3O5ZA

Crystal structure of the sh3 domain from p85beta subunit of phosphoinositide 3-kinase (pi3k)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
GPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPVALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the SH3 domain of the phosphoinositide 3-kinase p85 beta subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit beta
total genus 21
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3o5zA00
3VS6A 2CREA 3UF4A 5GJWB 1RLQC 1UECA 2DLPA 1M3CA 1NM7A 1WA7A 1V1CA 4LN2A 1GFDA 1E7OA 1QWEA 1ZSGA 3EHRA 3LH5A 1K0XA 1M30A 2DL8A 2LJ0A 2SEMA 2OAWA 1NEBA 2JXBA 2FG0A 2LZ6B 1ZLMA 1TUCA 2G6FX 5GJVB 2ENMA 2EYYA 2FPEA 3RBBB 2JMAA 2LP5A 3IQLA 1E6HA 4OMOA 1N5ZA 2FO0A 2AKKA 2FPDA 2LQNA 1UG1A 2RPNA 1FMKA 2KYMA 2X3XD 2EQIA 1CKAA 2A28A 1PNJA 3PVQA 1VYUA 2ECZA 2CUDA 1MV3A 2DX1A 2W10A 3VRYA 1B3QA 1T3SA 4RTTA 1BBZA 1NLOC 2CT3A 4LUDA 1BU1A 1H3HA 3VS4A 2OJ2A 2K9GA 1AZEA 2K3BA 2EYWA 1ZUKA 1UJ0A 4R0KA 3H0HA 1OOTA 4IIOA 4JJDA 2EYXA 3VS5A 1X27A 2RQUA 4JPBW 3NGPA 2RF0A 1CSKA 4F17A 5IHKA 2O9SA 4GLMA 3VS0A 2CT4A 3UATA 2L3QA 4ESRA 1SPKA 1YNZA 2VKNA 4RTZA 3EG0A 3THKA 2V1RA 1AD5A 4HVUA 4LE9A 1OEBA 4HVWA 4RTWA 2CSIA 3H41A 2GNCA 2JS2A 2AZSA 1QKXA 3QWYA 2M0YA 2KBTA 1GCPA 2O9VA 1Y0MA 1A0NB 1I0CA 2B86A 1JEGA 2JTEA 5FWCA 2KRNA 1ZUYA 3PE0A 3VS1A 4OMQA 2J6OA 2K6DA 1G83A 4OMMA 1UTIA 2F2VA 1GFCA 1U5SA 1JO8A 5ECAA 2J06A 2AK5A 2RQWA 4OMNA 4AFSC 2EBPA 1QKWA 4J9IA 2KROA 1UDLA 2SRCA 1ZX6A 1OV3A 2DM1A 2AZVA 4RTXA 4D8DA 2DNUA 2FPFA 2BZXA 2MCNA 3SEMA 1AWXA 1M8MA 1PKSA 2K7AA 2VVKA 4Z88A 1SHFA 2J05A 3R6NA 3M0TA 2W0ZA 2ESWA 3KFVA 4QT7A 2LX7A 2KE9A 1AWOA 2EVRA 3VRZA 2YT6A 2YUQA 2HCKA 1EFNA 2HEQA 2C0IA 2GBQA 1H92A 4RTYA 3EG2A 4M4ZA 1SHGA 4OMLA 4WCIA 3SHWA 3M0SA 4EIKA 2NUZA 2DMOA 1X6GA 4JZ4A 3O5ZA 5IHIA 3VS2A 1AVZC 2A08A 3QWXX 2EPDA 1U06A 4CC7A 1IO6A 2L3PA 2V1QA 4K11A 3CQTA 1WIEA 3H0IA 2LCSA 1X69A 3I9QA 1B07A 5IH2A 1Z9QA 1QCFA 1JXMA 1ZUUA 2GTOA 1SRMA 1PKTA 2H8HA 1AWWA 2NWMA 2HDAA 2DJQA 2J7IA 2VWFA 4J9DA 4LUEA 4F14A 1GCQC 3UA7A 3TVTA 1YCSB 1W70A 1WLPB 1RUWA 2YUPA 2EYZA 3TSZA 1W6XA 1K76A 2D0NA 1BB9A 2CH4W 2KR3A 3VS7A 1WI7A 1T0HA 2RMOA 1AOJA 4J9HA 2PZ1A 2AKLA 2ED1A 3NPFA 2YSQA 4RUGA 2XMFA 3M0RA 1NYFA 2PNIA 1K9AA 4Z8AA 2RQRA 1HSQA 5L23A 1HJDA 2ED0A 2EKHA 1TUDA 2DF6A 2CUBA 1OPLA 2D8JA 2DVJA 3I5SA 2K79A 5EC7A 1GBQA 2ROTA 4OMPA 1K4US 1AEYA 1UUEA 1MUZA 5I11A 3REAB 2DL5A 3JV3A 2A36A 2CSQA 1SEMA 3I5RA 4AG2C 1NG2A 2DRKA 2C0OA 1I1JA 1YWOA 1X43A 2DBMA 1ABOA 1GRIA 2BZYA 2L2PA 1JU5C 5FW9A 4RTUA 3PVLA 2ABLA 1VYVA 4DEYA 1WDXA 2KRMA 1I07A 4ORZA 4A63B 2O31A 2KT8A 1UE9A 3U23A 3REBB 1E6GA 2JM9A 2QDLA 4J9BA 1UFFA 5IHNA 2JW4A 1T0JA 4Y92A 1UJYA 2GGRA 3NHNA 2KT1A 2MOXA 2LNHB 2EGCA 4GBQA 4CC3A 2YUOA 1CKBA 2M51A 2FEIA 4RTVA 4AG1C 2D1XA 2FRYA 2YUNA 1J3TA 1S1NA 2D8HA 4HXJA 4DEXA 1GBRA 1WX6A 2F2XA 1UHCA 4F16A 4CC4B 3EG1A 2GTJA 1RI9A 1PRLC 1LCKA 4FSSA 3TSWA 1K1ZA 2EGAA 1VYTA 2DL3A 1PHTA 1WXBA 1WFWA 3NMZC 1WXUA 3A98A 2CH4A 1QWFA 4JJBA 2EGEA 2LJ1A 1M3AA 1Y57A 2X3WD 2BTTA 4ZNXA 1GL5A 4J9FA 2RQVA 1HD3A 1SSHA 4AFQC 2O2OA 2RQTA 1K0SA 3GBQA 1RLPC 2CDTA 2DL7A 1H8KA 2KYBA 1GCQA 3I35A 1KSWA 2JM8A 2E5KA 2KGTA 4JZ3A 2RN8A 3M0PA 4KRTA 1PRMC 3EHQA 3EG3A 1M3BA 2JT4A 4JJCA 4HVVA 3VS3A 1SRLA 2LQWA 1VA7A 4D8KA 2C0TA 5FWBA 4AFZC 4CC2A 5HCKA 1ABQA 2I0NA 2DBKA 2FRWA 2O88A 2KNBB 4IIMA 4X1VA 1T3LA 1KFZA 1TG0A 2DILA 2KEAA 2EW3A 2IIMA 1NYGA 2YDLA 3FJ5A 1AWJA 5I22A 1X2KA 3M0QA 3ZL7C 3H0FA 1QLYA 2J6KA 3ULRB 1PWTA 4Z89A 1JXOA 2L0AA 1YP5A 2HSPA 1X2QA 1OPKA 1MV0B 1M27C 1NLPC 2DE0X 2JMCA 4AFUC 1KIKA 3RNJA 1ZBJA 2P4RA 1YN8A 1ARKA 2KRSA 4LNPA 1XOVA 4E6RA 2DYBA 1WYXA 2F2WA 2BZ8A 3EGUA 1KJWA 3UA6A 1NEGA 1BK2A 2JS0A 2KXDA 2RNAA 3M0UA 2PTKA 1WXTA 1FYNA 3C0CA 1G2BA 2LMJA 2J6FA 2DA9A 1X6BA 1AZGB 2DL4A 1Z9ZA 2LJ3A 2L3SA 1JQQA 4J9CA 4J9GA 2ROLA 1U3OA 2DRMA 1W1FA 2OI3A 5IXBA 4J9EA 5IXFA 2A37A 2K2MA 2GQIA 1UGVA 2KXCA 2MIOA 2HBWA 1UHFA 1YWPA 4HCKA
chains in the Genus database with same CATH superfamily
2ATCB 3UF4A 1UECA 4LN2A 1E7OA 1QVPA 1UEBA 3OB9A 2K5LA 3C94A 3X28B 4E7KA 1ZSGA 3RKYA 3V7RA 3EHRA 3LH5A 1M30A 2OAWA 1I4K1 2G6FX 2ZAEA 1VQOT 2ENMA 1MMDA 3RBBB 4M7AC 3OW2S 2DKGA 3A5ZB 2LP5A 3E19A 1N5ZA 1M5Q1 1VQ8T 1K9MC 2AKKA 3LYIA 4TVRA 2DETA 2YXYA 2LQNA 2KYMA 2BUDA 2VGMA 3PVQA 3OY9A 5CQYA 1BI2A 4C0GA 4L6V5 2DX1A 3QO3A 4LD9K 1IREB 2FZGB 2CT3A 3EG9A 3C12A 2RK1A 3VS4A 3RUXA 1QVGS 1AZEA 1HYOA 1UGRB 2EYWA 3JCMe 4E7JA 3QJ6A 3QSUA 4A4FA 2DIGA 9ATCB 2LC4A 2EYXA 4PFZA 4KH0B 1UB4A 1X27A 2K5FA 2RF0A 4F17A 1MMNA 1WJRA 2YLCA 5DY9A 2RB6A 3L2UA 3OYDA 1VQKT 1YNZA 4RTZA 2VXEA 1BI3A 2DEQA 3RIRA 1ZBXA 4XK8E 2XU8A 1OZ2A 4HVWA 3LWHA 2CSIA 3G6EA 2ZPGB 3OYFA 1WHHA 3QZ9B 3TREA 3V8JA 3QWYA 5GAN2 1MGQA 1GCPA 3T9NA 4IUPA 1I0CA 1VQOQ 2KRNA 5GANg 3CCRQ 2J6OA 2YWWA 2K6DA 1JJ2P 1G83A 5GMKi 1XTDA 4OMMA 5LL6S 2F2VA 4PJMA 2DTIA 5A0GA 4O5VA 3CPWP 1VQ9Q 1ZA2B 4MMLA 4HCZA 4AFSC 3L2RA 4C92B 1ZX6A 1VQ5Q 2AZVA 3CCJA 3CCUA 1Y96B 1K73R 1AWXA 1M8MA 2D0QB 5A0LA 4FYYB 1QVGA 3S3MA 4M7DA 1NBEB 4JLIA 3MKDA 2YRCA 4PFPA 1H3ZA 4ZN3A 2RHXA 4II1A 3KBGA 4RTYA 3EAEA 1I5OB 2HAXA 4M7DF 4EIKA 2DZ9A 2NUZA 5LJ5h 4XQ3A 4HCBA 1VQNQ 3LWIA 2YRVA 2EPDA 3EGXB 1IO6A 2V1QA 4RCCA 1KC8C 2FB7A 4C0FA 4XAXB 1OYXA 2LCSA 3CPWA 1B07A 4QVDA 1ZUUA 2GTOA 3GP8A 2WSCE 4M78E 1U8RA 3A1PA 2K2VA 4PKCC 4XTYA 4J9DA 4LUEA 3V8LA 3MHXA 4F14A 2C06A 4L5GA 1OI1A 2KVQG 1WLPB 1BIAA 2YUPA 5FU7C 2JOYA 1BB9A 2CH4W 4BDZA 2KR3A 1MMAA 4MZPA 2RMOA 5KYYA 2IG0A 1AOJA 1EX4A 2PZ1A 1K8AR 4M75A 3GIBA 1NYFA 3J81E 1YFNA 2DD5A 1WQWA 1HJDA 3HFNA 1OPLA 2XHCA 2DVJA 1GBQA 2ZCFB 1VQ4A 2QQAA 3L1AA 3LW5E 1ACMB 1FMWA 2A36A 1VQ5T 2E6NA 1IZ6A 4M75C 3JCMQ 1IHVA 1NG2A 1VQLT 5CKEA 2DRKA 4X34A 3CEYA 3JB9D 2E41A 4QKUA 1KHCA 4RTUA 1NE8A 4Y91A 2KAFA 2BKDN 3CCVQ 4J8OA 1WDXA 3VUZA 1I07A 4B9XA 1VIFA 2O31A 1VQ6A 3CBMA 4FW2A 1TWBA 5CO7A 3REBB 2H3JA 5KYNA 5IHNA 4Y92A 1QP3A 2GGRA 2DERA 3OYGA 4C5IA 3KXTA 3CCMQ 2LNHB 4CC3A 3A8GB 4A4HA 3JCMc 1BKBA 1PM3A 5GAN4 1J3TA 4JRIA 4N4GA 2D8HA 5GAMg 1VQ7A 2F2XA 1UHCA 1YI2A 1KQ1A 3LX7A 3KUFA 3HKSA 1WHJA 2NLUA 4BD3A 4C8QE 3CC7A 3VYHB 2FVUA 1QWFA 3HRUA 3LLRA 4QW2A 1GL5A 2LTOA 