3O5ZA

Crystal structure of the sh3 domain from p85beta subunit of phosphoinositide 3-kinase (pi3k)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
GPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPVALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structure of the SH3 domain of the phosphoinositide 3-kinase p85 beta subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit beta
total genus 21
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3o5zA00
2D8JA 2EGCA 3REAB 1ZUUA 2DBMA 4F17A 1HJDA 1BBZA 1YNZA 2DL7A 1W70A 5HCKA 3EG0A 2BTTA 1H8KA 2RNAA 4JZ4A 1UFFA 4KRTA 2LJ1A 1T0HA 2EPDA 1RLPC 3QWYA 1Y0MA 1WDXA 2L0AA 2LQNA 4RTYA 2XMFA 4IIOA 2DL4A 2DA9A 2HCKA 4JPBW 3EHRA 4OMPA 2GGRA 2EGEA 3TSWA 1PHTA 1OV3A 1GCQC 1VYTA 3PVLA 1I1JA 2JS0A 1OPKA 5GJVB 1AWWA 3IQLA 2LX7A 2DRMA 1RLQC 4J9BA 1ZLMA 2AKKA 5ECAA 2A36A 1T3LA 2RQTA 1X69A 1JXOA 3I35A 2CSIA 3LH5A 3U23A 2J6OA 1X2QA 4DEYA 4ESRA 3QWXX 2J06A 1PRMC 4LUEA 1T3SA 1BU1A 1LCKA 1UTIA 4E6RA 2X3WD 1M3AA 2NWMA 3NPFA 2MIOA 3PE0A 2RN8A 1WYXA 1CKAA 1WFWA 1NM7A 2AK5A 2FRWA 5L23A 2EVRA 1TUDA 1K0XA 1AWXA 4RTUA 2EYZA 4WCIA 4HVVA 1X43A 2ECZA 4J9CA 4LNPA 3RBBB 2CH4W 1KSWA 3C0CA 2KGTA 2KXCA 3M0TA 2O2OA 1K76A 2C0TA 1FYNA 1VYVA 1AEYA 1JQQA 1X6BA 2ROTA 2JMCA 1NLPC 2D1XA 1QKXA 4HCKA 3PVQA 4ZNXA 1U06A 1YWOA 2BZYA 1CKBA 2RQUA 1WLPB 4LUDA 2K7AA 1ZUYA 2DBKA 2LNHB 2K9GA 2W0ZA 5FW9A 4J9GA 2DE0X 4X1VA 2J6FA 2JM9A 2K6DA 3CQTA 3O5ZA 1U5SA 2P4RA 2FO0A 4HXJA 1XOVA 1X2KA 2ABLA 2L2PA 1U3OA 3A98A 2FEIA 2DNUA 4RUGA 4J9DA 1ARKA 3VRYA 2G6FX 1Y57A 3VS3A 2KE9A 2YDLA 2DRKA 1UHFA 2DLPA 2EKHA 2VKNA 2CH4A 1AZEA 2F2VA 2BZXA 1K0SA 4DEXA 2DILA 1AOJA 2CSQA 1IO6A 1OOTA 4M4ZA 2YUQA 1B07A 1VA7A 3M0PA 1HSQA 2LJ0A 1AWOA 1GCPA 2O88A 4RTZA 3I9QA 1QCFA 2KXDA 1K1ZA 1NEGA 1G2BA 2CUDA 5IH2A 2EBPA 3TVTA 2OAWA 4FSSA 5IHKA 2I0NA 2M0YA 2KBTA 1UG1A 2VVKA 1I0CA 2O31A 2W10A 2ED0A 3VRZA 2BZ8A 1M8MA 1VYUA 4AFUC 3R6NA 1EFNA 1RUWA 4RTVA 3EG2A 1GBQA 3H41A 1QLYA 4GLMA 4D8DA 1YP5A 3TSZA 2GTJA 1K4US 1BB9A 2L3QA 1UGVA 5IHIA 4Y92A 3UA7A 1OEBA 2KYMA 1QKWA 1NEBA 1QWFA 2CT3A 1J3TA 2YUNA 4LN2A 5EC7A 2EYYA 3REBB 1YN8A 4AG1C 2K79A 2RQRA 2RQVA 2RMOA 1QWEA 4Z89A 3VS2A 4GBQA 1M30A 3M0UA 1NYGA 2VWFA 2YUOA 1WA7A 2GNCA 1UE9A 1BK2A 2A08A 2ENMA 3UF4A 2DYBA 4J9IA 3NMZC 1WXTA 4D8KA 1W1FA 1X27A 4J9FA 1NLOC 3UA6A 2JM8A 1WIEA 2HDAA 1UUEA 2KR3A 4OMOA 2LJ3A 2JTEA 3M0SA 4JJDA 5I11A 2DL5A 3FJ5A 4CC3A 2KYBA 1E7OA 1N5ZA 4CC4B 2C0IA 2KT8A 2GBQA 2DL3A 2LMJA 2FPDA 1G83A 3M0RA 4OMNA 3RNJA 3VS5A 1PNJA 4HVWA 4JJCA 2L3PA 4A63B 1SEMA 2HBWA 2ROLA 1NG2A 3UATA 2EQIA 2OJ2A 3NGPA 1AWJA 2KEAA 4IIMA 2E5KA 1MV0B 1WI7A 1SHGA 2DX1A 1KJWA 2LQWA 1E6HA 2PTKA 2GQIA 3NHNA 2A28A 3EGUA 3M0QA 3KFVA 3EG3A 4F16A 4J9EA 2OI3A 2PNIA 2CREA 1JEGA 1YCSB 4JZ3A 3EHQA 3GBQA 2ESWA 1H92A 4AFQC 3VS6A 1KIKA 2DMOA 1I07A 3H0IA 4AFSC 2YT6A 2FRYA 3JV3A 1MUZA 2SRCA 1TUCA 1UJ0A 1ZSGA 2X3XD 4J9HA 2MOXA 2AZVA 3VS4A 1AVZC 2JXBA 1RI9A 3ZL7C 1AD5A 2DF6A 1TG0A 2CUBA 2NUZA 2SEMA 5FWBA 4F14A 3THKA 2C0OA 2QDLA 1AZGB 4LE9A 1ABQA 4HVUA 2JMAA 2LP5A 1UJYA 4R0KA 2FPFA 1JO8A 1GL5A 2ED1A 2KRMA 4JJBA 4QT7A 1GCQA 4K11A 5IHNA 2RQWA 5IXBA 2V1RA 2CT4A 2O9VA 2J05A 2JS2A 1GFCA 1ABOA 3VS1A 1PRLC 3SEMA 1GBRA 3SHWA 2K2MA 3H0HA 4RTTA 1PKTA 2DM1A 2M51A 2J6KA 1E6GA 1UECA 2F2WA 5IXFA 2D0NA 2V1QA 2GTOA 2MCNA 1HD3A 1Z9ZA 1SSHA 1V1CA 2RPNA 2CDTA 2EYWA 2PZ1A 5GJWB 1SRLA 1YWPA 1M27C 1UDLA 1SHFA 2DJQA 2H8HA 2D8HA 2O9SA 3EG1A 1ZBJA 4ORZA 2A37A 2KRNA 3I5SA 4CC2A 3I5RA 3VS7A 2YUPA 2LCSA 1ZX6A 4Z88A 2KROA 1UHCA 2JT4A 2HEQA 1K9AA 1GFDA 2DL8A 1M3BA 2EGAA 2L3SA 4Z8AA 2HSPA 1SPKA 4OMMA 2AZSA 2FG0A 2KRSA 4EIKA 1OPLA 1Z9QA 4OMQA 1X6GA 4RTXA 1H3HA 2AKLA 1MV3A 2B86A 2K3BA 1FMKA 2KT1A 1T0JA 1PWTA 4AG2C 2J7IA 4CC7A 3H0FA 1A0NB 1KFZA 1WX6A 1SRMA 2RF0A 2EW3A 1JU5C 2KNBB 2JW4A 1WXUA 1W6XA 3ULRB 1JXMA 2EYXA 1PKSA 2F2XA 1WXBA 4AFZC 5I22A 4OMLA 1CSKA 1NYFA 1M3CA 1S1NA 2LZ6B 1GRIA 1ZUKA 5FWCA 2DVJA 2YSQA 4RTWA 1B3QA 3VS0A 2FPEA 2IIMA
chains in the Genus database with same CATH superfamily
