0A 3RW6A 3H25A 4ECXA 2QA2A 2RILA 1EETA 1SI9A 5BYSA 3EGZA 3NNHA 3EM1A 1OYDA 3BSOA 5DG8A 3IAS9 2VJUA 2BZ2A 1S4FA 1WTBA 1N8RT 2E1AA 3BQ2A 1SPBP 3NCRA 4PWDA 3FRZA 1S4EA 3OR2B 3PRBA 1SIZA 2GGPB 1IJEB 4ELUA 1WWHA 3IO1A 3QIPA 1N6QA 2QLJB 5CYMA 2HNDA 4MIAA 3TA1A 5I3UA 3AJDA 1VQKS 1KLMB 1LWFB 2DGWA 1VQMS 4FBUA 4JI3F 1VR6A 1RTHA 3E3XA 3HSDA 1RI7A 3QGHA 1JLAB 4PUOA 2KYXA 3AOAA 3FEXB 1ZBTA 3HT3A 2ADCA 1NB7A 2VV5A 2HYIB 4CDIA 1GH8A 2VD3A 1HKAA 5CH7B 4F4YA 1NEEA 1XR7A 4J9SA 1LQ9A 4KHRA 3DLHA 1X4GA 1DQ8A 1IJFB 3IG1A 3BGLA 5DQGA 3PHTA 1SVDA 2YWGA 5A2QY 5LMNJ 2LQBA 2QX0A 3M9NB 3EX7B 4K2XA 3LANA 1FNOA 2QL5B 1Q8IA 4HL9A 5I4MA 3D0GE 3M2RB 3HJVA 2HHHF 3V6HA 5DDRC 1TU0B 2NYIA 1FRXA 3W64A 3UNYA 4U8YA 3ZTQA 4OL8A 2V2VA 4DR2F 3EDRB 5J2NA 4DFJA 2FD2A 3OXGA 5K14A 1DJ0A 5M2UA 2VPYB 4IH5A 4CO2A 3Q8PB 2IBKA 4OMFG 1AZSA 2QLWA 4JI8J 4EMDA 1LXJA 4NYZA 5KFQA 1ZM3A 2Y0BB 2VFVA 2A2CA 1TL1B 3AOBA 4P7VA 1SL1A 2VBWA 1S10A 1JNRB 3GE9A 2DNNA 4OHYA 1K1QA 1R43A 3H90A 1P27B 2CJAA 2EFQA 2AEFA 2AYGA 2MJUA 1O5JA 4BWMA 3ZTRA 3HVRA 2DR7A 1QDUB 5HANA 2CWXA 1U4BA 3CJSA 3PX0A 3MMAB 4ZCMA 2NXCA 2N3OA 2Q6BA 3HHKA 2XMWA 4DR7J 2RU3A 2BRLA 4YY3F 3PDNA 1C1BA 3F41A 3OXLA 2CKWA 1X7VA 1C0TB 3B4DA 2H9ZA 1JNZB 1GFWB 3EWGA 1HHSA 2ZBCA 2FVSA 4OYOA 1RT1B 4Q2LA 5KFCA 4QYRA 4DFPA 4DU8A 3VQSA 2BJ7A 1U1PA 1X5TA 1IBCB 3GQCA 4ZPWR 3NY0A 2YNHA 1RHKB 3UPFA 3DRRA 4FPRA 3ITHB 4RBUA 4ECTA 2KDOA 4HTIA 2QFIA 3QRPA 2CQ1A 5A6WA 2KH9A 3LH2S 4ILMA 5D0EA 1I6JA 4L74A 3PW0A 4L3KA 2IVFB 1B7FA 2HW3A 3R5GA 2JOQA 2C2ZB 1R0AA 1CULB 1YJTA 2ZJQQ 3ILLA 5A8WB 5E7OB 5CD4H 2MHEA 4JI6F 4ECYA 4NZ0A 5GAEU 3AB4B 1HBOB 4CRJA 3QYYA 4X4SA 1PG5B 4FKXA 3H5YA 4J9LA 3HHLC 3JTNA 3A4TA 2HHWA 5CCLA 2RDJA 2L9DA 3EZ5A 3Q8UA 4LRCA 4DV0F 2F63A 1AUSL 2QLBB 1N5YB 1ZTWA 5L1IA 3IA0A 2JRSA 2ZEJA 3GJTB 2C2MB 1S6QA 3EUNA 4KGVB 1M5OC 2I2YA 1RWKB 2PIIA 2H1YA 1Q0NA 3NKYA 3N6MA 1UA0A 3PTWA 1YJ9S 4PQAA 3T1YF 