2WSEE 4PFOA 1PC0A 4ELZC 5CK9A 2LDMA 1IGQA 1VQLQ 4RG8A 1VQ6T 1IGUA 3G71Q 2O2OA 5IT9E 3CCJQ 3CCUQ 1WHKA 1RABB 4PJOF 4F7UG 2KGTA 3JCMP 3M0PA 1YJNQ 4M75G 2JT4A 1Y07A 4JJCA 1RAAB 4HVVA 3VS3A 4M7AG 4OB0B 3WXMB 2LQWA 5KE3A 3J7AF 2QYZA 1ZA1B 4CC2A 1ABQA 2I0NA 1TUGB 2DBKA 2O88A 3TCJA 4X9DA 4OB1B 3VU3C 1N6AA 4C8QG 4FSXA 1KFZA 4XU3A 3JAME 1N8RC 2KEAA 5KE2A 3CCVT 1PCXA 4M77B 1NYGA 2YDLA 3FJ5A 1AWJA 3CMAT 2QEXA 5I22A 4JUVA 1VQ6Q 1OQKA 4PLIA 2F1LA 1K8AC 4PJOC 1KK7A 2XKOC 4LDYA 2P4TA 4PJOD 1JXOA 3FEOA 4O6JA 3MEAA 1YP5A 4KT0E 2XG8D 3RMSA 2CP5A 2DJZA 1M27C 4LDVA 2JMCA 5GMKm 4QVZA 3M53A 1ZBJA 2P4RA 5GMKe 4E6RA 1W2BA 2RH2A 5D6WA 2OTJA 4Z02A 1KJWA 3FRNA 5D6XA 1BK2A 3GOXA 4HT9A 2JS0A 2RNAA 1YHQQ 1BYMA 4PJOE 4Q5WA 2PTKA 5FU7B 3ER0A 3CCQT 1VIEA 2J6FA 1U1SA 1PG5B 2DL4A 5LJ3g 1Q7YU 2F5KA 3FC3A 2LJ3A 1Q82C 4M78G 5CVIA 2XK0A 3UT1A 1U3OA 2X4JA 5IXFA 4J9EA 1VQPT 2PU9B 2R5MA 1BCMA 5M9OA 2CKKA 4QQGA 1UHFA 3BE3A 3OBYA 3VS6A 1PSFA 1M3CA 1VQ8Q 2MYSA 3MEWA 1O9SA 1R0CB 4E2FB 5GAOp 2EYYA 2FPEA 4DOWA 2JMAA 4ATOA 1M9SA 2E3IA 4E7SA 1S72Q 2FO0A 1MHNA 2FL7A 2PUKB 2RPNA 3H6ZA 2ZPFB 5CCAA 1D0ZA 2X3XD 2E6ZA 2IVWA 3JCMd 4M78B 2A28A 1PNJA 5D6YA 1VYUA 2ECZA 2CUDA 5GAN8 1MV3A 4KGVB 3OYLA 5J3BA 1M90R 1W2BP 4BACA 1RAGB 4IUQA 1B3QA 1K9MU 1T3SA 4RTTA 3NFCA 1NLOC 4LUDA 3FDRA 2M0OA 3RESA 5LJ5f 3C4SA 3H0HA 2RHIA 4IIOA 4C92C 1VQNA 4M75B 3VS5A 4KH1B 1FXXA 5GAMd 3OYIA 5GANj 2Y4XA 2EKOA 2RHUA 2XDDA 2PVDB 3E1SA 1SPKA 1W2BS 4J6WA 2QTXA 2R5AA 1OEBA 1C0MA 2GNCA 3M59A 1RAIB 2JS2A 2OTLA 2AZSA 5KCHA 1QKXA 3TQ7P 2HZYA 2KBTA 1Y0MA 2DIQA 3CCRA 3R6OA 2JTEA 4UC4A 5FWCA 4GY5A 4RMOA 4RKUE 2MWOA 1D1BA 2EQJA 1SKUB 1GFCA 3EGXA 3CXCP 3CCEQ 4JRKA 1R0BG 2NYSA 3P8DA 1Y7XA 1DJ7B 5IN1A 1OV3A 2DM1A 2E1HA 1N8RU 2E65A 2CP6A 3EGDA 1D09B 4D8DA 2DNUA 4ZGJB 1VQ8A 3M5AA 2BZXA 2VXFA 2OTLT 1BCOA 1YJ9Q 1G3WA 2CZ6B 2Y90A 3M0TA 5CAIA 2ESWA 4J5YA 2LX7A 3BW1A 3OYAA 3JCMh 1AWOA 2EVRA 3VRZA 2YT6A 4BI8B 3PGGA 2E64A 3V8KA 3EG2A 4FU6A 4OMLA 3CD6Q 2K3YA 3SHWA 2MI6A 4PNOA 1KHIA 1X6GA 3O5ZA 1JB0E 5GANd 1YJ9A 2L5QA 1FWZA 1AVZC 3QWXX 1I8FA 3OYBA 4J7FA 2CYZB 2LVMA 1TOVA 3QYGB 1EZZB 2P0PA 2EJFA 4BB7A 1V29B 3I9QA 1QCFA 3JB9H 4ME7A 2CZ1B 2H8HA 1PKTA 2ZPBB 2DJQA 2G3RA 3JB9I 1Q95G 2J7IA 4RCBA 1TS9A 2EIFA 5KCOA 3TVTA 1YCSB 1NJIU 1YJNT 1RUWA 2EYZA 1K76A 2QEXQ 4KGZB 5A0DA 1M90C 3L2VA 1WI7A 3GNFB 1YJ9T 4J6XA 1OU9A 2KY9A 2L3RA 3NPFA 4M77E 2YSQA 2DD4A 2XMFA 1WJQA 1AT1B 2PNIA 3HTRA 5L23A 4ZN1A 2EFIA 3CPWS 2LNVA 2D8JA 4ZGDB 2CZ0B 3OYEA 5EC7A 1GXIE 2MF2A 3I56Q 2L89A 1KQSP 1UUEA 3G7ZA 1MUZA 1R8OB 4C92G 5I11A 3OMCA 3HFOA 2XDBA 2EJ9A 3SD4A 1PD0A 3REAB 2DL5A 3JV3A 3F70A 3CCMA 2I2LA 2VUBA 2PVGB 4FT2A 4C5EA 2DXBA 3MEVA 2AT1B 1UGPB 1ABOA 4PJOG 3VYGA 2HL5C 1VQ7Q 1VYVA 1YHQT 3VJPA 4ANJA 2LQKA 1X01A 3HSBA 2KT8A 2ZGWA 3BDUA 3HRSA 2DYIA 3HP9A 4DBFA 2JM9A 4Y28E 4J9BA 1UFFA 3RR6A 3C95A 1T0JA 3QIIA 3CCRT 4FYXB 4GBQA 1QVGP 2YUOA 4A4EA 1CKBA 3MP6A 2M51A 2HQHA 2WSFE 4JS5A 4AG1C 3PMTA 4JRPA 2F5TX 2K3XA 2JVVA 4N0AC 1I5LA 1ZQ1A 4C0DC 3EG1A 4FCYA 2K57A 2LX9A 1KC8U 2VASA 1NZ9A 4M7DB 4FSSA 2EGAA 4F04B 4E7ZA 1WXBA 3RKWA 4C0ZA 4LDXA 2QDYB 1QMCA 4DOVA 3A98A 1QW1A 1OULA 1Y57A 4ZNXA 4MMKA 4J9FA 3OS5A 2FHDA 5GANh 3JRZA 4AFQC 4M7AD 5I21A 3CCST 4BY6C 1K0SA 1BIBA 1RLPC 2CDTA 2XICA 5KYUB 3X26B 2JM8A 2E5KA 1VQ7T 4J6YA 4JZ3A 2RN8A 3CC2A 4E47A 1M2OA 4NS5A 2JN0A 1YCYA 2DK3A 2A7YA 1RL2A 3OS0A 3QZ5B 1QCOA 2VC8A 5GAOq 2X4YA 3SWNC 3SWNA 2KNBB 2FZKB 2CP2A 1ZSZB 2CS7A 2DILA 3OYNA 3OMGA 2QGGA 1C1AA 2RJEA 1M4ZA 4M78F 2LQ8A 3CCSA 1QLYA 4X9CA 1PWTA 4OVAA 3GF5A 2L0AA 3A8LB 1OX8A 1EIFA 2HSPA 1NLPC 2DXTA 1BI1A 1VQPA 4YTLA 3SDZA 4L59A 4C92D 3ZFJA 3GNGA 5I2MA 2VYTA 1JRIA 3G6ET 2BZ8A 2B8AA 1NEGA 2KQWA 3OYYA 4QQDA 1VQ4T 4N0AA 3A8HB 1FYNA 2E12A 3ME9A 3OQ5A 1SF9A 2VB6A 2LMJA 3QHSA 2MMPA 4BI3A 1AZGB 5GANe 4MDWA 5KYUA 3RMQA 1YJWA 4OMFB 2L3SA 1JQQA 1YIJT 1M1FA 5GMKl 2DRMA 1YJWQ 2OI3A 1JJ2S 3CC7Q 2A37A 2GQIA 3OYMA 4B6MA 4M7DD 2D6FA 2OTJT 3JCMg 5C6SA 5GAOm 5GJWB 1RLQC 2DLPA 2LT4A 1NM7A 1WA7A 1V1CA 2Z0WA 1GFDA 2EQUA 3CMAA 3M4GA 4HA8A 5FLXE 2CP0A 2DAQA 2QGFB 4FYVB 2SEMA 4KBMB 1NEBA 2JXBA 3M55A 1Q82R 2FG0A 5GAMe 1TUCA 4F7UB 1VQ9A 3EGDB 5HK3A 1KQSS 4MDXA 3IQLA 3GLXA 1E6HA 2MK5A 1HK9A 1FMKA 3JCMV 1M1KC 2DTOA 1N9SA 5GAMh 2JUFA 3E2UA 3HL8A 2COYA 4M77G 3VRYA 4PJOB 2GF7A 1QVFP 3OSSC 2F69A 1H3HA 2OJ2A 2K9GA 3BDLA 2K3BA 2NUTA 3MP8A 1ZUKA 1UJ0A 4R0KA 3DB4A 2HMAA 3OW2A 1VQ4Q 4MZMA 4PJJA 1XQHA 2R58A 1K9MR 2RQUA 1Q82U 1VQ9T 1CSKA 3L2ZA 4FYWB 2XI9A 2XDPA 1Q7YC 5IHKA 4GLMA 3VS0A 1M90U 4XU1A 4XTXA 2OTJQ 1LNXA 3OS1A 2L3QA 1XNIA 4ESRA 3MO8A 3EG0A 4HCCA 2BE7D 4FM4B 1AD5A 4LE9A 5AYFA 1B7TA 4VUBA 3H41A 3CC7T 1Q81U 2QA4A 1K73U 4EMHA 2M0YA 3CCJT 2O9VA 3CCUT 1A0NB 5LJ5g 4XTZA 2CP3A 3OYHA 3PE0A 5L8RE 3VS1A 3VKIA 1UTIA 4N4HA 1YJWT 1U5SA 4EMKC 5LJ3j 1C6VX 4M78A 5ECAA 2J06A 2RQWA 4FL6A 2HD0A 4OMNA 3QXEB 2EBPA 3CC4A 1UDLA 4C0DB 1QVFA 6AT1B 2RD1A 1Q86R 1X75C 4WTOB 5CKDA 2FPFA 3JCMJ 4FT4A 4ZTJA 2MCNA 1LJOA 1PKSA 2VVKA 4Z88A 3FIFA 4M78D 1SHFA 4IUUA 2DXUA 3M54A 3R6NA 4HKEA 1YBYA 2EQMA 3EH1A 2V8JA 2W0ZA 3TU4K 4KGXB 3QDRB 4J83A 2MPXC 1M2VA 3G71A 4EPCA 4LDUA 1D0YA 2COZA 3ZEHA 1Q7YR 1NJIC 2YUQA 2HCKA 2HEQA 2C0IA 2GBQA 2GCXA 1H92A 3HHTB 4M4ZA 2D9TA 1D0XA 4P5NA 4ELYC 4EDUA 1VOMA 3M0SA 1YI2Q 3AHUA 5J39A 1LOJA 1RADB 2LCCA 4C8QF 2A08A 5LJ3f 1U06A 3EH2A 2FZCB 3UWNA 4CC7A 4DBRA 1KQ2A 2L3PA 4K11A 5GMKj 3OSVA 1KD1C 3CQTA 3CD6T 1WIEA 2AIRB 3H0IA 1X69A 5IH2A 5LJ5e 2DPPB 1OU8A 2VWFA 1VQMQ 1GCQC 2FYKA 3UA7A 1M1KR 1VQOA 4M75F 2PVOB 5DLQE 1W70A 2RJDA 3TSZA 1S72T 1W6XA 1TH7A 3E9GA 5DLOA 5LJ3d 3PFSA 3NTKA 2ED1A 3DB3A 3EFSA 1Q81R 4C8QB 1KD1R 3M0RA 3SB2A 1HSQA 2ED0A 4M77A 1HXDA 2EKHA 3UPUA 2DF6A 5CQXA 3SFMA 2CUBA 1YITA 3ASKA 3I5SA 1JJ2A 3QUIA 2ROTA 4OMPA 1UGSB 2K4YA 2O4XA 3CD6A 3EFOB 2KDSA 2QAZA 2EYQA 3JCMX 5CKHA 3MEUA 2RI2A 4IURA 3N5BB 3I5RA 4AG2C 4AT1B 2C0OA 1WPYA 1I1JA 1X43A 2QTVA 2RA2A 2DBMA 2MWPA 2BZYA 1JU5C 5FW9A 4LXCA 4IUTA 2ABLA 2KK4A 1YHQA 2X4XA 5GAOr 3CBOA 4ORZA 4A63B 2DEUA 3WVEB 1M8VA 4F7UE 3CPFA 3U23A 4A4GA 1G3SA 1E6GA 3M56A 2RHYA 3AT1B 2CZ7B 4FIBA 1D1CA 1UJYA 2X51A 1V76A 3FJPA 3TEEA 4BY6B 1YITT 2MOXA 2EGCA 1W4SA 2KI7A 2FEIA 