1FXXA 3CD6T 1LJOA 4FCYA 4M7DA 3OA6A 3SD4A 3REAB 2E4HA 1X6OA 1PG5B 1YNZA 2MMPA 3RMSA 2PUOB 1MNDA 3A8HB 1H8KA 5FRNA 2RNAA 5KCHA 2Y4YA 3M4GA 4BI4A 1RLPC 1Y0MA 1WDXA 5GAN5 4IIOA 4ELYC 4JPBW 5LJ5d 2GGRA 3TSWA 1M2OA 2X4JA 1VQMT 3E9FA 4BI3A 3LX7A 3C94A 3UPUA 3TEEA 1OPKA 1SSFA 5GJVB 4IUPA 2LX7A 3H6ZA 2DRMA 4J9BA 5KCOA 2A7YA 1ZLMA 1ZSZC 2RA2A 1R8OB 5CVIA 2IVWA 3MEVA 5HK3A 3X20B 1UGSB 3HRTA 1YITT 1HXDA 2DXCA 5J3BA 1R0BG 1X2QA 4DEYA 4M77C 3QWXX 4J83A 2J06A 2HSEB 4ZGEB 2FYKA 1I5LA 3GNGA 2X3WD 1LNXA 1O75A 3E19A 1BKBA 1VQNT 1TUDA 1AWXA 2V8KA 2COZA 1LVKA 4KUIA 4JRKA 4E2FB 3RBBB 1KSWA 3RDVA 2O2OA 3META 5GMKj 2JTFA 1FYNA 1X6BA 2ROTA 4M7DD 2DAQA 2JMCA 1VQ7A 3FJPA 4HCKA 2L8DA 5D6WA 3CCET 2RQUA 3F70A 4XTVA 3GNFB 3CMAQ 3GP8A 1WQ7A 2W0ZA 5FW9A 2X35A 2DE0X 1PD0A 5GAMd 3O5ZA 4O5VA 2F5TX 3OYCA 2FO0A 4HXJA 1C1AA 4KH0B 2QAZA 2L2PA 3RKWA 1H3ZA 4RKUE 4M7DG 4M78B 2V8JA 2L89A 3VS3A 2KE9A 3VKIA 2PU9B 2HNIA 2CH4A 2K5IA 2FB7A 5GAN8 3FRNA 2DILA 1IXDA 2MK5A 1IO6A 1OOTA 5KYYB 2YUQA 2O4XA 1M90C 3M0PA 1W2BA 3CMEQ 4XAXB 3CC4Q 1K1ZA 2QEXQ 1NEGA 4J7FA 1KQSA 4RG2A 4R56A 2MF2A 2VXFA 1UGQB 4HCCA 3X26B 3CCST 2MYSA 2KQWA 1C6VX 2KY9A 3LYIA 4E7HA 2DEQA 2I0NA 1NBEB 2EQJA 2M0YA 5AT1B 2KBTA 5CKBA 4PJNA 3JCMe 2ED0A 3QXEB 2XI9A 1UGPB 2BZ8A 4JJNK 1VYUA 4D6WA 2R5AA 4J7IA 1EFNA 2K3XA 3CCMT 4RTVA 5KYWB 3EG2A 3M56A 1QLYA 1N8RU 3OW2A 3G7ZA 3TSZA 2L3QA 1OU9A 4Y92A 3UA7A 1YJWT 1OEBA 2KYMA 3QBYA 3EH2A 2MAMA 3OYFA 3D7SB 2RJDA 1K8AC 2F1LA 1K9MU 7AT1B 4FT4A 5GMKi 1YIJQ 4GBQA 2CKKA 4C0DB 1ZQ1A 5FU6B 3L1AA 1NJIU 3QIIA 4UC4A 4QQGA 1BK2A 5I2SA 4X34A 4N4HA 4F7UE 1EIFA 3UF4A 4J9IA 3CC7Q 4M7AA 3OMCA 4D8KA 4J9FA 2QA4T 1IHVA 1AT1B 2JM8A 2FZKB 4F7UB 5DM7R 1BIAA 3WXMB 1QVFP 3A5ZB 3PT9A 2XDDA 1C0MA 3FIFA 3H8ZA 2QA4A 2VV5A 1VQPT 4EMKA 3FJ5A 4CC3A 4AT1B 1EX4A 1E7OA 1N5ZA 4HA8A 2DYIA 2C0IA 5GANh 3EH1A 1FMVA 4A4EA 2K5LA 2ATCB 3AHUA 1PNJA 4JJCA 4C0ZA 1TSFA 3UATA 3S3OA 1FMWA 3CD6A 1AWJA 1WI7A 1Q7YU 4M7DE 2QK0A 4E7SA 1QVGP 2GQIA 4M78C 1K8AR 3CCVA 3KFVA 2QQBA 2XU8A 1JEGA 3E9GA 3EHQA 4ZN3A 3KUFA 1U1SA 3OYHA 1MMAA 3BDLA 4NS5A 1NE8A 3BW1A 3H0IA 1YJNQ 4M77D 1VQ6Q 1TUCA 1UJ0A 2LNVA 3OYNA 4R55A 4TVRA 2MOXA 2JXBA 1VQMA 2WACA 2DK3A 5LJ3f 4F14A 1OULA 1ZA1B 3CBMA 5I21A 2WSCE 1ABQA 3E2UA 2JMAA 2LP5A 2NUPB 1JO8A 1GL5A 3EFOB 1YI2T 1VUBA 2A0FB 4K11A 3CCMA 2J05A 3QZ9B 2GFAA 2DVEA 5GAN7 2GF7A 4EMKB 3H0HA 3PTAA 4RTTA 1PKTA 2DM1A 5M9OA 1TOVA 3OYMA 1UECA 2V1QA 4BDYA 2MCNA 1IGUA 5AYFA 3QZ5B 2LT4A 1SRLA 3OY9A 2HKNA 1WHGA 1YI2Q 3EG1A 1VQ6A 2NLUA 1ZBJA 4ORZA 2RHYA 2PVDB 1Q81R 2A37A 3CCRQ 4Z88A 2KROA 2JT4A 4L6V5 2HEQA 1K73C 5KYUA 1Q86R 2P84A 1YJNA 1VQ9A 2E3HA 2HSPA 2RD1A 3OYAA 2CZ0B 2AZSA 4M75E 1IRXA 2X4YA 1YJ9Q 5GANf 1X6GA 4RTXA 2RO0A 1VQ8A 2K3BA 1TXQA 1VQOQ 3CD6Q 2KT1A 1NZ9A 2PUKB 1A0NB 1SRMA 3HP9A 5GAMf 3RMQA 1P92A 5HY6A 2ZGWA 1K8AU 4F7UF 5GAOr 1PCXA 1XQHA 3EGDA 2HKQB 3JB9J 1TH7A 2RM4A 4OMLA 1GRIA 5DLQE 4DA4A 2VB6A 2QA4Q 5FWCA 4RTWA 3V7CA 1B3QA 3VS0A 4IUTA 3HHTB 2KSSA 2DD5A 2E41A 1JXOA 2RHZA 3V8LA 2JN0A 5LJ3d 2WSEE 2EGCA 2VYTA 3MP8A 3C95A 3G71T 1BBZA 1VQNQ 2K57A 1YJ9A 5HCKA 4M75C 5LJ5j 2EJFA 4X9DA 2BTTA 2NYSA 1UFFA 3MP1A 1W2BP 4E7ZA 2EPDA 1V29B 4P5NA 3JCMc 2CS7A 2DL4A 2DA9A 2DIGA 4OMPA 2RJCA 2OAUA 1PHTA 1ZBXA 1OV3A 4BY6C 1YIJA 1GCQC 3CCLA 1EZZB 1VYTA 1IHWA 1G3YA 3L2UA 2VUBA 1B7TA 4FW2A 2FL7A 4PJOA 1RLQC 1RI0A 3CPFA 3T9NA 1U8RA 3JCMP 4M7DB 4PLIA 1DJ7B 2A36A 1T3LA 2QQSA 2JVVA 3Q1JA 3CCMQ 2DXTA 2LCCA 5FLXE 3JB9G 3I35A 4EPCA 2CSIA 1B34A 3RERA 1X01A 1VQPA 2FVUA 3N5BB 2H3EB 2R5MA 2IPOB 2RHUA 3J80E 1IZ6A 1LCKA 2YLBA 2QASA 3V7RA 5GAN3 3OS0A 3M53A 4XU1A 2RN8A 1WYXA 2VXEA 4M7DF 2EQUA 4M78D 2FRWA 1VQMQ 2JZ2A 4BACA 4RTUA 2ZPHB 2BE7D 5I2MA 4WCIA 4HVVA 3JCMX 4M75G 3CPWA 4J9CA 4LNPA 1YCYA 5LJ5g 1QVGA 2P0KA 4KBMB 4JS4A 3CCVT 3QDFA 5CKEA 2D1XA 4A4KA 1QKXA 2YHTA 3PVQA 4FW1A 2I2LA 1KD1R 4J5YA 1WLPB 3QJ6A 2ZPEB 2EAYA 3X25B 3JB9F 2RJFA 2K7AA 2DBKA 5HKCA 2RK1A 3H9NA 1WJRA 4C5IA 5CQYA 4KGZB 1U5SA 3I55Q 1X2KA 2ABLA 2XICA 1S72A 2OTJT 2DNUA 4RUGA 5GAN6 3OYLA 8ATCB 2LQ8A 2EIFA 3VRYA 2LVMA 2RB6A 1QCOA 4C0DC 2FZGB 3JCMV 4AMCA 2DLPA 2EKHA 1AZEA 1FX7A 1O9SA 1K0SA 3P8DA 4MMKA 3HTRA 1VQKT 2LJ0A 2NUTB 4LXCA 1WJQA 5FRMA 1VQ4A 4C0GA 4RTZA 2ZPFB 4JRPA 2EKOA 2X9HA 4PJOF 5IH2A 2EBPA 4C5EA 2OAWA 3A1PA 4QVCA 1ZA2B 3HRSA 5IHKA 2DO3A 3OSSC 1M4ZA 1UG1A 1M1FA 3VUBA 2VVKA 2LCLA 2QI2A 