5K9FA 4NEZA 4ILRA 3PW7A 3HHNB 3MAAA 2HLTA 1DTTB 2CNOB 1JLFA 4RBTA 4DXLA 1V3RA 4OJ1A 2QIFA 1H6KX 1WTFA 5AXNA 5KFZA 2XG8A 2YKQA 3OW2R 4Y2AA 4JUZA 2HK2A 4ZVHA 1RCXB 1OQ3A 1ZM2A 2F4FA 3JXOA 2L48A 4DV4J 3G82B 4QW8A 1RT4A 1RHQB 4OHXA 4Q44A 4O44B 3SFUA 3AD7C 2H54B 2VFUA 2WB4A 4C8MA 3HSGA 2OKQA 3KK1B 2W9CB 2XYGB 5MLCV 4ZLJA 3TUZC 3GIKA 3CJKB 4YR3A 1EP4A 1F5BA 4NRTA 1V5IB 1Q7LB 1XN9A 2COLA 2V63A 4I6AA 2WOMA 4WZQA 2HHUA 4DF4A 1KEKA 3R97A 3BH7B 4H54A 4OJ3A 3R2DJ 2Z2YB 2G2YA 3POTB 4ZIVA 3D6FB 4DR6F 3VAIA 1U09A 3UN2A 4DV3F 5L1LA 3CWJA 3R5BA 1GMWD 3W9HA 1EHWA 1VC6A 2JLEA 4RW6A 2OSQA 1WG5A 2BA9A 1RUSA 4FP9A 5KFMA 4G1IA 4DSFA 5IT4A 3DLLQ 3QRQA 4CO5A 4EUVA 3MHYA 3CPWR 5LOQA 3LPEA 2GQ2A 3DLGA 4ZLNA 3RJMB 1EJ7L 1E6YA 2JH3A 4DX7A 2JC0A 4B3TJ 1AA1B 4IYQA 2GJIA 2CDRB 2MKCA 3ZTOA 1TKXA 2JVOA 2V0NA 1V6HA 3ETOA 1R89A 2JX2A 1IM6A 1S9GA 5HQMA 1U7LA 1JX4A 1PKUA 2V2QA 2EG2A 3R5JB 2DISA 3A8JA 4F2SA 2XB2D 1UW4A 1MWYA 1IQTA 1U1LA 1ZH5A 2OO4A 3GTYX 4ETXA 3TX0A 1CJKB 4KV8B 1I3OB 5DS7A 5DQHA 2BMBA 1S1WB 3A1YG 3JSMA 1SKSA 3R1HA 4DSLA 1FDDA 1RTIA 1HNIB 5ETRA 2P9GA 5EWEA 2LU1A 5EX0A 2ASJA 3EDQB 1R8PA 2O01C 3CO0P 3B78A 1VFJA 4DPTA 5A0YB 1S97A 3QJPA 2DIVA 4RO0A 3KHLA 1NUEA 5CHCB 2NPIA 2QG9B 5J2MA 1RHJB 5ETQA 1YKWA 4RW9B 1BQNB 1H2TZ 2KFYA 1MWZA 4WE1B 2HZAA 1D09B 2MLZA 1RAHB 4ED7A 3QWUA 3FSIA 3O44A 4OYPA 3MF5A 4G3IA 4OJHA 4PXBA 2CA9A 2FLNA 4GRSA 4FKYA 4CZCA 2OD4A 4NLOA 1UPPA 3HHEA 2HFZA 5AJ3F 4TVAB 2BUNA 1NB2A 3RTVA 4U7UK 2A1BA 2IY5B 4JB8B 3RBXA 2DHHA 2Y0SD 4ATNA 1M5VC 1TL3B 4MAKA 1VRQC 1FE0A 1D0EA 1TUGB 1UJ5A 3AQPA 3DHWC 3AD8C 4NLXA 5C24B 5EGYA 1YJRA 3CDUA 2B0GA 1X0PA 5GAEI 4ES1A 3ULHA 2RF2B 2O5DA 4ALZA 3N0VA 4B3RJ 4I1TA 4RR5A 5DO2A 1NK6A 3OTBA 4ZN3A 2JEJA 1REGX 3CULA 3CJ0A 4B3SJ 2R4FA 1ITPA 1BD6A 2R8JA 3M8QA 2FC9A 2ROPA 1D9AA 2FJBB 4FZVA 3V6DB 2K8GA 4G6VB 4Q8EA 1MROB 2N4CA 3BV8A 2DH8A 4DR3F 4HT5A 4RUCA 1FK9B 4DQRA 1J5OB 4YMEA 