3O5TB

Structure of drag-glnz complex with adp
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
112
structure length
100
Chain Sequence
b'MKLVMAIIKPFKLDEVREALTSLGIQGLTVSEVKGFGRQKVSFLPKVKVEVAVSDDQYEQVVEAIQKAANTGRIGDGKIFVLDIAQAVRIRTGETNTEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dinitrogenase reductase activacting glicohydrolase
publication title Crystal structure of the GlnZ-DraG complex reveals a different form of PII-target interaction
pubmed doi rcsb
source organism Azospirillum brasilense
molecule tags Hydrolase/transcription
total genus 23
structure length 100
sequence length 112
ec nomenclature
pdb deposition date 2010-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00543 P-II Nitrogen regulatory protein P-II
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.120 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3o5tB00
4CO1A 5L9NA 1V6HA 4C3KA 2PIIA 1QY7A 3GSDA 2NUUG 4YB5A 2GW8A 4AFFA 4RWWA 1V3SA 4USIA 3DFEA 2RD5C 1O5JA 2DCLA 3CE8A 3N5BA 4OZLA 4Y65A 1V9OA 4C3MA 2ZFHA 5D4OA 3AA8A 4RWXA 4D3HA 5DS7A 2J9DE 3NCQA 3TA1A 2XG8A 5DRKA 4WK3A 3NCRA 4OZNA 3M05A 3AA9A 3O5TB 2J9EA 4ZK7M 1HWUA 5D4LA 2XZWA 4CO3A 2Z0GA 4D3GA 1OSCA 1H3DA 1NZAA 3TA0A 2E66A 1V3RA 2O67A 3X3UA 2NUHA 1P1LA 3AHPA 3NCPA 4CNZA 2NS1B 4C3LA 2XBPA 4CO4A 5D4PA 1O51A 1UMJA 4RX6A 4CO2A 4CO0A 1NAQA 2GNKA 2GX8A 1UL3A 2EG2A 4YB6A 3T9ZA 1XK8A 2V5HG 4OZJA 1UFLA 3LF0A 3HLUA 1PILA 2VD3A 1KR4A 4R25A 4NYOA 2EG1A 1NH7A 2J9DA 4RLEA 1UKUA 3TA2A 3BZQA 4WK1A 4YB7A 1VFJA 4USJC 3L7PA 4Y6IA 1NH8A 2XULA 4USHA 3AH6A 1VHFA 1J2VA 2ZOMA 2CZ4A 3O8WA 4NYPA 4IYQA 4E98A 2J9CA 3OPKA 2JJ4D 1Q1KA 5D4NA 3MHYA 2O66A 1GNKA 4CNYA 4CO5A
chains in the Genus database with same CATH superfamily
1AUDA 4J9UE 2QL5B 3MEEB 4PRFA 2N4DA 3KJVA 2MJUA 2CNKB 2CQ4A 3FRZA 3P45B 4YB5A 4RU9A 2NPFA 4IH5A 2PMHA 2R4FA 3BBFA 2VICA 2I38A 3CJ5A 3BEGB 2V2VA 1BUXA 2CUYA 5F8NA 2JVRA 4B3RJ 1N34F 2M88A 4DV5F 2HNDA 3V6KA 3DMJA 3KLEB 3QO9B 2KZMA 1N0UA 2MQMA 1FJGJ 2KT2A 3GJQB 3RU0A 2DEJA 4TKTA 4Q7AA 2GX8A 2IBKA 1WEZA 2ATCB 3VGSA 2XQCA 4WE1B 4OYBA 5HQLA 2CPYA 4NLRA 8AT1B 2OO4A 4NZ7A 1VHFA 4QJVA 1FRIA 4QOTA 1SQEA 1Y10A 2DNGA 4HDGA 3BDPA 3MI7X 3PX6A 3ILJA 4DCJB 4NZ6A 3HHLC 3GONA 3I4HX 2CXEA 2FD2A 5DG8A 3VGUA 1FRMA 4ZVRB 5CA5A 1YTYA 3QT8A 4QW8A 3ILOA 2ZH7A 4ZPTR 3V6DB 1J5OB 1QE1A 4DU8A 1OMSA 3WHIA 4TU8A 1HBMB 2ASDA 1VQ7S 3FZ2A 4DSLA 2VKZG 1RAOA 2RRAA 4OLOA 5IWAJ 1PG5B 1MLAA 2BUNA 1N8RT 1MMNA 4X62J 1Q8IA 4BC7A 4TLRA 4RO0A 1RWWB 4CO3A 3W5ZA 5CAAA 1PO6A 2AJ1A 5FLXU 4CLFA 3MM8A 5DJBA 4KHRA 3MTJA 3IM9A 2CPHA 2RF2A 4RUBA 2VKRA 2BW7A 1U0SA 2OI2A 2OUGA 2NXJA 2AGQA 1S6UA 2FJVA 4M5LA 2DTJA 1UKUA 2IDEA 2VG7B 3NP5A 5D3GB 3PYFA 3CDEA 3RGIA 5GAGI 4P7VA 2CVIA 2YBVA 3WIVA 2UXDJ 1NDCA 1DRZA 3B54A 3MPUB 3BO4A 2C2OB 1JLGB 3P8BB 1NCLA 3CJ0A 2ACMA 4MFBA 3ENQA 4ZKAA 4NPOA 4RBVA 2LP4A 1WWHA 4YY3F 1RBAA 5IOLA 1NHKL 1FD8A 4OHYA 2B0GA 1RKJA 2NZ4A 4L72B 1X9SA 1H7WA 4WP8A 4RL1A 4O3PA 4WJBA 4QPXA 1VMBA 2DBBA 4OI0A 2WB1D 1VRUB 1SUQA 3E51A 2WRMA 2DY1A 4G65A 1URNA 5U47A 5IM0A 1FKPA 4WKRA 4Z37A 1HBUA 1Q0NA 1LFWA 2GNKA 4DI6A 4CH7A 3Q8SB 2XB2D 4ZIWA 4O4GA 3RJMB 3D0GE 2Q6BA 4Y2MA 1GAOA 2N7YA 2ERRA 4IFVA 4ES2A 1L3SA 2RQ4A 1U1QA 1JXLA 3D3BJ 2COLA 5F41A 3CMES 2EI5A 4NA1A 3GV7B 1G7CB 4CLPA 1RHRB 2QX0A 1U02A 1LFPA 4X4TA 1L3KA 2V4JB 4YS2A 1I5OB 3HKZD 2B56A 1S7IA 3UD4P 4MT1A 4LSZB 2HNZB 3NKYA 3IN5A 5EDWA 1WDDA 4O0NA 3BGUA 3THVA 5A0YB 1UVJA 1URRA 4LVOP 5KT6A 4ZP6A 4DF4A 5LOQA 5L1IA 1RTJB 5HMZA 1SKSA 1H73A 4LSLA 4U8YA 4DLEA 3AA9A 2PMWA 4DV3J 2FJXA 3A8EA 2ZDOA 1Y11A 2QLJB 2QO3A 4NI2B 4DX6A 4KE5A 2E5GA 3MM9B 4HHHA 2HHTA 3SSRA 2IJFA 4DR7J 1WSRA 3DXBA 2MZ1A 2YKOA 4OX9J 1X9MA 2FVPA 3ULHA 4P2FA 4U96A 5FLXY 3MMCB 4OFZA 3KMQA 2E5HA 1HNVA 3EUNA 4DSIA 2NQPA 1RWUA 2NXUA 1FCAA 4Q5VA 4OHXA 2HLUA 1R8HA 2QMXA 3J7YU 2RE1A 2LEBA 2DVIA 2G0IA 1RAGB 2QJ3A 4ECUA 1S1VA 1RU1A 3IMQJ 2RD5C 2QA4S 3RBZA 1HNWF 4MK7A 1GEHA 1EARA 5IT9U 4K4TA 3R2DJ 2HGMA 3OSPA 2HVDA 3NWGA 3KLFA 1EZZB 1VBZA 1Q16B 3MCOA 2HHVA 1O8BA 4ILRA 3KHRA 2ZEJA 2DISA 3OLBA 2HS3A 2MLZA 2YWWA 1YBUA 2XBPA 2E5LF 2CG8A 3B6BA 3B82A 1T11A 1S99A 3UW1A 2IA6A 4FYXB 5A8KA 1NPRA 3HHKA 3PYGA 1S9GA 5C24A 2RU3A 4I2QB 2QL9B 1ZETA 3HI9A 2NXCA 1HWIA 3H59A 2CQDA 2J9CA 4PEOA 3DNCA 1FJGF 2JH3A 2ZDPA 4TVAB 4E8UA 4UTGA 2YWGA 3FDSA 2MHEA 3I5BA 4MKVA 2Q6CA 3R2CJ 5GMKa 4KHMA 5F8MA 1LKZA 5J2NB 1D9DA 1DFDA 2W1BA 2FJWA 2V50A 5KFAA 5F3ZA 3MUVP 3MPWA 4OZ5A 5F8JA 1N36J 1YGYA 1NHVA 1Q4RA 3DHXA 4KH0B 2XZWA 4LF1A 5BYRA 5CQGA 1V3RA 2CNLB 2LLZA 3AHPA 3DYAA 1T03B 3C15A 3I5CA 2DH7A 3G6XA 1SH3A 1NJYA 4A8WA 1LK7A 3M8WA 4M8LA 1AYEA 4H4OB 3UR3C 4H4MA 4IG3B 4LF8J 2UXBJ 2VODA 1Z4UA 1U1LA 4FF1A 1FEEA 2FHKA 4PPZA 3FK4A 4CM2A 2R2UA 3BSOA 4Y34A 1LOUA 1H38A 1QVGR 4M5DB 2GQQA 1EP4A 5B0AA 3MECB 1YJNS 3UE2A 1V3SA 2F1FA 2L41A 4O4RA 3SQGA 5J2PA 4A8YA 2UUWA 2QV6A 1JLCA 4YR3A 3JSMB 2HHQA 2CQHA 2WVBA 1RE1B 1F0XA 1ZAXA 4TY8B 2IY5B 3H5YA 1TAUA 2OIHA 2OEKA 4ZMMA 1RT4B 5HROA 4JI1J 4IFYB 4DPTA 3DDKA 2ALYB 5CZVA 3KKFA 1RA7A 4LQ9A 3GG0A 2C1EB 5IT9Y 2GQ2A 4NCGA 1ZZNA 3DHWC 5IC4B 1GFWB 3M8PB 4CYUA 1BQNB 3OHAA 3OFEA 3DLHA 3PJWA 3PO5A 