2DERA 1VQKQ 4FSXA 2QYZA 3JCMJ 3VRZA 3OYIA 2EJGA 1BIBA 2O01E 4L59A 1VOMA 4QW2A 2F69A 4BE1A 3H41A 4GLMA 4PJMA 4J6WA 4LDXA 1KQSS 1QKWA 3CCQQ 1KHCA 1IREB 4AG1C 1Q86U 3LH0A 3G6EQ 2K79A 2YLCA 1JJ2P 2RQVA 1HK9A 5IT9E 5KE3A 5KYUB 1D0XA 2YUOA 2E6ZA 4C0FA 4HKEA 2CP5A 2A08A 2ENMA 4M75A 1OX9A 3NMZC 1W1FA 4FM4B 1JBMA 3UA6A 5GANg 1WNLA 1OYXA 4RG8A 3OYKA 2KR3A 2JUFA 4FYXB 3GLXA 5KYNA 2Y90A 2DL5A 4C92E 5IAYA 2KYBA 4WTOB 1B34B 2CP7A 2KT8A 3J81E 1Y96A 3AT1B 2DL3A 5FU6C 2LMJA 3TCJA 1D09B 1VQLT 2FPDA 3CCQT 3M0RA 3VS5A 2E3IA 1RAIB 1SEMA 2HBWA 1NG2A 3G6ET 2RHXA 2M1HA 1SKUB 2VGMA 4IIMA 2KI7A 1KJWA 4B9WA 4M7AE 1E6HA 2AHJB 1VQLA 4WF2A 1W2BS 4DOVA 3CCLT 3EG3A 4F16A 1M1GA 1G8XA 2PNIA 1YCSB 4DOWA 1VQNA 2YRCA 2KMTA 1VQ7Q 1IB8A 3GBQA 4QQ6A 3OS5A 1N8RR 3GOXA 3VS6A 2DMOA 1I07A 4OB3B 4AFSC 2YT6A 4F7UG 3M5AA 1VQOA 4BE0A 3GIBA 1ZSGA 1QVPA 4C8QB 2X3XD 1RL2A 1AVZC 1QMCA 2EFIA 3ZL7C 1LPLA 2LC4A 2NUPA 4FT2A 2CUBA 2NUZA 2K5FA 2D9TA 4M7AF 5KYYA 4LE9A 2DD4A 4HCBA 2EYQA 2ED1A 3P8BB 4JJBA 5GMKm 5GAOp 3EGXA 4FIBA 3OBYA 2XHCA 5IHNA 2RQWA 3CCSQ 2CGHA 2JS2A 2YRVA 4IUVA 3OS1A 3NTIA 1OZ2A 1ABOA 1XJWB 3SEMA 1VQ8Q 3PFSA 5EG2A 4BY6B 1Q81C 4QVZA 3RR6A 4A4HA 2M51A 2J6KA 4KULA 3JCMb 2D0NA 4OGEA 3QSUA 2MI6A 2E65A 1VQ5A 3VUZA 1VQ9Q 1Z9ZA 1I5OB 1V1CA 2BE9B 4KGXB 5A0LA 2EYWA 1TS9A 1M27C 1UDLA 1SHFA 2H8HA 1TWBA 3MPUB 3SWNA 2E70A 2KRNA 3I5SA 4CC2A 4Y28E 3VS7A 1MMDA 3KBGA 1ZX6A 2VC8A 4OVAA 1Q7YR 2HL3A 4XU2A 1TUGB 2QDYB 4IUQA 1GFDA 2EGAA 4QQDA 2GFUA 4Z8AA 4N4IA 5LJ5e 4EMKC 4EIKA 1Z9QA 4MDXA 3LWIA 3CCQA 5CK9A 4XTUA 1MV3A 2B86A 3EFRA 2F5KA 2XDBA 4GY5A 1PWTA 5LL6S 2J7IA 2MWPA 3M59A 4C92A 5GANd 3H0FA 1UGRB 1KFZA 4M78F 1WX6A 2RF0A 4NL3A 4XTZA 1M9SA 2CZ6B 4MMLA 4JRQA 1VQ4T 4ELZC 1JXMA 3C12A 1YJWA 2HAXA 3CCSA 4AFZC 2LZ6B 5LJ3j 2B8AA 3MKDA 4DBRA 4F04B 3EGXB 4PJLA 3DB3A 4CRIA 1Q82U 4M7AD 5KE2A 1IGQA 1WHLA 1ZUUA 2DBMA 3SDZA 4F7UA 1HJDA 2DL7A 1W70A 3L42A 3MCAB 5A2QE 3EG0A 2X4WA 4JZ4A 1KC8U 1VQ6T 2QXFA 4KRTA 2LJ1A 4BB7A 4B9XA 3JAME 3CCEA 2LQNA 4ZGDB 4PFPA 3JB9H 2AIRB 4FL6A 3EHRA 5GAMe 5CIUA 4N0AA 3L2RA 1QP2A 3PVLA 4XTWA 4IURA 3I55A 3M57A 1M1KR 2JS0A 3RESA 1AWWA 1WJSA 3IQLA 4BUGA 3QJYA 3C4SA 4Y91A 5LJ5f 4M78G 5ECAA 4M7AB 1VIFA 3JCMd 2RQTA 1X69A 5D7UA 5CQXA 2RI2A 1PC0A 3U23A 2J6OA 2QTVA 2D6FA 1QQJA 4A4FA 2QQAA 1PRMC 2XDPA 1UTIA 4O6JA 2DETA 1CKAA 1UB4A 4XU0A 5GAOq 2QGGA 1M1KC 4HT9A 5L23A 1RAFB 3DLMA 3VYGA 4J8OA 1K0XA 5FROA 2EYZA 2MWOA 3OS2A 1X43A 5GAMj 2ECZA 3PMTA 9ATCB 2ZCFB 3C0CA 3FDRA 3G71A 3CCRA 1VQ5Q 1MNEA 2KXCA 1YJ9T 2X51A 3QKJA 3QPHA 2C0TA 2JJ9A 2G3RA 1VYVA 1AEYA 1JQQA 4BE2A 3HKSA 1YI2A 1NLPC 1Y96B 4J6XA 4J6YA 3QYGB 3PGGA 4ZNXA 1YWOA 2QGFB 2BZYA 3PIPA 3I56T 4LUDA 3HSBA 2DFUA 3CCRT 2E6NA 4M77B 2LNHB 4J9GA 3VYHB 1M90U 2JM9A 2K6DA 5C0MA 2CP0A 2AT1B 2P4RA 1KG1A 2O4XB 1U3OA 3X24B 3A98A 1BCMA 3RKXA 4J9DA 3ZEHA 3S3NA 3M9QA 2G6FX 3EAEA 2YDLA 5FU7C 3LLRA 2DRKA 3CEYA 4PJOG 3EGDB 2P0PA 4C5GA 4PJOD 4C92F 3MO8A 4PJJA 2F2VA 2BZXA 4DEXA 3G4SA 3V7SA 2CSQA 4OB2B 1VA7A 1YITQ 1GCPA 3FEOA 4ZTFA 1K9MR 3J7AF 1JB0E 1LOJA 4RMOA 2M0OA 2O88A 3I9QA 3A8GB 4XTXA 1ZHIA 1G2BA 1RADB 1D3BB 4FSSA 1N9RA 1N9SA 3FLGA 2QEXT 4DBQA 1QVFS 2DTIA 3JCMW 1I0CA 3RIRA 1PD1A 3CPWS 1FWZA 2DJZA 4ANJA 2W10A 2C06A 3CC2T 5CKFA 4JDSA 4M78E 2E12A 4N4GA 2CYZB 4M7AC 3R6NA 1RUWA 3OYBA 4D8DA 2PVOB 3V8KA 1YP5A 1WHMA 5J26A 2GTJA 2XK0A 5GAMg 1OZ3A 5IHIA 3ASKA 1NEBA 5GAOn 1QWFA 2CT3A 1J3TA 4LN2A 3REBB 4C8QA 4E7LA 2K2VA 3ZFJA 3UT1A 1YFNA 3OQ5A 1N27A 4MZTA 3VS2A 2VGNA 2YXYA 1M30A 5GMKl 5CCAA 3CCJA 4KH1B 3LGLA 2GNCA 2JNGA 2RHIA 2HBPA 2QQ9A 4PJOE 2DYBA 1K9MC 4OB0B 1WXTA 4FYYB 1X27A 3M58A 1WIEA 2M9UA 1UUEA 3JCMf 1KQSP 2LJ3A 2JTEA 2HQHA 1K73R 1JJ2S 4Q5WA 5DLOA 4JUVA 5I11A 3JCMQ 3MP6A 4HT8A 1KQ2A 3RUXA 3M54A 1NJIC 3SB2A 4CC4B 3TQ7P 3A8MB 1VQPQ 5GAOm 1G83A 4OMNA 2E10A 3GPLA 4HVWA 3HL8A 2L3PA 4A63B 2BIVA 4PKCC 3NGPA 1RAHB 2KEAA 4PLLA 2DX1A 4VUBA 4DBHA 2A28A 2VASA 1M8VA 3M0QA 3JCMg 4ZTJA 4J9EA 1VQ4Q 2CREA 1I8FA 4B6MA 4JZ3A 2D0QB 3ER0A 1WHHA 1KQ1A 2HD0A 4AFQC 1WGSA 2YWWA 2FRYA 1MUZA 2SRCA 3HRUA 4YTLA 3CC4T 3UDCA 3VS4A 1RI9A 1KHIA 5KH6A 3L2QA 1AD5A 3QUIA 5FWBA 3I55T 3THKA 2C0OA 1G3SA 2QDLA 1OX8A 3CPWP 2HQXA 2GQVA 3NTHA 4R0KA 2FPFA 