2OAUA 4KULA 3CCLA 2D1XA 2FRYA 4RG2A 4OF1A 4E7IA 2YUNA 3QDFA 2RI5A 2IPOB 2K5IA 4DEXA 1GBRA 1WX6A 2X9HA 4F16A 4CC4B 1FX7A 4EMKB 2YLBA 5KYWA 1RI0A 3MJXA 3TSWA 1LCKA 1K1ZA 1KD1U 3LGFA 2CH4A 4JJBA 3OYKA 2EGEA 4M7DG 3D7SB 1M3AA 1QQJA 2PQWA 4PLLA 2X3WD 2BTTA 2DZCA 2P0KA 3CXCS 1WQ7A 2JZ2A 4CRIA 4FW1A 1HD3A 1SSHA 1D3BA 1YJNA 2KMTA 2NUPA 3S3NA 3GBQA 2DL7A 1H641 1GCQA 4JDSA 3CBPA 1RAHB 2E10A 2XD0A 4EMGA 1VQKQ 2M1HA 4KRTA 1K8AU 1PRMC 4LDWA 3EHQA 3L2WA 1SRLA 2QQRA 2C0TA 4D8KA 3M57A 1UGQB 2JJ9A 4X1VA 1ZHIA 3UDCA 4C5GA 1ZSZC 2DXCA 2O01E 3CCVA 1IXDA 2EAYA 4M77D 2IIMA 2HKNA 2V8KA 3CCQQ 5LJ3h 4JS4A 1X2KA 5CKFA 3ZL7C 2RJFA 3H0FA 2J6KA 2CGHA 3JSCA 4BE1A 3NTIA 1X2QA 1OPKA 1KQSA 1Q86U 4AFUC 1KIKA 4JRQA 4R56A 2KRSA 4LNPA 4IUVA 1XOVA 4MZTA 3GPLA 1D3BB 2DYBA 3M4YA 2F2WA 2P0QA 3G4ST 2DFUA 4M77F 1Q86C 4J7IA 2Y4YA 4PK4A 4KUDK 1WXTA 2ZPIB 5CIUA 1G2BA 3LH0A 4PJLA 3O8VA 4M7DC 2DA9A 2QA4T 2YHTA 2GFAA 4EMKA 5KYWB 4J9CA 1YI2T 4J9GA 2ROLA 4XTVA 3S3OA 2GFUA 2K2MA 4XU0A 4BDYA 1UGVA 2KXCA 4V2SA 1NPRA 2E3HA 2HBWA 1AHJB 1VUBA 3QBYA 1YWPA 5HKCA 4HCKA 2CREA 2EWNA 1QWEA 1FMVA 2ZZDA 2EJGA 3G71T 3CCEA 2A0FB 1K0XA 2DL8A 2LJ0A 2RI3A 5GAOn 4DA4A 5LJ3e 2LZ6B 1ZLMA 5GJVB 2DO3A 3EFRA 5I2SA 1VQNT 5A2QE 2QK0A 3CMAQ 3WVDB 4OMOA 3OA6A 3P8BB 3INZA 2FPDA 1R77A 1UG1A 2EQIA 1CKAA 2X35A 1VQLA 4GLKA 3OYCA 1N8RR 3CCLT 3EFOA 2QXFA 3PMIA 2W10A 5GAN5 5GANf 1BBZA 1BU1A 4E7LA 2JTFA 2DVEA 3LGLA 1OOTA 3I56A 4JJDA 5CKBA 5LJ5j 3PNWC 3QPHA 5FROA 4JPBW 3NGPA 4BE2A 2O9SA 4CI0C 2V8IA 2CT4A 3DLMA 3E9FA 3UATA 4DQ2A 3V7SA 2QG9B 5D7UA 2VKNA 1N9RA 3THKA 2V1RA 2M16A 4HVUA 4HT8A 1YIJA 1QVFS 2BE9B 4RTWA 3PIPA 1VQPQ 3CMEQ 4IKFA 4QVCA 1Q81C 5J26A 4OB3B 2B86A 4OB2B 1JEGA 2QQ9A 3J80E 3G6EQ 1ZUYA 1PD1A 2OX7A 4OMQA 5KYYB 1MNDA 4NOYA 2RM4A 1S72A 5KH6A 3OS2A 3RDVA 1JO8A 3JB9J 3BFMA 2AK5A 1IB8A 2NUPB 1QKWA 4J9IA 1MMGA 2KROA 1TU0B 3VUBA 2SRCA 3I55T 1F1BB 2RJCA 4RTXA 4A53A 5GMKh 3SEMA 1MNEA 2K7AA 2COWA 2J05A 3CMET 1YITQ 1M2VB 3DLLA 3KFVA 4QT7A 2KE9A 4JJNK 1G3YA 5GAMf 4M7DE 3OBWA 1EFNA 4ZGEB 3X20B 3L2QA 1SHGA 4C92F 2LCLA 2M9UA 3I56T 4PL6A 4WCIA 5LJ5d 1M1GA 8ATCB 2QEXT 3FB9A 3Q1JA 2DMOA 5GAMj 3CC2T 3G1JA 1KG1A 4JZ4A 5IHIA 3VS2A 3PT9A 1IRXA 1VQMT 3PIOA 4D6WA 1G8XA 3BY7A 3A8MB 1M1KU 2HQXA 4ZTFA 4QQ6A 2V26A 1WGSA 2KSSA 2LRQA 2AHJB 1Z9QA 2RK2A 1JXMA 4JLGA 4WF2A 1P92A 3CCET 1Y96A 4C92E 1SRMA 1AWWA 1VQKA 2NWMA 2HDAA 4BE0A 4C92A 1X6OA 4OGEA 1WHLA 1D1AA 3G4SQ 3JCMb 2P84A 2D0NA 3FLGA 3CCQA 2E70A 3VS7A 4C8QC 2OTLQ 1G5VA 1T0HA 4C8QD 3OW2P 2O4XB 4A4KA 4J9HA 3CC4T 3META 2AKLA 3QYHB 3URGA 4XTUA 4RUGA 4OGCA 2WACA 3JB9F 1RAFB 1K9AA 2E5QA 2PUOB 2RQRA 3H9NA 4Z8AA 1QP2A 1Y71A 4M75E 1TUDA 2NUTB 4KUIA 2K79A 2MAMA 4C8QA 1O75A 3H8ZA 1AEYA 1K4US 1N27A 3CXCA 4A54A 1RACB 2CSQA 1SEMA 5FU6C 2BIVA 1JBMA 1TTHB 2M02A 5C0MA 3S6WA 4E7HA 1YWOA 1SG5A 3QJYA 5EG2A 2RHZA 3CCSQ 2JTMA 1KC8R 1GRIA 4M77C 2L2PA 4NL2A 5GAN3 3CCMT 3G4SA 3EG9B 1WNLA 5HK0A 3PVLA 4F7UA 4DEYA 5FRMA 2KRMA 5CR2A 2CP7A 4BUGA 1NJIR 1UE9A 3JB9G 1LPLA 1SSFA 2QDLA 3RERA 4BI4A 2JW4A 5AT1B 5FU6B 2ZPEB 1I81A 3NHNA 4OP0A 4M7AE 2KT1A 3PTAA 1TXQA 3CCLQ 1VQ5A 4RTVA 3CC2Q 4NL3A 3CC4Q 1WHGA 1K73C 1S1NA 4HXJA 2DTHA 3MP1A 4DBHA 2ZPHB 3JCMW 4XTWA 2VGNA 2GTJA 3OYJA 2HNIA 2LT1A 1RI9A 1PRLC 2HBPA 1WJSA 1VYTA 1TSFA 1QCNA 2DL3A 1PHTA 1WFWA 2XIDA 3NMZC 1WXUA 3ZBDA 2X4WA 4AMCA 2A3LA 3NTHA 2LJ1A 5GAOl 3M58A 2RQVA 1PSEA 2QI2A 2EQKA 2RQTA 1H8KA 2KYBA 4M7AF 2H3EB 3I35A 1KSWA 3V7CA 7AT1B 2JNGA 1NPPA 3X25B 5DM7R 3EG3A 3JCMf 1M3BA 1RAEB 1VA7A 5KYXA 5FWBA 2GQVA 4AFZC 5HCKA 2HL3A 1WHMA 4M7AA 2FRWA 3RKXA 1B34A 1LVKA 4IIMA 1T3LA 2VV5A 4M75D 3HPWA 1TG0A 1IHWA 1ZSZA 2EW3A 4LD6A 3VV0A 2QQSA 3M9QA 3SWNB 2L8DA 4B9WA 3M0QA 4PJNA 4XU2A 3ULRB 4M78C 4Z89A 5GAN7 1VQMA 3DKMA 1YIJQ 1XJWB 3QG1A 1MV0B 2DE0X 2QASA 3RNJA 5IAYA 1YN8A 3HRTA 1ARKA 3P8HA 1WYXA 1B34B 2HSEB 2RO0A 4M7AB 4DBQA 3EGUA 4PJOA 3UA6A 1U1TA 2HQEA 3MCAB 5KYXB 2KXDA 4R55A 3L42A 3A8OB 2YRDA 3M0UA 3C0CA 3MPUB 2R57A 1OX9A 3CMEA 2HKQB 1X6BA 1Z9ZA 2E4HA 3I55Q 2QQBA 4F7UF 1BI0A 1G3TA 1WZOA 1W1FA 3I55A 4N4IA 5IXBA 5FRNA 5HY6A 5GAN6 3X24B 1OZ3A 2MIOA 8AT1B 4C5HA 3QKJA 2QA4Q
chains in the Genus database with same CATH topology
3VS6A 2CREA 3UF4A 5GJWB 1RLQC 1UECA 2DLPA 1M3CA 1NM7A 1WA7A 1V1CA 4LN2A 1GFDA 1E7OA 1QWEA 1ZSGA 3EHRA 3LH5A 1K0XA 1M30A 2DL8A 2LJ0A 2SEMA 2OAWA 1NEBA 2JXBA 2FG0A 2LZ6B 1ZLMA 1TUCA 2G6FX 5GJVB 2ENMA 2EYYA 2FPEA 3RBBB 2JMAA 2LP5A 3IQLA 1E6HA 4OMOA 1N5ZA 2FO0A 2AKKA 2FPDA 2LQNA 1UG1A 2RPNA 1FMKA 2KYMA 2X3XD 2EQIA 1CKAA 2A28A 1PNJA 3PVQA 1VYUA 2ECZA 2CUDA 1MV3A 2DX1A 2W10A 3VRYA 1B3QA 1T3SA 4RTTA 1BBZA 1NLOC 2CT3A 4LUDA 1BU1A 1H3HA 3VS4A 2OJ2A 2K9GA 1AZEA 2K3BA 2EYWA 1ZUKA 1UJ0A 4R0KA 3H0HA 1OOTA 4IIOA 4JJDA 2EYXA 3VS5A 1X27A 2RQUA 4JPBW 3NGPA 2RF0A 1CSKA 4F17A 5IHKA 2O9SA 4GLMA 3VS0A 2CT4A 3UATA 2L3QA 4ESRA 1SPKA 1YNZA 2VKNA 4RTZA 3EG0A 3THKA 2V1RA 1AD5A 4HVUA 4LE9A 1OEBA 4HVWA 4RTWA 2CSIA 3H41A 2GNCA 2JS2A 2AZSA 1QKXA 3QWYA 2M0YA 2KBTA 1GCPA 2O9VA 1Y0MA 1A0NB 1I0CA 2B86A 1JEGA 2JTEA 5FWCA 2KRNA 1ZUYA 3PE0A 3VS1A 4OMQA 2J6OA 2K6DA 1G83A 4OMMA 1UTIA 2F2VA 1GFCA 1U5SA 1JO8A 5ECAA 2J06A 2AK5A 2RQWA 4OMNA 4AFSC 2EBPA 1QKWA 4J9IA 2KROA 1UDLA 2SRCA 1ZX6A 1OV3A 2DM1A 2AZVA 4RTXA 4D8DA 2DNUA 2FPFA 2BZXA 2MCNA 3SEMA 1AWXA 1M8MA 1PKSA 2K7AA 2VVKA 4Z88A 1SHFA 2J05A 3R6NA 3M0TA 2W0ZA 2ESWA 3KFVA 4QT7A 2LX7A 2KE9A 1AWOA 2EVRA 3VRZA 2YT6A 2YUQA 2HCKA 1EFNA 2HEQA 2C0IA 2GBQA 1H92A 4RTYA 3EG2A 4M4ZA 1SHGA 4OMLA 4WCIA 3SHWA 3M0SA 4EIKA 2NUZA 2DMOA 1X6GA 4JZ4A 3O5ZA 5IHIA 3VS2A 1AVZC 2A08A 3QWXX 2EPDA 1U06A 4CC7A 1IO6A 2L3PA 2V1QA 4K11A 3CQTA 1WIEA 3H0IA 2LCSA 1X69A 3I9QA 1B07A 5IH2A 1Z9QA 1QCFA 1JXMA 1ZUUA 2GTOA 1SRMA 1PKTA 2H8HA 1AWWA 2NWMA 2HDAA 2DJQA 2J7IA 2VWFA 4J9DA 4LUEA 4F14A 1GCQC 3UA7A 3TVTA 1YCSB 1W70A 1WLPB 1RUWA 2YUPA 2EYZA 3TSZA 1W6XA 1K76A 2D0NA 1BB9A 2CH4W 2KR3A 3VS7A 1WI7A 1T0HA 2RMOA 1AOJA 4J9HA 2PZ1A 2AKLA 2ED1A 3NPFA 2YSQA 4RUGA 2XMFA 3M0RA 1NYFA 2PNIA 1K9AA 4Z8AA 2RQRA 1HSQA 5L23A 1HJDA 2ED0A 2EKHA 1TUDA 2DF6A 2CUBA 1OPLA 2D8JA 2DVJA 3I5SA 2K79A 5EC7A 1GBQA 2ROTA 4OMPA 1K4US 1AEYA 1UUEA 1MUZA 5I11A 3REAB 2DL5A 3JV3A 2A36A 2CSQA 