1HIYA 1RP5A 3ZTSA 1WD6A 2IMOA 3JQMA 3T9NA 3CJTA 1NK6A 1RAJA 2GVDA 3DXSX 4J90A 3TEHB 2U2FA 1TL7A 4DQSA 2FUG9 1M5VC 3PO4A 2Y1IA 4RW9B 1Y0HA 4U67Q 1SL1A 2CZVC 1K47A 4CNYA 2XSFA 4U9RA 4N77A 4DFPA 1WKKA 2IYGA 4LR9A 4KBIA 4NEZA 2CQ2A 2VH7A 4C0HA 3LWMA 2EFVA 4ZP9A 5DLFA 4NZ0A 3DDIA 5C7PA 2LA4A 3L4BC 3PYEA 4NLSA 3V4IB 4EBCA 3QIPB 5KT3A 1Q5VA 3GJSB 4DL6A 2QEXS 5B7WA 1NK0A 3GCXP 3RR8A 4AL6A 1HBNA 4URSA 2HBQB 1N56A 1YSJA 1TUVA 1UETA 2XO7A 2P6TA 2W4DA 2XMUA 2W9CB 3PJXA 3DOKB 2UUAJ 4NLXA 4QZVB 1VBYA 1EKSA 1AZSA 3LW5C 1VQ4S 1BE4A 2E5IA 2A1BA 3AOCA 5J2QB 4KSEB 2YNGA 1W2BR 2DGOA 3SXLA 4ZPCA 3RZAA 4RZRA 4ZVGA 3KLHB 4O3OA 1BD6A 2R3VA 4XDCA 2X7IA 5LMNJ 4KH1B 2VQEF 2ZM6F 1FK9A 3OT9A 4Y2KA 2MHNA 4AT1B 2AX0A 4P71A 3BH7B 4DR7F 2MXYA 3I0SA 3LAKA 2HZVA 2WTFA 1EETA 1F3FA 4OX9F 2X1BA 1QAIA 3BB5A 2V8GA 3FEXB 4RWXA 4DV2J 1UVMA 4K5SA 1WKLA 1FE0A 3H25A 3QT7A 3CNQP 3C16A 4EI2A 2XLJA 2FJDB 1IKYB 2OD6A 2NUHA 1XMOJ 1CBKA 3RG6A 3HSJA 2XHWA 2ROEA 4X64J 3UD3P 2UUCJ 2WZ1A 2W8LA 1U6BA 2ZH8A 3CD0A 3EDRB 4LF5J 1JJHA 1FKAF 1HA1A 3IM8A 1VQ5S 4C98A 3I32A 2FY8A 1KVKA 2V2ZA 4F8RA 3HSGA 1JNZB 4HL9A 2VZ9A 4KKOA 2I6WA 5AXMA 1EHWA 4BS2A 3D54A 2M9KA 1DLOB 2B8QA 1HYSB 1UWBA 2OEMA 1HNXJ 3CJ3A 3C3LA 3MXHP 3Q83A 4YUDA 3Q2TC 3R5DA 3NXZA 2ZH1A 3AB2B 2BQUA 4OV6A 1NSKL 5KFXA 3RW6A 4RNFA 2XGPA 4GKKJ 2MPUA 3BREA 3W9JA 3HSDA 4DV0J 1VI7A 1NKEA 4UT4A 4FYYB 2DGSA 4AL5A 1DTQA 2GIQA 2R2SA 3LP0A 1HD0A 4USUA 2D9PA 3HT0A 2XMJA 1F2HA 1S1XA 3KFWX 3J7YI 4LIRA 3CCSS 3OLAA 3K7RA 1MROA 3M2RA 3OXFA 1TR0A 3HVRA 4CLUA 2MKHA 2Y1RI 2MQ8A 2UUBJ 4DDFA 3NY0A 1SKWA 1QVFR 2AKWB 4PWWA 5C2CA 3EJMA 3GQCA 4TU9A 4CTAA 2F8HA 1S77D 1KBRA 4PG7A 3JS9A 1HQEB 2FGCA 1DY3A 2AT1B 3TX8A 4DZDA 1WG1A 5CYQB 1HLWA 2R8JA 3NL0A 2DHAA 1LW2A 3FZBA 3PFOA 3PR4A 1CJTB 2V9WA 1Q79A 2CAJA 1HPZA 2YQ0A 1QSLA 3SI8A 2B9WA 3US5A 4OL8A 4WTYA 2D1CA 2ROGA 2B3TB 2PA3A 4LF8F 5AXLA 1U24A 3TUIC 3C19A 2HKEA 4TY9A 3M2VB 5H9FK 4DUZJ 4NA2A 1FA0A 3DCAA 2K7JA 5GAEI 3DOLB 4OIXA 3OR2A 1M1GA 2RH3A 2MQNA 2O3DA 3MCMA 4A48A 1I6JA 4RX6A 5DG7A 4ZPVR 2X3GA 4CH1A 5HAOA 3HK2A 4FPRA 3MAQA 1VHIA 4KY3A 1LWEB 1RK8A 1MU2A 2BV3A 3MAAA 3UDEA 4QWCA 1DZ5A 4ECXA 1IBKF 2ADCA 4QIGA 2XC9A 2KU7A 1WELA 4IQMA 4JI1F 1OSDA 2K7KA 2VBZA 3HVWA 4OI2A 4O44A 2BR0A 2XCAA 1WTFA 2DH8A 3SIPB 2MZTA 4IO9Q 2D3O1 1XTZA 1GMWD 3KK1B 5H1SV 3OL6A 5HLFA 4A47A 2IAJA 4O0IA 1RT7A 3TA1A 5HQMA 2XHCA 2VA3A 3HXMA 5I4MA 3D1HA 3JSRA 1HMVB 3H98A 4DSJA 3PHTA 1W25A 1B7YB 1TL5A 3EPIA 2FVSA 3NCPA 3NOGA 5EHHA 3OTOJ 3QQCD 2Y0BB 3GIJA 1U48A 5DDRC 3ICLA 1VLYA 1RWXB 2PO4A 3MAHA 3FMBA 2GMJA 2BM1A 5LSOA 3PG9A 4YQWA 2IVFB 2B5JB 1D1UA 3IWNC 3QT6A 2AJ0A 1TL3B 5KG0A 1T02A 3HVTA 3GB0A 3ZZTA 1F5BA 4OI6A 3JTOA 4ZPWR 2UUAF 1BQMA 1WJ9A 1GXLA 2R7VA 4PUOA 1GNKA 2YX1A 3MGJA 3FNNA 2LQBA 2CDQA 4FXWA 4CLTA 3N6LA 3A3OB 3Q8YA 4ZJOA 2KZZA 1NSAA 4KTQA 4PG5A 3D6TB 1FWPA 1WEXA 4EYHB 2YNHA 3LA0A 2MKYA 4WP9A 3QZ8A 2MKKA 1S0OA 2MGZA 2KHDA 5D4LA 4JP8A 2ZOFA 2YKAA 2N82B 4WYWA 1KOOA 1LW0B 3ET6A 4J9NA 3IR7B 3N6NA 3NBPA 3QYYA 1NDPA 1RTHA 1FFGB 2DNRA 4G1QB 4X4SA 4NASA 2V5HG 2RS2A 1RWOB 3PW0A 3DGPB 3D9BA 3D1QA 2VOPA 1XR6A 1B7FA 5CYMB 3LP2B 2A0FB 4NYPA 4NLPA 2DNPA 4J9PA 1JLBB 1X4EA 5EX0A 1XMOF 1XNQJ 4NLVA 5IV4A 1VYAA 5KFOA 1YZ6A 4C0BA 2UUCF 1KQSR 3L7UA 2QA4G 2RNEA 3M8QB 4ELVA 1SL0A 1L5UA 2AX1A 2Y1JA 2DHSA 1FTCA 2LVWA 2QYCA 2BKPA 9RUBA 4A8KA 2I5JB 4MIWA 4B3TJ 1CVJA 5BXIA 1VRTB 1UVIA 2M70A 2C3MA 1UWAA 3M6VA 1GX6A 3P3DA 4L74A 1HNXF 4F4XA 1RISA 2Z8QA 3D1OA 3E01B 5AXNA 1IBLJ 4OLPA 2HK3A 1FDBA 2QYGA 1CJKA 4K50A 3SDEA 1F2GA 1Q8KA 2JNJA 3G82A 4EBEA 3ISNC 2GVZB 1FHTA 1UFLA 4GKKF 1J5EJ 1T05B 3CDWA 3O1LA 1FTRA 2UV8G 2XMKA 4IOAQ 1J2VA 1KFSA 3R5JB 2F4VJ 4H4KA 2J6SA 3K5MA 1KEKA 2K1RB 2YWKA 2RMLA 2L08A 4M63A 3Q23A 2YKNB 2H5EA 2AGPA 3DI6B 1X0PA 4F7VA 4TQSA 2G2ZA 5KTQA 2M8HA 2EBEA 3QAUA 3MEGA 4FNIA 4I2PA 2C2ZB 5T7LB 4ZVFA 1NHUA 5KFJA 1DTTA 2WONB 2KH9A 3NGRA 2HQDA 3FEZA 4B9UA 4K4ZA 2CNOB 3GIMA 2AMCB 2CJBA 2UVRA 1DQ8A 3X1LB 2HHXA 1KQFB 3Q89A 3TO8A 3BF4A 2E1RA 3EGWB 1E6YB 1GH8A 2W7PA 3F56A 4YMEA 4RNNA 4USMA 1KC8T 1KTQA 4J9QA 1DAXA 2L9NA 1HHSA 2RHSB 1KR4A 1S6PB 4IO1A 4GC6A 1N5TA 2XY6A 3TUJC 4DUZF 4DQPA 2Y1LB 2YKQA 5HVFA 4DMZA 3AT1B 2CQPA 5KFFA 3IWLA 2CWXA 3CJKB 2BANA 3NGTA 1GX5A 1XC9A 4KGZB 3NGDA 2CQ0A 4F4YA 3NMAA 4QW9A 1RT2A 2R7OA 2BJ9A 3MTKA 1IXKA 1UEVA 2F40A 3MMBB 3TVZA 2E9RX 5K9FA 4USIA 2GJ2A 3QLHA 5L8RC 1UZHA 1TL1A 4ZIVA 3IS9A 1RLDA 3NS6A 3OFHA 2HMIA 3QRQA 2B4UA 1TV6A 1V9OA 2OPSA 1Q8BA 2KXFA 1FDNA 1WC0A 4ED5A 3M1VA 5DRKA 3JQKA 5CCMA 3H4BA 5E3QA 1AT1B 2YNIB 4D3GA 4I6WA 2AGOA 2DIUA 2XZDB 4ED7A 4W90B 4YFUA 5B0BA 3H2LA 1FRKA 1RT6B 4LF9J 4USWA 1VQYA 3N28A 5HP1B 1D8YA 2W9BA 4QR1A 3C6UA 4IG0B 5KFMA 3J7A1 2OLWA 4XAKA 4RW8A 4FPIA 2DR9A 2YX7A 3BM7A 1C1BB 1HHQA 5D77A 5E3CA 2PSZA 2JLGA 2VF3A 2QZ8A 3OTOF 4H4KC 5EWEA 3NGSA 4DCOB 2MZSA 4NX9A 4C3KA 1SCJB 2EKYA 5F8IA 1Q53A 4A8QA 4QIVA 2AU0A 2M52A 3I96A 3QGIA 3OFFA 2B6AB 4OJ1A 1GTHA 1JWWA 3FQKA 4OYAA 5F0UA 3K89A 4WK3A 4M5IA 5HBMB 1H2TZ 1S6QA 1HWJA 1KLMB 3HSZA 3BN7A 2ZKTA 1NK5A 4FN5A 2IJRA 3W2VB 4FVCA 1Y9OA 5J1EA 2ZBPA 2MKJA 3U27A 1YG0A 1VBXA 4MH8A 2R7WA 5A6PA 1MWQA 2DD8S 3MM5A 1CS4B 2DHXA 