2KRMA 4E7KA 1UEBA 4QT7A 5CAIA 3CCUQ 4C92C 1VQLQ 2V1RA 2X4XA 2CT4A 2QG9B 3VS1A 1PRLC 4EMGA 3BDUA 2XKOC 3OYJA 2CP3A 3SHWA 2K2MA 3CMET 3CCUA 3CCJT 4PK4A 1QVGS 2DKGA 4FU6A 1E6GA 2F2WA 2XG8D 3EFSA 2NUTA 4BDZA 1NPPA 1SSHA 2PZ1A 1XNIA 1YWPA 2DJQA 2DXBA 3CCEQ 2D8HA 3P8HA 2DTOA 1WQWA 2LCSA 4PNOA 2E64A 2QTXA 4KT0E 1UHCA 3CC2Q 1K9AA 2V26A 1M5Q1 1M3BA 4MDWA 4LDVA 3OW2S 4NOYA 3EG9B 5GANj 4C8QE 3QG1A 3SWNB 4E47A 4OMQA 5GMKh 4QVDA 2AKLA 1MMGA 5CKDA 3OBWA 1FMKA 4JRIA 4CC7A 2QQRA 1AHJB 3G6EA 2KAFA 1I4K1 3LWHA 2EW3A 1JU5C 3VU3C 2KNBB 2JW4A 3ULRB 2DIQA 2EYXA 2RI5A 4GLKA 2OX7A 1WXBA 4ATOA 1M3CA 1S1NA 2V8IA 4IUUA 5CO7A 2YSQA 4L5GA 3OYDA 1M2VA 1SF9A 2COYA 2IIMA 1D1CA 1RABB 2D8JA 4M7DC 3VJPA 2DZ9A 3OMGA 1R0CB 3G1JA 2RH2A 1I81A 4F17A 3R6OA 2DEUA 3CCJQ 3OSVA 3CCLQ 4M77F 4RCCA 5CKHA 1T0HA 3QWYA 4RTYA 2L0AA 5CR2A 1Q82C 2XMFA 3L2VA 8AT1B 2HCKA 3BE3A 4PL6A 1R77A 2EGEA 5A0GA 3DB4A 3CXCP 3CBPA 1I1JA 4II1A 5GMKe 4LDUA 3MEAA 3MJXA 5GANe 4C92B 2L3RA 2AKKA 4PFZA 3BFMA 3X28B 1BI0A 1S72Q 2LX9A 2OTLT 3A8LB 2JTMA 2K3YA 3KXTA 3HFOA 4C8QD 2MPXC 4C92G 5FU7B 2LT1A 3CMAT 3LH5A 2EWNA 4ESRA 1Q86C 1YBYA 1PM3A 1JRIA 4LUEA 2E5QA 3PNWC 1T3SA 1QP3A 3L2WA 1BU1A 4E6RA 2FZCB 4E7JA 1M3AA 2NWMA 3NPFA 2BKDN 2MIOA 3PE0A 4C8QC 1WFWA 1NM7A 1Q95G 2AK5A 2EVRA 3QDRB 3RKYA 2R58A 3MEWA 1Q82R 1BCOA 2CH4W 3CXCS 3G4SQ 2KGTA 4C92D 1M2VB 3M0TA 4XK8E 1OQKA 2LQKA 1K76A 5IN1A 1OU8A 4N0AC 3M4YA 1Y07A 2PQWA 1U06A 4LDYA 1CKBA 1OI1A 3JCMh 1D3BA 5LJ3e 5KYXA 1ZUYA 2K9GA 2LTOA 4X1VA 2J6FA 3CQTA 4Z02A 1VQ5T 1SG5A 2EJ9A 1NJIR 1XOVA 1WHJA 2IG0A 1KC8R 2FEIA 4JS5A 1M1KU 1VQ7T 1ARKA 1YJWQ 2CZ1B 4M7AG 4QKUA 4OB1B 1Y57A 1UHFA 2VKNA 2DZCA 1N8RC 1KK7A 4OP0A 4M78A 2QEXA 3CC4A 4V2SA 3G71Q 1AOJA 3O8VA 1JJ2A 4M4ZA 1B07A 4OMFB 2WSFE 2CZ7B 1HSQA 2KDSA 1AWOA 2H3JA 1KD1U 1D1AA 3QHSA 4IKFA 1MGQA 1GXIE 1QCFA 2DPPB 2HZYA 2KXDA 2DTHA 3CMEA 4RCBA 3CCVQ 1S72T 2CUDA 1PSEA 2OTLQ 1RAGB 5A0DA 4KGVB 3TVTA 5L8RE 1WZOA 4C5HA 3JB9D 1BI3A 3BY7A 4BD3A 2O31A 1MHNA 1PSFA 5D6YA 1BYMA 3CCUT 1M8MA 1VQKA 4AFUC 2E1HA 4M77A 1KC8C 4XTYA 1GBQA 3CMAA 1K4US 1BB9A 2EQKA 2CP6A 4PFOA 1UGVA 3V8JA 1Y7XA 3URGA 3ZBDA 2YUNA 1VQOT 5EC7A 2EYYA 1YN8A 4NL2A 2RQRA 2RMOA 1QWEA 2JOYA 4Z89A 2ZPGB 3M0UA 1NYGA 2KVQG 2VWFA 1WA7A 4A4GA 4XQ3A 1UE9A 3OYEA 2P4TA 1M90R 2BUDA 2L5QA 4MZPA 4LD6A 2Z0WA 4M75D 1NLOC 1U1TA 2HDAA 1H641 3WVDB 3WVEB 2XD0A 3CBOA 1G5VA 4DBFA 1YITA 4OMOA 3S3MA 1W4SA 3HPWA 1Q7YC 3L2ZA 3M0SA 1Y71A 3CC7A 3PMIA 4JJDA 2GCXA 1WPYA 4M75F 3MHXA 3FC3A 3TREA 3SFMA 1NPRA 2GBQA 2HQEA 4FYVB 4X9CA 2M16A 2FHDA 3RNJA 1RACB 5HK0A 1N6AA 2ROLA 3SWNC 4LD9K 1RAAB 2EQIA 3CXCA 1Q81U 2OTJQ 2OJ2A 2P0QA 4XU3A 1QVFA 3VV0A 2E5KA 1MV0B 1SHGA 3NTKA 1D0ZA 2LQWA 2PVGB 2PTKA 2YRDA 3NHNA 4EDUA 4A54A 2R57A 3EGUA 1KD1C 4M75B 3EG9A 1VIEA 2OI3A 5LJ3h 1YJNT 2OTLA 2ESWA 4MZMA 1H92A 3LW5E 4HCZA 1KIKA 2A3LA 1VQ9T 1G3WA 1TTHB 5LJ5h 4E7IA 3JV3A 5DY9A 3ME9A 3OB9A 3S6WA 4J9HA 2XIDA 2AZVA 4JLIA 2LRQA 1D1BA 6AT1B 5LJ3g 1ACMB 4C8QG 1VQ8T 4ZN1A 2DF6A 1TG0A 2SEMA 3E1SA 1HYOA 3DLLA 4OF1A 1AZGB 2LDMA 4HVUA 5KYWA 3CC2A 1UJYA 1V76A 1QW1A 2ZZDA 2EQMA 1QCNA 1X75C 3MEUA 3NFCA 2OTJA 1GCQA 5IXBA 3JSCA 1ZSZB 2O9VA 3HFNA 4M77G 1TU0B 1GFCA 3QO3A 5D6XA 1BI2A 1K73U 2RJEA 3OW2P 2COWA 2K4YA 4M77E 1GBRA 1G3TA 3I56A 4JLGA 4OGCA 5IXFA 2GTOA 4FYWB 1HD3A 2RI3A 5GAOl 3FB9A 2RPNA 1RAEB 2KK4A 1YHQA 2CDTA 5GJWB 3JB9I 2O9SA 4ZGJB 4CI0C 4C8QF 3I5RA 4DQ2A 2YUPA 1YHQT 3LGFA 3JRZA 2Y4XA 3M55A 4LDWA 3CC7T 2DL8A 2L3SA 1YIJT 3QYHB 3PIOA 4EMHA 2DXUA 3TU4K 1SPKA 5C6SA 2M02A 1ZSZA 4KUDK 4OMMA 3INZA 2FG0A 2KRSA 3OYGA 1OPLA 2RK2A 3G4ST 2CP2A 1D0YA 3EFOA 1H3HA 5GAN4 1T0JA 2ZPIB 4ME7A 2HL5C 4AG2C 4PJOB 5KYXB 5GAMh 2ZPBB 3I56Q 1XTDA 1YHQQ 1WXUA 1W6XA 1PKSA 2F2XA 3GF5A 1BI1A 1MMNA 3DKMA 5I22A 1CSKA 1NYFA 1F1BB 5J39A 4BI8B 2HMAA 1ZUKA 4A53A 3A8OB 2DVJA 3OYYA 5GAN2 3UWNA 4PJOC 1WHKA 2ZAEA 2FPEA
chains in the Genus database with same CATH topology