1SEMA 3I5RA 4AG2C 1NG2A 2DRKA 2C0OA 1I1JA 1YWOA 1X43A 2DBMA 1ABOA 1GRIA 2BZYA 2L2PA 1JU5C 5FW9A 4RTUA 3PVLA 2ABLA 1VYVA 4DEYA 1WDXA 2KRMA 1I07A 4ORZA 4A63B 2O31A 2KT8A 1UE9A 3U23A 3REBB 1E6GA 2JM9A 2QDLA 4J9BA 1UFFA 5IHNA 2JW4A 1T0JA 4Y92A 1UJYA 2GGRA 3NHNA 2KT1A 2MOXA 2LNHB 2EGCA 4GBQA 4CC3A 2YUOA 1CKBA 2M51A 2FEIA 4RTVA 4AG1C 2D1XA 2FRYA 2YUNA 1J3TA 1S1NA 2D8HA 4HXJA 4DEXA 1GBRA 1WX6A 2F2XA 1UHCA 4F16A 4CC4B 3EG1A 2GTJA 1RI9A 1PRLC 1LCKA 4FSSA 3TSWA 1K1ZA 2EGAA 1VYTA 2DL3A 1PHTA 1WXBA 1WFWA 3NMZC 1WXUA 3A98A 2CH4A 1QWFA 4JJBA 2EGEA 2LJ1A 1M3AA 1Y57A 2X3WD 2BTTA 4ZNXA 1GL5A 4J9FA 2RQVA 1HD3A 1SSHA 4AFQC 2O2OA 2RQTA 1K0SA 3GBQA 1RLPC 2CDTA 2DL7A 1H8KA 2KYBA 1GCQA 3I35A 1KSWA 2JM8A 2E5KA 2KGTA 4JZ3A 2RN8A 3M0PA 4KRTA 1PRMC 3EHQA 3EG3A 1M3BA 2JT4A 4JJCA 4HVVA 3VS3A 1SRLA 2LQWA 1VA7A 4D8KA 2C0TA 5FWBA 4AFZC 4CC2A 5HCKA 1ABQA 2I0NA 2DBKA 2FRWA 2O88A 2KNBB 4IIMA 4X1VA 1T3LA 1KFZA 1TG0A 2DILA 2KEAA 2EW3A 2IIMA 1NYGA 2YDLA 3FJ5A 1AWJA 5I22A 1X2KA 3M0QA 3ZL7C 3H0FA 1QLYA 2J6KA 3ULRB 1PWTA 4Z89A 1JXOA 2L0AA 1YP5A 2HSPA 1X2QA 1OPKA 1MV0B 1M27C 1NLPC 2DE0X 2JMCA 4AFUC 1KIKA 3RNJA 1ZBJA 2P4RA 1YN8A 1ARKA 2KRSA 4LNPA 1XOVA 4E6RA 2DYBA 1WYXA 2F2WA 2BZ8A 3EGUA 1KJWA 3UA6A 1NEGA 1BK2A 2JS0A 2KXDA 2RNAA 3M0UA 2PTKA 1WXTA 1FYNA 3C0CA 1G2BA 2LMJA 2J6FA 2DA9A 1X6BA 1AZGB 2DL4A 1Z9ZA 2LJ3A 2L3SA 1JQQA 4J9CA 4J9GA 2ROLA 1U3OA 2DRMA 1W1FA 2OI3A 5IXBA 4J9EA 5IXFA 2A37A 2K2MA 2GQIA 1UGVA 2KXCA 2MIOA 2HBWA 1UHFA 1YWPA 4HCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VS6 A;  2CRE A;  3UF4 A;  5GJW B;  1RLQ C;  1UEC A;  2DLP A;  1M3C A;  1NM7 A;  1WA7 A;  1V1C A;  4LN2 A;  1GFD A;  1E7O A;  1QWE A;  1ZSG A;  3EHR A;  3LH5 A;  1K0X A;  1M30 A;  2DL8 A;  2LJ0 A;  2SEM A;  2OAW A;  1NEB A;  2JXB A;  2FG0 A;  2LZ6 B;  1ZLM A;  1TUC A;  2G6F X;  5GJV B;  2ENM A;  2EYY A;  2FPE A;  3RBB B;  2JMA A;  2LP5 A;  3IQL A;  1E6H A;  4OMO A;  1N5Z A;  2FO0 A;  2AKK A;  2FPD A;  2LQN A;  1UG1 A;  2RPN A;  1FMK A;  2KYM A;  2X3X D;  2EQI A;  1CKA A;  2A28 A;  1PNJ A;  3PVQ A;  1VYU A;  2ECZ A;  2CUD A;  1MV3 A;  2DX1 A;  2W10 A;  3VRY A;  1B3Q A;  1T3S A;  4RTT A;  1BBZ A;  1NLO C;  2CT3 A;  4LUD A;  1BU1 A;  1H3H A;  3VS4 A;  2OJ2 A;  2K9G A;  1AZE A;  2K3B A;  2EYW A;  1ZUK A;  1UJ0 A;  4R0K A;  3H0H A;  1OOT A;  4IIO A;  4JJD A;  2EYX A;  3VS5 A;  1X27 A;  2RQU A;  4JPB W;  3NGP A;  2RF0 A;  1CSK A;  4F17 A;  5IHK A;  2O9S A;  4GLM A;  3VS0 A;  2CT4 A;  3UAT A;  2L3Q A;  4ESR A;  1SPK A;  1YNZ A;  2VKN A;  4RTZ A;  3EG0 A;  3THK A;  2V1R A;  1AD5 A;  4HVU A;  4LE9 A;  1OEB A;  4HVW A;  4RTW A;  2CSI A;  3H41 A;  2GNC A;  2JS2 A;  2AZS A;  1QKX A;  3QWY A;  2M0Y A;  2KBT A;  1GCP A;  2O9V A;  1Y0M A;  1A0N B;  1I0C A;  2B86 A;  1JEG A;  2JTE A;  5FWC A;  2KRN A;  1ZUY A;  3PE0 A;  3VS1 A;  4OMQ A;  2J6O A;  2K6D A;  1G83 A;  4OMM A;  1UTI A;  2F2V A;  1GFC A;  1U5S A;  1JO8 A;  5ECA A;  2J06 A;  2AK5 A;  2RQW A;  4OMN A;  4AFS C;  2EBP A;  1QKW A;  4J9I A;  2KRO A;  1UDL A;  2SRC A;  1ZX6 A;  1OV3 A;  2DM1 A;  2AZV A;  4RTX A;  4D8D A;  2DNU A;  2FPF A;  2BZX A;  2MCN A;  3SEM A;  1AWX A;  1M8M A;  1PKS A;  2K7A A;  2VVK A;  4Z88 A;  1SHF A;  2J05 A;  3R6N A;  3M0T A;  2W0Z A;  2ESW A;  3KFV A;  4QT7 A;  2LX7 A;  2KE9 A;  1AWO A;  2EVR A;  3VRZ A;  2YT6 A;  2YUQ A;  2HCK A;  1EFN A;  2HEQ A;  2C0I A;  2GBQ A;  1H92 A;  4RTY A;  3EG2 A;  4M4Z A;  1SHG A;  4OML A;  4WCI A;  3SHW A;  3M0S A;  4EIK A;  2NUZ A;  2DMO A;  1X6G A;  4JZ4 A;  3O5Z A;  5IHI A;  3VS2 A;  1AVZ C;  2A08 A;  3QWX X;  2EPD A;  1U06 A;  4CC7 A;  1IO6 A;  2L3P A;  2V1Q A;  4K11 A;  3CQT A;  1WIE A;  3H0I A;  2LCS A;  1X69 A;  3I9Q A;  1B07 A;  5IH2 A;  1Z9Q A;  1QCF A;  1JXM A;  1ZUU A;  2GTO A;  1SRM A;  1PKT A;  2H8H A;  1AWW A;  2NWM A;  2HDA A;  2DJQ A;  2J7I A;  2VWF A;  4J9D A;  4LUE A;  4F14 A;  1GCQ C;  3UA7 A;  3TVT A;  1YCS B;  1W70 A;  1WLP B;  1RUW A;  2YUP A;  2EYZ A;  3TSZ A;  1W6X A;  1K76 A;  2D0N A;  1BB9 A;  2CH4 W;  2KR3 A;  3VS7 A;  1WI7 A;  1T0H A;  2RMO A;  1AOJ A;  4J9H A;  2PZ1 A;  2AKL A;  2ED1 A;  3NPF A;  2YSQ A;  4RUG A;  2XMF A;  3M0R A;  1NYF A;  2PNI A;  1K9A A;  4Z8A A;  2RQR A;  1HSQ A;  5L23 A;  1HJD A;  2ED0 A;  2EKH A;  1TUD A;  2DF6 A;  2CUB A;  1OPL A;  2D8J A;  2DVJ A;  3I5S A;  2K79 A;  5EC7 A;  1GBQ A;  2ROT A;  4OMP A;  1K4U S;  1AEY A;  1UUE A;  1MUZ A;  5I11 A;  3REA B;  2DL5 A;  3JV3 A;  2A36 A;  2CSQ A;  1SEM A;  3I5R A;  4AG2 C;  1NG2 A;  2DRK A;  2C0O A;  1I1J A;  1YWO A;  1X43 A;  2DBM A;  1ABO A;  1GRI A;  2BZY A;  2L2P A;  1JU5 C;  5FW9 A;  4RTU A;  3PVL A;  2ABL A;  1VYV A;  4DEY A;  1WDX A;  2KRM A;  1I07 A;  4ORZ A;  4A63 B;  2O31 A;  2KT8 A;  1UE9 A;  3U23 A;  3REB B;  1E6G A;  2JM9 A;  2QDL A;  4J9B A;  1UFF A;  5IHN A;  2JW4 A;  1T0J A;  4Y92 A;  1UJY A;  2GGR A;  3NHN A;  2KT1 A;  2MOX A;  2LNH B;  2EGC A;  4GBQ A;  4CC3 A;  2YUO A;  1CKB A;  2M51 A;  2FEI A;  4RTV A;  4AG1 C;  2D1X A;  2FRY A;  2YUN A;  1J3T A;  1S1N A;  2D8H A;  4HXJ A;  4DEX A;  1GBR A;  1WX6 A;  2F2X A;  1UHC A;  4F16 A;  4CC4 B;  3EG1 A;  2GTJ A;  1RI9 A;  1PRL C;  1LCK A;  4FSS A;  3TSW A;  1K1Z A;  2EGA A;  1VYT A;  2DL3 A;  1PHT A;  1WXB A;  1WFW A;  3NMZ C;  1WXU A;  3A98 A;  2CH4 A;  1QWF A;  4JJB A;  2EGE A;  2LJ1 A;  1M3A A;  1Y57 A;  2X3W D;  2BTT A;  4ZNX A;  1GL5 A;  4J9F A;  2RQV A;  1HD3 A;  1SSH A;  4AFQ C;  2O2O A;  2RQT A;  1K0S A;  3GBQ A;  1RLP C;  2CDT A;  2DL7 A;  1H8K A;  2KYB A;  1GCQ A;  3I35 A;  1KSW A;  2JM8 A;  2E5K A;  2KGT A;  4JZ3 A;  2RN8 A;  3M0P A;  4KRT A;  1PRM C;  3EHQ A;  3EG3 A;  1M3B A;  2JT4 A;  4JJC A;  4HVV A;  3VS3 A;  1SRL A;  2LQW A;  1VA7 A;  4D8K A;  2C0T A;  5FWB A;  4AFZ C;  4CC2 A;  5HCK A;  1ABQ A;  2I0N A;  2DBK A;  2FRW A;  2O88 A;  2KNB B;  4IIM A;  4X1V A;  1T3L A;  1KFZ A;  1TG0 A;  2DIL A;  2KEA A;  2EW3 A;  2IIM A;  1NYG A;  2YDL A;  3FJ5 A;  1AWJ A;  5I22 A;  1X2K A;  3M0Q A;  3ZL7 C;  3H0F A;  1QLY A;  2J6K A;  3ULR B;  1PWT A;  4Z89 A;  1JXO A;  2L0A A;  1YP5 A;  2HSP A;  1X2Q A;  1OPK A;  1MV0 B;  1M27 C;  1NLP C;  2DE0 X;  2JMC A;  4AFU C;  1KIK A;  3RNJ A;  1ZBJ A;  2P4R A;  1YN8 A;  1ARK A;  2KRS A;  4LNP A;  1XOV A;  4E6R A;  2DYB A;  1WYX A;  2F2W A;  2BZ8 A;  3EGU A;  1KJW A;  3UA6 A;  1NEG A;  1BK2 A;  2JS0 A;  2KXD A;  2RNA A;  3M0U A;  2PTK A;  1WXT A;  1FYN A;  3C0C A;  1G2B A;  2LMJ A;  2J6F A;  2DA9 A;  1X6B A;  1AZG B;  2DL4 A;  1Z9Z A;  2LJ3 A;  2L3S A;  1JQQ A;  4J9C A;  4J9G A;  2ROL A;  1U3O A;  2DRM A;  1W1F A;  2OI3 A;  5IXB A;  4J9E A;  5IXF A;  2A37 A;  2K2M A;  2GQI A;  1UGV A;  2KXC A;  2MIO A;  2HBW A;  1UHF A;  1YWP A;  4HCK A; 