4RW7A 3GV5B 2YH0A 4Q0BB 1NJIT 4LRBA 4FBTA 1CULB 4GVLA 2JSXA 5ETMA 1X4BA 4PWDA 3TANA 2WVCA 2J8SA 3KG4A 4LF2A 1RT5B 4PABA 2Q66A 3NGKA 2J8AA 3BV8A 3AFGA 2KYXA 1FX2A 3TYTA 2LCWA 4FBUA 1RU2A 2XG8A 1JIHA 3GFYA 2R42A 5FDLA 4PQAA 1XNQF 3OUYB 5B0FA 1JQGA 2KXHA 1OS5A 3KK3B 3KMSA 4J9SA 1RWPB 2OFGX 5ETKA 1XIQA 2K3KA 1UVNA 1B4SA 4OZ2A 1X4HA 2A6OA 4OYPA 4DR1J 1EIYB 1HI1A 4A8MP 2MZRA 4B3TF 1PAEX 1NZ8A 1LXNA 1WG5A 1RHUB 4IUFA 2IVYA 2R8IA 2MDAA 2HGLA 2RU9A 3OJUA 1R0CB 5DDPC 1HWLA 4DPWA 2A3JA 3SV3A 2J5AA 1IBLF 1SJ3P 4IOCQ 2E44A 3THPA 3ELHA 4FS1A 4WBFA 1DHMA 1U0HA 4GVBB 3P96A 2WOMB 4O3NA 3SV4A 2M7SA 4TNOA 1T8EA 1J5EF 1TELA 1YI2S 2R8KA 1OY9A 2EFNA 2ADBA 3JTNA 3FMWA 4TYBA 3OTDA 4LUBA 2SXLA 1ZPVA 4A8SA 3RTVA 3KG0A 3DRRA 5GAHU 4B3SF 2F4VF 2DK2A 2FDNA 3FCVA 3TUPA 1OY6A 4K4WA 2H4YB 2VG5A 1RADB 3D7SB 3EE3A 2GZOA 2ZHBA 2HK2A 3BN4A 1WACA 1F9FA 3UDVA 2YXLA 3KLIB 4I7FA 1R3NA 3PKYA 2OHDA 3H8YA 1UJ4A 2JJ4D 1KD1T 4WXOA 3A8KA 4ZVTB 4FS2A 1V6HA 4O4GB 5K8MA 3MFHA 1FDAA 1R0BG 1LQ9A 3QRPA 2KG0A 2E1CA 2CQBA 3BPDA 5CZXA 1VS3A 4OZLA 2YH1A 3K17A 1NJWA 2HPUA 3BKUA 1Y3JA 4I68A 4DL7A 3C6TB 2QT7A 1VQPS 4ZHRB 4MMOA 1O0PA 2VPWB 1UP1A 3P5BP 2RILA 2M8DB 3CEDA 5ETOA 2W2QP 1O51A 3E8OA 2VPXB 1K9MT 4DL5A 3GG1A 1SB6A 1ZBTA 3Q8QB 2UXCJ 1U1MA 1HNZJ 3JB9k 3PZPA 4LSLB 3PKMA 2C3PA 5KT2A 4X84A 4N76A 2ZWOA 3VVUA 4RR5A 2NYIA 3VAFA 3W8GA 2BJ3A 5E5NA 1DBDA 2XULA 3MOJB 2NSCA 3ITHB 1T9YA 2JC0A 4OYIA 3PX4A 4JI3J 2BJ1A 5K14B 5KFBA 3TWZA 3OD2A 2DO4A 1E6VA 5IQQA 4KV8B 1F1BB 1FI4A 5ETSA 5DDOC 2FHMA 3OVAA 1BXNA 3VTIA 1WC1A 3W5YA 2FLNA 5I3UB 3R97A 1EX8A 2MSSA 1SI9A 2HVIA 1I94F 4A4JA 3TJ9A 3IG1A 4ZP8A 3FKBA 3R7NB 1CC7A 1HR0J 3QPIA 1U25A 3TA0A 3AOAA 3CWJA 1TMMA 3W2WB 1JJ4A 3C46A 2KRBA 4MK9A 5KT5A 3H90A 5AE2A 4X4VA 4O3RA 1B0PA 2NLWA 1DARA 4EUVA 2OELA 2JWNA 3OR1A 3WC2A 2ZE2A 2IBOA 3CW2C 3MEEA 1T3NA 4G3IA 2BJ7A 3PTWA 1REGX 4UZBA 2KYZA 2QLBB 5G0RB 3G9CA 2XLKA 2VDIA 1HARA 1TP7A 1RHKB 1W2IA 3W62A 4NEYA 3DLKB 4LBPA 5A2QU 1XEZA 3EVWA 1D0EA 1ZAVA 3KLEA 3QO9A 3G6ES 1ZA2B 2J9EA 4WWSA 1NU4A 5D0GA 4DFJA 2NCKL 2HLTA 4HKQA 2O67A 1KDNA 2PT0A 4UQGA 4ZVHA 3H5UA 3TVKA 1RAEB 3N0VA 4ZVQB 4WE1A 2LEAA 4MK8A 4DR4J 4UUWA 4IH7A 1WC4A 3J81U 4GO7X 2LXFA 1RQ0A 3K8WA 4PXEA 2HBYB 5KFPA 4ZCMA 7AT1B 3PYDA 3UVJB 1X5OA 1TU0B 2ZOGA 3LUYA 1NO8A 1ZM3A 3PW4A 4EU0A 4JV1A 4M5HA 2W9AA 3CD6S 5DLGA 4LR8A 3V6DA 1J5OA 2J0SD 2BYCA 2VBXA 4DR1F 1HBMA 2RQCA 2VOOA 3N5FA 1ITPA 2UZAA 2ZZMA 1X60A 2OPPB 4ANCA 2J0WA 4P7TA 4DV1J 4CM0A 5MAOA 1H98A 1JLFB 3FBEA 2BE9B 4U6PA 2XYPB 1X4FA 3TARA 3CJ8A 1XJWB 3KJQB 2E7WA 1EP4B 4RKUC 2AF6A 4WFZA 3C66A 4UOCA 2P2CB 4EWTA 3EXYA 2B9EA 1RAAB 3JTPA 1UA0A 4K4YA 3IBCB 4DV5J 1PBUA 4C8ZA 3CC7S 1IVZA 2A2DA 1RWKB 3NOCA 2VG7A 5C2GA 5D3GA 3UQSA 2IRUA 5KFZA 3R1HA 5I3QA 2BOAA 2DO0A 1N32J 2HAFA 2FJEB 1RXOB 1SC3B 4NYZA 3LO3A 2UUTA 3D3CJ 4Y0FA 4OZ3A 1JLGA 4NLDA 3T41A 1Q78A 3JSBA 1IQZA 3SBMA 1IKVA 5ETQA 3BSCA 3PX0A 3M9OB 4FVMA 1CJUB 3AAWB 2HZCA 1PC4A 2ASLA 3AB4B 1LNQA 3H7HB 4LREA 1BY9A 3CCLS 2K3IA 1NDKA 1TL7B 3LP1B 1VRUA 3NNAA 2DGXA 2YKPA 2HYIB 1U45A 3T5LA 5CHCB 1YRXA 3AJDA 2OAUA 1N54B 3TI0A 4X4UA 3KWMA 4EEYA 4HVZA 5G4DA 4CO2A 3A3PB 3DLEA 1YQHA 1G2EA 4UOGA 3AXMA 3MWBA 1M1KT 4P2SA 2C42A 5L1LA 3FCWA 1ICEB 2VJUA 5GAHI 4ZVOB 2R7TA 1SBRA 4PZVA 5KFCA 2V4JA 4F67A 3OTCA 2LA6A 1RBLA 4Z7CA 2PEBA 5EWFA 3J81Y 2HNZA 2XMMA 3W5XA 4LRFA 4C0OC 4RUAA 2HHWA 2HRYA 5K5MA 3FBCA 1JLEB 2O1PA 1ZM9A 2QL7B 5A0YA 3SYZA 2UXCF 2WW4A 5HI7A 1HNZF 1RTJA 4KPCA 1C0TB 4DV4J 2V69A 1H2VZ 1R8AA 2ZUGA 5AE3A 1QTNB 2R8GA 4NI2A 3LOUA 3MM9A 5DQGA 1UW4A 1WORA 2HFVA 4PXDA 4EO8A 4OYXA 2QFJA 1S59A 4YY3J 2FHJA 4UOHA 2QA1A 4JI3F 3RB3A 4CLYA 1YJ9S 2PMZD 2G0CA 3Q0AA 4LRCA 3MMCA 4M5MA 5L1KA 1UFKA 2F5GA 2EC0A 1MN7A 2W8KA 2V68A 4AUKA 2G2OA 4LQ3A 4E98A 3MDFA 4RW4B 1HR0F 3SCLE 2VG6B 2V2QA 2KRRA 3MR5A 2ZITA 1RUSA 1U6FA 4PG4A 5F9LA 2EK1A 4ED4A 2XNRA 1QY7A 4ANEA 5HMYA 1SC6A 4W4MA 1FRLA 2HRUA 2ZFHA 2OPQB 2XO6A 2I2YA 3LANA 1RZMA 2AP6A 2CPXA 3CB4A 5K8NA 4ED3A 3GMGA 4IDKB 4XK8C 2V8HA 1VQLS 5E41A 4TLQA 4F4WA 2GHWA 3SSQA 1K1QA 2BW2A 3H4DA 2NS1B 4OMFG 2V0NA 3GJTB 4ZVEA 5M2PA 1T9UA 5ETNA 3UPFA 3DLGB 4I2QA 2HHHF 2H54B 2HSEB 1CJVB 4HACA 2YQ1A 1NH7A 3KNGA 3MUTP 3IR5B 2HGNA 5D0RA 3R8YA 1KHWA 4G1IA 2CZ4A 5BJRA 3LWLA 2YNFB 3H42A 1TKZB 1WHXA 4C9DA 5J2NA 2OMLA 5ETTA 3RB0A 4DR4F 2G1HA 2GW8A 3M8ZA 3TAQA 5KFLA 2V2KA 2XLIA 2BQRA 3M7VA 5EGYA 1RAIB 1TVRB 3PXGa 2FYXA 4BLGA 3TQ1A 4RBTA 1AUSL 1WHYA 1T03A 3G8TA 4OZ0A 4OQJA 1TK0A 1FWLA 4C2MA 2VL1A 2OD4A 3RW7A 4R0JA 4H4OA 3BSNA 4CP5A 2D41A 4DR5J 4IG3A 2EG2A 2J76E 4DV1F 4JUZA 3K5PA 3E2EA 4KYZA 3VAIA 1PILA 1LWFB 2M5YA 2HHSA 1NM2A 2CJ9A 1FX4A 1N5VA 4USJC 2E5LJ 4Y2AA 2LYVA 1SL2A 2GIRA 4M5DA 3MECA 4LSNB 1T94A 1KP6A 2RUSA 2BX6A 4KFBB 1QUVA 3KUHA 6AT1B 4ZLPA 4F25A 3JSMA 1TL4A 4TY8A 5IZHA 3HPOA 2JEJA 1N32F 3U1MA 2YKMB 1N5SA 1RABB 3G86A 1RT4A 4FKXA 4IFYA 2JOQA 3MMAB 2VFUA 1WG4A 2RIJA 5LSRA 1SH0A 5KG6A 3M8PA 1BQNA 2I9SA 2KKHA 4HEA9 3MCNA 1X4CA 3GE9A 4NE9C 4CO4A 1AROP 3CMQA 1UMJA 2R7QA 5FIIA 1VRQC 1UPMB 1FXLA 2BXJA 3KUEA 3IC1A 2QA2A 3MCSA 2OTJS 3Q86A 2R8HA 3EGZA 1VCTA 4PYDA 2NXNA 1MG7A 1ZS6A 4NYOA 3RR7A 1KTVA 5CABA 4Z7YA 4RW9A 1NKCA 