3O5ZA

Crystal structure of the sh3 domain from p85beta subunit of phosphoinositide 3-kinase (pi3k)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
GPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPVALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit beta
publication title X-ray structure of the SH3 domain of the phosphoinositide 3-kinase p85 beta subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3o5zA00
1JU5C 1TUCA 1X2KA 4HVVA 3R6NA 2KROA 2ESWA 1RUWA 1AZGB 2HBWA 2JT4A 4Z8AA 2GBQA 1QLYA 2CH4A 3I5RA 1WI7A 2DA9A 2SRCA 2X3XD 2DILA 2DF6A 2K79A 3NMZC 2PZ1A 1NEGA 2BZYA 4K11A 2YSQA 2DL8A 5ECAA 3KFVA 5IXBA 3VS2A 2YUNA 1KIKA 1HJDA 1M8MA 2J6OA 3REAB 2KBTA 1KFZA 1T0HA 2AK5A 3QWYA 1WLPB 2DLPA 4RTUA 1CKAA 4J9CA 2D1XA 2JM9A 4RTWA 5EC7A 1ZUUA 1T3LA 1UE9A 4R0KA 2KE9A 1WDXA 1GBRA 4JZ3A 2J7IA 2K3BA 1AWWA 3EGUA 1AD5A 4IIMA 2ED0A 4D8KA 3VS3A 2FRWA 1I1JA 1PKSA 4A63B 1M3CA 4M4ZA 1JEGA 2DRKA 1ZUKA 1WXTA 2LMJA 1PHTA 5IXFA 2ABLA 4J9HA 4OMMA 1G2BA 2K2MA 5FW9A 4CC3A 2EYYA 1GRIA 1YCSB 2F2VA 2LQNA 4HVWA 1JO8A 2HSPA 2O31A 2CSIA 1AVZC 1W1FA 2RNAA 3O5ZA 2NUZA 1WX6A 1RLQC 1V1CA 2ENMA 5GJVB 2C0OA 3GBQA 2W10A 2KRNA 2BZ8A 2MIOA 2VWFA 1AWOA 2O9SA 4OMQA 1E6HA 2GTJA 1NYFA 1OOTA 2RQWA 2AKKA 1VA7A 1K1ZA 4RTTA 1SRMA 1RI9A 2JTEA 5IH2A 1T3SA 1YP5A 3IQLA 1QKXA 3ZL7C 4EIKA 4AFQC 2K7AA 1BU1A 3CQTA 4KRTA 2LCSA 1I07A 2LQWA 1NYGA 3I5SA 2C0IA 1XOVA 2MCNA 3C0CA 3M0RA 4JPBW 2J6FA 2FPEA 4F16A 3NGPA 4LE9A 1PRLC 1JXMA 4CC7A 1H8KA 1JQQA 2DJQA 1QWEA 5IHNA 1X43A 2YT6A 3VS4A 3TSZA 3U23A 1NM7A 1WIEA 1WFWA 2D0NA 4RUGA 1T0JA 1GBQA 1OPLA 2PNIA 2ED1A 3M0SA 3ULRB 2DMOA 1KJWA 3EG1A 2YUPA 2EPDA 2DL4A 2RQUA 2D8HA 1GFCA 3TVTA 1H3HA 4HXJA 2QDLA 3EG3A 1K0XA 1ZBJA 3UA7A 4QT7A 2JS2A 3JV3A 2DL7A 3UF4A 2J05A 2OI3A 1ARKA 1WXBA 3H0IA 1NG2A 5HCKA 2VKNA 1K0SA 1KSWA 1BBZA 1SEMA 3TSWA 3EG2A 1UHCA 1B3QA 1RLPC 1UFFA 2W0ZA 4JZ4A 1UG1A 2L0AA 3M0UA 1K76A 1X6GA 4RTVA 2KRMA 2KT1A 2V1QA 1TUDA 3NHNA 1Y0MA 1ABQA 1HSQA 1X6BA 2O9VA 2JMAA 1J3TA 4X1VA 1X69A 1MV3A 4AG2C 2D8JA 1OEBA 1U06A 1Z9QA 2FRYA 1SHFA 1SPKA 2KNBB 2RF0A 3UATA 3I35A 2L2PA 2SEMA 5IHIA 2MOXA 1YNZA 3FJ5A 2DE0X 1CKBA 5IHKA 1WYXA 1K9AA 3THKA 1TG0A 3H0FA 1S1NA 4J9DA 1M30A 4ORZA 2DYBA 2DRMA 1AWJA 2FG0A 4F17A 1AZEA 1AEYA 1Z9ZA 3EHQA 4LUDA 1YWPA 1UJYA 2ECZA 2HCKA 4F14A 1WA7A 1NEBA 2A28A 2I0NA 1N5ZA 3REBB 1JXOA 2BZXA 1X27A 2RQVA 3VS5A 1UDLA 2M51A 4JJCA 1WXUA 3NPFA 2GQIA 3PE0A 2OJ2A 3VS0A 1VYUA 1EFNA 1W6XA 2LJ3A 2JMCA 1PKTA 4FSSA 4JJBA 1W70A 1U5SA 4Z88A 2J6KA 2RQTA 1QKWA 2FEIA 3M0PA 4AFUC 1NLOC 2JW4A 4GBQA 2K6DA 2YUQA 1GCQC 2RQRA 1SRLA 4E6RA 1YN8A 3M0TA 1X2QA 2KGTA 2B86A 2J06A 1GCQA 2LJ0A 2LX7A 2JM8A 3QWXX 3RBBB 4ESRA 2P4RA 1PNJA 4CC2A 2C0TA 1GCPA 2M0YA 4Z89A 2LJ1A 4OMLA 2DM1A 1K4US 2EW3A 3H41A 4AG1C 2KRSA 4WCIA 1H92A 1G83A 1OPKA 2JXBA 4J9IA 2AZSA 3M0QA 2EYZA 1SSHA 4HVUA 1I0CA 2EKHA 3PVLA 3H0HA 4RTZA 4JJDA 3VRZA 1ZX6A 2CUDA 2X3WD 1IO6A 1VYVA 2LP5A 3A98A 1E6GA 1SHGA 1M3AA 2HDAA 2F2WA 2FPDA 2YDLA 4J9BA 3PVQA 2FPFA 5I22A 1E7OA 2EBPA 2GNCA 4AFZC 1AWXA 5FWBA 2RN8A 2V1RA 1BK2A 4IIOA 4OMNA 2A36A 3UA6A 2AZVA 1UUEA 2CT4A 4RTXA 1Y57A 2DVJA 2DNUA 2EYWA 2VVKA 2CH4W 2BTTA 1M3BA 1QCFA 1HD3A 1OV3A 1UGVA 2KEAA 2LZ6B 2GGRA 1UTIA 2HEQA 1UJ0A 3LH5A 4LN2A 2CDTA 1ABOA 2GTOA 4J9EA 4D8DA 2YUOA 4ZNXA 4DEXA 1GFDA 1B07A 2IIMA 1CSKA 4DEYA 1NLPC 1FYNA 2K9GA 5GJWB 2RMOA 4RTYA 3VRYA 1GL5A 2LNHB 3I9QA 2EGCA 1ZUYA 2L3SA 3VS1A 1UECA 3VS7A 1MV0B 2KR3A 1QWFA 2FO0A 2DBKA 2KXCA 4CC4B 1FMKA 2L3PA 2CT3A 1UHFA 1PRMC 4J9FA 2PTKA 2O2OA 1BB9A 2F2XA 2L3QA 3EHRA 4AFSC 2CREA 4OMOA 5I11A 2H8HA 2KT8A 2A37A 1U3OA 3VS6A 2JS0A 2A08A 2XMFA 4LUEA 2EGAA 1YWOA 1MUZA 2KYMA 2EGEA 2ROTA 2O88A 2E5KA 2DBMA 1ZSGA 2EQIA 5L23A 3SHWA 2KXDA 3SEMA 2ROLA 2EYXA 1AOJA 2CSQA 2NWMA 4OMPA 1ZLMA 2CUBA 2OAWA 1PWTA 4GLMA 1M27C 3RNJA 1LCKA 2EVRA 2G6FX 4HCKA 4Y92A 5FWCA 1VYTA 2AKLA 3EG0A 2DL3A 2DL5A 2KYBA 1A0NB 2DX1A 2RPNA 4J9GA 4LNPA
chains in the Genus database with same CATH superfamily
2CZ7B 7AT1B 3A8GB 1RUWA 3LWHA 1QLYA 2CH4A 4FYXB 2K79A 3A8HB 3OB9A 5A0LA 1NEGA 3A5ZB 2EJ9A 2DL8A 3CCEA 4EDUA 1KIKA 1VQKT 4F7UG 4D6WA 1Q81U 1KQSA 2KBTA 4DBFA 3J7AF 2V8KA 4GLKA 3RIRA 5KCOA 4X9CA 2LQKA 4C0DB 2JM9A 1Q86U 3G71A 4R0KA 2KE9A 3QZ9B 3DB3A 1GBRA 4JZ3A 2HNIA 5GMKm 2K3BA 1H3ZA 3OYNA 4IUQA 1AD5A 1I8FA 2DZ9A 3NTKA 4II1A 5HKCA 4LDXA 4Q5WA 1NJIU 4DOWA 3PT9A 1M3CA 3QIIA 2PUOB 3CD6Q 2DKGA 3QO3A 3HP9A 1WJSA 5IXFA 1Y7XA 2HQXA 4M75A 3JB9G 3CPWS 1M2VA 2YHTA 3MCAB 3WVDB 2EYYA 4C92F 1YJWT 1GRIA 2LTOA 2F2VA 4HVWA 2O31A 1D0XA 1M4ZA 2QEXT 3CMEQ 1JJ2A 5FRNA 1WHMA 1ZSZC 2ENMA 4FIBA 2BUDA 2HKQB 4HA8A 1RABB 3M56A 4F7UB 2IG0A 3OYDA 1YIJQ 1AWOA 1E6HA 3ASKA 4M7DA 3WVEB 4QQGA 1OOTA 1TU0B 1BIBA 5LJ5f 1T3SA 4EIKA 4AFQC 2K7AA 3G7ZA 1NYGA 3QSUA 4UC4A 3URGA 1DJ7B 1UEBA 3BDUA 3J80E 1MMDA 4E7IA 3NGPA 2DIQA 3V7SA 1H8KA 2DTOA 5IHNA 2X4YA 4XTUA 1K8AC 2R57A 1Q82C 3TSZA 3HKSA 1B34B 4N0AA 5CKEA 1BI2A 4BACA 4FYVB 3PGGA 2EPDA 2QYZA 4M78F 5GAN4 1GFCA 4LD6A 1NPRA 5J3BA 1K0XA 3CCVA 3E19A 3JV3A 3UF4A 1LNXA 3NTIA 2J05A 5CVIA 2MAMA 1ARKA 1SF9A 4B6MA 1NG2A 4OMFB 3I56A 2VYTA 2EWNA 2M9UA 1C0MA 5EG2A 4CI0C 4C92C 2HAXA 4JZ4A 3SD4A 2L0AA 4RTVA 2RM4A 2KT1A 2X51A 5LJ3j 2M0OA 3CXCS 1QMCA 3EH1A 1VQ5A 1K9MC 3QHSA 1J3TA 5LJ5h 2DXCA 2LT1A 4PLIA 1VUBA 1SPKA 2KQWA 4C5EA 5IHIA 4C92D 2H3EB 2DXTA 1P92A 1K9AA 2IVWA 1VQMA 1TG0A 3H0FA 1S1NA 4M75B 2QA4Q 4BY6B 1WHLA 5GANg 2AT1B 1UGRB 1AWJA 1M2VB 4QQDA 3HTRA 2ZPHB 4IUPA 1AEYA 3JCMe 1M1KR 4LUDA 4C5HA 4B9WA 4ZGJB 2HL5C 1NEBA 3OY9A 2I0NA 3BW1A 2MPXC 4JJCA 3ZEHA 3HRUA 1VQ4Q 1YJ9A 3SWNC 3S6WA 3CBPA 2OJ2A 3OS0A 1QVPA 2YLCA 1QVFA 2LJ3A 1G8XA 2JMCA 3CMAA 2O01E 2VC8A 2ZZDA 4JJBA 5GMKj 3OYCA 2RQTA 1M9SA 1I5OB 3M0PA 1M90U 4DQ2A 4GBQA 2K6DA 2RQRA 3FJPA 3HRSA 5CKFA 4J7FA 1YIJT 2VXEA 2HBPA 3MEAA 4M78D 2LJ0A 2JM8A 5DLQE 1D3BA 3QWXX 3RBBB 2CZ6B 1PNJA 2HZYA 4A54A 4CC2A 2DEUA 2C0TA 1GCPA 2M0YA 2FHDA 2EQJA 2QA4A 3DKMA 2MWPA 5AT1B 5KE2A 4WCIA 1VQ6Q 1OPKA 3HHTB 2E65A 2AZSA 3M0QA 2QI2A 4PJJA 2EYZA 4DOVA 4C92E 3CC2A 3JB9F 3OQ5A 1IO6A 1VYVA 1E6GA 3DB4A 3QXEB 2HDAA 2F2WA 4HT8A 4NOYA 3CCQQ 2FPFA 5I22A 1FMWA 4LDVA 2HL3A 2EBPA 2GNCA 4AFZC 