#chains in the Genus database with same CATH topology
 2ATC B;  3UF4 A;  1UEC A;  4LN2 A;  1E7O A;  1QVP A;  1UEB A;  3OB9 A;  2K5L A;  3C94 A;  3X28 B;  4E7K A;  1ZSG A;  3RKY A;  3V7R A;  3EHR A;  3LH5 A;  1M30 A;  2OAW A;  1I4K 1;  2G6F X;  2ZAE A;  1VQO T;  2ENM A;  1MMD A;  3RBB B;  4M7A C;  3OW2 S;  2DKG A;  3A5Z B;  2LP5 A;  3E19 A;  1N5Z A;  1M5Q 1;  1VQ8 T;  1K9M C;  2AKK A;  3LYI A;  4TVR A;  2DET A;  2YXY A;  2LQN A;  2KYM A;  2BUD A;  2VGM A;  3PVQ A;  3OY9 A;  5CQY A;  1BI2 A;  4C0G A;  4L6V 5;  2DX1 A;  3QO3 A;  4LD9 K;  1IRE B;  2FZG B;  2CT3 A;  3EG9 A;  3C12 A;  2RK1 A;  3VS4 A;  3RUX A;  1QVG S;  1AZE A;  1HYO A;  1UGR B;  2EYW A;  3JCM e;  4E7J A;  3QJ6 A;  3QSU A;  4A4F A;  2DIG A;  9ATC B;  2LC4 A;  2EYX A;  4PFZ A;  4KH0 B;  1UB4 A;  1X27 A;  2K5F A;  2RF0 A;  4F17 A;  1MMN A;  1WJR A;  2YLC A;  5DY9 A;  2RB6 A;  3L2U A;  3OYD A;  1VQK T;  1YNZ A;  4RTZ A;  2VXE A;  1BI3 A;  2DEQ A;  3RIR A;  1ZBX A;  4XK8 E;  2XU8 A;  1OZ2 A;  4HVW A;  3LWH A;  2CSI A;  3G6E A;  2ZPG B;  3OYF A;  1WHH A;  3QZ9 B;  3TRE A;  3V8J A;  3QWY A;  5GAN 2;  1MGQ A;  1GCP A;  3T9N A;  4IUP A;  1I0C A;  1VQO Q;  2KRN A;  5GAN g;  3CCR Q;  2J6O A;  2YWW A;  2K6D A;  1JJ2 P;  1G83 A;  5GMK i;  1XTD A;  4OMM A;  5LL6 S;  2F2V A;  4PJM A;  2DTI A;  5A0G A;  4O5V A;  3CPW P;  1VQ9 Q;  1ZA2 B;  4MML A;  4HCZ A;  4AFS C;  3L2R A;  4C92 B;  1ZX6 A;  1VQ5 Q;  2AZV A;  3CCJ A;  3CCU A;  1Y96 B;  1K73 R;  1AWX A;  1M8M A;  2D0Q B;  5A0L A;  4FYY B;  1QVG A;  3S3M A;  4M7D A;  1NBE B;  4JLI A;  3MKD A;  2YRC A;  4PFP A;  1H3Z A;  4ZN3 A;  2RHX A;  4II1 A;  3KBG A;  4RTY A;  3EAE A;  1I5O B;  2HAX A;  4M7D F;  4EIK A;  2DZ9 A;  2NUZ A;  5LJ5 h;  4XQ3 A;  4HCB A;  1VQN Q;  3LWI A;  2YRV A;  2EPD A;  3EGX B;  1IO6 A;  2V1Q A;  4RCC A;  1KC8 C;  2FB7 A;  4C0F A;  4XAX B;  1OYX A;  2LCS A;  3CPW A;  1B07 A;  4QVD A;  1ZUU A;  2GTO A;  3GP8 A;  2WSC E;  4M78 E;  1U8R A;  3A1P A;  2K2V A;  4PKC C;  4XTY A;  4J9D A;  4LUE A;  3V8L A;  3MHX A;  4F14 A;  2C06 A;  4L5G A;  1OI1 A;  2KVQ G;  1WLP B;  1BIA A;  2YUP A;  5FU7 C;  2JOY A;  1BB9 A;  2CH4 W;  4BDZ A;  2KR3 A;  1MMA A;  4MZP A;  2RMO A;  5KYY A;  2IG0 A;  1AOJ A;  1EX4 A;  2PZ1 A;  1K8A R;  4M75 A;  3GIB A;  1NYF A;  3J81 E;  1YFN A;  2DD5 A;  1WQW A;  1HJD A;  3HFN A;  1OPL A;  2XHC A;  2DVJ A;  1GBQ A;  2ZCF B;  1VQ4 A;  2QQA A;  3L1A A;  3LW5 E;  1ACM B;  1FMW A;  2A36 A;  1VQ5 T;  2E6N A;  1IZ6 A;  4M75 C;  3JCM Q;  1IHV A;  1NG2 A;  1VQL T;  5CKE A;  2DRK A;  4X34 A;  3CEY A;  3JB9 D;  2E41 A;  4QKU A;  1KHC A;  4RTU A;  1NE8 A;  4Y91 A;  2KAF A;  2BKD N;  3CCV Q;  4J8O A;  1WDX A;  3VUZ A;  1I07 A;  4B9X A;  1VIF A;  2O31 A;  1VQ6 A;  3CBM A;  4FW2 A;  1TWB A;  5CO7 A;  3REB B;  2H3J A;  5KYN A;  5IHN A;  4Y92 A;  1QP3 A;  2GGR A;  2DER A;  3OYG A;  4C5I A;  3KXT A;  3CCM Q;  2LNH B;  4CC3 A;  3A8G B;  4A4H A;  3JCM c;  1BKB A;  1PM3 A;  5GAN 4;  1J3T A;  4JRI A;  4N4G A;  2D8H A;  5GAM g;  1VQ7 A;  2F2X A;  1UHC A;  1YI2 A;  1KQ1 A;  3LX7 A;  3KUF A;  3HKS A;  1WHJ A;  2NLU A;  4BD3 A;  4C8Q E;  3CC7 A;  3VYH B;  2FVU A;  1QWF A;  3HRU A;  3LLR A;  4QW2 A;  1GL5 A;  2LTO A;  2WSE E;  4PFO A;  1PC0 A;  4ELZ C;  5CK9 A;  2LDM A;  1IGQ A;  1VQL Q;  4RG8 A;  1VQ6 T;  1IGU A;  3G71 Q;  2O2O A;  5IT9 E;  3CCJ Q;  3CCU Q;  1WHK A;  1RAB B;  4PJO F;  4F7U G;  2KGT A;  3JCM P;  3M0P A;  1YJN Q;  4M75 G;  2JT4 A;  1Y07 A;  4JJC A;  1RAA B;  4HVV A;  3VS3 A;  4M7A G;  4OB0 B;  3WXM B;  2LQW A;  5KE3 A;  3J7A F;  2QYZ A;  1ZA1 B;  4CC2 A;  1ABQ A;  2I0N A;  1TUG B;  2DBK A;  2O88 A;  3TCJ A;  4X9D A;  4OB1 B;  3VU3 C;  1N6A A;  4C8Q G;  4FSX A;  1KFZ A;  4XU3 A;  3JAM E;  1N8R C;  2KEA A;  5KE2 A;  3CCV T;  1PCX A;  4M77 B;  1NYG A;  2YDL A;  3FJ5 A;  1AWJ A;  3CMA T;  2QEX A;  5I22 A;  4JUV A;  1VQ6 Q;  1OQK A;  4PLI A;  2F1L A;  1K8A C;  4PJO C;  1KK7 A;  2XKO C;  4LDY A;  2P4T A;  4PJO D;  1JXO A;  3FEO A;  4O6J A;  3MEA A;  1YP5 A;  4KT0 E;  2XG8 D;  3RMS A;  2CP5 A;  2DJZ A;  1M27 C;  4LDV A;  2JMC A;  5GMK m;  4QVZ A;  3M53 A;  1ZBJ A;  2P4R A;  5GMK e;  4E6R A;  1W2B A;  2RH2 A;  5D6W A;  2OTJ A;  4Z02 A;  1KJW A;  3FRN A;  5D6X A;  1BK2 A;  3GOX A;  4HT9 A;  2JS0 A;  2RNA A;  1YHQ Q;  1BYM A;  4PJO E;  4Q5W A;  2PTK A;  5FU7 B;  3ER0 A;  3CCQ T;  1VIE A;  2J6F A;  1U1S A;  1PG5 B;  2DL4 A;  5LJ3 g;  1Q7Y U;  2F5K A;  3FC3 A;  2LJ3 A;  1Q82 C;  4M78 G;  5CVI A;  2XK0 A;  3UT1 A;  1U3O A;  2X4J A;  5IXF A;  4J9E A;  1VQP T;  2PU9 B;  2R5M A;  1BCM A;  5M9O A;  2CKK A;  4QQG A;  1UHF A;  3BE3 A;  3OBY A;  3VS6 A;  1PSF A;  1M3C A;  1VQ8 Q;  2MYS A;  3MEW A;  1O9S A;  1R0C B;  4E2F B;  5GAO p;  2EYY A;  2FPE A;  4DOW A;  2JMA A;  4ATO A;  1M9S A;  2E3I A;  4E7S A;  1S72 Q;  2FO0 A;  1MHN A;  2FL7 A;  2PUK B;  2RPN A;  3H6Z A;  2ZPF B;  5CCA A;  1D0Z A;  2X3X D;  2E6Z A;  2IVW A;  3JCM d;  4M78 B;  2A28 A;  1PNJ A;  5D6Y A;  1VYU A;  2ECZ A;  2CUD A;  5GAN 8;  1MV3 A;  4KGV B;  3OYL A;  5J3B A;  1M90 R;  1W2B P;  4BAC A;  1RAG B;  4IUQ A;  1B3Q A;  1K9M U;  1T3S A;  4RTT A;  3NFC A;  1NLO C;  4LUD A;  3FDR A;  2M0O A;  3RES A;  5LJ5 f;  3C4S A;  3H0H A;  2RHI A;  4IIO A;  4C92 C;  1VQN A;  4M75 B;  3VS5 A;  4KH1 B;  1FXX A;  5GAM d;  3OYI A;  5GAN j;  2Y4X A;  2EKO A;  2RHU A;  2XDD A;  2PVD B;  3E1S A;  1SPK A;  1W2B S;  4J6W A;  2QTX A;  2R5A A;  1OEB A;  1C0M A;  2GNC A;  3M59 A;  1RAI B;  2JS2 