1YLXA 3AH6A 1RT1B 1FT8A 4B3OB 3IRXB 4C11B 4C8YA 2A2CA 4TYAA 3BR8A 3I0RB 2CPEA 3QIPA 1Q7LB 4PQUB 3FBFA 4WKYA 1T9TA 4KB7A 2JLFA 1I1GA 1N33J 1WF1A 1NK7A 2JRSA 4ALZA 2DXDA 1PYOB 3RAXA 3MPYA 3V81B 3GYXB 1U1NA 1KS2A 4D3HA 2J9DE 4ZCLA 2W9CA 3WIUA 1BQMB 3DOKA 2W2NP 2B4PA 3M05A 3TRGA 1C0UB 2AEFA 4Y28C 3DGVA 4WFNQ 1OSCA 5J2QA 4R5PB 1Y5NB 1UPPA 5C25B 2BABA 2FC8A 2P6SA 5GMEA 2K8GA 5AT1B 1D9FA 3BO2A 4DV4F 1D3WA 5AE1A 1YHQS 4J7CA 1WNEA 2G1DA 1RT3A 2CNNB 1U2CA 2D3UA 5LXRA 5HN0A 3KNAA 1VFJA 3L7PA 4DL3A 2KI2A 3HX9A 3PACA 1KLNA 1YBTA 4KO0B 4Q44A 1F60B 4KPYA 1MW7A 1IBCB 4PAAA 1OQ6A 1NSQA 3MM7B 3GTYX 1S0MA 3WX8A 2OEJA 4OYOA 4ZLLA 1VJQA 2VBYA 2OGUA 3PW7A 2DR8A 1JLQB 2FQQB 3MEKA 1VK8A 2VB6A 2ZD1B 4CLWA 3EYZA 4ZP7A 1RYSA 1IKYA 5DQHA 2R7UA 2HQ3A 4WFXA 1F3VA 1RWVB 2FZGB 5A8WB 2Q3PA 1X4DA 2ZWPA 3UWTA 2D3OR 3DRXA 2YY3A 2XMVA 2G9OA 2M0GB 1FEHA 3UCUP 1ZYQA 3CCUS 3DC2A 3HKWA 1ZOTA 3OVSA 3F41A 1DLOA 1PJ7A 1WSVA 1HYSA 3SQOP 4LMZA 3VAHA 4I56A 2EEYA 4MKYA 4F0HA 3OPKA 2KM8B 3MR7A 4E0DA 1N52B 1RWMB 4F4ZA 4XPCA 3Q8UA 5E33A 2BJDA 2QLFB 4BDPA 4C4WA 1ELOA 2LDIA 3DU6A 3CCZA 1T3OA 5GVQA 4FF4A 4E2FB 3P49B 2VQEJ 2XEXA 5KFGA 2FLLA 2ZM6J 2DEIA 3EGVA 3DRSB 1KQKA 1PC5A 5KG2A 2R7SA 3S8SA 4JYAF 3F44A 3V6HA 2W25A 5E0OA 3DRPB 3HM9A 4V1Ak 3GZ7A 9ATCB 1B70B 3I6PA 1M5PC 2XY5A 2G13A 1S76D 2FVQA 3IWXA 4I64A 1SJ1A 4YDXA 4ETZA 2VU5A 3OL7A 1HQEA 2CZ9A 3T1YF 4IR1A 3TUZC 2JLEA 1IKXA 3R5CA 3BYRA 5LT5A 4NOHA 4RJVA 5CYQA 3CCTA 2ZJPQ 1G1XA 4Q8EA 1CJTA 2HS4A 4HI1A 4DLGA 2RDJA 2C2RA 5KFVA 1NJZA 2HQFA 3BQ2A 4DFMA 2V63A 3DLJA 3EICA 2H5JB 1UVKA 2DKOB 2E7VA 4DR5F 3MPDA 1I51B 2CFXA 4DG1B 2AV5A 3OL9A 1TKXB 3KOAA 2ASYA 1REVB 2BE2B 2YX4A 3JSYA 4ZVUB 4ECQA 2BE7D 2VFRA 3M2VA 1VJWA 4ITSA 2AZ1A 3I82A 5KG1A 3DOLA 4L3NA 4CLZA 3P4UB 1TUGB 7FDRA 4NMXA 1NK4A 1U1RA 3C8YA 3G87A 3CCJS 3Q22A 1JNRB 5A8RB 3D67A 4OX8A 3VCDA 3MD1A 1OPIA 5B0GA 1LWEA 3PFEA 2PE8A 2F63A 5GAEU 3R5BA 1S72S 5IFMA 1B64A 1C4CA 2KB2A 2LFVA 3HCXA 4FF2A 4AL7A 1U49A 4K4VA 3PIOQ 3KTQA 3UFCX 4B9MA 2E9ZA 2Y0SD 1IUJA 2QFIA 5DQIA 2Z30B 3KK1A 3EXCX 3DRYA 3GFXA 3VGTA 1S10A 3L95X 4CI0B 5E3AA 2QSWA 1LWXA 1HMVA 3ZTOA 5DS7A 3BS9A 2XMAA 4UZCA 3K57A 4EZ6A 5D0HA 4OHVA 2XZTB 3GR0A 2BZ2A 1WOPA 3PR5B 1OYDA 2AJ2A 1S1TB 2O5DA 1Q81T 1HQUB 1F9HA 4LF7J 2DRDA 4YP3A 3V4MA 3M30B 3RBXA 1N33F 2IYIA 4K4XA 2GGPB 2AYMA 3F73A 2AEMA 5KFSA 4ZLNA 3EZOA 2B5JA 3T19A 2CPIA 1TQLA 1TL3A 4M5KA 2HHPA 1DQ9A 3BGLA 2HIQA 3BZQA 4YB7A 3QBCA 4B3MJ 2M3DA 5ETLA 5D15A 3A13A 2MYFA 3JQJA 1FXRA 1BGXT 2RSQA 3UDCA 1X9WA 3B4DA 1ZH5A 3CSKA 2GJIA 4TU7A 1KOHA 2BEFA 1IBKJ 4F2RA 1R6YA 2CJXB 3WC0A 1YBAA 1IM4A 2IDLA 2QMUB 2XCPA 1SVDA 2VC1A 3WDOA 4RUCA 4JI4F 1IJEB 1S4FA 5L38A 2F4FA 4ZVSB 4ECYA 2D7SA 4OV1A 3CT9A 4G1QA 1LK5A 2R2TA 1YRUA 4R8UB 4PWUA 2KO1A 1RGVA 1X5PA 1NUEA 3DGPA 3UN5A 2X1FA 2FIUA 4UQTA 3UD5A 3LP2A 5CYMA 1Z2ZA 2PN6A 1JLBA 2G2YA 4FF3A 1VIOA 4LF6F 1XBWA 3MR2A 8RUCA 1EKRA 2B43A 2WSCC 3BDEA 1AB8A 2AYGA 2AHOB 1S4EA 4BWJA 3M8QA 2C2DA 1NPKA 5IQ6A 1VQNS 2I5JA 2Z2MA 1VRTA 3AD7C 1WC3A 1EAYC 3FQLA 1JX4A 1SJRA 2QRRA 1R31A 2Q1LA 3VAKA 3ZTRA 3MF5A 1LWCB 3E01A 1S9EB 3V6JA 1SIWB 1T7PA 2ZC3A 3MOZA 2RDDA 2Z2ZA 1QD1A 3CJQA 2W7OA 5KOWA 1S1UB 3FRYA 3H0PA 2FC9A 2W2OP 3Q8RB 3Q8VA 3ZZZA 2VQFJ 2V9KA 5LM7E 3SMZA 1SXLA 4OZ1A 1W26A 4AD6A 3W8PA 3DDNA 2GVZA 4LFBJ 1K73T 4U7CA 2E1AA 4QIWD 2I8EA 5D78A 4K59A 1HWKA 5KFWA 4J9RA 3IBWA 1ZPWX 2Z2YB 3GFZA 4ID8A 1PKUA 3IGNA 3UNYA 1QLNA 4HT5A 3BKTA 2DIVA 2E5JA 4F26A 4ID5B 2EC2A 1IBMJ 2HWHA 2K1RA 4B9NA 3HO1A 1UZDA 2YKNA 1B0VA 2VG5B 4I6AA 3U1LA 1VGYA 3A12A 3CF5Q 4DX7A 1HNIB 2AYEA 5T7LA 1EQMA 4KGXB 3UR0A 2WONA 4C8NA 2P9CA 2J7KA 4K7QA 2EFQA 3MM6B 2BDPA 3HD1A 4Y65A 2RKIA 4F3QA 1O6XA 3M2UB 3NCQA 5KT7A 1VDHA 2HWIA 1C4AA 4J9LA 2V8DA 3QSYB 2QG9B 2L48A 4DV6J 1YKWA 3I9ZA 3ISZA 3KK2B 2O01C 1YZ7A 2VBWA 5F8HA 4N5SA 2XMWA 2Q43A 4UW2A 5H9EJ 1X5TA 2X1AA 3M32B 2EBGA 1S6PA 1TFYA 3T9ZA 1RAFB 1FNMA 3FC9A 1JXEA 1TUWA 2J7WA 1A7GE 3SZ2A 4ED2A 3MURP 2JFKA 3CJKA 1UW9A 4Y00A 3WX4A 2ZZTA 1NSPA 1HBOB 3MMBA 2DNQA 5IT4A 4CQ1A 5E3RA 2UV8A 1RI7A 1X8DA 5DETA 5HVGA 1XR7A 4OJGA 1C2PA 1R8BA 2QLWA 3HHLD 1NB2A 3S7RA 1UA1A 3BYPA 4ZJLA 4PG8A 3IO1A 2YNIA 2X3DA 1Y5IB 4WIIA 3QWUA 3NAHA 3G6VA 4OZNA 3OTEA 2P9EA 1WOOA 5I42B 2C3YA 2B7BB 3NAIA 1F5AA 1SQGA 1RT6A 2W7AA 3ZZUA 3QATA 4ILLA 5HP1A 4IG0A 1E6VB 4YB6A 4QWBA 3EWGA 1C1BA 4MIAA 3HJFA 1LXJA 2N3OA 3TA2A 1KVJA 5B08A 2IPOB 3O3LA 4DU7A 5CXTA 5LJ3Y 1YJWS 4ECSA 4DPOA 1N5YB 4LF7F 3TQEA 1IM6A 1IR1A 3GYGA 4ATNA 1M90T 3LQVA 2H3EB 3NMRA 1VQ6S 2B6AA 3EVMA 3M8YA 4YN3B 2RRBA 4DSFA 4IRCA 3W9IA 4MIBA 3GILA 4QWEA 4J91A 5HBMA 1B99A 4K2JA 3IGVA 4B3MF 3GWCA 4RPFA 2FZCB 2FJBB 2R9LA 2K06A 3CDBA 3HHNB 3W2VA 2KTQA 5L39A 3DOMB 3GV8B 2FPHX 5EUHA 1ZAWA 1X5SA 4BC9A 1JJ2R 2CJYB 4IH6A 2BKOA 1FRHA 5C42B 1T0TV 1CS4A 2XMTA 4ECZA 3N01A 1GQEA 4CT8A 3PHEA 4JOUA 5I3PA 4C8KA 2LKZA 2N4CA 5BR8J 1MWZA 4Q0BA 4HI2A 1CULA 4DPXA 3ZZ0A 3QSIA 3C14B 5MLCV 1RKIA 4X65J 4IYQA 2W01A 5DGAA 3GFHA 1S7HA 1RT5A 2Z4PA 1VIXA 1RLCL 1JLAB 3QAEA 4F2SA 4ETXA 1VC6A 1GMWA 1GXUA 5HATA 2VA2A 3GCWP 1S12A 1FO1A 3MPVA 2P8IA 4ES3A 1ZM2A 4C48A 1SV5B 5HK4A 5LJ5Y 4EMDA 1K1SA 1IQTA 3AA8A 5K8PA 3OUYA 2C3UA 