2K2VA 2V1RA 4M7AC 2OTJA 1EZZB 2AZVA 2QTXA 1UUEA 1Y57A 2DNUA 2VVKA 2ZPGB 3LGFA 2KEAA 4IUUA 1UTIA 3LH5A 3SDZA 2GTOA 1M2OA 1QVFS 4D8DA 4ZNXA 2IIMA 3CCUQ 1NLPC 2RMOA 2RJEA 4RTYA 4IKFA 3VRYA 2LNHB 2ZPBB 3PMTA 4J6WA 1G3YA 3MEWA 4OB2B 5GAOn 2QQSA 1G3WA 2L89A 1YBYA 2BE9B 4IUVA 4Y91A 4DBRA 2KXCA 3EFOA 3KXTA 2ZAEA 4M78E 5LJ5j 2PVDB 2GFAA 3OSSC 4NS5A 2E64A 2FYKA 4C0FA 2F2XA 1ZQ1A 3EHRA 3VUZA 4AFSC 3CCSA 4M75F 4OB0B 3JCMd 2KY9A 3VS6A 4RMOA 4E7KA 1PM3A 2E10A 4BI8B 2RJDA 5CAIA 4E7JA 3OYKA 3S3NA 3RKYA 5LJ3g 4ELZC 3CCLT 5C6SA 1R77A 1VIEA 1WJRA 1ZLMA 2CUBA 2OAWA 4OMPA 2XICA 4HCKA 2G6FX 1D3BB 1VYTA 5KYNA 4OVAA 2AKLA 1N8RC 2KYBA 5D6YA 2PQWA 3EG9B 5FU7B 1QP3A 3JB9D 3JCMW 3JRZA 3G4ST 1S72Q 1X75C 4JRPA 2KROA 2D0QB 2V26A 2HBWA 4Z8AA 2F5TX 2D9TA 1NBEB 1WI7A 3OYFA 2DILA 2DF6A 4E7LA 5ECAA 4KUIA 1OULA 2K5FA 2GCXA 1YITQ 1K8AR 1D0YA 3NFCA 1Q82R 1VQOT 1Y96A 2E5QA 1KFZA 4BB7A 2AK5A 3QWYA 2DPPB 4RTUA 3OYHA 2CYZB 5EC7A 1G5VA 1M1FA 1T3LA 5IN1A 4M78G 2XIDA 1VQ7T 1G3SA 3EGUA 4J6YA 3CC7A 4IIMA 2R5MA 2OTLQ 4D8KA 1I1JA 3QJYA 1PKSA 4A63B 2HQEA 4A4FA 4KULA 1KC8U 4QW2A 1I4K1 1RAEB 3MO8A 3RKWA 1PHTA 1PG5B 4OMMA 1G2BA 2RI2A 2DO3A 2F69A 1YJNQ 2CP7A 2LQNA 5GAN6 5CKHA 1JO8A 2HSPA 1RI0A 4J7IA 2CSIA 2JVVA 1LJOA 3CCEQ 4M75D 5GJVB 1VQKA 3TCJA 3TREA 1KK7A 1K9MR 4ZGDB 3MEVA 2VWFA 2H3JA 2P4TA 2O9SA 2V8JA 1D0ZA 1FXXA 4OMQA 2GTJA 4EPCA 2VUBA 3META 2QK0A 1NYFA 3OYLA 1VA7A 1K1ZA 2JTEA 1VQNT 5LL6S 2PU9B 1BU1A 3CQTA 1I07A 1VOMA 4PFPA 2IPOB 3I5SA 2HMAA 1FWZA 2C0IA 1RAIB 2MCNA 4PFZA 2QASA 2X4WA 3QDFA 4F16A 1WQ7A 4LE9A 3GIBA 1GXIE 1JXMA 2DJQA 2OTLA 3LX7A 5GAMf 3U23A 1NM7A 4C8QA 1WFWA 5M9OA 4J8OA 3V7RA 3M0SA 4IURA 3ULRB 3EG1A 3HPWA 5FLXE 2WSFE 2YUPA 3V8JA 2BE7D 2DL4A 3EGXA 2D8HA 5CKBA 5FRMA 5KYXB 3WXMB 1YJNA 3DLMA 1H3HA 1ACMB 4OP0A 2RK2A 3PIOA 1QW1A 5KH6A 1ZBJA 5KE3A 3G6ET 4NL2A 1MGQA 4QVZA 1OYXA 3OS1A 4ATOA 2VKNA 1K0SA 1BBZA 2QQAA 3TSWA 2XDBA 1ZA2B 1B3QA 1UFFA 2E3HA 3E9GA 4BDZA 4KGVB 1X6GA 5LJ5g 2D6FA 2XU8A 2DXUA 4PJOA 4JRQA 3NHNA 4M75E 1ABQA 2F5KA 1X69A 2ZPFB 1MV3A 2KNBB 2KSSA 1TWBA 3UATA 2WACA 4ZN1A 1OX9A 2L2PA 2SEMA 2ZGWA 4XTWA 2MOXA 2QQRA 1YITT 1YNZA 3CCRA 3FJ5A 5GMKh 2E6NA 5D6XA 1WYXA 1XTDA 2X35A 4J9DA 4ZTJA 3VYGA 5GAMh 3CCVQ 5KYWA 4C8QG 2MF2A 3OBWA 1RL2A 1TXQA 3JB9H 4PJLA 4M7DE 4F17A 3EHQA 3I56Q 2YRVA 1VQ8Q 1OX8A 2CS7A 1G3TA 4F14A 1WA7A 1AT1B 3FEOA 2AHJB 2EQUA 3REBB 2RQVA 3CCMQ 1HK9A 1N9SA 2FZKB 1VQLQ 1IRXA 2M51A 3CC4T 1VQ5Q 3EFRA 3PE0A 3VS0A 1IZ6A 1MNDA 1YHQQ 1VYUA 4C0ZA 1EFNA 1D1BA 4HKEA 3E9FA 3PMIA 4AFUC 1KQSS 1UGQB 4JS4A 1VQMQ 3M0TA 4PJOG 1PSEA 3OBYA 5GANe 1Q7YC 4P5NA 2B86A 2J06A 1KD1C 1UGSB 5FU7C 1BKBA 2LX7A 4F04B 3V8KA 4C8QB 3G71T 2BKDN 4JJNK 1RAAB 1BCOA 2M16A 2Z0WA 3CCJT 4M75G 3OMGA 2LJ1A 3EGXB 1MMNA 2EW3A 3H41A 2CP2A 1H92A 1YJ9Q 2JXBA 4J9IA 1KQ2A 1VQ8A 3OMCA 1I0CA 3H0HA 3SB2A 2X3WD 5FU6B 3CCMA 3JCMQ 3M55A 3CMAQ 1SHGA 3INZA 1M3AA 1VQLA 2YDLA 1JJ2S 5CK9A 2M02A 3PVQA 4HT9A 2LX9A 4Z02A 4M7DG 2VB6A 1IB8A 5L8RE 4IIOA 1YHQA 3UA6A 1PCXA 4PJOB 4VUBA 2CT4A 4RTXA 3BDLA 2JUFA 1N8RR 2CH4W 2BTTA 1M3BA 8AT1B 4CRIA 2NYSA 3L2ZA 3V8LA 1R0CB 1OZ3A 2LZ6B 2KMTA 2GGRA 2WSCE 1WQWA 1KG1A 2Y90A 3P8HA 1Q81C 3HL8A 2XI9A 3DLLA 2RO0A 2E1HA 2K9GA 3QKJA 5GJWB 4ANJA 1Q86C 4OB3B 2P84A 2HD0A 3FLGA 3I9QA 2L3SA 4ZN3A 3CC2Q 4ZGEB 1VQ9Q 1UECA 2JN0A 1QWFA 1NJIC 3CD6T 5KYUA 3TQ7P 1QVGA 3VV0A 1UHFA 4QVCA 4J9FA 2PTKA 2VXFA 4M78C 1PD1A 4XTYA 4M7DB 4FT2A 3MJXA 1BB9A 2KI7A 2XKOC 2L3QA 4RKUE 2OTJQ 3OYBA 3QYGB 5I11A 2QAZA 2A37A 3A8LB 1U3OA 1WHKA 1ZSZA 4LD9K 3CMET 3OW2P 4EMKC 2EGAA 2WSEE 2ROTA 5GAN8 3QBYA 1X6OA 1YCYA 5GAMj 2AIRB 5DLOA 2DEQA 2L5QA 5L23A 9ATCB 1BYMA 5A2QE 2DZCA 3H6ZA 3GOXA 3SHWA 2KXDA 3JB9J 2EYXA 2K4YA 2CSQA 1O75A 4L59A 1Y07A 3L42A 5FWCA 4Y28E 4OB1B 3LH0A 1K73R 3EG0A 4KBMB 3MEUA 3MP8A 1A0NB 1D1AA 3FDRA 4LNPA 2DK3A 1JU5C 1M1KU 1X2KA 4HVVA 3R6NA 5GANd 2ESWA 2CGHA 2JT4A 2GBQA 3T9NA 1VQ9A 5J26A 5I21A 3CCSQ 3I5RA 2JOYA 2SRCA 2LCLA 2MWOA 2PZ1A 5GAN7 1WHHA 3GP8A 4C0DC 4K11A 3L2QA 4XTXA 4C8QF 2NUPA 2DD5A 3KFVA 5IXBA 4A4GA 2YUNA 4X34A 1HJDA 1M8MA 2DERA 3REAB 5LJ3e 3H8ZA 5C0MA 2EJGA 3A1PA 4XU0A 5KYYA 3M5AA 1CKAA 3OYYA 1IHWA 2P0PA 4RTWA 3D7SB 1UE9A 3CCLA 1WDXA 3BE3A 1AWWA 4FU6A 2ED0A 2RJCA 2CKKA 3VS3A 4M77A 2A3LA 2LNVA 2RK1A 3I55A 2CP3A 1JBMA 4PNOA 1JEGA 5GAN2 1VQPQ 1OU8A 1QCNA 4MZPA 4PJMA 2MMPA 1ZUKA 5CO7A 3MKDA 4EMGA 1WXTA 3RKXA 3QUIA 4J9HA 3G4SA 2CZ0B 1YI2A 2K2MA 4C5IA 5FW9A 4PJOF 3LWIA 3CPFA 2K3XA 2I2LA 3JCMb 1JB0E 2COWA 1FX7A 2L3RA 4FL6A 1AVZC 2RNAA 1QP2A 3E2UA 1WX6A 1QCOA 1MMGA 5KYUB 2VV5A 1VQOA 4A4KA 3JCMV 2EKOA 2QA4T 3JCMf 1OU9A 2X9HA 4KGXB 2RQWA 2COYA 2AKKA 2RA2A 3OS5A 1ZSZB 4RTTA 1WGSA 1VQ7A 3A8OB 1SRMA 4PFOA 5IH2A 3CC7Q 5GMKe 1QKXA 3ZL7C 4HCCA 4JS5A 2E12A 2LCCA 2LQWA 3SWNA 4GY5A 2QGGA 3C0CA 2J6FA 1VQ4T 4C8QC 3H9NA 3L2WA 3UPUA 3N5BB 3SFMA 4E47A 2EAYA 2P0KA 4M7DF 1X43A 3CXCP 2OTJT 1KHIA 4FW1A 1WIEA 4E7SA 3VUBA 2RJFA 4M77G 1VQPA 2BIVA 2QQBA 2DMOA 2Y4YA 1KJWA 4QKUA 1WZOA 1M90C 2XDPA 3X24B 1VQKQ 2LQ8A 4C8QD 3X26B 4E7ZA 5GAOl 2QDLA 3EG3A 4AMCA 4MZTA 2JS2A 1BI1A 1FMVA 2OI3A 4R56A 1WXBA 3LW5E 1VQNA 2NUPB 4MMLA 1UHCA 1LPLA 3OYMA 1Q7YR 2W0ZA 4O6JA 3M0UA 1K76A 2KRMA 1VQ6T 2V1QA 3O8VA 1TUDA 2RHUA 3JCMh 4OF1A 5KYYB 1U1SA 3QPHA 1YFNA 2E41A 1HSQA 2QTVA 4M75C 3MHXA 2D8JA 1NPPA 1WHGA 1YJWQ 1OEBA 1Z9QA 2FRYA 4BY6C 3E1SA 3CCQT 4X9DA 2RD1A 3I35A 4M77B 5A0DA 3OYGA 2QEXQ 2YWWA 2RI3A 4M7AA 4PJOD 5GAMg 4EMHA 2DD4A 5LJ3d 3VYHB 3ER0A 2DE0X 5IHKA 1M30A 4WF2A 2DYBA 3JCMX 3OW2A 3G6EA 3EFOB 3BFMA 1YWPA 1UJYA 4M7DC 2HCKA 3ZBDA 2XHCA 1JXOA 2BZXA 4RCBA 3VS5A 3CCUT 1PD0A 5LJ5e 3V7CA 5CQXA 2RI5A 1WXUA 2LRQA 3NPFA 1EIFA 4F7UA 4KH1B 1K8AU 1SSFA 1IGQA 3JCMc 1Q82U 2HKNA 2FZGB 4XAXB 2ZCFB 2QG9B 1Q81R 1XJWB 1W6XA 1TS9A 3JCMJ 4FSSA 4C8QE 1H641 4M7DD 4LDYA 1W70A 3M59A 3Q1JA 1U5SA 3G1JA 1QVGP 2J6KA 3R6OA 3A8MB 1QKWA 4N0AC 1NLOC 1M1GA 2JW4A 3GLXA 3L1AA 3CCRQ 2YUQA 3QJ6A 1WPYA 3RR6A 3RESA 1X2QA 2QXFA 1NJIR 3CPWA 1N6AA 1YJWA 2KGTA 3HRTA 2QEXA 1GCQA 3OA6A 4ESRA 4FYWB 3CC7T 4M7AG 3FB9A 4BE1A 3QDRB 4BE0A 2LDMA 3X28B 4PJNA 1KQ1A 2DAQA 1G83A 1RAFB 3CC4A 4PJOE 3MP1A 2EKHA 3PVLA 1K9MU 4RTZA 3VRZA 1ZX6A 2CUDA 2FB7A 1I5LA 2LP5A 3OW2S 