2D8JA 2EGCA 3REAB 1ZUUA 2DBMA 4F17A 1HJDA 1BBZA 1YNZA 2DL7A 1W70A 5HCKA 3EG0A 2BTTA 1H8KA 2RNAA 4JZ4A 1UFFA 4KRTA 2LJ1A 1T0HA 2EPDA 1RLPC 3QWYA 1Y0MA 1WDXA 2L0AA 2LQNA 4RTYA 2XMFA 4IIOA 2DL4A 2DA9A 2HCKA 4JPBW 3EHRA 4OMPA 2GGRA 2EGEA 3TSWA 1PHTA 1OV3A 1GCQC 1VYTA 3PVLA 1I1JA 2JS0A 1OPKA 5GJVB 1AWWA 3IQLA 2LX7A 2DRMA 1RLQC 4J9BA 1ZLMA 2AKKA 5ECAA 2A36A 1T3LA 2RQTA 1X69A 1JXOA 3I35A 2CSIA 3LH5A 3U23A 2J6OA 1X2QA 4DEYA 4ESRA 3QWXX 2J06A 1PRMC 4LUEA 1T3SA 1BU1A 1LCKA 1UTIA 4E6RA 2X3WD 1M3AA 2NWMA 3NPFA 2MIOA 3PE0A 2RN8A 1WYXA 1CKAA 1WFWA 1NM7A 2AK5A 2FRWA 5L23A 2EVRA 1TUDA 1K0XA 1AWXA 4RTUA 2EYZA 4WCIA 4HVVA 1X43A 2ECZA 4J9CA 4LNPA 3RBBB 2CH4W 1KSWA 3C0CA 2KGTA 2KXCA 3M0TA 2O2OA 1K76A 2C0TA 1FYNA 1VYVA 1AEYA 1JQQA 1X6BA 2ROTA 2JMCA 1NLPC 2D1XA 1QKXA 4HCKA 3PVQA 4ZNXA 1U06A 1YWOA 2BZYA 1CKBA 2RQUA 1WLPB 4LUDA 2K7AA 1ZUYA 2DBKA 2LNHB 2K9GA 2W0ZA 5FW9A 4J9GA 2DE0X 4X1VA 2J6FA 2JM9A 2K6DA 3CQTA 3O5ZA 1U5SA 2P4RA 2FO0A 4HXJA 1XOVA 1X2KA 2ABLA 2L2PA 1U3OA 3A98A 2FEIA 2DNUA 4RUGA 4J9DA 1ARKA 3VRYA 2G6FX 1Y57A 3VS3A 2KE9A 2YDLA 2DRKA 1UHFA 2DLPA 2EKHA 2VKNA 2CH4A 1AZEA 2F2VA 2BZXA 1K0SA 4DEXA 2DILA 1AOJA 2CSQA 1IO6A 1OOTA 4M4ZA 2YUQA 1B07A 1VA7A 3M0PA 1HSQA 2LJ0A 1AWOA 1GCPA 2O88A 4RTZA 3I9QA 1QCFA 2KXDA 1K1ZA 1NEGA 1G2BA 2CUDA 5IH2A 2EBPA 3TVTA 2OAWA 4FSSA 5IHKA 2I0NA 2M0YA 2KBTA 1UG1A 2VVKA 1I0CA 2O31A 2W10A 2ED0A 3VRZA 2BZ8A 1M8MA 1VYUA 4AFUC 3R6NA 1EFNA 1RUWA 4RTVA 3EG2A 1GBQA 3H41A 1QLYA 4GLMA 4D8DA 1YP5A 3TSZA 2GTJA 1K4US 1BB9A 2L3QA 1UGVA 5IHIA 4Y92A 3UA7A 1OEBA 2KYMA 1QKWA 1NEBA 1QWFA 2CT3A 1J3TA 2YUNA 4LN2A 5EC7A 2EYYA 3REBB 1YN8A 4AG1C 2K79A 2RQRA 2RQVA 2RMOA 1QWEA 4Z89A 3VS2A 4GBQA 1M30A 3M0UA 1NYGA 2VWFA 2YUOA 1WA7A 2GNCA 1UE9A 1BK2A 2A08A 2ENMA 3UF4A 2DYBA 4J9IA 3NMZC 1WXTA 4D8KA 1W1FA 1X27A 4J9FA 1NLOC 3UA6A 2JM8A 1WIEA 2HDAA 1UUEA 2KR3A 4OMOA 2LJ3A 2JTEA 3M0SA 4JJDA 5I11A 2DL5A 3FJ5A 4CC3A 2KYBA 1E7OA 1N5ZA 4CC4B 2C0IA 2KT8A 2GBQA 2DL3A 2LMJA 2FPDA 1G83A 3M0RA 4OMNA 3RNJA 3VS5A 1PNJA 4HVWA 4JJCA 2L3PA 4A63B 1SEMA 2HBWA 2ROLA 1NG2A 3UATA 2EQIA 2OJ2A 3NGPA 1AWJA 2KEAA 4IIMA 2E5KA 1MV0B 1WI7A 1SHGA 2DX1A 1KJWA 2LQWA 1E6HA 2PTKA 2GQIA 3NHNA 2A28A 3EGUA 3M0QA 3KFVA 3EG3A 4F16A 4J9EA 2OI3A 2PNIA 2CREA 1JEGA 1YCSB 4JZ3A 3EHQA 3GBQA 2ESWA 1H92A 4AFQC 3VS6A 1KIKA 2DMOA 1I07A 3H0IA 4AFSC 2YT6A 2FRYA 3JV3A 1MUZA 2SRCA 1TUCA 1UJ0A 1ZSGA 2X3XD 4J9HA 2MOXA 2AZVA 3VS4A 1AVZC 2JXBA 1RI9A 3ZL7C 1AD5A 2DF6A 1TG0A 2CUBA 2NUZA 2SEMA 5FWBA 4F14A 3THKA 2C0OA 2QDLA 1AZGB 4LE9A 1ABQA 4HVUA 2JMAA 2LP5A 1UJYA 4R0KA 2FPFA 1JO8A 1GL5A 2ED1A 2KRMA 4JJBA 4QT7A 1GCQA 4K11A 5IHNA 2RQWA 5IXBA 2V1RA 2CT4A 2O9VA 2J05A 2JS2A 1GFCA 1ABOA 3VS1A 1PRLC 3SEMA 1GBRA 3SHWA 2K2MA 3H0HA 4RTTA 1PKTA 2DM1A 2M51A 2J6KA 1E6GA 1UECA 2F2WA 5IXFA 2D0NA 2V1QA 2GTOA 2MCNA 1HD3A 1Z9ZA 1SSHA 1V1CA 2RPNA 2CDTA 2EYWA 2PZ1A 5GJWB 1SRLA 1YWPA 1M27C 1UDLA 1SHFA 2DJQA 2H8HA 2D8HA 2O9SA 3EG1A 1ZBJA 4ORZA 2A37A 2KRNA 3I5SA 4CC2A 3I5RA 3VS7A 2YUPA 2LCSA 1ZX6A 4Z88A 2KROA 1UHCA 2JT4A 2HEQA 1K9AA 1GFDA 2DL8A 1M3BA 2EGAA 2L3SA 4Z8AA 2HSPA 1SPKA 4OMMA 2AZSA 2FG0A 2KRSA 4EIKA 1OPLA 1Z9QA 4OMQA 1X6GA 4RTXA 1H3HA 2AKLA 1MV3A 2B86A 2K3BA 1FMKA 2KT1A 1T0JA 1PWTA 4AG2C 2J7IA 4CC7A 3H0FA 1A0NB 1KFZA 1WX6A 1SRMA 2RF0A 2EW3A 1JU5C 2KNBB 2JW4A 1WXUA 1W6XA 3ULRB 1JXMA 2EYXA 1PKSA 2F2XA 1WXBA 4AFZC 5I22A 4OMLA 1CSKA 1NYFA 1M3CA 1S1NA 2LZ6B 1GRIA 1ZUKA 5FWCA 2DVJA 2YSQA 4RTWA 1B3QA 3VS0A 2FPEA 2IIMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D8J A;  2EGC A;  3REA B;  1ZUU A;  2DBM A;  4F17 A;  1HJD A;  1BBZ A;  1YNZ A;  2DL7 A;  1W70 A;  5HCK A;  3EG0 A;  2BTT A;  1H8K A;  2RNA A;  4JZ4 A;  1UFF A;  4KRT A;  2LJ1 A;  1T0H A;  2EPD A;  1RLP C;  3QWY A;  1Y0M A;  1WDX A;  2L0A A;  2LQN A;  4RTY A;  2XMF A;  4IIO A;  2DL4 A;  2DA9 A;  2HCK A;  4JPB W;  3EHR A;  4OMP A;  2GGR A;  2EGE A;  3TSW A;  1PHT A;  1OV3 A;  1GCQ C;  1VYT A;  3PVL A;  1I1J A;  2JS0 A;  1OPK A;  5GJV B;  1AWW A;  3IQL A;  2LX7 A;  2DRM A;  1RLQ C;  4J9B A;  1ZLM A;  2AKK A;  5ECA A;  2A36 A;  1T3L A;  2RQT A;  1X69 A;  1JXO A;  3I35 A;  2CSI A;  3LH5 A;  3U23 A;  2J6O A;  1X2Q A;  4DEY A;  4ESR A;  3QWX X;  2J06 A;  1PRM C;  4LUE A;  1T3S A;  1BU1 A;  1LCK A;  1UTI A;  4E6R A;  2X3W D;  1M3A A;  2NWM A;  3NPF A;  2MIO A;  3PE0 A;  2RN8 A;  1WYX A;  1CKA A;  1WFW A;  1NM7 A;  2AK5 A;  2FRW A;  5L23 A;  2EVR A;  1TUD A;  1K0X A;  1AWX A;  4RTU A;  