4HHUA 4G6VB 2Z56B 3KK3A 1KKHA 3QJJA 4HHJA 1FVQA 2YPYA 2OSRA 2HBZB 5J2MB 2GIFA 1OQ3A 4A8OA 2HFUA 4RBUA 1SH2A 2F7VA 4ED8A 1YRTA 2LMIA 1PSDA 3MUMP 2QSFA 4QWDA 4OZJA 3PW2A 2HZAA 4C8MA 1TFWA 3WBZA 4R25A 3BGRB 3HULA 1ZM4A 1CSJA 3RRGA 4GVBA 2C3OA 3VQTA 2VQFF 3VVTA 2ZH6A 3ZZRA 3EZUA 4DX8H 3PY8A 4NXMJ 4K4UA 2WOMA 3OSNA 1FFWB 1P9QC 4ENOA 4KR0B 4LFBF 5IXUA 3Q2SC 1ZTTA 2HNYA 2WCXA 3Q24A 1M5SA 3VZHA 1GK8A 4QU7A 4IRKA 2A18A 4DJBA 4N56A 7FD1A 2AQ4A 5A6WA 1C1CB 4Z2XA 5EWGA 3GLJA 4RU2A 1IBMF 3N9UC 4C97A 2UVUA 2DYAA 2ZC4A 2DGVA 3G4SS 1PAUB 3A8JA 1IKVB 1U8SA 1Y3KA 4I1TA 5KFYA 1NNDA 4ICLB 2DXEA 1JK9B 1Q7YT 1MSWD 3UI3A 5ETRA 2W2MP 2E1PA 1HW8A 1OPZA 3IRWP 5J1NA 2MQLA 3DN9A 1RTIB 3KLIA 3CCVS 6FDRA 2DHGA 1I3OB 2CPJA 1IJFB 2DR6A 3T1HJ 2J9DA 4M94A 4BHQA 3JAMU 2J7UA 1WHWA 4NA3A 4DV6F 3VR1A 2V34A 3NS7B 4NLGA 1S1WB 4J9VA 3LPEA 1HI8A 5SUHA 1NBEB 3TJAA 4QPTA 3ZC4A 1A9NB 3DLEB 4X66F 3W3SA 4ZS6A 4MTPA 4B17A 3GU0A 2PI5A 4B9LA 3ETOA 3OV7A 2E29A 4P73A 1O5JA 3C6TA 3CE8A 2DNOA 4DR3J 5DO2A 4ZHRA 3D68A 1PJ5A 2FZKB 3KLGB 4URQU 3CO9A 2FLPA 4W92B 3DM2B 2JC1A 1KNZA 2MY8A 2CQ3A 4NL5A 3VALA 3CC2S 1Q95G 1U8WA 3ZZPA 1VISA 3TAPA 4DV7J 1R0AB 1D8ZA 1RACB 2ZJQQ 3EDQB 3I87A 2HWTA 1JKHB 3KJNB 1S49A 4B3SJ 2DHHA 1P1TA 2EKNA 4JV0A 4PKDB 4HTJA 3MEDB 5KFTA 3TNVA 3QIDA 1QDUB 1RHMB 3ITHA 2EPIA 5B0DA 2OFHX 4KHPJ 3SCJE 1OO0B 5CCLA 1FRJA 1Q1KA 2AEJA 2DY9A 4F4AA 5K14A 1RWNB 1N4LA 3W9HA 4EBDA 2XM3A 1S79A 3A4TA 2J6UA 1T9VA 1S0VA 3PEHA 3TZWA 2CQ1A 3HZGA 1HHTP 5B0EA 1NKBA 2ZBQA 3R27A 4WCEQ 4KV8A 2BBEA 4NLWA 3TAMB 3PEJA 4LFCF 2WB4A 4GC7A 2ZBRA 3FUYA 2DCLA 5I3UA 2JHEA 1RHQB 2M4MA 4UOFA 2XS7A 3QGHA 3W2WA 3P5TL 3G2XA 1N6QB 2QN6B 2KDOA 3NWRA 4NWBA 4RW6B 2E66A 2BJ8A 4WPAA 2IC3B 4HDHA 4FYVB 1T95A 4A46A 3TZXA 4K4SA 4OHZA 3OJSA 3W60A 3BO3A 2B4OA 4O3QA 1FXDA 4ERDA 3K8VA 4USKA 4Y2IA 4KJIA 2ZVIA 1IWGA 3D6HB 5G0RA 4UY85 4AYBD 4DL2A 3FBBA 4PXBA 3W1YC 3QJPA 1RHJB 3JYTA 4DUYJ 3ILLA 2HVEA 4B3RF 1VQKS 3DLKA 3JAMY 1PJ6A 3HHLB 4AFFA 5BR8F 4HACB 3POTB 4PPDA 1TKTB 1RAHB 1G6BA 1EJ7L 3N5BA 5M2UA 1R6VA 2GAHC 2MKIA 1D9AA 5FJ4A 4ZOSA 4X65F 3TP2A 1PIEA 2Z57B 2DXFA 2MQPA 4J9KA 2DT9A 1RTDB 3BBCA 3PCOB 3J81j 2GCFA 1H74A 1FNOA 2HG4A 3L7OA 4RNHA 3J7ZT 2IVMA 4DFKA 4PR6A 1I94J 3UVJA 4DQQA 3ILIA 4DL4A 4FKYA 2VPZB 4OYMA 4RLEA 4W98A 1SJFA 2OPRB 2X1GA 2XSJB 4CWBA 3QFWA 3AQPA 4N8NA 4LR7A 4KRWA 3MHYA 2AWZA 3O44A 5IWAF 3CCMS 2DNYA 3H40A 4MKAA 1DURA 4X62F 4O23A 2OPPA 4WF9Q 3RBDA 2VASA 5F8LA 2HBRB 3RB4A 1F6TA 1H7XA 1Q82T 2BRLA 3OBIA 1FWKA 1JLFA 3KJVB 4GKJJ 5BYSA 1RTZA 4DR2J 2CJAA 5FD1A 3R6LB 2DPJA 1SPBP 3UDLA 1IN0A 2POKA 4LFAJ 4NXMF 3HVAA 4ZVPB 3W64A 1KRPA 4OX7A 1LV5A 2CJQA 4Y3CA 5EX3A 4DQRA 3KDNA 4X4QA 2HNDB 1XNRJ 4WTOB 3DMJB 1TK8A 2PA8D 2OJ3A 3OXLA 3D6FB 1AFIA 4YHHJ 3OQ2A 1KVIA 2EXUA 5JUMA 2UXDF 5D8HB 2DH9A 2E1MC 1RYRA 2CQCA 3I5AA 1S6OA 2UVWA 4OJ3A 5CYJA 3CMAS 4JI8J 3UCZP 2ZH9A 1T9WA 3CDAA 5D6GA 2B9XA 2Z58B 5D0EA 3I56S 3SFGA 1CJUA 4F02A 2BOPA 2KVIA 3KLVA 1BHNA 1HQ2A 3LP1A 3R3TA 3G8QA 3LGHA 3T1HF 4WP3A 1FE4A 3FFIA 2GA7A 2DGTA 1QE1B 2C28A 4DEZA 2WVFA 3KHGA 3QT5A 1U1OA 1JXVA 1KHVA 1N0VC 3CVKA 2WAQD 1CQNA 3T5KA 3CCES 4CNZA 4LJMA 3VV2B 2MLYA 2DCUB 2FVCA 1U2RA 4DR3F 2DITA 3MM8B 2XWXA 2ILZA 2NYHA 3HLUA 2RF2B 3D0HE 2CYYA 2W4PA 1FKOA 3HFVA 3CXCR 1NH8A 4TN2A 3FSXA 3HHDA 1FESA 4S0MA 2LXIA 1R8PA 1YJUA 3ZZYA 1JLEA 4DV7F 1SQFA 1OYEA 3EVOA 1C0TA 3HD2A 4ELUA 2RRNA 4DV3F 3PRBA 1RT3B 2RAQA 4B02A 3V2UC 2VHGA 3FEYB 2R7RA 3B8HA 2DNLA 1X4AA 4QR0A 4MFBB 2CVEA 2E9TA 2YVSA 3SSSA 3TVYA 1X0FA 4P10A 2EFGA 4KHPF 4JI5J 1KWMA 3CGIA 1ZA1B 2OSQA 4DBQA 3DLBA 4ELTA 1KSPA 5B0CA 3IAS9 2YQ3A 3FVYA 4F0KA 2OMOA 1SUQB 2MSTA 3B78A 2VFSA 5F0WA 5IM0B 1FKPB 3LGMA 3AXKA 1QM9A 1HBUB 4DPUA 1SC4B 2NZCA 4L6V3 2AJ4A 4RW4A 2VG6A 3NEKA 2ZOMA 5KG7A 2LXUA 4IFVB 1RB0A 4QYZJ 3EMTA 5E7OB 1XMBA 5ETPA 4OI4A 3O6QA 4M95A 4KAIA 2OPQA 4ZPAA 1WF2A 4RWWA 1ROFA 5IC6B 1SJQA 4IDKA 1YX2A 2CWKA 3J7AN 5KFUA 3GIIA 1QJHA 1IR2A 3SCIE 1MWYA 1OIAA 1MN9A 4URGA 4QIFA 4DR6J 2Z0GA 1AA1B 4XIUA 3DLGA 1H0HB 4DUYF 2CKWA 2DGUA 1V5IB 3K5LA 2HURA 3H5SA 2BVZA 5BYQA 4DL0C 2HFOA 1CJVA 2Y8YA 1U7LA 5H9FJ 2DRAA 4NMLA 2WVDA 1U26A 3Q8PB 2HEKA 5KFKA 3VF0B 2YNFA 1RBOB 4I69A 1M5HA 1TKZA 5HMWA 1ULRA 2ATLA 3LGNA 4QYZK 2BMBA 4CZCA 2WBMA 2CJKA 1VQSA 1HNVB 2ZVSA 2NR0A 2L9DA 3H20A 2RHQB 3VAJA 1P8GA 1N36F 4YOEA 1IKXB 1IKWA 1OJ4A 4QQBA 4QU6A 2CADA 5A76A 1TVRA 1VC0A 1GTEA 3DFEA 3M4XA 3D6MB 2GO8A 3PVXA 2FHOB 4KC5A 2WBRA 3VAMA 2FLOA 3OL8A 3NS5A 2ZUAA 3MR3A 3IA0A 4GO5X 1S1VB 4K8RA 5K8OA 2XTJP 3O5TB 2DRBA 2F8MA 3FSYA 2D74B 1FFSB 2GV1A 3FSIA 2Y3YA 2ABYA 3KLFB 2F9JA 2G4BA 1PYTA 1XQIA 1NK8A 3BGOP 1IR0A 4KT0C 2UXBF 4J9OA 4NCBA 4PXCA 1LWFA 2H1YA 3RRHA 3EX7B 2MEWA 4J5OA 3J80U 2J0QD 1U2FA 4GKJF 4DR2F 1NXIA 5KFIA 1U4BA 3NLCA 2EG1A 3S01A 4N7TA 4LFAF 1YWXA 2F8EX 3FJ2A 5A8KB 4LSNA 4YDDB 1S9GB 5C24B 4KFBA 2FVRA 4M5NA 3FGVA 1VC5A 2HHHJ 1XNRF 4HTIA 2JEIA 1R27B 4YHHF 3PRDA 1WUUA 4ED6A 5KG5A 2YKMA 3T5HA 3CD7A 4ZN1A 3MMAA 4JI8F 1FNXH 5D4OA 4FXDA 4OYWA 3K5OA 3G8SA 2R2RA 1CPZA 2QE5A 4DQIA 3L09A 2VV5A 1EB0A 2XGQA 3QFHA 2DNHA 3HDSA 2V6AA 1SJ4P 1PGZA 4C3LA 3ZO7A 3K59A 3K0JA 2HS0A 3KUGA 4HH1A 2IM2A 2GO9A 2IRYA 3C2PA 