2FPDA 3HFOA 3M53A 4J9BA 4JLGA 1Y96B 1RAHB 2GQVA 1IGUA 1S72T 2JZ2A 5FWBA 1V29B 3QZ5B 4RG2A 1I81A 3RERA 5GMKi 1OQKA 2X4XA 3EGDA 4N4IA 1QCFA 1PSFA 5D6WA 1HD3A 1D09B 4NL3A 4FM4B 2KDSA 4WTOB 5GAOq 4ZTFA 2HEQA 1UJ0A 4LN2A 4J9EA 4M7AB 3NTHA 2EFIA 2LT4A 3CCJA 1GFDA 1XNIA 4DEYA 3JSCA 1FYNA 3BY7A 4JDSA 3TU4K 1GL5A 1UB4A 2OX7A 3VS1A 3QG1A 4FW2A 2OTLT 5CKDA 1TSFA 4BE2A 1N27A 2FL7A 3KUFA 3FRNA 2FO0A 2DBKA 4J83A 4CC4B 1LVKA 1FMKA 2L3PA 2CT3A 1KC8C 4M77F 4PKCC 3JAME 3OYJA 4PL6A 1RAGB 4HCZA 1PRMC 1WNLA 2RHIA 2O2OA 3F70A 3L2VA 2NUTA 3CXCA 2DTHA 5HY6A 4A4EA 2CREA 1YJNT 4OMOA 2JS0A 2A08A 3J81E 3CCET 2O88A 2EGEA 1W2BP 5I2SA 2E5KA 5LJ5d 2YXYA 1W4SA 4ME7A 1TUGB 1X01A 4A4HA 1MNEA 4J5YA 3P8BB 3SEMA 2ROLA 2L8DA 2NWMA 5D7UA 1PWTA 4GLMA 1M27C 5GAOp 2E6ZA 1LCKA 4Y92A 2E4HA 2KAFA 2KVQG 3LYIA 4XTZA 2DL5A 3QYHB 3CD6A 2DX1A 2KK4A 1R8OB 1TUCA 3OSVA 1HXDA 3CCRT 1AZGB 2HQHA 2DA9A 1O9SA 2X3XD 3NMZC 3M58A 2BZYA 1IHVA 2YSQA 3CMEA 3EH2A 4QVDA 3VS2A 2JTFA 1LOJA 2J6OA 2EQKA 4FYYB 2ATCB 1T0HA 2COZA 1YIJA 3CBMA 3GF5A 1WLPB 1ZBXA 2DLPA 5GAOm 4J9CA 2D1XA 3X25B 2DXBA 2Y4XA 1ZUUA 4M77C 5A0GA 2O4XA 3AT1B 2QDYB 2J7IA 1ZA1B 3EGDB 1M90R 2EYQA 1BI3A 5GAN3 3VKIA 5HK3A 2FRWA 4JRIA 2PVGB 2R5AA 4JRKA 1MHNA 4M4ZA 4C5GA 2DRKA 5J39A 2XDDA 1N9RA 2LMJA 2ABLA 2CP6A 3P8DA 3X20B 5KYWB 4DBQA 2QGFB 4M77D 4CC3A 1QQJA 2DFUA 2XD0A 1YCSB 1KHCA 1W1FA 3O5ZA 2NUZA 1RLQC 4BUGA 1V1CA 2RH2A 3CBOA 4M7AF 2C0OA 3GBQA 2W10A 2KRNA 4QQ6A 2A0FB 2BZ8A 2MIOA 4E2FB 2NUTB 4L5GA 3CCVT 4OGEA 4BDYA 3LGLA 3CCLQ 3C12A 2RHZA 3I56T 1VQ8T 2VGMA 2X4JA 1RI9A 1ZHIA 3MPUB 1YP5A 4L6V5 3IQLA 5DY9A 2LCSA 4KRTA 3CCMT 4R55A 1N8RU 1WJQA 4LXCA 3I55Q 4ELYC 1VQLT 1XOVA 4TVRA 3M0RA 1F1BB 4JPBW 2FPEA 3OYEA 1PRLC 4CC7A 3G4SQ 1VQ5T 4XU2A 1JQQA 4DBHA 1YI2Q 4KH0B 1QWEA 4F7UF 1YHQT 2YT6A 3M4GA 3VS4A 1WHJA 3CEYA 2D0NA 4RCCA 4RUGA 1T0JA 2OAUA 4OGCA 1GBQA 1BCMA 1OPLA 2ED1A 2PNIA 2RHYA 4N4GA 4FSXA 4XQ3A 1PC0A 4RG8A 5GANf 2RQUA 2DTIA 1VQMT 5CR2A 3EG9A 3TVTA 3RUXA 3CPWP 1VQOQ 1M8VA 1V76A 5AYFA 4HXJA 3OYAA 1C1AA 4JLIA 3OYIA 3UA7A 4QT7A 5GMKl 4BI4A 2DL7A 1IXDA 3H0IA 4AT1B 5HCKA 1VQ7Q 1KSWA 4E7HA 1SEMA 3JCMg 3EG2A 4M77E 1RLPC 1NE8A 1C6VX 1UG1A 1QVGS 2JTMA 5KCHA 2CP5A 1YJ9T 1VQ4A 4FCYA 3HFNA 8ATCB 3KBGA 3GNFB 4C92A 1Y0MA 2XG8D 2O9VA 1X6BA 2JMAA 3M57A 2O4XB 4X1VA 3CMAT 4JUVA 4AG2C 3RDVA 1BIAA 1U06A 2RF0A 1SHFA 3PNWC 2V8IA 4YTLA 3S3OA 2VGNA 2YRCA 1R0BG 4FT4A 3FIFA 1CKBA 1KQSP 3TEEA 1Y71A 3THKA 1K73U 1VIFA 4ORZA 4XU1A 1M5Q1 2DRMA 2FG0A 2RB6A 5CCAA 4M7AD 2K5IA 1EX4A 3S3MA 2DIGA 1AZEA 1W2BA 1Z9ZA 4XTVA 4MDXA 2ECZA 2YRDA 1VQNQ 3C95A 2A28A 5GANh 4DA4A 1N5ZA 4BI3A 2HSEB 1X27A 4XU3A 3C4SA 2C06A 2F1LA 1UDLA 2EQMA 1U1TA 2MYSA 4LDWA 1VQ6A 5IAYA 2GQIA 3CC2T 1HYOA 5CQYA 1NZ9A 3M54A 1VQ9T 3GNGA 2PUKB 2YLBA 3EFSA 1PKTA 2CP0A 2CZ1B 5GAMe 3JB9I 4M78A 3CCQA 5GAOr 4Z88A 1JJ2P 1Q95G 2FEIA 2E3IA 2M1HA 3UWNA 1OZ2A 1GCQC 1SRLA 1SKUB 4E6RA 1YN8A 1B7TA 4C92G 4EMKA 2GF7A 1KC8R 3G6EQ 2JNGA 1SG5A 3LLRA 5CIUA 2P4RA 4N4HA 1TOVA 3UDCA 2E70A 5FU6C 2ZPEB 4Z89A 2EJFA 3ME9A 1MMAA 3CCUA 4OMLA 2DM1A 3I55T 4KUDK 1K4US 2EIFA 3AHUA 3RMSA 2KRSA 4AG1C 3VU3C 2K57A 2P0QA 5KYXA 1RACB 1YI2T 1SSHA 4HVUA 3RMQA 4JJDA 5IT9E 4PJOC 3PTAA 3A98A 1TH7A 1KD1R 4MDWA 2XK0A 3M9QA 1W2BS 1E7OA 4M7AE 2FZCB 4B9XA 2VASA 1M1KC 1AWXA 2R58A 2B8AA 2RN8A 1IREB 1BK2A 4OMNA 3CCST 2A36A 4C0GA 1JRIA 4C92B 2DVJA 4IUTA 2EYWA 4LDUA 5GAN5 5FROA 2JJ9A 1OV3A 3GPLA 1UGVA 4V2SA 4A53A 2CDTA 5LJ3f 1ABOA 3UT1A 2YUOA 4DEXA 3L2UA 2A7YA 1B07A 2MK5A 1CSKA 2NLUA 2DETA 3PIPA 3HSBA 2MI6A 1UGPB 2EGCA 4F7UE 2QQ9A 5DM7R 3CC4Q 1ZUYA 3VS7A 1MV0B 2KR3A 3EAEA 2PVOB 6AT1B 1VQPT 2ZPIB 4KGZB 4MMKA 2DYIA 1S72A 4PLLA 4PK4A 2K5LA 4HCBA 3M4YA 1TTHB 1XQHA 4XK8E 2DVEA 4J6XA 3FC3A 2H8HA 1K73C 1Q7YU 2KT8A 3L2RA 3VJPA 1KD1U 2DJZA 3C94A 3OS2A 2LC4A 1Q86R 1D1CA 1BI0A 2XMFA 4LUEA 1YWOA 1MUZA 2KYMA 1U8RA 3SWNB 3G71Q 1YITA 2G3RA 4M78B 2RHXA 1RADB 2DBMA 4MZMA 1ZSGA 2K3YA 4KT0E 2EQIA 3CCJQ 2GFUA 5HK0A 4O5VA 3MP6A 4EMKB 1AOJA 5GANj 1B34A 3RNJA 2EVRA 1AHJB 5GAMd 3ZFJA 1QVFP 5LJ3h 3JCMP 2DL3A 4BD3A 5I2MA 2LVMA 1OI1A 2FVUA 2RPNA 4J9GA 3PFSA
chains in the Genus database with same CATH topology
1JU5C 1TUCA 1X2KA 4HVVA 3R6NA 2KROA 2ESWA 1RUWA 1AZGB 2HBWA 2JT4A 4Z8AA 2GBQA 1QLYA 2CH4A 3I5RA 1WI7A 2DA9A 2SRCA 2X3XD 2DILA 2DF6A 2K79A 3NMZC 2PZ1A 1NEGA 2BZYA 4K11A 2YSQA 2DL8A 5ECAA 3KFVA 5IXBA 3VS2A 2YUNA 1KIKA 1HJDA 1M8MA 2J6OA 3REAB 2KBTA 1KFZA 1T0HA 2AK5A 3QWYA 1WLPB 2DLPA 4RTUA 1CKAA 4J9CA 2D1XA 2JM9A 4RTWA 5EC7A 1ZUUA 1T3LA 1UE9A 4R0KA 2KE9A 1WDXA 1GBRA 4JZ3A 2J7IA 2K3BA 1AWWA 3EGUA 1AD5A 4IIMA 2ED0A 4D8KA 3VS3A 2FRWA 1I1JA 1PKSA 4A63B 1M3CA 4M4ZA 1JEGA 2DRKA 1ZUKA 1WXTA 2LMJA 1PHTA 5IXFA 2ABLA 4J9HA 4OMMA 1G2BA 2K2MA 5FW9A 4CC3A 2EYYA 1GRIA 1YCSB 2F2VA 2LQNA 4HVWA 1JO8A 2HSPA 2O31A 2CSIA 1AVZC 1W1FA 2RNAA 3O5ZA 2NUZA 1WX6A 1RLQC 1V1CA 2ENMA 5GJVB 2C0OA 3GBQA 2W10A 2KRNA 2BZ8A 2MIOA 2VWFA 1AWOA 2O9SA 4OMQA 1E6HA 2GTJA 1NYFA 1OOTA 2RQWA 2AKKA 1VA7A 1K1ZA 4RTTA 1SRMA 1RI9A 2JTEA 5IH2A 1T3SA 1YP5A 3IQLA 1QKXA 3ZL7C 4EIKA 4AFQC 2K7AA 1BU1A 3CQTA 4KRTA 2LCSA 1I07A 2LQWA 1NYGA 3I5SA 2C0IA 1XOVA 2MCNA 3C0CA 3M0RA 4JPBW 2J6FA 2FPEA 4F16A 3NGPA 4LE9A 1PRLC 1JXMA 4CC7A 1H8KA 1JQQA 2DJQA 1QWEA 5IHNA 1X43A 2YT6A 3VS4A 3TSZA 3U23A 1NM7A 1WIEA 1WFWA 2D0NA 4RUGA 1T0JA 1GBQA 1OPLA 2PNIA 2ED1A 3M0SA 3ULRB 2DMOA 1KJWA 3EG1A 2YUPA 2EPDA 2DL4A 2RQUA 2D8HA 1GFCA 3TVTA 1H3HA 4HXJA 2QDLA 3EG3A 1K0XA 1ZBJA 3UA7A 4QT7A 2JS2A 3JV3A 2DL7A 3UF4A 2J05A 2OI3A 1ARKA 1WXBA 3H0IA 1NG2A 5HCKA 2VKNA 1K0SA 1KSWA 1BBZA 1SEMA 3TSWA 3EG2A 1UHCA 1B3QA 1RLPC 1UFFA 2W0ZA 4JZ4A 1UG1A 2L0AA 3M0UA 1K76A 1X6GA 4RTVA 2KRMA 2KT1A 2V1QA 1TUDA 3NHNA 1Y0MA 1ABQA 1HSQA 1X6BA 2O9VA 2JMAA 1J3TA 4X1VA 1X69A 1MV3A 4AG2C 2D8JA 1OEBA 1U06A 1Z9QA 2FRYA 1SHFA 1SPKA 2KNBB 2RF0A 3UATA 3I35A 2L2PA 2SEMA 5IHIA 2MOXA 1YNZA 3FJ5A 2DE0X 1CKBA 5IHKA 1WYXA 1K9AA 3THKA 1TG0A 3H0FA 1S1NA 4J9DA 1M30A 4ORZA 2DYBA 2DRMA 1AWJA 2FG0A 4F17A 1AZEA 1AEYA 1Z9ZA 3EHQA 4LUDA 1YWPA 1UJYA 2ECZA 2HCKA 4F14A 1WA7A 1NEBA 2A28A 2I0NA 1N5ZA 3REBB 1JXOA 2BZXA 1X27A 2RQVA 3VS5A 1UDLA 2M51A 4JJCA 1WXUA 3NPFA 2GQIA 3PE0A 2OJ2A 3VS0A 