2EYZ A;  4WCI A;  4HVV A;  1X43 A;  2ECZ A;  4J9C A;  4LNP A;  3RBB B;  2CH4 W;  1KSW A;  3C0C A;  2KGT A;  2KXC A;  3M0T A;  2O2O A;  1K76 A;  2C0T A;  1FYN A;  1VYV A;  1AEY A;  1JQQ A;  1X6B A;  2ROT A;  2JMC A;  1NLP C;  2D1X A;  1QKX A;  4HCK A;  3PVQ A;  4ZNX A;  1U06 A;  1YWO A;  2BZY A;  1CKB A;  2RQU A;  1WLP B;  4LUD A;  2K7A A;  1ZUY A;  2DBK A;  2LNH B;  2K9G A;  2W0Z A;  5FW9 A;  4J9G A;  2DE0 X;  4X1V A;  2J6F A;  2JM9 A;  2K6D A;  3CQT A;  3O5Z A;  1U5S A;  2P4R A;  2FO0 A;  4HXJ A;  1XOV A;  1X2K A;  2ABL A;  2L2P A;  1U3O A;  3A98 A;  2FEI A;  2DNU A;  4RUG A;  4J9D A;  1ARK A;  3VRY A;  2G6F X;  1Y57 A;  3VS3 A;  2KE9 A;  2YDL A;  2DRK A;  1UHF A;  2DLP A;  2EKH A;  2VKN A;  2CH4 A;  1AZE A;  2F2V A;  2BZX A;  1K0S A;  4DEX A;  2DIL A;  1AOJ A;  2CSQ A;  1IO6 A;  1OOT A;  4M4Z A;  2YUQ A;  1B07 A;  1VA7 A;  3M0P A;  1HSQ A;  2LJ0 A;  1AWO A;  1GCP A;  2O88 A;  4RTZ A;  3I9Q A;  1QCF A;  2KXD A;  1K1Z A;  1NEG A;  1G2B A;  2CUD A;  5IH2 A;  2EBP A;  3TVT A;  2OAW A;  4FSS A;  5IHK A;  2I0N A;  2M0Y A;  2KBT A;  1UG1 A;  2VVK A;  1I0C A;  2O31 A;  2W10 A;  2ED0 A;  3VRZ A;  2BZ8 A;  1M8M A;  1VYU A;  4AFU C;  3R6N A;  1EFN A;  1RUW A;  4RTV A;  3EG2 A;  1GBQ A;  3H41 A;  1QLY A;  4GLM A;  4D8D A;  1YP5 A;  3TSZ A;  2GTJ A;  1K4U S;  1BB9 A;  2L3Q A;  1UGV A;  5IHI A;  4Y92 A;  3UA7 A;  1OEB A;  2KYM A;  1QKW A;  1NEB A;  1QWF A;  2CT3 A;  1J3T A;  2YUN A;  4LN2 A;  5EC7 A;  2EYY A;  3REB B;  1YN8 A;  4AG1 C;  2K79 A;  2RQR A;  2RQV A;  2RMO A;  1QWE A;  4Z89 A;  3VS2 A;  4GBQ A;  1M30 A;  3M0U A;  1NYG A;  2VWF A;  2YUO A;  1WA7 A;  2GNC A;  1UE9 A;  1BK2 A;  2A08 A;  2ENM A;  3UF4 A;  2DYB A;  4J9I A;  3NMZ C;  1WXT A;  4D8K A;  1W1F A;  1X27 A;  4J9F A;  1NLO C;  3UA6 A;  2JM8 A;  1WIE A;  2HDA A;  1UUE A;  2KR3 A;  4OMO A;  2LJ3 A;  2JTE A;  3M0S A;  4JJD A;  5I11 A;  2DL5 A;  3FJ5 A;  4CC3 A;  2KYB A;  1E7O A;  1N5Z A;  4CC4 B;  2C0I A;  2KT8 A;  2GBQ A;  2DL3 A;  2LMJ A;  2FPD A;  1G83 A;  3M0R A;  4OMN A;  3RNJ A;  3VS5 A;  1PNJ A;  4HVW A;  4JJC A;  2L3P A;  4A63 B;  1SEM A;  2HBW A;  2ROL A;  1NG2 A;  3UAT A;  2EQI A;  2OJ2 A;  3NGP A;  1AWJ A;  2KEA A;  4IIM A;  2E5K A;  1MV0 B;  1WI7 A;  1SHG A;  2DX1 A;  1KJW A;  2LQW A;  1E6H A;  2PTK A;  2GQI A;  3NHN A;  2A28 A;  3EGU A;  3M0Q A;  3KFV A;  3EG3 A;  4F16 A;  4J9E A;  2OI3 A;  2PNI A;  2CRE A;  1JEG A;  1YCS B;  4JZ3 A;  3EHQ A;  3GBQ A;  2ESW A;  1H92 A;  4AFQ C;  3VS6 A;  1KIK A;  2DMO A;  1I07 A;  3H0I A;  4AFS C;  2YT6 A;  2FRY A;  3JV3 A;  1MUZ A;  2SRC A;  1TUC A;  1UJ0 A;  1ZSG A;  2X3X D;  4J9H A;  2MOX A;  2AZV A;  3VS4 A;  1AVZ C;  2JXB A;  1RI9 A;  3ZL7 C;  1AD5 A;  2DF6 A;  1TG0 A;  2CUB A;  2NUZ A;  2SEM A;  5FWB A;  4F14 A;  3THK A;  2C0O A;  2QDL A;  1AZG B;  4LE9 A;  1ABQ A;  4HVU A;  2JMA A;  2LP5 A;  1UJY A;  4R0K A;  2FPF A;  1JO8 A;  1GL5 A;  2ED1 A;  2KRM A;  4JJB A;  4QT7 A;  1GCQ A;  4K11 A;  5IHN A;  2RQW A;  5IXB A;  2V1R A;  2CT4 A;  2O9V A;  2J05 A;  2JS2 A;  1GFC A;  1ABO A;  3VS1 A;  1PRL C;  3SEM A;  1GBR A;  3SHW A;  2K2M A;  3H0H A;  4RTT A;  1PKT A;  2DM1 A;  2M51 A;  2J6K A;  1E6G A;  1UEC A;  2F2W A;  5IXF A;  2D0N A;  2V1Q A;  2GTO A;  2MCN A;  1HD3 A;  1Z9Z A;  1SSH A;  1V1C A;  2RPN A;  2CDT A;  2EYW A;  2PZ1 A;  5GJW B;  1SRL A;  1YWP A;  1M27 C;  1UDL A;  1SHF A;  2DJQ A;  2H8H A;  2D8H A;  2O9S A;  3EG1 A;  1ZBJ A;  4ORZ A;  2A37 A;  2KRN A;  3I5S A;  4CC2 A;  3I5R A;  3VS7 A;  2YUP A;  2LCS A;  1ZX6 A;  4Z88 A;  2KRO A;  1UHC A;  2JT4 A;  2HEQ A;  1K9A A;  1GFD A;  2DL8 A;  1M3B A;  2EGA A;  2L3S A;  4Z8A A;  2HSP A;  1SPK A;  4OMM A;  2AZS A;  2FG0 A;  2KRS A;  4EIK A;  1OPL A;  1Z9Q A;  4OMQ A;  1X6G A;  4RTX A;  1H3H A;  2AKL A;  1MV3 A;  2B86 A;  2K3B A;  1FMK A;  2KT1 A;  1T0J A;  1PWT A;  4AG2 C;  2J7I A;  4CC7 A;  3H0F A;  1A0N B;  1KFZ A;  1WX6 A;  1SRM A;  2RF0 A;  2EW3 A;  1JU5 C;  2KNB B;  2JW4 A;  1WXU A;  1W6X A;  3ULR B;  1JXM A;  2EYX A;  1PKS A;  2F2X A;  1WXB A;  4AFZ C;  5I22 A;  4OML A;  1CSK A;  1NYF A;  1M3C A;  1S1N A;  2LZ6 B;  1GRI A;  1ZUK A;  5FWC A;  2DVJ A;  2YSQ A;  4RTW A;  1B3Q A;  3VS0 A;  2FPE A;  2IIM A; 