1X4BA 3DRSA 4Q0BA 3O8WA 4K0KJ 3TAQA 4ICLA 1YX2A 4K4UA 3TA2A 3NXZA 2OGUA 2QZ8A 2NR0A 2DIUA 1APSA 4B9UA 4JI7J 5HI7A 4GKJF 3OVBA 4TQRA 3IS9A 4C0OC 2PDAA 1AYEA 3QO9B 4ZKAA 5D3GA 1S12A 2FDNA 2XEXA 3OL7A 2AEMA 4DFMA 3SSRA 4X62J 4C6AA 4DV5J 2D1CA 2RIJA 3GCXP 5CXTA 5HROA 1NK9A 5EHHA 5BR8J 2BKPA 4Q2MA 1SUQA 5C2GA 3I87A 4QIEA 2CPXA 1Y3JA 5MAOA 4ELTA 2QN6B 2HAIA 2IDEA 2PEBA 1U25A 4PWWA 1B0PA 1M5KC 4DV7J 4PXEA 4EYHB 4QWCA 4CLSA 4WFXA 2G2ZA 1T03B 3AJ2A 4Q5VA 3LQVA 3HK2A 3CC4S 3TOQA 1NDKA 1HQ2A 2ZZTA 2A3JA 4CLZA 1RT7B 4IR1A 2MHNA 2HEKA 1RAIB 3KLVA 2J9DE 2DNZA 3RAXA 1GX5A 4N77A 1VRTA 2W25A 2UUTA 1OY8A 3NGTA 1N32F 3MPUB 4RU2A 2YNIB 2FLPA 1CJUB 4DV6F 1DAXA 1RAAB 2NZCA 1YRXA 1AUDA 3M8PB 3M2UB 2WVEA 2XM3A 5J1NA 2OLWA 2Q66A 2C3PA 4UY8T 4WFAQ 1D9FA 1S1VA 2DBBA 1S1XB 1TKZA 3AAWB 3CB4A 3LGNA 2VQFF 3DLKA 4AUKA 4IRCA 4WXOA 3I5CA 1YJVA 3ZZYA 2J9CA 1B0VA 1NHUA 2EVZA 2DGXA 2L3MA 1XR6A 2PMWA 1Y5IB 2C22A 4NCGA 2FJEB 3QFWA 2AGOA 3D4JA 1WF0A 1H2UX 3T19A 3K5NA 4X64F 4KH0B 2KYZA 1RP5A 1HNVB 1HI0P 1NK8A 3W8PA 3LOUA 1HMVA 4P74A 1IBKJ 5HSPA 2G1DA 4EWTA 2YQ1A 2OTJS 3ZZPA 4HACA 3ZFVA 3R9LA 4M5LA 3NP5A 3MM9B 4A8YA 4KFBA 3U7JA 1EB0A 5AE2A 3US5A 2VQEJ 3GJQB 5RUBA 4MYUA 1OSDA 3EVMA 2ZH6A 4OHVA 2CJXB 3KLEA 3G86A 2RHSB 1VQ4S 4R8UA 3NCQA 4OJGA 2VPWB 4MIBA 4OV1A 1FFGB 4LBHA 3L9ZA 3FBCA 3MMBB 3E01B 1D1UA 2J9EA 4M94A 3OJUA 2JDJA 7AT1B 3H5UA 4LSNA 2K2PA 4NWBA 2CVEA 2CUYA 2QSFA 4C4WA 3P49B 3DLBA 1ZA2B 1HNWF 1X0FA 1SCJB 3FZ2A 4O3SA 3I5AA 4TU7A 1NM2A 1K44A 2DNLA 4A8MP 1OWXA 1R0BG 1W25A 1BWEA 3QSYB 1UWBA 4N56A 2B6AB 2AJ0A 3UW1A 4ZPVR 3OR1B 2X3GA 2IYGA 5GMEA 3PFOA 5IXUA 5IOLA 5E3RA 1FF2A 2AT1B 3M6UA 4IG0B 4WP8A 3AHPA 4DSIA 3NGSA 1R6VA 1SV5A 1Z4UA 2E5LJ 4LR8A 2G0JA 3M8WA 4GC6A 4OX8A 1LV5A 1EZZB 4USIA 4USUA 2Z2LA 1KOOA 2DPJA 3TAMA 3M9MB 1KD1T 1FD2A 1NSAA 3UCGA 4RNFA 2CJYB 2OSRA 4LIWA 2ACMA 2LQ9A 2FGCA 1ZOTA 4HT7A 4ID5B 1JLBB 2VOOA 2V8VA 1NU4A 