1VYUA 1EFNA 1W6XA 2LJ3A 2JMCA 1PKTA 4FSSA 4JJBA 1W70A 1U5SA 4Z88A 2J6KA 2RQTA 1QKWA 2FEIA 3M0PA 4AFUC 1NLOC 2JW4A 4GBQA 2K6DA 2YUQA 1GCQC 2RQRA 1SRLA 4E6RA 1YN8A 3M0TA 1X2QA 2KGTA 2B86A 2J06A 1GCQA 2LJ0A 2LX7A 2JM8A 3QWXX 3RBBB 4ESRA 2P4RA 1PNJA 4CC2A 2C0TA 1GCPA 2M0YA 4Z89A 2LJ1A 4OMLA 2DM1A 1K4US 2EW3A 3H41A 4AG1C 2KRSA 4WCIA 1H92A 1G83A 1OPKA 2JXBA 4J9IA 2AZSA 3M0QA 2EYZA 1SSHA 4HVUA 1I0CA 2EKHA 3PVLA 3H0HA 4RTZA 4JJDA 3VRZA 1ZX6A 2CUDA 2X3WD 1IO6A 1VYVA 2LP5A 3A98A 1E6GA 1SHGA 1M3AA 2HDAA 2F2WA 2FPDA 2YDLA 4J9BA 3PVQA 2FPFA 5I22A 1E7OA 2EBPA 2GNCA 4AFZC 1AWXA 5FWBA 2RN8A 2V1RA 1BK2A 4IIOA 4OMNA 2A36A 3UA6A 2AZVA 1UUEA 2CT4A 4RTXA 1Y57A 2DVJA 2DNUA 2EYWA 2VVKA 2CH4W 2BTTA 1M3BA 1QCFA 1HD3A 1OV3A 1UGVA 2KEAA 2LZ6B 2GGRA 1UTIA 2HEQA 1UJ0A 3LH5A 4LN2A 2CDTA 1ABOA 2GTOA 4J9EA 4D8DA 2YUOA 4ZNXA 4DEXA 1GFDA 1B07A 2IIMA 1CSKA 4DEYA 1NLPC 1FYNA 2K9GA 5GJWB 2RMOA 4RTYA 3VRYA 1GL5A 2LNHB 3I9QA 2EGCA 1ZUYA 2L3SA 3VS1A 1UECA 3VS7A 1MV0B 2KR3A 1QWFA 2FO0A 2DBKA 2KXCA 4CC4B 1FMKA 2L3PA 2CT3A 1UHFA 1PRMC 4J9FA 2PTKA 2O2OA 1BB9A 2F2XA 2L3QA 3EHRA 4AFSC 2CREA 4OMOA 5I11A 2H8HA 2KT8A 2A37A 1U3OA 3VS6A 2JS0A 2A08A 2XMFA 4LUEA 2EGAA 1YWOA 1MUZA 2KYMA 2EGEA 2ROTA 2O88A 2E5KA 2DBMA 1ZSGA 2EQIA 5L23A 3SHWA 2KXDA 3SEMA 2ROLA 2EYXA 1AOJA 2CSQA 2NWMA 4OMPA 1ZLMA 2CUBA 2OAWA 1PWTA 4GLMA 1M27C 3RNJA 1LCKA 2EVRA 2G6FX 4HCKA 4Y92A 5FWCA 1VYTA 2AKLA 3EG0A 2DL3A 2DL5A 2KYBA 1A0NB 2DX1A 2RPNA 4J9GA 4LNPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JU5 C;  1TUC A;  1X2K A;  4HVV A;  3R6N A;  2KRO A;  2ESW A;  1RUW A;  1AZG B;  2HBW A;  2JT4 A;  4Z8A A;  2GBQ A;  1QLY A;  2CH4 A;  3I5R A;  1WI7 A;  2DA9 A;  2SRC A;  2X3X D;  2DIL A;  2DF6 A;  2K79 A;  3NMZ C;  2PZ1 A;  1NEG A;  2BZY A;  4K11 A;  2YSQ A;  2DL8 A;  5ECA A;  3KFV A;  5IXB A;  3VS2 A;  2YUN A;  1KIK A;  1HJD A;  1M8M A;  2J6O A;  3REA B;  2KBT A;  1KFZ A;  1T0H A;  2AK5 A;  3QWY A;  1WLP B;  2DLP A;  4RTU A;  1CKA A;  4J9C A;  2D1X A;  2JM9 A;  4RTW A;  5EC7 A;  1ZUU A;  1T3L A;  1UE9 A;  4R0K A;  2KE9 A;  1WDX A;  1GBR A;  4JZ3 A;  2J7I A;  2K3B A;  1AWW A;  3EGU A;  1AD5 A;  4IIM A;  2ED0 A;  4D8K A;  3VS3 A;  2FRW A;  1I1J A;  1PKS A;  4A63 B;  1M3C A;  4M4Z A;  1JEG A;  2DRK A;  1ZUK A;  1WXT A;  2LMJ A;  1PHT A;  5IXF A;  2ABL A;  4J9H A;  4OMM A;  1G2B A;  2K2M A;  5FW9 A;  4CC3 A;  2EYY A;  1GRI A;  1YCS B;  2F2V A;  2LQN A;  4HVW A;  1JO8 A;  2HSP A;  2O31 A;  2CSI A;  1AVZ C;  1W1F A;  2RNA A;  3O5Z A;  2NUZ A;  1WX6 A;  1RLQ C;  1V1C A;  2ENM A;  5GJV B;  2C0O A;  3GBQ A;  2W10 A;  2KRN A;  2BZ8 A;  2MIO A;  2VWF A;  1AWO A;  2O9S A;  4OMQ A;  1E6H A;  2GTJ A;  1NYF A;  1OOT A;  2RQW A;  2AKK A;  1VA7 A;  1K1Z A;  4RTT A;  1SRM A;  1RI9 A;  2JTE A;  5IH2 A;  1T3S A;  1YP5 A;  3IQL A;  1QKX A;  3ZL7 C;  4EIK A;  4AFQ C;  2K7A A;  1BU1 A;  3CQT A;  4KRT A;  2LCS A;  1I07 A;  2LQW A;  1NYG A;  3I5S A;  2C0I A;  1XOV A;  2MCN A;  3C0C A;  3M0R A;  4JPB W;  2J6F A;  2FPE A;  4F16 A;  3NGP A;  4LE9 A;  1PRL C;  1JXM A;  4CC7 A;  1H8K A;  1JQQ A;  2DJQ A;  1QWE A;  5IHN A;  1X43 A;  2YT6 A;  3VS4 A;  3TSZ A;  3U23 A;  1NM7 A;  1WIE A;  1WFW A;  2D0N A;  4RUG A;  1T0J A;  1GBQ A;  1OPL A;  2PNI A;  2ED1 A;  3M0S A;  3ULR B;  2DMO A;  1KJW A;  3EG1 A;  2YUP A;  2EPD A;  2DL4 A;  2RQU A;  2D8H A;  1GFC A;  3TVT A;  1H3H A;  4HXJ A;  2QDL A;  3EG3 A;  1K0X A;  1ZBJ A;  3UA7 A;  4QT7 A;  2JS2 A;  3JV3 A;  2DL7 A;  3UF4 A;  2J05 A;  2OI3 A;  1ARK A;  1WXB A;  3H0I A;  1NG2 A;  5HCK A;  2VKN A;  1K0S A;  1KSW A;  1BBZ A;  1SEM A;  3TSW A;  3EG2 A;  1UHC A;  1B3Q A;  1RLP C;  1UFF A;  2W0Z A;  4JZ4 A;  1UG1 A;  2L0A A;  3M0U A;  1K76 A;  1X6G A;  4RTV A;  2KRM A;  2KT1 A;  2V1Q A;  1TUD A;  3NHN A;  1Y0M A;  1ABQ A;  1HSQ A;  1X6B A;  2O9V A;  2JMA A;  1J3T A;  4X1V A;  1X69 A;  1MV3 A;  4AG2 C;  2D8J A;  1OEB A;  1U06 A;  1Z9Q A;  2FRY A;  1SHF A;  1SPK A;  2KNB B;  2RF0 A;  3UAT A;  3I35 A;  2L2P A;  2SEM A;  5IHI A;  2MOX A;  1YNZ A;  3FJ5 A;  2DE0 X;  1CKB A;  5IHK A;  1WYX A;  1K9A A;  3THK A;  1TG0 A;  3H0F A;  1S1N A;  4J9D A;  1M30 A;  4ORZ A;  2DYB A;  2DRM A;  1AWJ A;  2FG0 A;  4F17 A;  1AZE A;  1AEY A;  1Z9Z A;  3EHQ A;  4LUD A;  1YWP A;  1UJY A;  2ECZ A;  2HCK A;  4F14 A;  1WA7 A;  1NEB A;  2A28 A;  2I0N A;  1N5Z A;  3REB B;  1JXO A;  2BZX A;  1X27 A;  2RQV A;  3VS5 A;  1UDL A;  2M51 A;  4JJC A;  1WXU A;  3NPF A;  2GQI A;  3PE0 A;  2OJ2 A;  3VS0 A;  1VYU A;  1EFN A;  1W6X A;  2LJ3 A;  2JMC A;  1PKT A;  4FSS A;  4JJB A;  1W70 A;  1U5S A;  4Z88 A;  2J6K A;  2RQT A;  1QKW A;  2FEI A;  3M0P A;  4AFU C;  1NLO C;  2JW4 A;  4GBQ A;  2K6D A;  2YUQ A;  1GCQ C;  2RQR A;  1SRL A;  4E6R A;  1YN8 A;  3M0T A;  1X2Q A;  2KGT A;  2B86 A;  2J06 A;  1GCQ A;  2LJ0 A;  2LX7 A;  2JM8 A;  3QWX X;  3RBB B;  4ESR A;  2P4R A;  1PNJ A;  4CC2 A;  2C0T A;  1GCP A;  2M0Y A;  4Z89 A;  2LJ1 A;  4OML A;  2DM1 A;  1K4U S;  2EW3 A;  3H41 A;  4AG1 C;  2KRS A;  4WCI A;  1H92 A;  1G83 A;  1OPK A;  2JXB A;  4J9I A;  2AZS A;  3M0Q A;  2EYZ A;  1SSH A;  4HVU A;  1I0C A;  2EKH A;  3PVL A;  3H0H A;  4RTZ A;  4JJD A;  3VRZ A;  1ZX6 A;  2CUD A;  2X3W D;  1IO6 A;  1VYV A;  2LP5 A;  3A98 A;  1E6G A;  1SHG A;  1M3A A;  2HDA A;  2F2W A;  2FPD A;  2YDL A;  4J9B A;  3PVQ A;  2FPF A;  5I22 A;  1E7O A;  2EBP A;  2GNC A;  4AFZ C;  1AWX A;  5FWB A;  2RN8 A;  2V1R A;  1BK2 A;  4IIO A;  4OMN A;  2A36 A;  3UA6 A;  2AZV A;  1UUE A;  2CT4 A;  4RTX A;  1Y57 A;  2DVJ A;  2DNU A;  2EYW A;  2VVK A;  2CH4 W;  2BTT A;  1M3B A;  1QCF A;  1HD3 A;  1OV3 A;  1UGV A;  2KEA A;  2LZ6 B;  2GGR A;  1UTI A;  2HEQ A;  1UJ0 A;  3LH5 A;  4LN2 A;  2CDT A;  1ABO A;  2GTO A;  4J9E A;  4D8D A;  2YUO A;  4ZNX A;  4DEX A;  1GFD A;  1B07 A;  2IIM A;  1CSK A;  4DEY A;  1NLP C;  1FYN A;  2K9G A;  5GJW B;  2RMO A;  4RTY A;  3VRY A;  1GL5 A;  2LNH B;  3I9Q A;  2EGC A;  1ZUY A;  2L3S A;  3VS1 A;  1UEC A;  3VS7 A;  1MV0 B;  2KR3 A;  1QWF A;  2FO0 A;  2DBK A;  2KXC A;  4CC4 B;  1FMK A;  2L3P A;  2CT3 A;  1UHF A;  1PRM C;  4J9F A;  2PTK A;  2O2O A;  1BB9 A;  2F2X A;  2L3Q A;  3EHR A;  4AFS C;  2CRE A;  4OMO A;  5I11 A;  2H8H A;  2KT8 A;  2A37 A;  1U3O A;  3VS6 A;  2JS0 A;  2A08 A;  2XMF A;  4LUE A;  2EGA A;  1YWO A;  1MUZ A;  2KYM A;  2EGE A;  2ROT A;  2O88 A;  2E5K A;  2DBM A;  1ZSG A;  2EQI A;  5L23 A;  3SHW A;  2KXD A;  3SEM A;  2ROL A;  2EYX A;  1AOJ A;  2CSQ A;  2NWM A;  4OMP A;  1ZLM A;  2CUB A;  2OAW A;  1PWT A;  4GLM A;  1M27 C;  3RNJ A;  1LCK A;  2EVR A;  2G6F X;  4HCK A;  4Y92 A;  5FWC A;  1VYT A;  2AKL A;  3EG0 A;  2DL3 A;  2DL5 A;  2KYB A;  1A0N B;  2DX1 A;  2RPN A;  4J9G A;  4LNP A; 