1VQOS 4G1PA 4L76A 2KFYA 2C22A 3DYAB 3C15B 5LXYA 2N7CA 1RT1A 3CCRS 3CUNA 4B3OA 4WFBQ 2ZNZA 4R0EA 3ISND 3IRXA 4C11A 4Y6IA 4CIOA 4H4MB 1FF2A 3GP9A 3I0RA 2ZNYA 3V5RA 4PQUA 4ZCKA 2JVOA 4DUTA 4RNOA 3AY0A 3AD8C 1Q86T 3PM9A 1VR6A 4B9SA 3T1AA 2KHCA 3V81A 3PJ9A 2YTCA 1YIJS 4NLTA 4DX5A 3M9MB 4DXLA 3RUBL 1C0UA 5CD4H 5CD4A 4R5PA 3SQGB 5J2PB 3PV8A 1JLCB 3PW5A 1HWUA 4IRDA 3DLLQ 5C25A 1P6TA 3OXGA 2C2EA 2QMWA 3X3UA 2JFDA 4P52A 5LMNF 4P74A 3W7BA 3CJ2A 5HROB 4LIWA 2P9GA 3KXDA 2KFZA 4QWAA 3CPWR 2F65A 2EWHA 4KO0A 4KGKA 4NCGB 4LT6A 1LEOA 4JI5F 4MYTA 4CYUB 4PCQA 3UCGA 4QCLA 4Y2CA 4YR2A 1K44A 3MM7A 4USHA 2JX2A 4EO6A 3J80Y 3QZ7A 2GVDB 2BACA 1NDLA 1SIZA 4DV2F 5L9NA 2LQ9A 3EM1A 2BKNA 4DZ6A 3GYNA 2LQ5A 1JLQA 2GHVC 1M1HA 2ZD1A 1W7WA 1BC6A 4XTTA 3HHEA 5A2QY 4NCAA 1CG2A 2XYGB 3QJLA 5A8WA 3SEOA 4X64F 3M6XA 3IR6B 3D4JA 1UEKA 2DR7A 1HBNB 4LF5F 4EK2A 2L9WA 3PRVA 2PEHA 3K58A 2IHR1 3IFEA 2GC8A 3CO0P 2B4VA 2BRKA 5M2RA 4CLKA 2I0XA 4B9VA 4A8FA 1AZSB 4B08A 1WI6A 4Q45A 3BQ1A 4UUXA 4IR9A 2OP5A 2YNGB 2DNNA 1Y7PA 2HAIA 4DR6F 2Q79A 5JVGQ 1Q8LA 2KL8A 5T41A 1V3ZA 3HZEA 3ONQA 5CH7B 1ACMB 1M5KC 1A6LA 4CRJA 4DV0F 1FK9B 4PG6A 3ZTPA 3DRSA 1K0TA 1RA6A 5T14A 3T6BA 3I0SB 2VFVA 4NLYA 3AODA 4ZN3A 3BKFA 1EETB 3DRPA 3LPYA 5IT0A 3H2VE 2UUBF 2IM0A 3EZ5A 5HSPA 4PYAA 3AJ2A 8ATCB 3GJRB 1K0VA 1WF0A 2MKCA 1GMVA 4JI7J 4EYIB 1HKAA 1RSCA 2LDYA 4X4RA 2HIYA 3DKDA 3CCWA 4MKBA 1R8CA 1RCOB 3C16B 5D4PA 1IWAA 5F9NA 1CQMA 1L3VA 4IOBA 2RKIB 2AIRB 1FJEB 5B09A 2MJNA 5DM7Q 4F50A 2RUGA 2MLXA 3MR6A 3R6GB 4JV5J 4ZITA 4MAKA 5DG9A 3THTA 4DCPB 3D2WA 1NPPA 4DSEA 1BWEA 2ZH4A 4OJHA 1YVFA 4KKOB 3OFGA 2CDRB 4DG1A 1WKJA 1TKXA 4ZDNA 2GMLA 1REVA 2BE2A 5DGBA 2NXEA 4WYLA 2KJWA 1QTMA 2EW9A 1UWBB 2VJVA 2NUUG 3VGVA 2WVEA 3BSAA 1Y4ZB 1YJTA 5HL7Q 4L75A 2HRTA 2KJVA 2XS5A 1N88A 3UNGC 2V8VA 3H2UB 3I4PA 2VIHA 2C2MB 5A8RA 1NLKL 1X4GA 4I6YA 4Q2LA 2IJNA 4K0KJ 2NREA 1DTQB 5IS2A 2KN4A 3LP0B 3OHBA 4V19X 1S1XB 4JYAJ 2BM0A 2HFZA 5JVHQ 3M2RB 1MROB 4KIAA 1XK8A 3AQOA 5L9XA 1U1KA 5RUBA 1UVLA 4U7UK 3R5AA 1XR5A 1BWVA 5KOXA 3PNIA 2KM8C 4CTAB 5E3PA 1H6KX 4WU2A 1TTHB 2KXNB 3T1YJ 4L73A 2YWFA 3VWSA 2W4CA 2CPDA 2GHPA 2IM1A 2R7XA 3ZZOA 1LW2B 4AE5A 2NPIA 3ENVA 2MZJA 1HPZB 4BWMA 4FDFA 3EGNA 5KAKA 2IA0A 2PGCA 3LALA 4P72A 1S1TA 1HQUA 1B0TA 2VC0A 4P75A 5KT4A 2B8PA 4HH0A 3M30A 2WSEC 5DDQC 1U09A 2GGPA 3KHHA 4IKAA 3J7Z5 3A8IA 3B4MA 3OR2B 4J37A 4JI2J 2IM3A 5KFDA 1YDLA 2Y8WA 2ZHOA 1G3OA 4JV2A 2VD3A 4ED1A 3GPAA 2MQOA 2NSBA 4WK1A 1TZ0A 2YWEA 3I55S 4ECWA 3ZTQA 2JZ5A 2KG1A 1MU2B 5LMUJ 4I0WA 3MAAB 4M1KA 3PDNA 3QNWB 1TK5A 1EQ0A 4N41A 4HYKA 5JMNA 1VQ8S 4C8OA 4F3MA 2H65B 4O44B 3R7SB 2MMYA 4DN9A 1VBKA 2RQMA 2H48B 3TEGA 3QRRA 2IIHA 2XI2A 2YPZA 4YB1P 4TQRA 3BGFA 3RAMA 2PI4A 5HLFB 4QIEA 2IAJB 3IP0A 4WXWA 1RT7B 4R8UA 1SKUB 3O2IA 4AXIA 2FTRA 1H2UX 3CIZA 1P1LA 4ZJQA 1HI0P 1CEZA 2DPIA 2GAGC 2ZH3A 2EVZA 2MB0B 3MMJA 4Q8FA 4AXJA 1VOMA 4O3SA 1FJCA 4DSKA 4K5RA 1R7IA 3W61A 3V4IA 5HMXA 4KQZA 5GADU 3FCHA 1H72C 2KVQE 4QBUA 1BQXA 5L46A 3O8WA 2HVZA 2AD9A 3OTBA 1OWXA 3DU5A 2O66A 3HVTB 4LBHA 2H5IB 1X7VA 2FJAB 3TR5A 1QAXA 4PUOB 3D0IE 3JXOA 4DPYA 1LWCA 1S9EA 3R5GA 3R1LA 2H9ZA 3ZFVA 3KLHA 1S1UA 1QUPA 2MQQA 2K2PA 4CDIA 1OY8A 1M5OC 1XMQJ 3UN2A 1MMDA 1WEYA 2YNHB 1UFWA 4ZA1A 4BBYA 2HNYB 5C5JA 5DZ6A 2MGZB 4A8XA 3RAQA 1JMTA 3IAM9 1NAQA 4JI4J 2XYHB 4LRAA 4KGMA 4GMKA 2RB7A 3TW0A 3ET6B 2AZ3A 3NBPB 3A3NB 4ID5A 3VQSA 3NRBA 1RTHB 2BQ3A 1R89A 3N79A 1CC8A 2V4QA 2QIFA 1UAWA 3D28A 1VQ9S 2RDIA 2W24A 4JI7F 4ED0A 1HNIA 3TX0A 3MZIA 3BPSP 2IMWP 3D66A 2D9OA 4NXNJ 4CO5A 3MM6A 2A10A 2F9DA 4EGLA 3UO0A 4LF6J 4F3OA 2QC3A 3M2UA 1AW0A 2QGFB 3QWPA 2JL9A 2J6TA 5L1JA 4U7UD 2CPFA 3BR9A 1NJXA 1UEUA 3CJRA 4JV5F 1SKRA 3IXQA 3KK2A 5K20B 5THWA 1NEEA 1AFJA 1M0SA 1D09B 4F36A 1NB7A 4WFAQ 3RB6A 5HANA 3A1YG 3M32A 4XDDA 2AW0A 3QMQA 4QR2A 2DNMA 2H4WB 2MY7A 4FYWB 4HLBA 1CJKB 2VONA 2FY1A 2AJQA 3SDEB 3QGPA 4CLLA 3G82B 4DHVA 1HBOA 4BCAA 2ZHAA 3G6YA 3ZXWA 2XI3A 2ZH5A 4K0KF 1APSA 4U8VA 5GMDA 3D5MA 3VZIA 5KFEA 2DNZA 4V19J 1XN9A 2B9YA 3BJYA 4USVA 4B9TA 4ANDA 2IFXA 4ZPBA 3U02A 2FGOA 4JI6J 3GIRA 3TOQA 1N5QA 3I31A 2H51B 4F0MA 3NG8A 1N48A 5I42A 1NK9A 4WU3A 3U7JA 1KQGB 5J1PA 3ZNJ1 4X4PA 2JEFA 2KT5A 3MEGB 3L9ZA 1WI8A 4LF9F 3M9NB 4I2PB 2VDHA 2Y9HA 1DTTB 4DWIA 2RVJA 1H3DA 2RT3A 1KN6A 1FD2A 3M6WA 4HT7A 1Y00A 2UU9J 1NRKA 4IQXA 2XS2A 5F8GA 1TMJA 3R9LA 2QTWA 2ALZA 1QSSA 3CD5A 3U1NA 1DJ0A 1HW9A 3LF0A 4JI0J 4UY8T 2WSFC 4ZCIA 1N5YA 4C6AA 4FNHA 2ZZNA 4AQYJ 4P6QA 4ECRA 2HFNA 4I4BA 4I67A 1ZZFA 1WHVA 4ZPDA 3NGUA 1U1PA 2BJEA 2BANB 4LF4J 4CCHA 4NLUA 1FRXA 4JI2F 2PFDA 2A6MA 1TAQA 3CTRA 3CJSA 1RT2B 2RQKA 1P27B 2B7CB 1Q5YA 1PBAA 4WFYA 3T3FA 3DOMA 3QLHB 2XWYA 1TL1B 3IS9B 5LMUF 2HMIB 3F0NA 1TV6B 2OPSB 3T6JA 1U6ZA 5AJ3J 1WTBA 3AJ1A 1J27A 3W65A 5C42A 3JYTB 3M1VB 1Z1ZA 1HD1A 1YITS 1L3UA 4RUHA 4K2XA 3BBBA 1VK3A 1UL3A 4CH0S 1U47A 2GFFA 2HW3A 1X31C 3C14A 4OI1A 4GRSA 1UJ5A 3HF5A 4UF4A 4HR2A 2GS8A 2W9BB 3C6UB 3ETMA 1JLAA 2EK6A 4RW8B 2YWHA 3KJFB 3IBFB 2VPYB 3N4WA 2D69A 4H54A 2GJFA 5DZ7A 4YR0A 5LL6d 1RJJA 1GMUA 2CA9A 5HVHA 1SV5A 2MKSA 1FJ7A 4DF8A 1ZTWA 5DM6Q 4N47A 3GIKA 1XERA 3BH6B 4LVNP 2HQIA 4WZMA 3CDUA 4WZQA 4X2BA 5KFQA 2C2KB 