#chains in the Genus database with same CATH topology
 1FXX A;  3CD6 T;  1LJO A;  4FCY A;  4M7D A;  3OA6 A;  3SD4 A;  3REA B;  2E4H A;  1X6O A;  1PG5 B;  1YNZ A;  2MMP A;  3RMS A;  2PUO B;  1MND A;  3A8H B;  1H8K A;  5FRN A;  2RNA A;  5KCH A;  2Y4Y A;  3M4G A;  4BI4 A;  1RLP C;  1Y0M A;  1WDX A;  5GAN 5;  4IIO A;  4ELY C;  4JPB W;  5LJ5 d;  2GGR A;  3TSW A;  1M2O A;  2X4J A;  1VQM T;  3E9F A;  4BI3 A;  3LX7 A;  3C94 A;  3UPU A;  3TEE A;  1OPK A;  1SSF A;  5GJV B;  4IUP A;  2LX7 A;  3H6Z A;  2DRM A;  4J9B A;  5KCO A;  2A7Y A;  1ZLM A;  1ZSZ C;  2RA2 A;  1R8O B;  5CVI A;  2IVW A;  3MEV A;  5HK3 A;  3X20 B;  1UGS B;  3HRT A;  1YIT T;  1HXD A;  2DXC A;  5J3B A;  1R0B G;  1X2Q A;  4DEY A;  4M77 C;  3QWX X;  4J83 A;  2J06 A;  2HSE B;  4ZGE B;  2FYK A;  1I5L A;  3GNG A;  2X3W D;  1LNX A;  1O75 A;  3E19 A;  1BKB A;  1VQN T;  1TUD A;  1AWX A;  2V8K A;  2COZ A;  1LVK A;  4KUI A;  4JRK A;  4E2F B;  3RBB B;  1KSW A;  3RDV A;  2O2O A;  3MET A;  5GMK j;  2JTF A;  1FYN A;  1X6B A;  2ROT A;  4M7D D;  2DAQ A;  2JMC A;  1VQ7 A;  3FJP A;  4HCK A;  2L8D A;  5D6W A;  3CCE T;  2RQU A;  3F70 A;  4XTV A;  3GNF B;  3CMA Q;  3GP8 A;  1WQ7 A;  2W0Z A;  5FW9 A;  2X35 A;  2DE0 X;  1PD0 A;  5GAM d;  3O5Z A;  4O5V A;  2F5T X;  3OYC A;  2FO0 A;  4HXJ A;  1C1A A;  4KH0 B;  2QAZ A;  2L2P A;  3RKW A;  1H3Z A;  4RKU E;  4M7D G;  4M78 B;  2V8J A;  2L89 A;  3VS3 A;  2KE9 A;  3VKI A;  2PU9 B;  2HNI A;  2CH4 A;  2K5I A;  2FB7 A;  5GAN 8;  3FRN A;  2DIL A;  1IXD A;  2MK5 A;  1IO6 A;  1OOT A;  5KYY B;  2YUQ A;  2O4X A;  1M90 C;  3M0P A;  1W2B A;  3CME Q;  4XAX B;  3CC4 Q;  1K1Z A;  2QEX Q;  1NEG A;  4J7F A;  1KQS A;  4RG2 A;  4R56 A;  2MF2 A;  2VXF A;  1UGQ B;  4HCC A;  3X26 B;  3CCS T;  2MYS A;  2KQW A;  1C6V X;  2KY9 A;  3LYI A;  4E7H A;  2DEQ A;  2I0N A;  1NBE B;  2EQJ A;  2M0Y A;  5AT1 B;  2KBT A;  5CKB A;  4PJN A;  3JCM e;  2ED0 A;  3QXE B;  2XI9 A;  1UGP B;  2BZ8 A;  4JJN K;  1VYU A;  4D6W A;  2R5A A;  4J7I A;  1EFN A;  2K3X A;  3CCM T;  4RTV A;  5KYW B;  3EG2 A;  3M56 A;  1QLY A;  1N8R U;  3OW2 A;  3G7Z A;  3TSZ A;  2L3Q A;  1OU9 A;  4Y92 A;  3UA7 A;  1YJW T;  1OEB A;  2KYM A;  3QBY A;  3EH2 A;  2MAM A;  3OYF A;  3D7S B;  2RJD A;  1K8A C;  2F1L A;  1K9M U;  7AT1 B;  4FT4 A;  5GMK i;  1YIJ Q;  4GBQ A;  2CKK A;  4C0D B;  1ZQ1 A;  5FU6 B;  3L1A A;  1NJI U;  3QII A;  4UC4 A;  4QQG A;  1BK2 A;  5I2S A;  4X34 A;  4N4H A;  4F7U E;  1EIF A;  3UF4 A;  4J9I A;  3CC7 Q;  4M7A A;  3OMC A;  4D8K A;  4J9F A;  2QA4 T;  1IHV A;  1AT1 B;  2JM8 A;  2FZK B;  4F7U B;  5DM7 R;  1BIA A;  3WXM B;  1QVF P;  3A5Z B;  3PT9 A;  2XDD A;  1C0M A;  3FIF A;  3H8Z A;  2QA4 A;  2VV5 A;  1VQP T;  4EMK A;  3FJ5 A;  4CC3 A;  4AT1 B;  1EX4 A;  1E7O A;  1N5Z A;  4HA8 A;  2DYI A;  2C0I A;  5GAN h;  3EH1 A;  1FMV A;  4A4E A;  2K5L A;  2ATC B;  3AHU A;  1PNJ A;  4JJC A;  4C0Z A;  1TSF A;  3UAT A;  3S3O A;  1FMW A;  3CD6 A;  1AWJ A;  1WI7 A;  1Q7Y U;  4M7D E;  2QK0 A;  4E7S A;  1QVG P;  2GQI A;  4M78 C;  1K8A R;  3CCV A;  3KFV A;  2QQB A;  2XU8 A;  1JEG A;  3E9G A;  3EHQ A;  4ZN3 A;  3KUF A;  1U1S A;  3OYH A;  1MMA A;  3BDL A;  4NS5 A;  1NE8 A;  3BW1 A;  3H0I A;  1YJN Q;  4M77 D;  1VQ6 Q;  1TUC A;  1UJ0 A;  2LNV A;  3OYN A;  4R55 A;  4TVR A;  2MOX A;  2JXB A;  1VQM A;  2WAC A;  2DK3 A;  5LJ3 f;  4F14 A;  1OUL A;  1ZA1 B;  3CBM A;  5I21 A;  2WSC E;  1ABQ A;  3E2U A;  2JMA A;  2LP5 A;  2NUP B;  1JO8 A;  1GL5 A;  3EFO B;  1YI2 T;  1VUB A;  2A0F B;  4K11 A;  3CCM A;  2J05 A;  3QZ9 B;  2GFA A;  2DVE A;  5GAN 7;  2GF7 A;  4EMK B;  3H0H A;  3PTA A;  4RTT A;  1PKT A;  2DM1 A;  5M9O A;  1TOV A;  3OYM A;  1UEC A;  2V1Q A;  4BDY A;  2MCN A;  1IGU A;  5AYF A;  3QZ5 B;  2LT4 A;  1SRL A;  3OY9 A;  2HKN A;  1WHG A;  1YI2 Q;  3EG1 A;  1VQ6 A;  2NLU A;  1ZBJ A;  4ORZ A;  2RHY A;  2PVD B;  1Q81 R;  2A37 A;  3CCR Q;  4Z88 A;  2KRO A;  2JT4 A;  4L6V 5;  2HEQ A;  1K73 C;  5KYU A;  1Q86 R;  2P84 A;  1YJN A;  1VQ9 A;  2E3H A;  2HSP A;  2RD1 A;  3OYA A;  2CZ0 B;  2AZS A;  4M75 E;  1IRX A;  2X4Y A;  1YJ9 Q;  5GAN f;  