A;  2OTL A;  2AZS A;  5KCH A;  1QKX A;  3TQ7 P;  2HZY A;  2KBT A;  1Y0M A;  2DIQ A;  3CCR A;  3R6O A;  2JTE A;  4UC4 A;  5FWC A;  4GY5 A;  4RMO A;  4RKU E;  2MWO A;  1D1B A;  2EQJ A;  1SKU B;  1GFC A;  3EGX A;  3CXC P;  3CCE Q;  4JRK A;  1R0B G;  2NYS A;  3P8D A;  1Y7X A;  1DJ7 B;  5IN1 A;  1OV3 A;  2DM1 A;  2E1H A;  1N8R U;  2E65 A;  2CP6 A;  3EGD A;  1D09 B;  4D8D A;  2DNU A;  4ZGJ B;  1VQ8 A;  3M5A A;  2BZX A;  2VXF A;  2OTL T;  1BCO A;  1YJ9 Q;  1G3W A;  2CZ6 B;  2Y90 A;  3M0T A;  5CAI A;  2ESW A;  4J5Y A;  2LX7 A;  3BW1 A;  3OYA A;  3JCM h;  1AWO A;  2EVR A;  3VRZ A;  2YT6 A;  4BI8 B;  3PGG A;  2E64 A;  3V8K A;  3EG2 A;  4FU6 A;  4OML A;  3CD6 Q;  2K3Y A;  3SHW A;  2MI6 A;  4PNO A;  1KHI A;  1X6G A;  3O5Z A;  1JB0 E;  5GAN d;  1YJ9 A;  2L5Q A;  1FWZ A;  1AVZ C;  3QWX X;  1I8F A;  3OYB A;  4J7F A;  2CYZ B;  2LVM A;  1TOV A;  3QYG B;  1EZZ B;  2P0P A;  2EJF A;  4BB7 A;  1V29 B;  3I9Q A;  1QCF A;  3JB9 H;  4ME7 A;  2CZ1 B;  2H8H A;  1PKT A;  2ZPB B;  2DJQ A;  2G3R A;  3JB9 I;  1Q95 G;  2J7I A;  4RCB A;  1TS9 A;  2EIF A;  5KCO A;  3TVT A;  1YCS B;  1NJI U;  1YJN T;  1RUW A;  2EYZ A;  1K76 A;  2QEX Q;  4KGZ B;  5A0D A;  1M90 C;  3L2V A;  1WI7 A;  3GNF B;  1YJ9 T;  4J6X A;  1OU9 A;  2KY9 A;  2L3R A;  3NPF A;  4M77 E;  2YSQ A;  2DD4 A;  2XMF A;  1WJQ A;  1AT1 B;  2PNI A;  3HTR A;  5L23 A;  4ZN1 A;  2EFI A;  3CPW S;  2LNV A;  2D8J A;  4ZGD B;  2CZ0 B;  3OYE A;  5EC7 A;  1GXI E;  2MF2 A;  3I56 Q;  2L89 A;  1KQS P;  1UUE A;  3G7Z A;  1MUZ A;  1R8O B;  4C92 G;  5I11 A;  3OMC A;  3HFO A;  2XDB A;  2EJ9 A;  3SD4 A;  1PD0 A;  3REA B;  2DL5 A;  3JV3 A;  3F70 A;  3CCM A;  2I2L A;  2VUB A;  2PVG B;  4FT2 A;  4C5E A;  2DXB A;  3MEV A;  2AT1 B;  1UGP B;  1ABO A;  4PJO G;  3VYG A;  2HL5 C;  1VQ7 Q;  1VYV A;  1YHQ T;  3VJP A;  4ANJ A;  2LQK A;  1X01 A;  3HSB A;  2KT8 A;  2ZGW A;  3BDU A;  3HRS A;  2DYI A;  3HP9 A;  4DBF A;  2JM9 A;  4Y28 E;  4J9B A;  1UFF A;  3RR6 A;  3C95 A;  1T0J A;  3QII A;  3CCR T;  4FYX B;  4GBQ A;  1QVG P;  2YUO A;  4A4E A;  1CKB A;  3MP6 A;  2M51 A;  2HQH A;  2WSF E;  4JS5 A;  4AG1 C;  3PMT A;  4JRP A;  2F5T X;  2K3X A;  2JVV A;  4N0A C;  1I5L A;  1ZQ1 A;  4C0D C;  3EG1 A;  4FCY A;  2K57 A;  2LX9 A;  1KC8 U;  2VAS A;  1NZ9 A;  4M7D B;  4FSS A;  2EGA A;  4F04 B;  4E7Z A;  1WXB A;  3RKW A;  4C0Z A;  4LDX A;  2QDY B;  1QMC A;  4DOV A;  3A98 A;  1QW1 A;  1OUL A;  1Y57 A;  4ZNX A;  4MMK A;  4J9F A;  3OS5 A;  2FHD A;  5GAN h;  3JRZ A;  4AFQ C;  4M7A D;  5I21 A;  3CCS T;  4BY6 C;  1K0S A;  1BIB A;  1RLP C;  2CDT A;  2XIC A;  5KYU B;  3X26 B;  2JM8 A;  2E5K A;  1VQ7 T;  4J6Y A;  4JZ3 A;  2RN8 A;  3CC2 A;  4E47 A;  1M2O A;  4NS5 A;  2JN0 A;  1YCY A;  2DK3 A;  2A7Y A;  1RL2 A;  3OS0 A;  3QZ5 B;  1QCO A;  2VC8 A;  5GAO q;  2X4Y A;  3SWN C;  3SWN A;  2KNB B;  2FZK B;  2CP2 A;  1ZSZ B;  2CS7 A;  2DIL A;  3OYN A;  3OMG A;  2QGG A;  1C1A A;  2RJE A;  1M4Z A;  4M78 F;  2LQ8 A;  3CCS A;  1QLY A;  4X9C A;  1PWT A;  4OVA A;  3GF5 A;  2L0A A;  3A8L B;  1OX8 A;  1EIF A;  2HSP A;  1NLP C;  2DXT A;  1BI1 A;  1VQP A;  4YTL A;  3SDZ A;  4L59 A;  4C92 D;  3ZFJ A;  3GNG A;  5I2M A;  2VYT A;  1JRI A;  3G6E T;  2BZ8 A;  2B8A A;  1NEG A;  2KQW A;  3OYY A;  4QQD A;  1VQ4 T;  4N0A A;  3A8H B;  1FYN A;  2E12 A;  3ME9 A;  3OQ5 A;  1SF9 A;  2VB6 A;  2LMJ A;  3QHS A;  2MMP A;  4BI3 A;  1AZG B;  5GAN e;  4MDW A;  5KYU A;  3RMQ A;  1YJW A;  4OMF B;  2L3S A;  1JQQ A;  1YIJ T;  1M1F A;  5GMK l;  2DRM A;  1YJW Q;  2OI3 A;  1JJ2 S;  3CC7 Q;  2A37 A;  2GQI A;  3OYM A;  4B6M A;  4M7D D;  2D6F A;  2OTJ T;  3JCM g;  5C6S A;  5GAO m;  5GJW B;  1RLQ C;  2DLP A;  2LT4 A;  1NM7 A;  1WA7 A;  1V1C A;  2Z0W A;  1GFD A;  2EQU A;  3CMA A;  3M4G A;  4HA8 A;  5FLX E;  2CP0 A;  2DAQ A;  2QGF B;  4FYV B;  2SEM A;  4KBM B;  1NEB A;  2JXB A;  3M55 A;  1Q82 R;  2FG0 A;  5GAM e;  1TUC A;  4F7U B;  1VQ9 A;  3EGD B;  5HK3 A;  1KQS S;  4MDX A;  3IQL A;  3GLX A;  1E6H A;  2MK5 A;  1HK9 A;  1FMK A;  3JCM V;  1M1K C;  2DTO A;  1N9S A;  5GAM h;  2JUF A;  3E2U A;  3HL8 A;  2COY A;  4M77 G;  3VRY A;  4PJO B;  2GF7 A;  1QVF P;  3OSS C;  2F69 A;  1H3H A;  2OJ2 A;  2K9G A;  3BDL A;  2K3B A;  2NUT A;  3MP8 A;  1ZUK A;  1UJ0 A;  4R0K A;  3DB4 A;  2HMA A;  3OW2 A;  1VQ4 Q;  4MZM A;  4PJJ A;  1XQH A;  2R58 A;  1K9M R;  2RQU A;  1Q82 U;  1VQ9 T;  1CSK A;  3L2Z A;  4FYW B;  2XI9 A;  2XDP A;  1Q7Y C;  5IHK A;  4GLM A;  3VS0 A;  1M90 U;  4XU1 A;  4XTX A;  2OTJ Q;  1LNX A;  3OS1 A;  2L3Q A;  1XNI A;  4ESR A;  3MO8 A;  3EG0 A;  4HCC A;  2BE7 D;  4FM4 B;  1AD5 A;  4LE9 A;  5AYF A;  1B7T A;  4VUB A;  3H41 A;  3CC7 T;  1Q81 U;  2QA4 A;  1K73 U;  4EMH A;  2M0Y A;  3CCJ T;  2O9V A;  3CCU T;  1A0N B;  5LJ5 g;  4XTZ A;  2CP3 A;  3OYH A;  3PE0 A;  5L8R E;  3VS1 A;  3VKI A;  1UTI A;  4N4H A;  1YJW T;  1U5S A;  4EMK C;  5LJ3 j;  1C6V X;  4M78 A;  5ECA A;  2J06 A;  2RQW A;  4FL6 A;  2HD0 A;  4OMN A;  3QXE B;  2EBP A;  3CC4 A;  1UDL A;  4C0D B;  1QVF A;  6AT1 B;  2RD1 A;  1Q86 R;  1X75 C;  4WTO B;  5CKD A;  2FPF A;  3JCM J;  4FT4 A;  4ZTJ A;  2MCN A;  1LJO A;  1PKS A;  2VVK A;  4Z88 A;  3FIF A;  4M78 D;  1SHF A;  4IUU A;  2DXU A;  3M54 A;  3R6N A;  4HKE A;  1YBY A;  2EQM A;  3EH1 A;  2V8J A;  2W0Z A;  3TU4 K;  4KGX B;  3QDR B;  4J83 A;  2MPX C;  1M2V A;  3G71 A;  4EPC A;  4LDU A;  1D0Y A;  2COZ A;  3ZEH A;  1Q7Y R;  1NJI C;  2YUQ A;  2HCK A;  2HEQ A;  2C0I A;  2GBQ A;  2GCX A;  1H92 A;  3HHT B;  4M4Z A;  2D9T A;  1D0X A;  4P5N A;  4ELY C;  4EDU A;  1VOM A;  3M0S A;  1YI2 Q;  3AHU A;  5J39 A;  1LOJ A;  1RAD B;  2LCC A;  4C8Q F;  2A08 A;  5LJ3 f;  1U06 A;  3EH2 A;  2FZC B;  3UWN A;  4CC7 A;  4DBR A;  1KQ2 A;  2L3P A;  4K11 A;  5GMK j;  3OSV A;  1KD1 C;  3CQT A;  3CD6 T;  1WIE A;  2AIR B;  3H0I A;  1X69 A;  5IH2 A;  5LJ5 e;  2DPP B;  1OU8 A;  2VWF A;  1VQM Q;  1GCQ C;  2FYK A;  3UA7 A;  1M1K R;  1VQO A;  4M75 F;  2PVO B;  5DLQ E;  1W70 A;  2RJD A;  3TSZ A;  1S72 T;  1W6X A;  1TH7 A;  3E9G A;  5DLO A;  5LJ3 d;  3PFS A;  3NTK A;  2ED1 A;  3DB3 A;  3EFS A;  1Q81 R;  4C8Q B;  1KD1 R;  3M0R A;  