#chains in the Genus database with same CATH topology
 2CZ7 B;  7AT1 B;  3A8G B;  1RUW A;  3LWH A;  1QLY A;  2CH4 A;  4FYX B;  2K79 A;  3A8H B;  3OB9 A;  5A0L A;  1NEG A;  3A5Z B;  2EJ9 A;  2DL8 A;  3CCE A;  4EDU A;  1KIK A;  1VQK T;  4F7U G;  4D6W A;  1Q81 U;  1KQS A;  2KBT A;  4DBF A;  3J7A F;  2V8K A;  4GLK A;  3RIR A;  5KCO A;  4X9C A;  2LQK A;  4C0D B;  2JM9 A;  1Q86 U;  3G71 A;  4R0K A;  2KE9 A;  3QZ9 B;  3DB3 A;  1GBR A;  4JZ3 A;  2HNI A;  5GMK m;  2K3B A;  1H3Z A;  3OYN A;  4IUQ A;  1AD5 A;  1I8F A;  2DZ9 A;  3NTK A;  4II1 A;  5HKC A;  4LDX A;  4Q5W A;  1NJI U;  4DOW A;  3PT9 A;  1M3C A;  3QII A;  2PUO B;  3CD6 Q;  2DKG A;  3QO3 A;  3HP9 A;  1WJS A;  5IXF A;  1Y7X A;  2HQX A;  4M75 A;  3JB9 G;  3CPW S;  1M2V A;  2YHT A;  3MCA B;  3WVD B;  2EYY A;  4C92 F;  1YJW T;  1GRI A;  2LTO A;  2F2V A;  4HVW A;  2O31 A;  1D0X A;  1M4Z A;  2QEX T;  3CME Q;  1JJ2 A;  5FRN A;  1WHM A;  1ZSZ C;  2ENM A;  4FIB A;  2BUD A;  2HKQ B;  4HA8 A;  1RAB B;  3M56 A;  4F7U B;  2IG0 A;  3OYD A;  1YIJ Q;  1AWO A;  1E6H A;  3ASK A;  4M7D A;  3WVE B;  4QQG A;  1OOT A;  1TU0 B;  1BIB A;  5LJ5 f;  1T3S A;  4EIK A;  4AFQ C;  2K7A A;  3G7Z A;  1NYG A;  3QSU A;  4UC4 A;  3URG A;  1DJ7 B;  1UEB A;  3BDU A;  3J80 E;  1MMD A;  4E7I A;  3NGP A;  2DIQ A;  3V7S A;  1H8K A;  2DTO A;  5IHN A;  2X4Y A;  4XTU A;  1K8A C;  2R57 A;  1Q82 C;  3TSZ A;  3HKS A;  1B34 B;  4N0A A;  5CKE A;  1BI2 A;  4BAC A;  4FYV B;  3PGG A;  2EPD A;  2QYZ A;  4M78 F;  5GAN 4;  1GFC A;  4LD6 A;  1NPR A;  5J3B A;  1K0X A;  3CCV A;  3E19 A;  3JV3 A;  3UF4 A;  1LNX A;  3NTI A;  2J05 A;  5CVI A;  2MAM A;  1ARK A;  1SF9 A;  4B6M A;  1NG2 A;  4OMF B;  3I56 A;  2VYT A;  2EWN A;  2M9U A;  1C0M A;  5EG2 A;  4CI0 C;  4C92 C;  2HAX A;  4JZ4 A;  3SD4 A;  2L0A A;  4RTV A;  2RM4 A;  2KT1 A;  2X51 A;  5LJ3 j;  2M0O A;  3CXC S;  1QMC A;  3EH1 A;  1VQ5 A;  1K9M C;  3QHS A;  1J3T A;  5LJ5 h;  2DXC A;  2LT1 A;  4PLI A;  1VUB A;  1SPK A;  2KQW A;  4C5E A;  5IHI A;  4C92 D;  2H3E B;  2DXT A;  1P92 A;  1K9A A;  2IVW A;  1VQM A;  1TG0 A;  3H0F A;  1S1N A;  4M75 B;  2QA4 Q;  4BY6 B;  1WHL A;  5GAN g;  2AT1 B;  1UGR B;  1AWJ A;  1M2V B;  4QQD A;  3HTR A;  2ZPH B;  4IUP A;  1AEY A;  3JCM e;  1M1K R;  4LUD A;  4C5H A;  4B9W A;  4ZGJ B;  2HL5 C;  1NEB A;  3OY9 A;  2I0N A;  3BW1 A;  2MPX C;  4JJC A;  3ZEH A;  3HRU A;  1VQ4 Q;  1YJ9 A;  3SWN C;  3S6W A;  3CBP A;  2OJ2 A;  3OS0 A;  1QVP A;  2YLC A;  1QVF A;  2LJ3 A;  1G8X A;  2JMC A;  3CMA A;  2O01 E;  2VC8 A;  2ZZD A;  4JJB A;  5GMK j;  3OYC A;  2RQT A;  1M9S A;  1I5O B;  3M0P A;  1M90 U;  4DQ2 A;  4GBQ A;  2K6D A;  2RQR A;  3FJP A;  3HRS A;  5CKF A;  4J7F A;  1YIJ T;  2VXE A;  2HBP A;  3MEA A;  4M78 D;  2LJ0 A;  2JM8 A;  5DLQ E;  1D3B A;  3QWX X;  3RBB B;  2CZ6 B;  1PNJ A;  2HZY A;  4A54 A;  4CC2 A;  2DEU A;  2C0T A;  1GCP A;  2M0Y A;  2FHD A;  2EQJ A;  2QA4 A;  3DKM A;  2MWP A;  5AT1 B;  5KE2 A;  4WCI A;  1VQ6 Q;  1OPK A;  3HHT B;  2E65 A;  2AZS A;  3M0Q A;  2QI2 A;  4PJJ A;  2EYZ A;  4DOV A;  4C92 E;  3CC2 A;  3JB9 F;  3OQ5 A;  1IO6 A;  1VYV A;  1E6G A;  3DB4 A;  3QXE B;  2HDA A;  2F2W A;  4HT8 A;  4NOY A;  3CCQ Q;  2FPF A;  5I22 A;  1FMW A;  4LDV A;  2HL3 A;  2EBP A;  2GNC A;  4AFZ C;  2K2V A;  2V1R A;  4M7A C;  2OTJ A;  1EZZ B;  2AZV A;  2QTX A;  1UUE A;  1Y57 A;  2DNU A;  2VVK A;  2ZPG B;  3LGF A;  2KEA A;  4IUU A;  1UTI A;  3LH5 A;  3SDZ A;  2GTO A;  1M2O A;  1QVF S;  4D8D A;  4ZNX A;  2IIM A;  3CCU Q;  1NLP C;  2RMO A;  2RJE A;  4RTY A;  4IKF A;  3VRY A;  2LNH B;  2ZPB B;  3PMT A;  4J6W A;  1G3Y A;  3MEW A;  4OB2 B;  5GAO n;  2QQS A;  1G3W A;  2L89 A;  1YBY A;  2BE9 B;  4IUV A;  4Y91 A;  4DBR A;  2KXC A;  3EFO A;  3KXT A;  2ZAE A;  4M78 E;  5LJ5 j;  2PVD B;  2GFA A;  3OSS C;  4NS5 A;  2E64 A;  2FYK A;  4C0F A;  2F2X A;  1ZQ1 A;  3EHR A;  3VUZ A;  4AFS C;  3CCS A;  4M75 F;  4OB0 B;  3JCM d;  2KY9 A;  3VS6 A;  4RMO A;  4E7K A;  1PM3 A;  2E10 A;  4BI8 B;  2RJD A;  5CAI A;  4E7J A;  3OYK A;  3S3N A;  3RKY A;  5LJ3 g;  4ELZ C;  3CCL T;  5C6S A;  1R77 A;  1VIE A;  1WJR A;  1ZLM A;  2CUB A;  2OAW A;  4OMP A;  2XIC A;  4HCK A;  2G6F X;  1D3B B;  1VYT A;  5KYN A;  4OVA A;  2AKL A;  1N8R C;  2KYB A;  5D6Y A;  2PQW A;  3EG9 B;  5FU7 B;  1QP3 A;  3JB9 D;  3JCM W;  3JRZ A;  3G4S T;  1S72 Q;  1X75 C;  4JRP A;  2KRO A;  2D0Q B;  2V26 A;  2HBW A;  4Z8A A;  2F5T X;  2D9T A;  1NBE B;  1WI7 A;  3OYF A;  2DIL A;  2DF6 A;  4E7L A;  5ECA A;  4KUI A;  1OUL A;  2K5F A;  2GCX A;  1YIT Q;  1K8A R;  1D0Y A;  3NFC A;  1Q82 R;  1VQO T;  1Y96 A;  2E5Q A;  1KFZ A;  4BB7 A;  2AK5 A;  3QWY A;  2DPP B;  4RTU A;  3OYH A;  2CYZ B;  5EC7 A;  1G5V A;  1M1F A;  1T3L A;  5IN1 A;  4M78 G;  2XID A;  1VQ7 T;  1G3S A;  3EGU A;  4J6Y A;  3CC7 A;  4IIM A;  2R5M A;  2OTL Q;  4D8K A;  1I1J A;  3QJY A;  1PKS A;  4A63 B;  2HQE A;  4A4F A;  4KUL A;  1KC8 U;  4QW2 A;  1I4K 1;  1RAE B;  3MO8 A;  3RKW A;  1PHT A;  1PG5 B;  4OMM A;  1G2B A;  2RI2 A;  2DO3 A;  2F69 A;  1YJN Q;  2CP7 A;  2LQN A;  5GAN 6;  5CKH A;  1JO8 A;  2HSP A;  1RI0 A;  4J7I A;  2CSI A;  2JVV A;  1LJO A;  3CCE Q;  4M75 D;  5GJV B;  1VQK A;  3TCJ A;  3TRE A;  1KK7 A;  1K9M R;  4ZGD B;  3MEV A;  2VWF A;  2H3J A;  2P4T A;  2O9S A;  2V8J A;  1D0Z A;  1FXX A;  4OMQ A;  2GTJ A;  4EPC A;  2VUB A;  3MET A;  2QK0 A;  1NYF A;  3OYL A;  1VA7 A;  1K1Z A;  2JTE A;  1VQN T;  5LL6 S;  2PU9 B;  1BU1 A;  3CQT A;  1I07 A;  1VOM A;  4PFP A;  2IPO B;  3I5S A;  2HMA A;  1FWZ A;  2C0I A;  1RAI B;  2MCN A;  4PFZ A;  2QAS A;  2X4W A;  3QDF A;  4F16 A;  1WQ7 A;  4LE9 A;  3GIB A;  1GXI E;  1JXM A;  2DJQ A;  2OTL A;  3LX7 A;  5GAM f;  3U23 A;  1NM7 A;  4C8Q A;  1WFW A;  5M9O A;  4J8O A;  3V7R A;  3M0S A;  4IUR A;  3ULR B;  3EG1 A;  3HPW A;  5FLX E;  2WSF E;  2YUP A;  3V8J A;  2BE7 D;  2DL4 A;  3EGX A;  2D8H A;  5CKB A;  5FRM A;  5KYX B;  3WXM B;  1YJN A;  3DLM A;  1H3H A;  1ACM B;  4OP0 A;  2RK2 A;  3PIO A;  1QW1 A;  5KH6 A;  1ZBJ A;  5KE3 A;  3G6E T;  4NL2 A;  1MGQ A;  4QVZ A;  1OYX A;  3OS1 A;  4ATO A;  2VKN A;  1K0S A;  1BBZ A;  2QQA A;  3TSW A;  2XDB A;  1ZA2 B;  1B3Q A;  1UFF A;  2E3H A;  3E9G A;  4BDZ A;  4KGV B;  1X6G A;  5LJ5 g;  2D6F A;  2XU8 A;  2DXU A;  4PJO A;  4JRQ A;  3NHN A;  4M75 E;  1ABQ A;  2F5K A;  1X69 A;  2ZPF B;  1MV3 A;  2KNB B;  2KSS A;  1TWB A;  3UAT A;  2WAC A;  4ZN1 A;  1OX9 A;  2L2P A;  2SEM A;  2ZGW A;  4XTW A;  2MOX A;  2QQR A;  1YIT T;  1YNZ A;  3CCR A;  3FJ5 A;  5GMK h;  2E6N A;  5D6X A;  1WYX A;  1XTD A;  2X35 A;  4J9D A;  4ZTJ A;  3VYG A;  5GAM h;  3CCV Q;  5KYW A;  4C8Q G;  2MF2 A;  3OBW A;  1RL2 A;  1TXQ A;  3JB9 H;  4PJL A;  4M7D E;  4F17 A;  3EHQ A;  3I56 Q;  2YRV A;  1VQ8 Q;  1OX8 A;  2CS7 A;  1G3T A;  4F14 A;  1WA7 A;  1AT1 B;  3FEO A;  2AHJ B;  2EQU A;  3REB B;  2RQV A;  3CCM Q;  1HK9 A;  1N9S A;  2FZK B;  1VQL Q;  1IRX A;  2M51 A;  3CC4 T;  1VQ5 Q;  3EFR A;  3PE0 A;  3VS0 A;  1IZ6 A;  1MND A;  1YHQ Q;  1VYU A;  4C0Z A;  1EFN A;  1D1B A;  4HKE A;  3E9F A;  3PMI A;  4AFU C;  1KQS S;  1UGQ B;  4JS4 A;  1VQM Q;  3M0T A;  4PJO G;  1PSE A;  3OBY A;  5GAN e;  1Q7Y C;  4P5N A;  2B86 A;  2J06 A;  1KD1 C;  1UGS B;  5FU7 C;  1BKB A;  2LX7 A;  4F04 B;  3V8K A;  4C8Q B;  3G71 T;  2BKD N;  4JJN K;  1RAA B;  1BCO A;  2M16 A;  2Z0W A;  3CCJ T;  4M75 G;  3OMG A;  2LJ1 A;  3EGX B;  1MMN A;  2EW3 A;  3H41 A;  2CP2 A;  1H92 A;  1YJ9 Q;  2JXB A;  4J9I A;  1KQ2 A;  1VQ8 A;  3OMC A;  1I0C A;  3H0H A;  3SB2 A;  2X3W D;  5FU6 B;  3CCM A;  3JCM Q;  3M55 A;  3CMA Q;  1SHG A;  3INZ A;  1M3A A;  1VQL A;  2YDL A;  1JJ2 S;  5CK9 A;  2M02 A;  3PVQ A;  4HT9 A;  2LX9 A;  4Z02 A;  4M7D G;  2VB6 A;  1IB8 A;  5L8R E;  4IIO A;  1YHQ A;  3UA6 A;  1PCX A;  4PJO B;  4VUB A;  2CT4 A;  4RTX A;  3BDL A;  2JUF A;  1N8R R;  2CH4 W;  2BTT A;  1M3B A;  8AT1 B;  4CRI A;  2NYS A;  3L2Z A;  3V8L A;  1R0C B;  1OZ3 A;  2LZ6 B;  2KMT A;  2GGR A;  2WSC E;  1WQW A;  1KG1 A;  2Y90 A;  3P8H A;  1Q81 C;  3HL8 A;  2XI9 A;  3DLL A;  2RO0 A;  2E1H A;  2K9G A;  3QKJ A;  5GJW B;  4ANJ A;  1Q86 C;  4OB3 B;  2P84 A;  2HD0 A;  3FLG A;  3I9Q A;  2L3S A;  4ZN3 A;  3CC2 Q;  4ZGE B;  1VQ9 Q;  1UEC A;  2JN0 A;  1QWF A;  1NJI C;  3CD6 T;  5KYU A;  3TQ7 P;  1QVG A;  3VV0 A;  1UHF A;  4QVC A;  4J9F A;  2PTK A;  2VXF A;  4M78 C;  1PD1 A;  4XTY A;  4M7D B;  4FT2 A;  3MJX A;  1BB9 A;  2KI7 A;  2XKO C;  2L3Q A;  4RKU E;  2OTJ Q;  3OYB A;  3QYG B;  5I11 A;  2QAZ A;  2A37 A;  3A8L B;  1U3O A;  1WHK A;  1ZSZ A;  4LD9 K;  3CME T;  3OW2 P;  4EMK C;  2EGA A;  2WSE E;  2ROT A;  5GAN 8;  3QBY A;  1X6O A;  1YCY A;  5GAM j;  2AIR B;  5DLO A;  2DEQ A;  2L5Q A;  5L23 A;  9ATC B;  1BYM A;  5A2Q E;  2DZC A;  3H6Z A;  3GOX A;  3SHW A;  2KXD A;  3JB9 J;  2EYX A;  2K4Y A;  2CSQ A;  1O75 A;  4L59 A;  1Y07 A;  3L42 A;  5FWC A;  4Y28 E;  4OB1 B;  3LH0 A;  1K73 R;  3EG0 A;  4KBM B;  3MEU A;  3MP8 A;  1A0N B;  1D1A A;  3FDR A;  4LNP A;  2DK3 A;  1JU5 C;  1M1K U;  1X2K A;  4HVV A;  3R6N A;  5GAN d;  2ESW A;  2CGH A;  2JT4 A;  2GBQ A;  3T9N A;  1VQ9 A;  5J26 A;  5I21 A;  3CCS Q;  3I5R A;  2JOY A;  2SRC A;  2LCL A;  2MWO A;  2PZ1 A;  5GAN 7;  1WHH A;  3GP8 A;  4C0D C;  4K11 A;  3L2Q A;  4XTX A;  4C8Q F;  2NUP A;  2DD5 A;  3KFV A;  5IXB A;  4A4G A;  2YUN A;  4X34 A;  1HJD A;  1M8M A;  2DER A;  3REA B;  5LJ3 e;  3H8Z A;  5C0M A;  2EJG A;  3A1P A;  4XU0 A;  5KYY A;  3M5A A;  1CKA A;  3OYY A;  1IHW A;  2P0P A;  4RTW A;  3D7S B;  1UE9 A;  3CCL A;  1WDX A;  3BE3 A;  1AWW A;  4FU6 A;  2ED0 A;  2RJC A;  2CKK A;  3VS3 A;  4M77 A;  2A3L A;  2LNV A;  2RK1 A;  3I55 A;  2CP3 A;  1JBM A;  4PNO A;  1JEG A;  5GAN 2;  1VQP Q;  1OU8 A;  1QCN A;  4MZP A;  4PJM A;  2MMP A;  1ZUK A;  5CO7 A;  3MKD A;  4EMG A;  1WXT A;  3RKX A;  3QUI A;  4J9H A;  3G4S A;  2CZ0 B;  1YI2 A;  2K2M A;  4C5I A;  5FW9 A;  4PJO F;  3LWI A;  3CPF A;  2K3X A;  2I2L A;  3JCM b;  1JB0 E;  2COW A;  1FX7 A;  2L3R A;  4FL6 A;  1AVZ C;  2RNA A;  1QP2 A;  3E2U A;  1WX6 A;  1QCO A;  1MMG A;  5KYU B;  2VV5 A;  1VQO A;  4A4K A;  3JCM V;  2EKO A;  2QA4 T;  3JCM f;  1OU9 A;  2X9H A;  4KGX B;  2RQW A;  2COY A;  2AKK A;  2RA2 A;  3OS5 A;  1ZSZ B;  4RTT A;  1WGS A;  1VQ7 A;  3A8O B;  1SRM A;  4PFO A;  5IH2 A;  3CC7 Q;  5GMK e;  1QKX A;  3ZL7 C;  4HCC A;  4JS5 A;  2E12 A;  2LCC A;  2LQW A;  3SWN A;  4GY5 A;  2QGG A;  3C0C A;  2J6F A;  1VQ4 T;  4C8Q C;  3H9N A;  3L2W A;  3UPU A;  3N5B B;  3SFM A;  4E47 A;  2EAY A;  2P0K A;  4M7D F;  1X43 A;  3CXC P;  2OTJ T;  1KHI A;  4FW1 A;  1WIE A;  4E7S A;  3VUB A;  2RJF A;  4M77 G;  1VQP A;  2BIV A;  2QQB A;  2DMO A;  2Y4Y A;  1KJW A;  4QKU A;  1WZO A;  1M90 C;  2XDP A;  3X24 B;  1VQK Q;  2LQ8 A;  4C8Q D;  3X26 B;  4E7Z A;  5GAO l;  2QDL A;  3EG3 A;  4AMC A;  4MZT A;  2JS2 A;  1BI1 A;  1FMV A;  2OI3 A;  4R56 A;  1WXB A;  3LW5 E;  1VQN A;  2NUP B;  4MML A;  1UHC A;  1LPL A;  3OYM A;  1Q7Y R;  2W0Z A;  4O6J A;  3M0U A;  1K76 A;  2KRM A;  1VQ6 T;  2V1Q A;  3O8V A;  1TUD A;  2RHU A;  3JCM h;  4OF1 A;  5KYY B;  1U1S A;  3QPH A;  1YFN A;  2E41 A;  1HSQ A;  2QTV A;  4M75 C;  3MHX A;  2D8J A;  1NPP A;  1WHG A;  1YJW Q;  1OEB A;  1Z9Q A;  2FRY A;  4BY6 C;  3E1S A;  3CCQ T;  4X9D A;  2RD1 A;  3I35 A;  4M77 B;  5A0D A;  3OYG A;  2QEX Q;  2YWW A;  2RI3 A;  4M7A A;  4PJO D;  5GAM g;  4EMH A;  2DD4 A;  5LJ3 d;  3VYH B;  3ER0 A;  2DE0 X;  5IHK A;  1M30 A;  4WF2 A;  2DYB A;  3JCM X;  3OW2 A;  3G6E A;  3EFO B;  3BFM A;  1YWP A;  1UJY A;  4M7D C;  2HCK A;  3ZBD A;  2XHC A;  1JXO A;  2BZX A;  4RCB A;  3VS5 A;  3CCU T;  1PD0 A;  5LJ5 e;  3V7C A;  5CQX A;  2RI5 A;  1WXU A;  2LRQ A;  3NPF A;  1EIF A;  4F7U A;  4KH1 B;  1K8A U;  1SSF A;  1IGQ A;  3JCM c;  1Q82 U;  2HKN A;  2FZG B;  4XAX B;  2ZCF B;  2QG9 B;  1Q81 R;  1XJW B;  1W6X A;  1TS9 A;  3JCM J;  4FSS A;  4C8Q E;  1H64 1;  4M7D D;  4LDY A;  1W70 A;  3M59 A;  3Q1J A;  1U5S A;  3G1J A;  1QVG P;  2J6K A;  3R6O A;  3A8M B;  1QKW A;  4N0A C;  1NLO C;  1M1G A;  2JW4 A;  3GLX A;  3L1A A;  3CCR Q;  2YUQ A;  3QJ6 A;  1WPY A;  3RR6 A;  3RES A;  1X2Q A;  2QXF A;  1NJI R;  3CPW A;  1N6A A;  1YJW A;  2KGT A;  3HRT A;  2QEX A;  1GCQ A;  3OA6 A;  4ESR A;  4FYW B;  3CC7 T;  4M7A G;  3FB9 A;  4BE1 A;  3QDR B;  4BE0 A;  2LDM A;  3X28 B;  4PJN A;  1KQ1 A;  2DAQ A;  1G83 A;  1RAF B;  3CC4 A;  4PJO E;  3MP1 A;  2EKH A;  3PVL A;  1K9M U;  4RTZ A;  3VRZ A;  1ZX6 A;  2CUD A;  2FB7 A;  1I5L A;  2LP5 A;  3OW2 S;  2FPD A;  3HFO A;  3M53 A;  4J9B A;  4JLG A;  1Y96 B;  1RAH B;  2GQV A;  1IGU A;  1S72 T;  2JZ2 A;  5FWB A;  1V29 B;  3QZ5 B;  4RG2 A;  1I81 A;  3RER A;  5GMK i;  1OQK A;  2X4X A;  3EGD A;  4N4I A;  1QCF A;  1PSF A;  5D6W A;  1HD3 A;  1D09 B;  4NL3 A;  4FM4 B;  2KDS A;  4WTO B;  5GAO q;  4ZTF A;  2HEQ A;  1UJ0 A;  4LN2 A;  4J9E A;  4M7A B;  3NTH A;  2EFI A;  2LT4 A;  3CCJ A;  1GFD A;  1XNI A;  4DEY A;  3JSC A;  1FYN A;  3BY7 A;  4JDS A;  3TU4 K;  1GL5 A;  1UB4 A;  2OX7 A;  3VS1 A;  3QG1 A;  4FW2 A;  2OTL T;  5CKD A;  1TSF A;  4BE2 A;  1N27 A;  2FL7 A;  3KUF A;  3FRN A;  2FO0 A;  2DBK A;  4J83 A;  4CC4 B;  1LVK A;  1FMK A;  2L3P A;  2CT3 A;  1KC8 C;  4M77 F;  4PKC C;  3JAM E;  3OYJ A;  4PL6 A;  1RAG B;  4HCZ A;  1PRM C;  1WNL A;  2RHI A;  2O2O A;  3F70 A;  3L2V A;  2NUT A;  3CXC A;  2DTH A;  5HY6 A;  4A4E A;  2CRE A;  1YJN T;  4OMO A;  2JS0 A;  2A08 A;  3J81 E;  3CCE T;  2O88 A;  2EGE A;  1W2B P;  5I2S A;  2E5K A;  5LJ5 d;  2YXY A;  1W4S A;  4ME7 A;  1TUG B;  1X01 A;  4A4H A;  1MNE A;  4J5Y A;  3P8B B;  3SEM A;  2ROL A;  2L8D A;  2NWM A;  5D7U A;  1PWT A;  4GLM A;  1M27 C;  5GAO p;  2E6Z A;  1LCK A;  4Y92 A;  2E4H A;  2KAF A;  2KVQ G;  3LYI A;  4XTZ A;  2DL5 A;  3QYH B;  3CD6 A;  2DX1 A;  2KK4 A;  1R8O B;  1TUC A;  3OSV A;  1HXD A;  3CCR T;  1AZG B;  2HQH A;  2DA9 A;  1O9S A;  2X3X D;  3NMZ C;  3M58 A;  2BZY A;  1IHV A;  2YSQ A;  3CME A;  3EH2 A;  4QVD A;  3VS2 A;  2JTF A;  1LOJ A;  2J6O A;  2EQK A;  4FYY B;  2ATC B;  1T0H A;  2COZ A;  1YIJ A;  3CBM A;  3GF5 A;  1WLP B;  1ZBX A;  2DLP A;  5GAO m;  4J9C A;  2D1X A;  3X25 B;  2DXB A;  2Y4X A;  1ZUU A;  4M77 C;  5A0G A;  2O4X A;  3AT1 B;  2QDY B;  2J7I A;  1ZA1 B;  3EGD B;  1M90 R;  2EYQ A;  1BI3 A;  5GAN 3;  3VKI A;  5HK3 A;  2FRW A;  4JRI A;  2PVG B;  2R5A A;  4JRK A;  1MHN A;  4M4Z A;  4C5G A;  2DRK A;  5J39 A;  2XDD A;  1N9R A;  2LMJ A;  2ABL A;  2CP6 A;  3P8D A;  3X20 B;  5KYW B;  4DBQ A;  2QGF B;  4M77 D;  4CC3 A;  1QQJ A;  2DFU A;  2XD0 A;  1YCS B;  1KHC A;  1W1F A;  3O5Z A;  2NUZ A;  1RLQ C;  4BUG A;  1V1C A;  2RH2 A;  3CBO A;  4M7A F;  2C0O A;  3GBQ A;  2W10 A;  2KRN A;  4QQ6 A;  2A0F B;  2BZ8 A;  2MIO A;  4E2F B;  2NUT B;  4L5G A;  3CCV T;  4OGE A;  4BDY A;  3LGL A;  3CCL Q;  3C12 A;  2RHZ A;  3I56 T;  1VQ8 T;  2VGM A;  2X4J A;  1RI9 A;  1ZHI A;  3MPU B;  1YP5 A;  4L6V 5;  3IQL A;  5DY9 A;  2LCS A;  4KRT A;  3CCM T;  4R55 A;  1N8R U;  1WJQ A;  4LXC A;  3I55 Q;  4ELY C;  1VQL T;  1XOV A;  4TVR A;  3M0R A;  1F1B B;  4JPB W;  2FPE A;  3OYE A;  1PRL C;  4CC7 A;  3G4S Q;  1VQ5 T;  4XU2 A;  1JQQ A;  4DBH A;  1YI2 Q;  4KH0 B;  1QWE A;  4F7U F;  1YHQ T;  2YT6 A;  3M4G A;  3VS4 A;  1WHJ A;  3CEY A;  2D0N A;  4RCC A;  4RUG A;  1T0J A;  2OAU A;  4OGC A;  1GBQ A;  1BCM A;  1OPL A;  2ED1 A;  2PNI A;  2RHY A;  4N4G A;  4FSX A;  4XQ3 A;  1PC0 A;  4RG8 A;  5GAN f;  2RQU A;  2DTI A;  1VQM T;  5CR2 A;  3EG9 A;  3TVT A;  3RUX A;  3CPW P;  1VQO Q;  1M8V A;  1V76 A;  5AYF A;  4HXJ A;  3OYA A;  1C1A A;  4JLI A;  3OYI A;  3UA7 A;  4QT7 A;  5GMK l;  4BI4 A;  2DL7 A;  1IXD A;  3H0I A;  4AT1 B;  5HCK A;  1VQ7 Q;  1KSW A;  4E7H A;  1SEM A;  3JCM g;  3EG2 A;  4M77 E;  1RLP C;  1NE8 A;  1C6V X;  1UG1 A;  1QVG S;  2JTM A;  5KCH A;  2CP5 A;  1YJ9 T;  1VQ4 A;  4FCY A;  3HFN A;  8ATC B;  3KBG A;  3GNF B;  4C92 A;  1Y0M A;  2XG8 D;  2O9V A;  1X6B A;  2JMA A;  3M57 A;  2O4X B;  4X1V A;  3CMA T;  4JUV A;  4AG2 C;  3RDV A;  1BIA A;  1U06 A;  2RF0 A;  1SHF A;  3PNW C;  2V8I A;  4YTL A;  3S3O A;  2VGN A;  2YRC A;  1R0B G;  4FT4 A;  3FIF A;  1CKB A;  1KQS P;  3TEE A;  1Y71 A;  3THK A;  1K73 U;  1VIF A;  4ORZ A;  4XU1 A;  1M5Q 1;  2DRM A;  2FG0 A;  2RB6 A;  5CCA A;  4M7A D;  2K5I A;  1EX4 A;  3S3M A;  2DIG A;  1AZE A;  1W2B A;  1Z9Z A;  4XTV A;  4MDX A;  2ECZ A;  2YRD A;  1VQN Q;  3C95 A;  2A28 A;  5GAN h;  4DA4 A;  1N5Z A;  4BI3 A;  2HSE B;  1X27 A;  4XU3 A;  3C4S A;  2C06 A;  2F1L A;  1UDL A;  2EQM A;  1U1T A;  2MYS A;  4LDW A;  1VQ6 A;  5IAY A;  2GQI A;  3CC2 T;  1HYO A;  5CQY A;  1NZ9 A;  3M54 A;  1VQ9 T;  3GNG A;  2PUK B;  2YLB A;  3EFS A;  1PKT A;  2CP0 A;  2CZ1 B;  5GAM e;  3JB9 I;  4M78 A;  3CCQ A;  5GAO r;  4Z88 A;  1JJ2 P;  1Q95 G;  2FEI A;  2E3I A;  2M1H A;  3UWN A;  1OZ2 A;  1GCQ C;  1SRL A;  1SKU B;  4E6R A;  1YN8 A;  1B7T A;  4C92 G;  4EMK A;  2GF7 A;  1KC8 R;  3G6E Q;  2JNG A;  1SG5 A;  3LLR A;  5CIU A;  2P4R A;  4N4H A;  1TOV A;  3UDC A;  2E70 A;  5FU6 C;  2ZPE B;  4Z89 A;  2EJF A;  3ME9 A;  1MMA A;  3CCU A;  4OML A;  2DM1 A;  3I55 T;  4KUD K;  1K4U S;  2EIF A;  3AHU A;  3RMS A;  2KRS A;  4AG1 C;  3VU3 C;  2K57 A;  2P0Q A;  5KYX A;  1RAC B;  1YI2 T;  1SSH A;  4HVU A;  3RMQ A;  4JJD A;  5IT9 E;  4PJO C;  3PTA A;  3A98 A;  1TH7 A;  1KD1 R;  4MDW A;  2XK0 A;  3M9Q A;  1W2B S;  1E7O A;  4M7A E;  2FZC B;  4B9X A;  2VAS A;  1M1K C;  1AWX A;  2R58 A;  2B8A A;  2RN8 A;  1IRE B;  1BK2 A;  4OMN A;  3CCS T;  2A36 A;  4C0G A;  1JRI A;  4C92 B;  2DVJ A;  4IUT A;  2EYW A;  4LDU A;  5GAN 5;  5FRO A;  2JJ9 A;  1OV3 A;  3GPL A;  1UGV A;  4V2S A;  4A53 A;  2CDT A;  5LJ3 f;  1ABO A;  3UT1 A;  2YUO A;  4DEX A;  3L2U A;  2A7Y A;  1B07 A;  2MK5 A;  1CSK A;  2NLU A;  2DET A;  3PIP A;  3HSB A;  2MI6 A;  1UGP B;  2EGC A;  4F7U E;  2QQ9 A;  5DM7 R;  3CC4 Q;  1ZUY A;  3VS7 A;  1MV0 B;  2KR3 A;  3EAE A;  2PVO B;  6AT1 B;  1VQP T;  2ZPI B;  4KGZ B;  4MMK A;  2DYI A;  1S72 A;  4PLL A;  4PK4 A;  2K5L A;  4HCB A;  3M4Y A;  1TTH B;  1XQH A;  4XK8 E;  2DVE A;  4J6X A;  3FC3 A;  2H8H A;  1K73 C;  1Q7Y U;  2KT8 A;  3L2R A;  3VJP A;  1KD1 U;  2DJZ A;  3C94 A;  3OS2 A;  2LC4 A;  1Q86 R;  1D1C A;  1BI0 A;  2XMF A;  4LUE A;  1YWO A;  1MUZ A;  2KYM A;  1U8R A;  3SWN B;  3G71 Q;  1YIT A;  2G3R A;  4M78 B;  2RHX A;  1RAD B;  2DBM A;  4MZM A;  1ZSG A;  2K3Y A;  4KT0 E;  2EQI A;  3CCJ Q;  2GFU A;  5HK0 A;  4O5V A;  3MP6 A;  4EMK B;  1AOJ A;  5GAN j;  1B34 A;  3RNJ A;  2EVR A;  1AHJ B;  5GAM d;  3ZFJ A;  1QVF P;  5LJ3 h;  3JCM P;  2DL3 A;  4BD3 A;  5I2M A;  2LVM A;  1OI1 A;  2FVU A;  2RPN A;  4J9G A;  3PFS A; 