1L3SA 4I69A 4LFBF 1XTZA 3MMJA 3PYDA 3OVSA 2ZD1B 1RKIA 3MM7A 3FSXA 4K50A 2V50A 1M5SA 3JYTA 2J0QD 3CIMA 3PZPA 1SQEA 2OI2A 1N34J 1FJCA 2A6MA 5F9LA 1U6ZA 1WDTA 1L3VA 1ZAWA 3DN9A 2V6AA 4F0HA 1X9MA 1DRZA 1UVMA 2GW8A 2AJ4A 3GIRA 5G4DA 1IKXA 5E3CA 1DARA 1VQSA 3HKZD 1JJ4A 5E3QA 4O4GA 4PYAA 3OUYB 3F44A 4LF9J 3IM9A 2MSTA 4P7TA 2EPIA 2J9DA 4B3OA 4OI2A 3KJQB 4CTAB 1FRIA 2OAUA 3EGVA 2YNFA 2XMUA 2IA0A 4WK3A 4TLQA 3LA0A 3CW2C 2ZBQA 3P5TL 2NXNA 2NZ4A 1IN0A 5A8RB 4USJC 2DYAA 1NPPA 2HIQA 3NS5A 5KFXA 3GSDA 2KXFA 2KTQA 4N41A 2WRMA 2X7IA 2I8EA 4GVBB 4M5DB 4I4BA 1X4FA 1TK8A 1AW0A 2UXCJ 3FQKA 5JVGQ 1TFYA 1NLKL 2IRYA 3I4PA 3SV4A 4DHVA 4I6YA 1RBAA 5CZVA 2UU9J 1XMQJ 3PKYA 3UWTA 5DDQC 2D74B 3A8KA 3NMRA 2ZH2A 4HHHA 4I68A 1XK8A 5J1EB 1LW2B 4YB7A 1NMEB 2F4VJ 3R5DA 2RHQB 3D6HB 1IBMJ 2BR0A 4DSEA 1Z2ZA 4C11B 2BANA 4DZ6A 1PYTA 8ATCB 3GP9A 2ZE2A 3UD5A 3MAAB 1X60A 4P71A 1UMJA 1Q81T 1OS5A 4R0JA 2WSFC 1IKVA 2XULA 4CYUB 3FQLA 1WJ9A 5IWAJ 5HN0A 2GV1A 3VGTA 1C1CA 5DLFA 3GFYA 5M2PA 4ZK7M 2MY7A 3C15A 1GMUA 2GX8A 4BS2A 4M5JA 3LP0A 2XGPA 3A13A 3T9NA 3NAHA 3T5HA 1F5CA 3HCXA 2XCAA 4WF9Q 3PACA 2GQQA 1T11A 5HJXA 1YSJA 3QRRA 3HXMA 4JI2J 3THPA 3OTOF 2OFGX 1R0CB 5FLXU 2RQCA 4NYOA 1ZZNA 3ETMA 3LF0A 1IUJA 2F5GA 2AJFE 2FJVA 3DOLB 4FNHA 4JV5J 2R8GA 1S57A 4LT6A 4L6V3 2GO9A 2HGNA 3NGKA 3MEDA 3B82A 1IBLJ 4OZ5A 1AT1B 3U1LA 3LP1A 3W60A 1JLCB 3T1HJ 2B56A 3R3TA 1T8EA 3BYPA 3J7YU 4K4SA 5KFOA 2HPUA 1NJXA 3L7PA 2CAJA 4DLEA 3HHLB 2Z8QA 1F3VA 3PV8A 4H4MB 3I55S 5D15A 1MMDA 4A8FA 4ES2A 2BEFA 1NKEA 2B4PA 5LM7E 2RVJA 2K7KA 1N33F 3ZZOA 2C2NA 5T7LA 3H8YA 3SYZA 1PJ6A 2WVCA 1QAYA
chains in the Genus database with same CATH topology