1YJRA 3W63A 1VQMS 5J2MA 3LAMA 4F4KA 1UTAA 1AXQA 4TXSA 1NZAA 2V8PA 3LTOA 2DGWA 3RRKA 1MNEA 3WZ0A 1S6QB 1QAYA 1GXTA 1RDRA 3HJVA 4C8LA 3NNCA 1T9XA 3BGRA 5ITHA 2LEPA 5KG4A 5J1EB 3TJ8A 1BLUA 1JJCB 3N6MA 2LU2A 1XMQF 2UP1A 4LRDA 3MM5B 1N34J 4RW7B 2AJFE 1FERA 2E7XA 3L3CA 3R7BB 5HJXA 2FB0A 3ENWA 3EPGA 1TKDA 3SFUA 1FDDA 3HFKA 4OYZA 1YK9A 3RYLA 1HFEL 3H5XA 2DR5A 1C1CA 4QYRA 1LW0A 2DJWA 3M8RA 4ECTA 4PWDB 3CIMA 2XNQA 4JB8B 1S5ZA 2KT3A 4CT9A 1NMEB 5GADI 4ICLA 1DQAA 4ES1A 5LSLA 5GAGU 4NXNF 3G96A 4DS5A 4ECVA 2ZJRQ 3OVBA 2DNKA 1RTIA 2IRXA 4KGVB 5FDLB 4P9SA 3MD3A 3NNHA 4P2XA 4RNMA 3RBEA 3FFIB 2P5VA 1WC5A 2VFTA 2JDJA 1S1WA 4N8OA 3CC4S 2BA9A 4OI3A 2ZBCA 4ILMA 2LU1A 2LECA 3E3XA 4M5JA 4NRTA 1L3TA 4LBIA 5KFRA 3KYLA 2LQJA 4P2MA 1P9YA 4NLQA 3KDOA 4DOZA 3VHQA 2HQCA 4FYDA 2CIMA 3I9V9 1U0HB 5HJYA 5KFHA 3KLGA 2CQIA 1S9FA 1KONA 1WOSA 1FKOB 3HT3A 2CG4A 1CLFA 3QGGA 4ER8A 2QLXA 3DM2A 1PYSB 4C7QA 2OH2A 5HQ8A 3NCRA 1T05A 2APOA 1JB0C 1R0AA 3LH2S 3BQ0A 3PIPQ 3AD9C 4NRUA 3ENAA 3DRRB 5KFNA 1JKHA 1YJ7A 2DGQA 2B51A 4NLOA 2EFPA 1WC6A 4JI6F 4XO0A 3AOBA 3MEDA 4FZVA 2C2NA 1Z2LA 1F9EB 2FHJD 2RS8A 3DI6A 2WK4A 2PC6A 2I1RA 3ADAC 5E2QA 1HL6A 3HFZB 3OW2R 2J0XA 2WW8A 1S0NA 5AXKA 4XPEA 2VUGA 2D3ZA 3M8SA 2KFNA 2ASJA 4I7FB 5KG3A 2L3MA 1MMLA 2UU9F 4Q2MA 3TAMA 4X4NA 1QAJA 3T5JA 2F3JA 2ZH2A 5JXSA 2PIIA 2GMHA 3GSDA 4OHWA 4JI0F 4WIQA 5SZTA 2CQGA 2HVHA 3CJ4A 1E6YA 1RCXB 4C3MA 1N6QA 2M2BA 1V5VA 4ZLJA 1GT8A 2LQ8A 4X66J 2OTLS 2HHUA 4RW6A 3KG1A 1YJVA 6FD1A 2X51A 4AQYF 1S48A 2IC3A 4MJKA 2G0JA 4JBCA 3K2YA 2UVVA 3M6UA 4FP9A 5ADZA 2PFFB 4YEAA 1S57A 3S1TA 4J9MA 1B3TA 4LF4F 4F04B 2ACYA 1UCNA 4DN0A 5F3TA 4X4OA 2RJZA 3P6YC 3HMJG 2HFSA 2MTLA 1A0OB 3TZYA 3W66A 1Y5LB 2DB1A 1S97A 1SC1B 4CLSA 4DS4A 1K8AT 4FXVA 5AJ3F 2V4RA 2ZBIA 1UJ6A 1BMQB 3UN3A 3K5NA 5ETVA 2Z2LA 3GR1A 2OKQA 4MYUA 2WHOA 3HHLA 4EFAC 3HP6A 4CO1A 3POTA 3CULA 3CCQS 2HQGA 1TKTA 4L3KA 2ILYA 1XWLA 1F5CA 3GSIA 1R43A 2PD1A 5H9EK 2EFOA 3MFIA 5JJBA 3S6EA 3WQPA 2CRLA 2GQCA 1RTDA 4ZK7M 1PCAA 5HO4A 2U1AA 5IV3A 3SCKE 2V67A 4LFCJ 1IKWB 2MZQA 4USTA 4CO0A 3IG1B 3TZZA 4Q43A 2OPRA 2W2PP 1KFDA 1G4CA 2PDAA 2XSJA 4M5GA 1HNWJ 1VLOA 2AYBA 2JEGA 1QSYA 2XY7A 1WDTA 2ZKUA 3VAGA 2V94A 2CPZA 5EN1A 2ROPA 4U95A 1FVSA 3OR1B 5D4NA 3ZNUA 3G71S 2N3LA 2ZE2B 4EZ9A 3KHLA 4OX6A 1KLMA
chains in the Genus database with same CATH topology
1IUJA 4H4KC 5EWEA 1AUDA 5DQIA 4HTIA 3MEEB 4PRFA 2MZSA 2JEIA 1R27B 2N4DA 4YHHF 4NX9A 3KJVA 2MJUA 3PRDA 4C3KA 2EKYA 5F8IA 3KK1A 2CQ4A 3FRZA 1Q53A 3EXCX 4ED6A 5KG5A 4YB5A 3DRYA 3GFXA 2YKMA 3T5HA 4A8QA 4QIVA 2AU0A 4RU9A 2M52A 3I96A 2NPFA 1S10A 3CD7A 4IH5A 2PMHA 2R4FA 3OFFA 3QGIA 2I38A 3L95X 3MMAA 4CI0B 4JI8F 3CJ5A 1FNXH 2B6AB 5E3AA 2QSWA 1HMVA 3BEGB 5D4OA 4OJ1A 4FXDA 5DS7A 1GTHA 3BS9A 1JWWA 3K57A 5F8NA 2JVRA 4EZ6A 3FQKA 5F0UA 4WK3A 3K5OA 4OHVA 1N34F 3GR0A 2M88A 4DV5F 5HBMB 3G8SA 2R2RA 1CPZA 2BZ2A 2QE5A 1H2TZ 4DQIA 3PR5B 3L09A 1S6QA 1HWJA 1KLMB 2VV5A 3BN7A 2ZKTA 2HNDA 2XGQA 3V6KA 3DMJA 1NK5A 2DNHA 3KLEB 1S1TB 3HDSA 3QO9B 4FN5A 2O5DA 2KZMA 1N0UA 1Q81T 1HQUB 1SJ4P 2MQMA 2KT2A 1PGZA 3W2VB 4FVCA 4C3LA 4YP3A 1Y9OA 5J1EA 3K0JA 3K59A 3RU0A 3V4MA 2MKJA 3M30B 2HS0A 1N33F 2IYIA 4TKTA 4K4XA 2GGPB 4Q7AA 3U27A 2AYMA 2IM2A 4HH1A 2GX8A 3F73A 1YG0A 2GO9A 2IRYA 1VBXA 5KFSA 3C2PA 1VQOS 4G1PA 4MH8A 2R7WA 2IBKA 5A6PA 2KFYA 2C22A 3DYAB 1WEZA 2B5JA 3T19A 5LXYA 2CPIA 2DD8S 2N7CA 1TQLA 1TL3A 2HHPA 1DQ9A 3MM5A 1RT1A 4WE1B 3BGLA 2DHXA 3CCRS 3CUNA 4RW7A 4B3OA 2HIQA 4WFBQ 2ZNZA 2CPYA 3BZQA 4NLRA 4R0EA 4YB7A 3ISND 3GV5B 3IRXA 4C11A 2OO4A 2YH0A 4Y6IA 4NZ7A 1VHFA 2M3DA 4QJVA 4Q0BB 2MYFA 4CIOA 1NJIT 1FRIA 1FXRA 4H4MB 1FF2A 4QOTA 1BGXT 2RSQA 1SQEA 3I0RA 3UDCA 2DNGA 4FBTA 2ZNYA 4HDGA 3BDPA 3V5RA 3MI7X 4PQUA 2JSXA 1X9WA 1X4BA 4ZCKA 3B4DA 2JVOA 3PX6A 4PWDA 3TANA 4RNOA 3AY0A 1ZH5A 3CSKA 3KG4A 2GJIA 4NZ6A 4TU7A 1RT5B 3HHLC 1Q86T 3PM9A 4B9SA 3I4HX 3T1AA 1KOHA 2KHCA 2FD2A 5DG8A 1FRMA 3V81A 4F2RA 2Q66A 2YTCA 1YIJS 4NLTA 3NGKA 3M9MB 5CA5A 1YTYA 2J8AA 4QW8A 1R6YA 2ZH7A 4ZPTR 3V6DB 1J5OB 2KYXA 1QE1A 3TYTA 1C0UA 3WC0A 1YBAA 4TU8A 1HBMB 2ASDA 1VQ7S 3FZ2A 1IM4A 2VKZG 2RRAA 5CD4H 4DSLA 2XCPA 4OLOA 2VC1A 2LCWA 3WDOA 4FBUA 4RUCA 4JI4F 2XG8A 1IJEB 2BUNA 1N8RT 4R5PA 3SQGB 1MMNA 5J2PB 1Q8IA 3PV8A 4BC7A 1JLCB 3PW5A 1HWUA 4TLRA 1S4FA 5L38A 4IRDA 1JIHA 3GFYA 3DLLQ 5C25A 5FDLA 4PQAA 1XNQF 4ECYA 1P6TA 4CO3A 3OUYB 5B0FA 2D7SA 3OXGA 2C2EA 2KXHA 4OV1A 2AJ1A 1PO6A 3CT9A 4G1QA 1OS5A 2QMWA 3X3UA 3KK3B 2JFDA 3KMSA 4J9SA 5LMNF 1LK5A 3MM8A 2R2TA 3W7BA 3CJ2A 5DJBA 4KHRA 2OFGX 1YRUA 3MTJA 4R8UB 5HROB 4PWUA 4LIWA 2P9GA 2KO1A 2K3KA 2CPHA 1UVNA 2RF2A 1RGVA 1X5PA 2VKRA 1X4HA 3DGPA 2KFZA 2X1FA 2FIUA 4QWAA 1HI1A 3CPWR 4A8MP 4UQTA 2EWHA 2MZRA 4B3TF 4KO0A 4KGKA 4NCGB 3LP2A 5CYMA 4LT6A 1LXNA 1WG5A 2AGQA 1S6UA 4IUFA 1Z2ZA 2FJVA 2IVYA 2R8IA 2PN6A 2MDAA 2DTJA 4JI5F 4MYTA 1UKUA 4PCQA 3UCGA 2HGLA 4QCLA 2RU9A 4Y2CA 2VG7B 3NP5A 4YR2A 1JLBA 3OJUA 5D3GB 4FF3A 5DDPC 3CDEA 1HWLA 1VIOA 3MM7A 4USHA 4LF6F 2A3JA 1XBWA 3MR2A 5GAGI 2JX2A 4P7VA 2J5AA 3SV3A 2CVIA 4EO6A 1IBLF 1SJ3P 4IOCQ 2E44A 2B43A 2WSCC 3J80Y 2BACA 3THPA 3QZ7A 4FS1A 3BDEA 1DRZA 1DHMA 1SIZA 2AYGA 3BO4A 4DV2F 4BWJA 3M8QA 5L9NA 