3SB2 A;  1HSQ A;  2ED0 A;  4M77 A;  1HXD A;  2EKH A;  3UPU A;  2DF6 A;  5CQX A;  3SFM A;  2CUB A;  1YIT A;  3ASK A;  3I5S A;  1JJ2 A;  3QUI A;  2ROT A;  4OMP A;  1UGS B;  2K4Y A;  2O4X A;  3CD6 A;  3EFO B;  2KDS A;  2QAZ A;  2EYQ A;  3JCM X;  5CKH A;  3MEU A;  2RI2 A;  4IUR A;  3N5B B;  3I5R A;  4AG2 C;  4AT1 B;  2C0O A;  1WPY A;  1I1J A;  1X43 A;  2QTV A;  2RA2 A;  2DBM A;  2MWP A;  2BZY A;  1JU5 C;  5FW9 A;  4LXC A;  4IUT A;  2ABL A;  2KK4 A;  1YHQ A;  2X4X A;  5GAO r;  3CBO A;  4ORZ A;  4A63 B;  2DEU A;  3WVE B;  1M8V A;  4F7U E;  3CPF A;  3U23 A;  4A4G A;  1G3S A;  1E6G A;  3M56 A;  2RHY A;  3AT1 B;  2CZ7 B;  4FIB A;  1D1C A;  1UJY A;  2X51 A;  1V76 A;  3FJP A;  3TEE A;  4BY6 B;  1YIT T;  2MOX A;  2EGC A;  1W4S A;  2KI7 A;  2FEI A;  2OAU A;  4KUL A;  3CCL A;  2D1X A;  2FRY A;  4RG2 A;  4OF1 A;  4E7I A;  2YUN A;  3QDF A;  2RI5 A;  2IPO B;  2K5I A;  4DEX A;  1GBR A;  1WX6 A;  2X9H A;  4F16 A;  4CC4 B;  1FX7 A;  4EMK B;  2YLB A;  5KYW A;  1RI0 A;  3MJX A;  3TSW A;  1LCK A;  1K1Z A;  1KD1 U;  3LGF A;  2CH4 A;  4JJB A;  3OYK A;  2EGE A;  4M7D G;  3D7S B;  1M3A A;  1QQJ A;  2PQW A;  4PLL A;  2X3W D;  2BTT A;  2DZC A;  2P0K A;  3CXC S;  1WQ7 A;  2JZ2 A;  4CRI A;  4FW1 A;  1HD3 A;  1SSH A;  1D3B A;  1YJN A;  2KMT A;  2NUP A;  3S3N A;  3GBQ A;  2DL7 A;  1H64 1;  1GCQ A;  4JDS A;  3CBP A;  1RAH B;  2E10 A;  2XD0 A;  4EMG A;  1VQK Q;  2M1H A;  4KRT A;  1K8A U;  1PRM C;  4LDW A;  3EHQ A;  3L2W A;  1SRL A;  2QQR A;  2C0T A;  4D8K A;  3M57 A;  1UGQ B;  2JJ9 A;  4X1V A;  1ZHI A;  3UDC A;  4C5G A;  1ZSZ C;  2DXC A;  2O01 E;  3CCV A;  1IXD A;  2EAY A;  4M77 D;  2IIM A;  2HKN A;  2V8K A;  3CCQ Q;  5LJ3 h;  4JS4 A;  1X2K A;  5CKF A;  3ZL7 C;  2RJF A;  3H0F A;  2J6K A;  2CGH A;  3JSC A;  4BE1 A;  3NTI A;  1X2Q A;  1OPK A;  1KQS A;  1Q86 U;  4AFU C;  1KIK A;  4JRQ A;  4R56 A;  2KRS A;  4LNP A;  4IUV A;  1XOV A;  4MZT A;  3GPL A;  1D3B B;  2DYB A;  3M4Y A;  2F2W A;  2P0Q A;  3G4S T;  2DFU A;  4M77 F;  1Q86 C;  4J7I A;  2Y4Y A;  4PK4 A;  4KUD K;  1WXT A;  2ZPI B;  5CIU A;  1G2B A;  3LH0 A;  4PJL A;  3O8V A;  4M7D C;  2DA9 A;  2QA4 T;  2YHT A;  2GFA A;  4EMK A;  5KYW B;  4J9C A;  1YI2 T;  4J9G A;  2ROL A;  4XTV A;  3S3O A;  2GFU A;  2K2M A;  4XU0 A;  4BDY A;  1UGV A;  2KXC A;  4V2S A;  1NPR A;  2E3H A;  2HBW A;  1AHJ B;  1VUB A;  3QBY A;  1YWP A;  5HKC A;  4HCK A;  2CRE A;  2EWN A;  1QWE A;  1FMV A;  2ZZD A;  2EJG A;  3G71 T;  3CCE A;  2A0F B;  1K0X A;  2DL8 A;  2LJ0 A;  2RI3 A;  5GAO n;  4DA4 A;  5LJ3 e;  2LZ6 B;  1ZLM A;  5GJV B;  2DO3 A;  3EFR A;  5I2S A;  1VQN T;  5A2Q E;  2QK0 A;  3CMA Q;  3WVD B;  4OMO A;  3OA6 A;  3P8B B;  3INZ A;  2FPD A;  1R77 A;  1UG1 A;  2EQI A;  1CKA A;  2X35 A;  1VQL A;  4GLK A;  3OYC A;  1N8R R;  3CCL T;  3EFO A;  2QXF A;  3PMI A;  2W10 A;  5GAN 5;  5GAN f;  1BBZ A;  1BU1 A;  4E7L A;  2JTF A;  2DVE A;  3LGL A;  1OOT A;  3I56 A;  4JJD A;  5CKB A;  5LJ5 j;  3PNW C;  3QPH A;  5FRO A;  4JPB W;  3NGP A;  4BE2 A;  2O9S A;  4CI0 C;  2V8I A;  2CT4 A;  3DLM A;  3E9F A;  3UAT A;  4DQ2 A;  3V7S A;  2QG9 B;  5D7U A;  2VKN A;  1N9R A;  3THK A;  2V1R A;  2M16 A;  4HVU A;  4HT8 A;  1YIJ A;  1QVF S;  2BE9 B;  4RTW A;  3PIP A;  1VQP Q;  3CME Q;  4IKF A;  4QVC A;  1Q81 C;  5J26 A;  4OB3 B;  2B86 A;  4OB2 B;  1JEG A;  2QQ9 A;  3J80 E;  3G6E Q;  1ZUY A;  1PD1 A;  2OX7 A;  4OMQ A;  5KYY B;  1MND A;  4NOY A;  2RM4 A;  1S72 A;  5KH6 A;  3OS2 A;  3RDV A;  1JO8 A;  3JB9 J;  3BFM A;  2AK5 A;  1IB8 A;  2NUP B;  1QKW A;  4J9I A;  1MMG A;  2KRO A;  1TU0 B;  3VUB A;  2SRC A;  3I55 T;  1F1B B;  2RJC A;  4RTX A;  4A53 A;  5GMK h;  3SEM A;  1MNE A;  2K7A A;  2COW A;  2J05 A;  3CME T;  1YIT Q;  1M2V B;  3DLL A;  3KFV A;  4QT7 A;  2KE9 A;  4JJN K;  1G3Y A;  5GAM f;  4M7D E;  3OBW A;  1EFN A;  4ZGE B;  3X20 B;  3L2Q A;  1SHG A;  4C92 F;  2LCL A;  2M9U A;  3I56 T;  4PL6 A;  4WCI A;  5LJ5 d;  1M1G A;  8ATC B;  2QEX T;  3FB9 A;  3Q1J A;  2DMO A;  5GAM j;  3CC2 T;  3G1J A;  1KG1 A;  4JZ4 A;  5IHI A;  3VS2 A;  3PT9 A;  1IRX A;  1VQM T;  3PIO A;  4D6W A;  1G8X A;  3BY7 A;  3A8M B;  1M1K U;  2HQX A;  4ZTF A;  4QQ6 A;  2V26 A;  1WGS A;  2KSS A;  2LRQ A;  2AHJ B;  1Z9Q A;  2RK2 A;  1JXM A;  4JLG A;  4WF2 A;  1P92 A;  3CCE T;  1Y96 A;  4C92 E;  1SRM A;  1AWW A;  1VQK A;  2NWM A;  2HDA A;  4BE0 A;  4C92 A;  1X6O A;  4OGE A;  1WHL A;  1D1A A;  3G4S Q;  3JCM b;  2P84 A;  2D0N A;  3FLG A;  3CCQ A;  2E70 A;  3VS7 A;  4C8Q C;  2OTL Q;  1G5V A;  1T0H A;  4C8Q D;  3OW2 P;  2O4X B;  4A4K A;  4J9H A;  3CC4 T;  3MET A;  2AKL A;  3QYH B;  3URG A;  4XTU A;  4RUG A;  4OGC A;  2WAC A;  3JB9 F;  1RAF B;  1K9A A;  2E5Q A;  2PUO B;  2RQR A;  3H9N A;  4Z8A A;  1QP2 A;  1Y71 A;  4M75 E;  1TUD A;  2NUT B;  4KUI A;  2K79 A;  2MAM A;  4C8Q A;  1O75 A;  3H8Z A;  1AEY A;  1K4U S;  1N27 A;  3CXC A;  4A54 A;  1RAC B;  2CSQ A;  1SEM A;  5FU6 C;  2BIV A;  1JBM A;  1TTH B;  2M02 A;  5C0M A;  3S6W A;  4E7H A;  1YWO A;  1SG5 A;  3QJY A;  5EG2 A;  2RHZ A;  3CCS Q;  2JTM A;  1KC8 R;  1GRI A;  4M77 C;  2L2P A;  4NL2 A;  5GAN 3;  3CCM T;  3G4S A;  3EG9 B;  1WNL A;  5HK0 A;  3PVL A;  4F7U A;  4DEY A;  5FRM A;  2KRM A;  5CR2 A;  2CP7 A;  4BUG A;  1NJI R;  1UE9 A;  3JB9 G;  1LPL A;  1SSF A;  2QDL A;  3RER A;  4BI4 A;  2JW4 A;  5AT1 B;  5FU6 B;  2ZPE B;  1I81 A;  3NHN A;  4OP0 A;  4M7A E;  2KT1 A;  3PTA A;  1TXQ A;  3CCL Q;  1VQ5 A;  4RTV A;  3CC2 Q;  4NL3 A;  3CC4 Q;  1WHG A;  1K73 C;  1S1N A;  4HXJ A;  2DTH A;  3MP1 A;  4DBH A;  2ZPH B;  3JCM W;  4XTW A;  2VGN A;  2GTJ A;  3OYJ A;  2HNI A;  2LT1 A;  1RI9 A;  1PRL C;  2HBP A;  1WJS A;  1VYT A;  1TSF A;  1QCN A;  2DL3 A;  1PHT A;  1WFW A;  2XID A;  3NMZ C;  1WXU A;  3ZBD A;  2X4W A;  4AMC A;  2A3L A;  3NTH A;  2LJ1 A;  5GAO l;  3M58 A;  2RQV A;  1PSE A;  2QI2 A;  2EQK A;  2RQT A;  1H8K A;  2KYB A;  4M7A F;  2H3E B;  3I35 A;  1KSW A;  3V7C A;  7AT1 B;  2JNG A;  1NPP A;  3X25 B;  5DM7 R;  3EG3 A;  3JCM f;  1M3B A;  1RAE B;  1VA7 A;  5KYX A;  5FWB A;  2GQV A;  4AFZ C;  5HCK A;  2HL3 A;  1WHM A;  4M7A A;  2FRW A;  3RKX A;  1B34 A;  1LVK A;  4IIM A;  1T3L A;  2VV5 A;  4M75 D;  3HPW A;  1TG0 A;  1IHW A;  1ZSZ A;  2EW3 A;  4LD6 A;  3VV0 A;  2QQS A;  3M9Q A;  3SWN B;  2L8D A;  4B9W A;  3M0Q A;  4PJN A;  4XU2 A;  3ULR B;  4M78 C;  4Z89 A;  5GAN 7;  1VQM A;  3DKM A;  1YIJ Q;  1XJW B;  3QG1 A;  1MV0 B;  2DE0 X;  2QAS A;  3RNJ A;  5IAY A;  1YN8 A;  3HRT A;  1ARK A;  3P8H A;  1WYX A;  1B34 B;  2HSE B;  2RO0 A;  4M7A B;  4DBQ A;  3EGU A;  4PJO A;  3UA6 A;  1U1T A;  2HQE A;  3MCA B;  5KYX B;  2KXD A;  4R55 A;  3L42 A;  3A8O B;  2YRD A;  3M0U A;  3C0C A;  3MPU B;  2R57 A;  1OX9 A;  3CME A;  2HKQ B;  1X6B A;  1Z9Z A;  2E4H A;  3I55 Q;  2QQB A;  4F7U F;  1BI0 A;  1G3T A;  1WZO A;  1W1F A;  3I55 A;  4N4I A;  5IXB A;  5FRN A;  5HY6 A;  5GAN 6;  3X24 B;  1OZ3 A;  2MIO A;  8AT1 B;  4C5H A;  3QKJ A;  2QA4 Q; 