2F4VF 4NZ7A 3MM6A 2E7XA 4KBIA 3QIDA 1UVJA 1IBMF 3MM5A 3MEGA 5FDLA 3HFKA 4X66F 3J7A1 3N79A 3NCPA 4EZ6A 3DOMA 3Q24A 2J76E 2DR8A 4UQGA 4ECRA 3I82A 4F02A 3GIIA 4N76A 3C6TB 5LSLA 2G9OA 4M63A 4WZMA 3MOJB 2YKPA 1HNXF 5H1SV 4DWIA 3M1VB 2WBRA 3BF4A 1G6BA 1VC0A 4IRKA 1HYSA 3MFIA 2M52A 1TL4A 1OSCA 2AP6A 1FERA 3TX8A 1NK0A 3CC7S 4O44A 4WU2A 4ED0A 2NUHA 3M6VA 4R8UB 2DO0A 3RW6A 4I67A 3V6JA 2CPFA 2F9DA 4GO5X 3H25A 4ECXA 2QA2A 3UQSA 5KT3A 2RILA 3MOZA 4U67Q 5KOWA 4IOCQ 1EETA 3NBPB 5IWAF 1SI9A 2ASYA 3KK1A 2G0CA 2W9CA 3MFHA 1FTCA 2ZOMA 1L3TA 2KHDA 5BYSA 1ZETA 3EGZA 3PR5B 3X1LB 3NNHA 5KFVA 2MY8A 3MDFA 3THVA 2K3IA 2IRXA 2JWNA 3CJKA 4YR0A 4LSNB 2MDAA 3G4SS 3BSOA 2AWZA 2B51A 2MKKA 2BM1A 4WFYA 5DG8A 2LDYA 3IAS9 2HVHA 1CSJA 2BZ2A 2E5JA 5LL6d 3QZ7A 4ED5A 1DURA 1Q53A 1S4FA 4KHMA 3PEJA 1WTBA 4NMLA 3TRGA 3KNGA 2VFTA 1N8RT 3KK2A 1VLYA 2CQBA 2E1AA 4QWEA 1M0SA 5B0FA 2KXNB 3BQ2A 4MH8A 2YWFA 1HBUB 3NCRA 2AX0A 3QGPA 4PWDA 3FRZA 3VR1A 3TNVA 3OR2B 3PRBA 1SIZA 2GGPB 4UW2A 4O3NA 4ZPBA 1QAJA 1VBXA 2P9CA 1IJEB 2Z0GA 5KFJA 4TLRA 4X65F 1WHXA 4ELUA 2FUG9 4LF4F 1ZTTA 1WWHA 3VZIA 3HO1A 3V2UC 3RB3A 3RRKA 3JSMB 1N5QA 1TVRB 3IO1A 3M6XA 3QIPA 1UWBB 1N6QA 2EBEA 2I5JA 2YY3A 1FXRA 2F8EX 4XDDA 5KFLA 5CYMA 2HNDA 4MIAA 4OHZA 3TA1A 1LW0B 3S8SA 3KHRA 3PW4A 1AFJA 2DGTA 4RWXA 5I3UA 1VQKS 3QMQA 2C2EA 2DHGA 2M8HA 5FLXY 5DRKA 4JI2F 5IZHA 3LALA 1KLMB 4NLWA 2MPUA 1LWFB 2JLFA 1HWKA 2DGWA 4K4XA 3PW2A 4XPEA 1Y9OA 2FVCA 1VQMS 4YB6A 4KO0B 4FBUA 4IR9A 3IBWA 2VKZG 4JI3F 3V81B 1IKYA 4F67A 2D9OA 3AH6A 1RTHA 3E3XA 2IBOA 1Q86T 4TNOA 3CSKA 1RI7A 3QGHA 1JLAB 4ETZA 1NK4A 1N5SA 1ZAVA 2L9WA 4PUOA 4JV5F 1SV5B 3Q8RB 3ZZTA 3VZHA 2YX7A 1JXEA 2KYXA 1R7IA 1U49A 3M8RA 4ED3A 2CQ2A 1WEXA 3PJWA 1IKWA 2PMHA 3TUIC 3FEXB 1ZBTA 3BM7A 3T6JA 4RW7A 3HT3A 2ADCA 3PKMA 1IBLF 1NB7A 4MFBA 5IT9Y 2VV5A 1QE1B 4DG1A 2HYIB 2GHVC 3IR5B 1GH8A 2VD3A 2CQGA 3BGRB 4U9RA 2NPFA 1NJYA 3T1HF 4W90B 3SQGB 2Q6CA 2FHJD 3QLHB 4KB7A 4DQQA 1RA7A 4QOTA 2FHJA 5CH7B 4F4YA 4AYBD 1NEEA 1RT6A 1XR7A 4J9SA 1LQ9A 1F0XA 4KHRA 3DLHA 4RNOA 4LMZA 3DFEA 1WACA 4IO9Q 4F3QA 2JEGA 4B9TA 2F8HA 1X4GA 3G8SA 1LFWA 3TAMB 1DQ8A 3U1NA 3FRYA 3QAEA 2CYYA 1IJFB 4Y00A 