2LQ9A 2C2DA 1JLGB 3CJ0A 5IQ6A 3GYNA 3P96A 2WOMB 2LQ5A 1VQNS 4O3NA 3SV4A 1JLQA 2I5JA 4MFBA 3ENQA 2M7SA 4NPOA 4ZKAA 4RBVA 4TNOA 2Z2MA 1VRTA 1WWHA 2GHVC 2ZD1A 4YY3F 1T8EA 1BC6A 1J5EF 3HHEA 3FQLA 1YI2S 2R8KA 5A2QY 1FD8A 4NCAA 2B0GA 1SJRA 1RKJA 4L72B 1JX4A 2EFNA 4OHYA 2NZ4A 2QRRA 1CG2A 2ADBA 1R31A 2Q1LA 3JTNA 3FMWA 3VAKA 4TYBA 3OTDA 1X9SA 3QJLA 3MF5A 5A8WA 4LUBA 1H7WA 2SXLA 4O3PA 3SEOA 1ZPVA 1LWCB 4WJBA 3E01A 4X64F 4QPXA 3RTVA 4A8SA 1VMBA 3DRRA 1S9EB 2DBBA 3KG0A 3M6XA 3V6JA 4OI0A 1SIWB 3IR6B 1T7PA 2ZC3A 5GAHU 4B3SF 3MOZA 2DR7A 2F4VF 2W7OA 5KOWA 1HBNB 1S1UB 2WB1D 1VRUB 3FRYA 4LF5F 2FC9A 1SUQA 3Q8RB 2L9WA 3E51A 2WRMA 3ZZZA 2DK2A 2FDNA 2V9KA 3SMZA 1SXLA 2PEHA 3K58A 1URNA 2IHR1 4OZ1A 5U47A 3IFEA 5IM0A 1FKPA 4K4WA 2GC8A 4WKRA 4Z37A 2VG5A 3DDNA 2B4VA 1HBUA 2BRKA 5M2RA 1LFWA 2I0XA 1K73T 2GNKA 4U7CA 4B9VA 4CH7A 2E1AA 4QIWD 3Q8SB 2ZHBA 4A8FA 2XB2D 4O4GA 1WI6A 2I8EA 4B08A 4Q45A 5D78A 3D0GE 2Q6BA 4K59A 3BQ1A 1HWKA 5KFWA 4J9RA 3IBWA 4UUXA 1ZPWX 3GFZA 4ID8A 4Y2MA 3BN4A 3IGNA 1WACA 4IR9A 2OP5A 2YNGB 1QLNA 4HT5A 1GAOA 1F9FA 2DIVA 2N7YA 2ERRA 4IFVA 2DNNA 4ES2A 1Y7PA 1L3SA 2RQ4A 2E5JA 2HAIA 3KLIB 1U1QA 1JXLA 4I7FA 1R3NA 4F26A 4ID5B 3PKYA 4DR6F 2COLA 2HWHA 2Q79A 5JVGQ 5F41A 1Q8LA 3H8YA 2K1RA 3CMES 1UJ4A 2JJ4D 4B9NA 3HO1A 2EI5A 2YKNA 5T41A 1B0VA 4NA1A 3GV7B 2VG5B 1KD1T 1G7CB 1V3ZA 3HZEA 4I6AA 4WXOA 3U1LA 3ONQA 5CH7B 1VGYA 4X4TA 1LFPA 1M5KC 1L3KA 1A6LA 3CF5Q 4DV0F 2V4JB 4FS2A 1HNIB 1FK9B 2AYEA 1V6HA 4PG6A 3HKZD 4O4GB 5K8MA 2B56A 3MFHA 1FDAA 3UD4P 3DRSA 1LQ9A 2HNZB 5T7LA 3NKYA 3IN5A 1K0TA 5EDWA 1RA6A 3BGUA 2KG0A 5T14A 3THVA 3T6BA 2E1CA 3UR0A 3I0SB 2CQBA 2WONA 4C8NA 5A0YB 2P9CA 2J7KA 1UVJA 5CZXA 2EFQA 2VFVA 3MM6B 1VS3A 4NLYA 4OZLA 1URRA 4LVOP 5KT6A 2YH1A 2BDPA 4Y65A 4ZP6A 1EETB 2RKIA 4F3QA 4DF4A 3DRPA 5L1IA 1NJWA 2HPUA 3LPYA 5IT0A 1RTJB 3M2UB 3NCQA 5HMZA 5KT7A 3H2VE 2UUBF 1Y3JA 4I68A 1SKSA 4LSLA 2HWIA 2IM0A 3EZ5A 4DL7A 3C6TB 1C4AA 2QT7A 4J9LA 3AA9A 2V8DA 4DLEA 1VQPS 3AJ2A 4ZHRB 2L48A 1WF0A 1K0VA 2MKCA 4MMOA 2FJXA 3A8EA 4EYIB 1O0PA 2VPWB 2ZDOA 1UP1A 2LDYA 4X4RA 3I9ZA 2QO3A 3CCWA 2RILA 3ISZA 4MKBA 2O01C 3KK2B 2M8DB 3CEDA 4KE5A 1R8CA 2E5GA 3MM9B 2HHTA 2VBWA 3SSRA 2IJFA 5D4PA 1O51A 5F9NA 3E8OA 5F8HA 4N5SA 2XMWA 2Q43A 1CQMA 4UW2A 2VPXB 5H9EJ 1L3VA 1K9MT 1X5TA 4IOBA 4DL5A 2X1AA 3M32B 3GG1A 1SB6A 2EBGA 1S6PA 1ZBTA 3DXBA 2MZ1A 3Q8QB 1TFYA 3T9ZA 1U1MA 2RKIB 1FNMA 3JB9k 2YKOA 1JXEA 1FJEB 3PZPA 4LSLB 3PKMA 2J7WA 2C3PA 5KT2A 4X84A 5B09A 1X9MA 2MJNA 1A7GE 2FVPA 5DM7Q 4F50A 2RUGA 3SZ2A 4ED2A 3MURP 2JFKA 3ULHA 4N76A 5FLXY 2NYIA 3MR6A 3VAFA 3MMCB 4OFZA 3KMQA 3CJKA 2E5HA 5E5NA 1DBDA 2XULA 1HNVA 3EUNA 4MAKA 5DG9A 4DSIA 2NQPA 3MOJB 3THTA 4Y00A 1RWUA 3D2WA 2NXUA 3WX4A 4DSEA 1FCAA 2NSCA 1BWEA 3ITHB 1HBOB 4Q5VA 2ZH4A 3MMBA 4OJHA 4OHXA 2HLUA 1YVFA 1R8HA 2QMXA 3OFGA 4KKOB 4DG1A 3J7YU 2RE1A 2JC0A 2LEBA 2DVIA 1TKXA 2DNQA 4ZDNA 4CQ1A 5IT4A 3PX4A 2GMLA 5E3RA 1REVA 2BE2A 5DGBA 2UV8A 5K14B 1RI7A 2KJWA 4WYLA 2EW9A 5KFBA 1QTMA 1UWBB 4ECUA 1X8DA 5DETA 1XR7A 2NUUG 3BSAA 4OJGA 1C2PA 1S1VA 2DO4A 1Y4ZB 1R8BA 2RD5C 2QLWA 2QA4S 1E6VA 1YJTA 3HHLD 5IQQA 3S7RA 5HL7Q 1HNWF 2KJVA 1UA1A 2XS5A 4PG8A 3IO1A 4KV8B 1N88A 4MK7A 3UNGC 2YNIA 2V8VA 5DDOC 2FHMA 3OVAA 3H2UB 4K4TA 3I4PA 3VTIA 1Y5IB 2HGMA 4WIIA 3QWUA 3OSPA 2FLNA 5A8RA 3NAHA 3NWGA 3G6VA 4OZNA 3KLFA 5I3UB 1VBZA 2MSSA 1Q16B 1SI9A 3OTEA 2P9EA 2HVIA 1I94F 2HHVA 1O8BA 2C3YA 4A4JA 5I42B 1X4GA 4ILRA 4I6YA 3KHRA 3IG1A 4Q2LA 2IJNA 4ZP8A 2B7BB 3NAIA 1F5AA 1CC7A 2DISA 3OLBA 1RT6A 2HS3A 1U25A 3QPIA 3CWJA 3TA0A 3W2WB 2W7AA 1JJ4A 2NREA 1DTQB 3ZZUA 5IS2A 3C46A 2KRBA 2KN4A 2XBPA 3LP0B 5HP1A 4ILLA 2E5LF 4MK9A 4IG0A 5KT5A 3OHBA 4V19X 1E6VB 1S1XB 5AE2A 2BM0A 2HFZA 5JVHQ 3B82A 4YB6A 4X4VA 3M2RB 1MROB 4KIAA 1XK8A 3AQOA 5L9XA 1S99A 4QWBA 3UW1A 2IA6A 5A8KA 1U1KA 1C1BA 4MIAA 4O3RA 1B0PA 2NLWA 1UVLA 3HJFA 3HHKA 1LXJA 4U7UK 1DARA 4EUVA 2N3OA 1S9GA 5C24A 2RU3A 3R5AA 3TA2A 1XR5A 1KVJA 4I2QB 2JWNA 5B08A 3PNIA 5KOXA 3OR1A 3O3LA 2KM8C 4CTAB 3WC2A 5E3PA 2ZE2A 5CXTA 5LJ3Y 1ZETA 3HI9A 2IBOA 1YJWS 1H6KX 1HWIA 3H59A 2CQDA 2J9CA 4ECSA 3MEEA 1T3NA 4WU2A 4G3IA 4DPOA 1N5YB 3DNCA 4LF7F 2KYZA 2KXNB 1FJGF 2JH3A 4ATNA 2ZDPA 5G0RB 2YWFA 3LQVA 4E8UA 1M90T 3G9CA 3VWSA 2XLKA 2W4CA 2CPDA 2GHPA 2IM1A 3NMRA 2R7XA 3ZZOA 2YWGA 3FDSA 1LW2B 2MHEA 3I5BA 4AE5A 1VQ6S 2NPIA 2B6AA 1HARA 2Q6CA 1TP7A 5GMKa 2RRBA 4DSFA 3ENVA 2MZJA 4KHMA 1HPZB 5F8MA 1W2IA 1LKZA 4BWMA 5J2NB 4IRCA 4MIBA 3GILA 4QWEA 1D9DA 3DLKB 1DFDA 5HBMA 3EGNA 3IGVA 5KAKA 1XEZA 2IA0A 2PGCA 3LALA 2FJWA 5KFAA 4B3MF 1D0EA 3GWCA 1ZAVA 3KLEA 1S1TA 5F3ZA 3MUVP 2FJBB 3QO9A 3MPWA 3G6ES 4OZ5A 2R9LA 5F8JA 1HQUA 1B0TA 2J9EA 1NU4A 1YGYA 2VC0A 1NHVA 1Q4RA 3CDBA 5KT4A 3HHNB 3W2VA 2KTQA 3DHXA 4HH0A 5L39A 3GV8B 2XZWA 2FPHX 3M30A 4DFJA 5EUHA 2WSEC 5BYRA 1ZAWA 5DDQC 5CQGA 1X5SA 1U09A 2GGPA 3KHHA 2HLTA 4BC9A 1JJ2R 4HKQA 1V3RA 2O67A 2PT0A 4IH6A 2LLZA 3AHPA 4ZVHA 4UQGA 3DYAA 1T03B 3H5UA 4IKAA 3TVKA 3I5CA 1FRHA 2DH7A 5C42B 3N0VA 3J7Z5 4WE1A 3G6XA 2XMTA 3B4MA 4ECZA 1SH3A 1GQEA 3N01A 2LEAA 3OR2B 3PHEA 4MK8A 4CT8A 1NJYA 4J37A 4JOUA 4UUWA 5I3PA 4C8KA 4A8WA 4IH7A 1LK7A 2IM3A 2LKZA 2N4CA 5KFDA 4M8LA 1MWZA 4GO7X 4Q0BA