#chains in the Genus database with same CATH homology
 1JU5 C;  1TUC A;  1X2K A;  4HVV A;  3R6N A;  2KRO A;  2ESW A;  1RUW A;  1AZG B;  2HBW A;  2JT4 A;  4Z8A A;  2GBQ A;  1QLY A;  2CH4 A;  3I5R A;  1WI7 A;  2DA9 A;  2SRC A;  2X3X D;  2DIL A;  2DF6 A;  2K79 A;  3NMZ C;  2PZ1 A;  1NEG A;  2BZY A;  4K11 A;  2YSQ A;  2DL8 A;  5ECA A;  3KFV A;  5IXB A;  3VS2 A;  2YUN A;  1KIK A;  1HJD A;  1M8M A;  2J6O A;  3REA B;  2KBT A;  1KFZ A;  1T0H A;  2AK5 A;  3QWY A;  1WLP B;  2DLP A;  4RTU A;  1CKA A;  4J9C A;  2D1X A;  2JM9 A;  4RTW A;  5EC7 A;  1ZUU A;  1T3L A;  1UE9 A;  4R0K A;  2KE9 A;  1WDX A;  1GBR A;  4JZ3 A;  2J7I A;  2K3B A;  1AWW A;  3EGU A;  1AD5 A;  4IIM A;  2ED0 A;  4D8K A;  3VS3 A;  2FRW A;  1I1J A;  1PKS A;  4A63 B;  1M3C A;  4M4Z A;  1JEG A;  2DRK A;  1ZUK A;  1WXT A;  2LMJ A;  1PHT A;  5IXF A;  2ABL A;  4J9H A;  4OMM A;  1G2B A;  2K2M A;  5FW9 A;  4CC3 A;  2EYY A;  1GRI A;  1YCS B;  2F2V A;  2LQN A;  4HVW A;  1JO8 A;  2HSP A;  2O31 A;  2CSI A;  1AVZ C;  1W1F A;  2RNA A;  3O5Z A;  2NUZ A;  1WX6 A;  1RLQ C;  1V1C A;  2ENM A;  5GJV B;  2C0O A;  3GBQ A;  2W10 A;  2KRN A;  2BZ8 A;  2MIO A;  2VWF A;  1AWO A;  2O9S A;  4OMQ A;  1E6H A;  2GTJ A;  1NYF A;  1OOT A;  2RQW A;  2AKK A;  1VA7 A;  1K1Z A;  4RTT A;  1SRM A;  1RI9 A;  2JTE A;  5IH2 A;  1T3S A;  1YP5 A;  3IQL A;  1QKX A;  3ZL7 C;  4EIK A;  4AFQ C;  2K7A A;  1BU1 A;  3CQT A;  4KRT A;  2LCS A;  1I07 A;  2LQW A;  1NYG A;  3I5S A;  2C0I A;  1XOV A;  2MCN A;  3C0C A;  3M0R A;  4JPB W;  2J6F A;  2FPE A;  4F16 A;  3NGP A;  4LE9 A;  1PRL C;  1JXM A;  4CC7 A;  1H8K A;  1JQQ A;  2DJQ A;  1QWE A;  5IHN A;  1X43 A;  2YT6 A;  3VS4 A;  3TSZ A;  3U23 A;  1NM7 A;  1WIE A;  1WFW A;  2D0N A;  4RUG A;  1T0J A;  1GBQ A;  1OPL A;  2PNI A;  2ED1 A;  3M0S A;  3ULR B;  2DMO A;  1KJW A;  3EG1 A;  2YUP A;  2EPD A;  2DL4 A;  2RQU A;  2D8H A;  1GFC A;  3TVT A;  1H3H A;  4HXJ A;  2QDL A;  3EG3 A;  1K0X A;  1ZBJ A;  3UA7 A;  4QT7 A;  2JS2 A;  3JV3 A;  2DL7 A;  3UF4 A;  2J05 A;  2OI3 A;  1ARK A;  1WXB A;  3H0I A;  1NG2 A;  5HCK A;  2VKN A;  1K0S A;  1KSW A;  1BBZ A;  1SEM A;  3TSW A;  3EG2 A;  1UHC A;  1B3Q A;  1RLP C;  1UFF A;  2W0Z A;  4JZ4 A;  1UG1 A;  2L0A A;  3M0U A;  1K76 A;  1X6G A;  4RTV A;  2KRM A;  2KT1 A;  2V1Q A;  1TUD A;  3NHN A;  1Y0M A;  1ABQ A;  1HSQ A;  1X6B A;  2O9V A;  2JMA A;  1J3T A;  4X1V A;  1X69 A;  1MV3 A;  4AG2 C;  2D8J A;  1OEB A;  1U06 A;  1Z9Q A;  2FRY A;  1SHF A;  1SPK A;  2KNB B;  2RF0 A;  3UAT A;  3I35 A;  2L2P A;  2SEM A;  5IHI A;  2MOX A;  1YNZ A;  3FJ5 A;  2DE0 X;  1CKB A;  5IHK A;  1WYX A;  1K9A A;  3THK A;  1TG0 A;  3H0F A;  1S1N A;  4J9D A;  1M30 A;  4ORZ A;  2DYB A;  2DRM A;  1AWJ A;  2FG0 A;  4F17 A;  1AZE A;  1AEY A;  1Z9Z A;  3EHQ A;  4LUD A;  1YWP A;  1UJY A;  2ECZ A;  2HCK A;  4F14 A;  1WA7 A;  1NEB A;  2A28 A;  2I0N A;  1N5Z A;  3REB B;  1JXO A;  2BZX A;  1X27 A;  2RQV A;  3VS5 A;  1UDL A;  2M51 A;  4JJC A;  1WXU A;  3NPF A;  2GQI A;  3PE0 A;  2OJ2 A;  3VS0 A;  1VYU A;  1EFN A;  1W6X A;  2LJ3 A;  2JMC A;  1PKT A;  4FSS A;  4JJB A;  1W70 A;  1U5S A;  4Z88 A;  2J6K A;  2RQT A;  1QKW A;  2FEI A;  3M0P A;  4AFU C;  1NLO C;  2JW4 A;  4GBQ A;  2K6D A;  2YUQ A;  1GCQ C;  2RQR A;  1SRL A;  4E6R A;  1YN8 A;  3M0T A;  1X2Q A;  2KGT A;  2B86 A;  2J06 A;  1GCQ A;  2LJ0 A;  2LX7 A;  2JM8 A;  3QWX X;  3RBB B;  4ESR A;  2P4R A;  1PNJ A;  4CC2 A;  2C0T A;  1GCP A;  2M0Y A;  4Z89 A;  2LJ1 A;  4OML A;  2DM1 A;  1K4U S;  2EW3 A;  3H41 A;  4AG1 C;  2KRS A;  4WCI A;  1H92 A;  1G83 A;  1OPK A;  2JXB A;  4J9I A;  2AZS A;  3M0Q A;  2EYZ A;  1SSH A;  4HVU A;  1I0C A;  2EKH A;  3PVL A;  3H0H A;  4RTZ A;  4JJD A;  3VRZ A;  1ZX6 A;  2CUD A;  2X3W D;  1IO6 A;  1VYV A;  2LP5 A;  3A98 A;  1E6G A;  1SHG A;  1M3A A;  2HDA A;  2F2W A;  2FPD A;  2YDL A;  4J9B A;  3PVQ A;  2FPF A;  5I22 A;  1E7O A;  2EBP A;  2GNC A;  4AFZ C;  1AWX A;  5FWB A;  2RN8 A;  2V1R A;  1BK2 A;  4IIO A;  4OMN A;  2A36 A;  3UA6 A;  2AZV A;  1UUE A;  2CT4 A;  4RTX A;  1Y57 A;  2DVJ A;  2DNU A;  2EYW A;  2VVK A;  2CH4 W;  2BTT A;  1M3B A;  1QCF A;  1HD3 A;  1OV3 A;  1UGV A;  2KEA A;  2LZ6 B;  2GGR A;  1UTI A;  2HEQ A;  1UJ0 A;  3LH5 A;  4LN2 A;  2CDT A;  1ABO A;  2GTO A;  4J9E A;  4D8D A;  2YUO A;  4ZNX A;  4DEX A;  1GFD A;  1B07 A;  2IIM A;  1CSK A;  4DEY A;  1NLP C;  1FYN A;  2K9G A;  5GJW B;  2RMO A;  4RTY A;  3VRY A;  1GL5 A;  2LNH B;  3I9Q A;  2EGC A;  1ZUY A;  2L3S A;  3VS1 A;  1UEC A;  3VS7 A;  1MV0 B;  2KR3 A;  1QWF A;  2FO0 A;  2DBK A;  2KXC A;  4CC4 B;  1FMK A;  2L3P A;  2CT3 A;  1UHF A;  1PRM C;  4J9F A;  2PTK A;  2O2O A;  1BB9 A;  2F2X A;  2L3Q A;  3EHR A;  4AFS C;  2CRE A;  4OMO A;  5I11 A;  2H8H A;  2KT8 A;  2A37 A;  1U3O A;  3VS6 A;  2JS0 A;  2A08 A;  2XMF A;  4LUE A;  2EGA A;  1YWO A;  1MUZ A;  2KYM A;  2EGE A;  2ROT A;  2O88 A;  2E5K A;  2DBM A;  1ZSG A;  2EQI A;  5L23 A;  3SHW A;  2KXD A;  3SEM A;  2ROL A;  2EYX A;  1AOJ A;  2CSQ A;  2NWM A;  4OMP A;  1ZLM A;  2CUB A;  2OAW A;  1PWT A;  4GLM A;  1M27 C;  3RNJ A;  1LCK A;  2EVR A;  2G6F X;  4HCK A;  4Y92 A;  5FWC A;  1VYT A;  2AKL A;  3EG0 A;  2DL3 A;  2DL5 A;  2KYB A;  1A0N B;  2DX1 A;  2RPN A;  4J9G A;  4LNP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...