2LKZA 3IG1A 3KK3A 3BGLA 5HMZA 2CQDA 2O66A 2CPJA 2ZDOA 5KFTA 3GR1A 5DQGA 1X5PA 4IDKA 1FE4A 3G6ES 1UL3A 2D3ZA 3FCHA 3GYXB 3KLHA 2YWGA 1U47A 5A2QY 2OFHX 2RB7A 4OI0A 2ZOGA 2LQBA 2XMKA 1WG1A 3M9NB 1NAQA 3EX7B 4K2XA 3F73A 1U8SA 3LANA 1DLOB 1FNOA 2RNEA 3WX4A 2QA1A 4FF2A 3DGPA 3FMBA 2J7WA 3MEEB 2ZC3A 2R9LA 1W2IA 4MIWA 1Q8IA 4O3PA 3KMQA 3H4DA 5JJBA 4ZPTR 4HL9A 5I4MA 2M3DA 3CMAS 5CYQB 1VIXA 4J9OA 3D0GE 5BYQA 2RH3A 2B4VA 1HWLA 3M2RB 3M2VB 4ID8A 4PG8A 5J2PB 4K5RA 2HHHF 3H98A 3MM7B 4PRFA 3V6HA 2KZMA 5DDRC 5DETA 2DNYA 2HGMA 3HMJG 1VRUB 2R7SA 1SJRA 5C42A 2UUCF 5B0AA 2NYIA 1GT8A 3ISZA 1OIAA 3TYTA 4FS1A 1KTQA 1FRXA 3ISND 3JYTB 4KV8A 4ZP8A 1UETA 3DYAB 2GMLA 2X51A 1ZZFA 4OL8A 4ED1A 4DR2F 2C2DA 3M32B 2ZNZA 5LSOA 1HHTP 1REVA 5J2NA 3PJXA 4DFJA 3I9ZA 2FD2A 4PQUB 2XSJB 2OPPB 3HHDA 3OXGA 5K8OA 2JVRA 3CCUS 2E1MC 4DMZA 3CJ2A 2YWKA 5K14A 1DJ0A 5M2UA 2VPYB 4IH5A 3RAMA 4CO2A 1S0VA 3SXLA 5SZTA 2GJ2A 1HNIA 2MGZB 5GAGU 1KQSR 2RT3A 2ZBIA 3Q8PB 3MGJA 2EC0A 1VIOA 1MU2A 1XMOF 4QZVB 2IBKA 4HYKA 4OMFG 1B64A 3DRYA 3K0JA 2QLWA 2L41A 1LXJA 1IKXB 4NYZA 5KFQA 1PSDA 3OFFA 5HO4A 1BQMA 1YI2S 1ZM3A 4O4GB 2XS5A 2FB0A 2OPQA 2VFVA 2QRRA 3M4XA 2A2CA 2DH9A 1URRA 2DCLA 1TL1B 2GO8A 3BN4A 5HBMA 4BBYA 4P7VA 1G1XA 1SL1A 2VBWA 3DXBA 1OPZA 3VTIA 1C2PA 1S10A 4DL5A 1JNRB 3GIJA 5KT2A 3GE9A 2DNNA 5DQIA 2NUUG 2J7KA 5A0YA 5H9FJ 4Y0FA 3CCES 4B3OB 4OHYA 1K1QA 2FC8A 1R43A 4N8NA 3ZZRA 2K7JA 1N5VA 1P27B 2CJAA 3W2WB 2YNFB 4F8RA 1R8CA 3TW0A 3CC2S 2EFQA 1WF2A 2UV8A 4RUHA 2AYGA 2MJUA 1VS3A 1O5JA 3RW7A 4X84A 4MKBA 4BWMA 5LSRA 3HVRA 2V8GA 4O3RA 2VG6B 2DR7A 4EZ9A 2CZ4A 3CGIA 2A10A 4RW9A 2ZH1A 2ZZNA 2VKRA 2ABYA 2MKSA 2CPEA 4WK1A 3MUVP 3LP2A 5J2QB 4QYZJ 1BQNA 1JK9B 3S1TA 4IFVA 1U4BA 2OPRA 3BO3A 4NX9A 3PX0A 3FVYA 3MMAB 1KVJA 5KG6A 4NA1A 4ZCMA 3DM2A 4WE1A 2N3OA 2Q6BA 3PRDA 3QZ8A 3HHKA 1CPZA 3BGFA 3OLBA 3DRPA 4ZHRA 2XMWA 1S49A 1U26A 2RU3A 2YWEA 3QGGA 2BRLA 2KI2A 4YY3F 2R8HA 4F2RA 5AE3A 3PDNA 1FRLA 2HQIA 3LPYA 2ILZA 1C1BA 3F41A 3KG4A 1UEVA 3OXLA 1HBNA 1MMNA 2CKWA 3H5SA 1QUPA 1KS2A 1X7VA 4ZVGA 1Y3KA 1C0TB 2QMWA 4QW9A 3B4DA 2H9ZA 4Q43A 2YKNB 4QCLA 1JNZB 1FKAF 4Y34A 4PG7A 1HHSA 1HFEL 3I31A 1DQAA 2ZBCA 4I7FA 2FVSA 1SC6A 1RT1B 4Q2LA 2BV3A 5KFCA 1YG0A 4QYRA 4J9PA 2XSFA 2RD5C 3V4IB 2KXHA 3MTKA 4DFPA 3I6PA 1RYRA 1KQFB 3GB0A 4AL7A 4WJBA 4G1QA 1C4AA 3VQSA 1N52B 1U1PA 1X5TA 2VG7B 5KFDA 3EPIA 1JJ2R 3GQCA 4HI2A 4ZPWR 2QLXA 5LMNF 2YNHA 2BANB 1A6LA 1MW7A 5DM7Q 5A8KB 3UPFA 5F9NA 2ZE2B 2W4CA 2RS2A 4KSEB 5C24A 3DRRA 5HLFA 4FPRA 3ITHB 2GFFA 4B08A 4RBUA 2VG5B 4ECTA 3MAHA 2KDOA 3DOKA 4HTIA 2LEBA 5HROB 1H38A 3HI9A 1I94F 3DMJA 3KG1A 2CQ1A 4WYWA 5JXSA 5A6WA 5L1JA 2RF2A 1I1GA 1RT2B 1C0UB 3LH2S 2KH9A 2R7QA 3OTCA 5E33A 4ILMA 1IKVB 3B4MA 2NSBA 1I6JA 4Y2MA 4MJKA 2POKA 4MK8A 2PA8D 3PW0A 2IVFB 3S6EA 3NNCA 1LWEA 2G13A 1B7FA 3FGVA 4XK8C 1C1CB 2R2RA 2HW3A 4ECUA 4PPZA 2JOQA 1UEUA 3RRHA 3SSQA 1R0AA 1R31A 5KG3A 1MSWD 4YP3A 1RT5A 4NXMF 1YJTA 2ZJQQ 1Q8BA 3MWBA 5A8WB 4IOAQ 3D54A 1HWJA 3CCZA 3V6DA 1P6TA 5E7OB 5CD4H 2ADBA 4Y2KA 1S79A 1WHWA 1RTJA 2MHEA 4B9VA 2CIMA 5I42A 1FO1A 4JI6F 5THWA 3DC2A 1KQGB 2XLJA 4OHWA 4QWBA 4PXCA 4AQYF 4ECYA 2AD9A 1D8YA 1TKDA 3HVTB 4EO8A 4KC5A 2PGCA 1YIJS 2MZSA 4NZ0A 2UVWA 2ILYA 3MECA 5GAEU 3AB4B 4JI8F 2N3LA 5IM0A 1HBOB 5L39A 3QYYA 2F1FA 4X4SA 4DUYF 4JV2A 5KFUA 5HP1B 1FK9A 2V9WA 4NYPA 3H5YA 1J5OA 1E6VA 2KM8C 4J9LA 4YOEA 2AYMA 3CD0A 1HW9A 2XHWA 3HHLC 3GMGA 2FGOA 3DI6A 5DJBA 3JTNA 2WONA 4AFFA 3J7YI 1JXLA 3RR7A 1Y5LB 1FA0A 2QT7A 2HHWA 5CCLA 4EYIB 2RDJA 1FVSA 2BABA 1H3DA 4NL5A 4C3LA 5AXKA 2PT0A 2BJDA 4PCQA 3MM8A 2L9DA 5T14A 3BQ1A 5I3PA 5KFYA 4CH7A 4F4WA 3EZ5A 2FVRA 2W9BA 1UFLA 1HQUB 4FS2A 5IFMA 4JI1F 4RNHA 4B02A 1O8BA 1SJQA 4QPTA 5KG5A 3ENQA 4DV0F 2D3OR 2OPSB 1KLNA 2UUBF 3KLGA 4FF3A 1N5YB 1ZTWA 5L1IA 3CT9A 4A8QA 3IA0A 2JRSA 2CQ0A 3KTQA 1QLNA 2DNGA 2B5JA 3BREA 3E51A 1S6QA 1X4HA 3EUNA 2HS4A 4WKYA 4B9SA 1M5OC 5KFWA 1C4CA 4TN2A 1LK5A 1KQKA 1TK5A 2I2YA 5HL7Q 2RUGA 4EGLA 2IRUA 4DSJA 3KHGA 2MYFA 3LAKA 2PIIA 4NA3A 2BQ3A 1CC7A 2CJBA 1KNZA 2PFFB 3IR6B 2UVUA 4C8LA 4HLBA 3EZUA 1T3NA 1YJUA 2E9TA 3NKYA 1GTEA 3BSCA 2ASLA 3N6MA 4OI4A 1UA0A 3CE8A 4DL3A 2E5IA 3QO9A 3LP1B 4KKOA 2VA3A 2M7SA 4DR7F 4WYLA 2R2SA 1VQNS 1YJ9S 2IC3B 2NS1B 3D1QA 4I2PA 4LQ9A 2IAJB 4OZ1A 3H4BA 4FF4A 1HWIA 4LFCF 3L3CA 1DZ5A 2JEIA 5KFGA 4PQAA 3FJ2A 4IH7A 4J9NA 3T1YF 4C3MA 5K9FA 3RB6A 4PKDB 1OO0B 4B3MF 3OFGA 4ILRA 2DHSA 1JLEA 5KFHA 3PW7A 3KNAA 1A9NB 3SSSA 3HHNB 3L95X 2GHWA 1SH3A 5KFEA 4D3GA 1FRJA 2HLTA 1FESA 4IG3B 4LUBA 4C8ZA 1S99A 1DTTB 1JLFA 3HZGA 4NOHA 1R27B 4RBTA 1V3RA 4OJ1A 4RU9A 2QIFA 1L5UA 3KLFB 1H6KX 4Y28C 1UAWA 1WTFA 1U1MA 5AXNA 5KFZA 2LCWA 2XG8A 2YKQA 3MM6B 2ZH3A 3CCWA 5F8LA 4PG5A 3OW2R 2FVQA 4Y2AA 3VF0B 4JUZA 4FVMA 2VBXA 1RGVA 3MM5B 1SH0A 3MEGB 5FDLB 1Q82T 2HMIA 3E2EA 5E3PA 1FD8A 4R25A 4IOBA 4ZVHA 4X4UA 1S1UB 2W7OA 2CG4A 2WW8A 1S0OA 4YEAA 5KTQA 5DDPC 1OQ3A 1ZM2A 2D41A 2ZHOA 1RK8A 3L7OA 1UVLA 2YX4A 1S72S 4UUWA 1XNQF 4HHJA 3DRXA 2XS2A 5F8JA 3OVAA 4DL7A 1F2GA 2L48A 3OBIA 5K8MA 4QW8A 3K57A 1HYSB 1RT4A 4OHXA 4Q44A 1UVNA 1D8ZA 1Y5NB 4O44B 3GFHA 3SFUA 3SI8A 2W24A 2UVVA 1FJ7A 1T03A 2VFUA 4IQXA 2WB4A 2E5HA 4C8MA 5L38A 3D1HA 1EETB 2N7CA 2B7CB 5K5MA 4FYDA 4XAKA 3ZZUA 2NQPA 1PC5A 3DCAA 4IH6A 4QPXA 1VBZA 2OKQA 1Y0HA 3KK1B 2W9CB 1FEHA 2ZHBA 2VODA 1BLUA 2IVMA 5MLCV 2KKHA 3TUZC 3GIKA 4GC7A 3K5PA 3CJKB 4AXIA 4X4VA 4YR3A 3MPYA 1FRKA 1V3ZA 5KFIA 1EP4A 3RYLA 2BBEA 1F5BA 1M5HA 4DR5F 4NRTA 1QVFR 2ZJRQ 2PE8A 3MR5A 3T5JA 1S77D 1Q7LB 1XN9A 3LAMA 2WBMA 3KK2B 2COLA 2WAQD 1S1TA 4I6AA 1VOMA 3GWCA 4WFBQ 1ZYQA 4PWDB 1WG4A 1ZM9A 2WOMA 1SKRA 4WZQA 2XLIA 1HQEA 2HHUA 2RQMA 3VQTA 4DF4A 1KEKA 3MR3A 4C97A 4CO3A 2DGVA 2YNIA 4H54A 4OJ3A 3POTB 1X9SA 4I2QA 5KG1A 4OIXA 4CT8A 3QIPB 3KLEB 1N6QB 2I5JB 4DR6F 3VAIA 1SBRA 1U09A 3I56S 5CYMB