#chains in the Genus database with same CATH homology
 3VS6 A;  2CRE A;  3UF4 A;  5GJW B;  1RLQ C;  1UEC A;  2DLP A;  1M3C A;  1NM7 A;  1WA7 A;  1V1C A;  4LN2 A;  1GFD A;  1E7O A;  1QWE A;  1ZSG A;  3EHR A;  3LH5 A;  1K0X A;  1M30 A;  2DL8 A;  2LJ0 A;  2SEM A;  2OAW A;  1NEB A;  2JXB A;  2FG0 A;  2LZ6 B;  1ZLM A;  1TUC A;  2G6F X;  5GJV B;  2ENM A;  2EYY A;  2FPE A;  3RBB B;  2JMA A;  2LP5 A;  3IQL A;  1E6H A;  4OMO A;  1N5Z A;  2FO0 A;  2AKK A;  2FPD A;  2LQN A;  1UG1 A;  2RPN A;  1FMK A;  2KYM A;  2X3X D;  2EQI A;  1CKA A;  2A28 A;  1PNJ A;  3PVQ A;  1VYU A;  2ECZ A;  2CUD A;  1MV3 A;  2DX1 A;  2W10 A;  3VRY A;  1B3Q A;  1T3S A;  4RTT A;  1BBZ A;  1NLO C;  2CT3 A;  4LUD A;  1BU1 A;  1H3H A;  3VS4 A;  2OJ2 A;  2K9G A;  1AZE A;  2K3B A;  2EYW A;  1ZUK A;  1UJ0 A;  4R0K A;  3H0H A;  1OOT A;  4IIO A;  4JJD A;  2EYX A;  3VS5 A;  1X27 A;  2RQU A;  4JPB W;  3NGP A;  2RF0 A;  1CSK A;  4F17 A;  5IHK A;  2O9S A;  4GLM A;  3VS0 A;  2CT4 A;  3UAT A;  2L3Q A;  4ESR A;  1SPK A;  1YNZ A;  2VKN A;  4RTZ A;  3EG0 A;  3THK A;  2V1R A;  1AD5 A;  4HVU A;  4LE9 A;  1OEB A;  4HVW A;  4RTW A;  2CSI A;  3H41 A;  2GNC A;  2JS2 A;  2AZS A;  1QKX A;  3QWY A;  2M0Y A;  2KBT A;  1GCP A;  2O9V A;  1Y0M A;  1A0N B;  1I0C A;  2B86 A;  1JEG A;  2JTE A;  5FWC A;  2KRN A;  1ZUY A;  3PE0 A;  3VS1 A;  4OMQ A;  2J6O A;  2K6D A;  1G83 A;  4OMM A;  1UTI A;  2F2V A;  1GFC A;  1U5S A;  1JO8 A;  5ECA A;  2J06 A;  2AK5 A;  2RQW A;  4OMN A;  4AFS C;  2EBP A;  1QKW A;  4J9I A;  2KRO A;  1UDL A;  2SRC A;  1ZX6 A;  1OV3 A;  2DM1 A;  2AZV A;  4RTX A;  4D8D A;  2DNU A;  2FPF A;  2BZX A;  2MCN A;  3SEM A;  1AWX A;  1M8M A;  1PKS A;  2K7A A;  2VVK A;  4Z88 A;  1SHF A;  2J05 A;  3R6N A;  3M0T A;  2W0Z A;  2ESW A;  3KFV A;  4QT7 A;  2LX7 A;  2KE9 A;  1AWO A;  2EVR A;  3VRZ A;  2YT6 A;  2YUQ A;  2HCK A;  1EFN A;  2HEQ A;  2C0I A;  2GBQ A;  1H92 A;  4RTY A;  3EG2 A;  4M4Z A;  1SHG A;  4OML A;  4WCI A;  3SHW A;  3M0S A;  4EIK A;  2NUZ A;  2DMO A;  1X6G A;  4JZ4 A;  3O5Z A;  5IHI A;  3VS2 A;  1AVZ C;  2A08 A;  3QWX X;  2EPD A;  1U06 A;  4CC7 A;  1IO6 A;  2L3P A;  2V1Q A;  4K11 A;  3CQT A;  1WIE A;  3H0I A;  2LCS A;  1X69 A;  3I9Q A;  1B07 A;  5IH2 A;  1Z9Q A;  1QCF A;  1JXM A;  1ZUU A;  2GTO A;  1SRM A;  1PKT A;  2H8H A;  1AWW A;  2NWM A;  2HDA A;  2DJQ A;  2J7I A;  2VWF A;  4J9D A;  4LUE A;  4F14 A;  1GCQ C;  3UA7 A;  3TVT A;  1YCS B;  1W70 A;  1WLP B;  1RUW A;  2YUP A;  2EYZ A;  3TSZ A;  1W6X A;  1K76 A;  2D0N A;  1BB9 A;  2CH4 W;  2KR3 A;  3VS7 A;  1WI7 A;  1T0H A;  2RMO A;  1AOJ A;  4J9H A;  2PZ1 A;  2AKL A;  2ED1 A;  3NPF A;  2YSQ A;  4RUG A;  2XMF A;  3M0R A;  1NYF A;  2PNI A;  1K9A A;  4Z8A A;  2RQR A;  1HSQ A;  5L23 A;  1HJD A;  2ED0 A;  2EKH A;  1TUD A;  2DF6 A;  2CUB A;  1OPL A;  2D8J A;  2DVJ A;  3I5S A;  2K79 A;  5EC7 A;  1GBQ A;  2ROT A;  4OMP A;  1K4U S;  1AEY A;  1UUE A;  1MUZ A;  5I11 A;  3REA B;  2DL5 A;  3JV3 A;  2A36 A;  2CSQ A;  1SEM A;  3I5R A;  4AG2 C;  1NG2 A;  2DRK A;  2C0O A;  1I1J A;  1YWO A;  1X43 A;  2DBM A;  1ABO A;  1GRI A;  2BZY A;  2L2P A;  1JU5 C;  5FW9 A;  4RTU A;  3PVL A;  2ABL A;  1VYV A;  4DEY A;  1WDX A;  2KRM A;  1I07 A;  4ORZ A;  4A63 B;  2O31 A;  2KT8 A;  1UE9 A;  3U23 A;  3REB B;  1E6G A;  2JM9 A;  2QDL A;  4J9B A;  1UFF A;  5IHN A;  2JW4 A;  1T0J A;  4Y92 A;  1UJY A;  2GGR A;  3NHN A;  2KT1 A;  2MOX A;  2LNH B;  2EGC A;  4GBQ A;  4CC3 A;  2YUO A;  1CKB A;  2M51 A;  2FEI A;  4RTV A;  4AG1 C;  2D1X A;  2FRY A;  2YUN A;  1J3T A;  1S1N A;  2D8H A;  4HXJ A;  4DEX A;  1GBR A;  1WX6 A;  2F2X A;  1UHC A;  4F16 A;  4CC4 B;  3EG1 A;  2GTJ A;  1RI9 A;  1PRL C;  1LCK A;  4FSS A;  3TSW A;  1K1Z A;  2EGA A;  1VYT A;  2DL3 A;  1PHT A;  1WXB A;  1WFW A;  3NMZ C;  1WXU A;  3A98 A;  2CH4 A;  1QWF A;  4JJB A;  2EGE A;  2LJ1 A;  1M3A A;  1Y57 A;  2X3W D;  2BTT A;  4ZNX A;  1GL5 A;  4J9F A;  2RQV A;  1HD3 A;  1SSH A;  4AFQ C;  2O2O A;  2RQT A;  1K0S A;  3GBQ A;  1RLP C;  2CDT A;  2DL7 A;  1H8K A;  2KYB A;  1GCQ A;  3I35 A;  1KSW A;  2JM8 A;  2E5K A;  2KGT A;  4JZ3 A;  2RN8 A;  3M0P A;  4KRT A;  1PRM C;  3EHQ A;  3EG3 A;  1M3B A;  2JT4 A;  4JJC A;  4HVV A;  3VS3 A;  1SRL A;  2LQW A;  1VA7 A;  4D8K A;  2C0T A;  5FWB A;  4AFZ C;  4CC2 A;  5HCK A;  1ABQ A;  2I0N A;  2DBK A;  2FRW A;  2O88 A;  2KNB B;  4IIM A;  4X1V A;  1T3L A;  1KFZ A;  1TG0 A;  2DIL A;  2KEA A;  2EW3 A;  2IIM A;  1NYG A;  2YDL A;  3FJ5 A;  1AWJ A;  5I22 A;  1X2K A;  3M0Q A;  3ZL7 C;  3H0F A;  1QLY A;  2J6K A;  3ULR B;  1PWT A;  4Z89 A;  1JXO A;  2L0A A;  1YP5 A;  2HSP A;  1X2Q A;  1OPK A;  1MV0 B;  1M27 C;  1NLP C;  2DE0 X;  2JMC A;  4AFU C;  1KIK A;  3RNJ A;  1ZBJ A;  2P4R A;  1YN8 A;  1ARK A;  2KRS A;  4LNP A;  1XOV A;  4E6R A;  2DYB A;  1WYX A;  2F2W A;  2BZ8 A;  3EGU A;  1KJW A;  3UA6 A;  1NEG A;  1BK2 A;  2JS0 A;  2KXD A;  2RNA A;  3M0U A;  2PTK A;  1WXT A;  1FYN A;  3C0C A;  1G2B A;  2LMJ A;  2J6F A;  2DA9 A;  1X6B A;  1AZG B;  2DL4 A;  1Z9Z A;  2LJ3 A;  2L3S A;  1JQQ A;  4J9C A;  4J9G A;  2ROL A;  1U3O A;  2DRM A;  1W1F A;  2OI3 A;  5IXB A;  4J9E A;  5IXF A;  2A37 A;  2K2M A;  2GQI A;  1UGV A;  2KXC A;  2MIO A;  2HBW A;  1UHF A;  1YWP A;  4HCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...