1X6G A;  4RTX A;  2RO0 A;  1VQ8 A;  2K3B A;  1TXQ A;  1VQO Q;  3CD6 Q;  2KT1 A;  1NZ9 A;  2PUK B;  1A0N B;  1SRM A;  3HP9 A;  5GAM f;  3RMQ A;  1P92 A;  5HY6 A;  2ZGW A;  1K8A U;  4F7U F;  5GAO r;  1PCX A;  1XQH A;  3EGD A;  2HKQ B;  3JB9 J;  1TH7 A;  2RM4 A;  4OML A;  1GRI A;  5DLQ E;  4DA4 A;  2VB6 A;  2QA4 Q;  5FWC A;  4RTW A;  3V7C A;  1B3Q A;  3VS0 A;  4IUT A;  3HHT B;  2KSS A;  2DD5 A;  2E41 A;  1JXO A;  2RHZ A;  3V8L A;  2JN0 A;  5LJ3 d;  2WSE E;  2EGC A;  2VYT A;  3MP8 A;  3C95 A;  3G71 T;  1BBZ A;  1VQN Q;  2K57 A;  1YJ9 A;  5HCK A;  4M75 C;  5LJ5 j;  2EJF A;  4X9D A;  2BTT A;  2NYS A;  1UFF A;  3MP1 A;  1W2B P;  4E7Z A;  2EPD A;  1V29 B;  4P5N A;  3JCM c;  2CS7 A;  2DL4 A;  2DA9 A;  2DIG A;  4OMP A;  2RJC A;  2OAU A;  1PHT A;  1ZBX A;  1OV3 A;  4BY6 C;  1YIJ A;  1GCQ C;  3CCL A;  1EZZ B;  1VYT A;  1IHW A;  1G3Y A;  3L2U A;  2VUB A;  1B7T A;  4FW2 A;  2FL7 A;  4PJO A;  1RLQ C;  1RI0 A;  3CPF A;  3T9N A;  1U8R A;  3JCM P;  4M7D B;  4PLI A;  1DJ7 B;  2A36 A;  1T3L A;  2QQS A;  2JVV A;  3Q1J A;  3CCM Q;  2DXT A;  2LCC A;  5FLX E;  3JB9 G;  3I35 A;  4EPC A;  2CSI A;  1B34 A;  3RER A;  1X01 A;  1VQP A;  2FVU A;  3N5B B;  2H3E B;  2R5M A;  2IPO B;  2RHU A;  3J80 E;  1IZ6 A;  1LCK A;  2YLB A;  2QAS A;  3V7R A;  5GAN 3;  3OS0 A;  3M53 A;  4XU1 A;  2RN8 A;  1WYX A;  2VXE A;  4M7D F;  2EQU A;  4M78 D;  2FRW A;  1VQM Q;  2JZ2 A;  4BAC A;  4RTU A;  2ZPH B;  2BE7 D;  5I2M A;  4WCI A;  4HVV A;  3JCM X;  4M75 G;  3CPW A;  4J9C A;  4LNP A;  1YCY A;  5LJ5 g;  1QVG A;  2P0K A;  4KBM B;  4JS4 A;  3CCV T;  3QDF A;  5CKE A;  2D1X A;  4A4K A;  1QKX A;  2YHT A;  3PVQ A;  4FW1 A;  2I2L A;  1KD1 R;  4J5Y A;  1WLP B;  3QJ6 A;  2ZPE B;  2EAY A;  3X25 B;  3JB9 F;  2RJF A;  2K7A A;  2DBK A;  5HKC A;  2RK1 A;  3H9N A;  1WJR A;  4C5I A;  5CQY A;  4KGZ B;  1U5S A;  3I55 Q;  1X2K A;  2ABL A;  2XIC A;  1S72 A;  2OTJ T;  2DNU A;  4RUG A;  5GAN 6;  3OYL A;  8ATC B;  2LQ8 A;  2EIF A;  3VRY A;  2LVM A;  2RB6 A;  1QCO A;  4C0D C;  2FZG B;  3JCM V;  4AMC A;  2DLP A;  2EKH A;  1AZE A;  1FX7 A;  1O9S A;  1K0S A;  3P8D A;  4MMK A;  3HTR A;  1VQK T;  2LJ0 A;  2NUT B;  4LXC A;  1WJQ A;  5FRM A;  1VQ4 A;  4C0G A;  4RTZ A;  2ZPF B;  4JRP A;  2EKO A;  2X9H A;  4PJO F;  5IH2 A;  2EBP A;  4C5E A;  2OAW A;  3A1P A;  4QVC A;  1ZA2 B;  3HRS A;  5IHK A;  2DO3 A;  3OSS C;  1M4Z A;  1UG1 A;  1M1F A;  3VUB A;  2VVK A;  2LCL A;  2QI2 A;  2DER A;  1VQK Q;  4FSX A;  2QYZ A;  3JCM J;  3VRZ A;  3OYI A;  2EJG A;  1BIB A;  2O01 E;  4L59 A;  1VOM A;  4QW2 A;  2F69 A;  4BE1 A;  3H41 A;  4GLM A;  4PJM A;  4J6W A;  4LDX A;  1KQS S;  1QKW A;  3CCQ Q;  1KHC A;  1IRE B;  4AG1 C;  1Q86 U;  3LH0 A;  3G6E Q;  2K79 A;  2YLC A;  1JJ2 P;  2RQV A;  1HK9 A;  5IT9 E;  5KE3 A;  5KYU B;  1D0X A;  2YUO A;  2E6Z A;  4C0F A;  4HKE A;  2CP5 A;  2A08 A;  2ENM A;  4M75 A;  1OX9 A;  3NMZ C;  1W1F A;  4FM4 B;  1JBM A;  3UA6 A;  5GAN g;  1WNL A;  1OYX A;  4RG8 A;  3OYK A;  2KR3 A;  2JUF A;  4FYX B;  3GLX A;  5KYN A;  2Y90 A;  2DL5 A;  4C92 E;  5IAY A;  2KYB A;  4WTO B;  1B34 B;  2CP7 A;  2KT8 A;  3J81 E;  1Y96 A;  3AT1 B;  2DL3 A;  5FU6 C;  2LMJ A;  3TCJ A;  1D09 B;  1VQL T;  2FPD A;  3CCQ T;  3M0R A;  3VS5 A;  2E3I A;  1RAI B;  1SEM A;  2HBW A;  1NG2 A;  3G6E T;  2RHX A;  2M1H A;  1SKU B;  2VGM A;  4IIM A;  2KI7 A;  1KJW A;  4B9W A;  4M7A E;  1E6H A;  2AHJ B;  1VQL A;  4WF2 A;  1W2B S;  4DOV A;  3CCL T;  3EG3 A;  4F16 A;  1M1G A;  1G8X A;  2PNI A;  1YCS B;  4DOW A;  1VQN A;  2YRC A;  2KMT A;  1VQ7 Q;  1IB8 A;  3GBQ A;  4QQ6 A;  3OS5 A;  1N8R R;  3GOX A;  3VS6 A;  2DMO A;  1I07 A;  4OB3 B;  4AFS C;  2YT6 A;  4F7U G;  3M5A A;  1VQO A;  4BE0 A;  3GIB A;  1ZSG A;  1QVP A;  4C8Q B;  2X3X D;  1RL2 A;  1AVZ C;  1QMC A;  2EFI A;  3ZL7 C;  1LPL A;  2LC4 A;  2NUP A;  4FT2 A;  2CUB A;  2NUZ A;  2K5F A;  2D9T A;  4M7A F;  5KYY A;  4LE9 A;  2DD4 A;  4HCB A;  2EYQ A;  2ED1 A;  3P8B B;  4JJB A;  5GMK m;  5GAO p;  3EGX A;  4FIB A;  3OBY A;  2XHC A;  5IHN A;  2RQW A;  3CCS Q;  2CGH A;  2JS2 A;  2YRV A;  4IUV A;  3OS1 A;  3NTI A;  1OZ2 A;  1ABO A;  1XJW B;  3SEM A;  1VQ8 Q;  3PFS A;  5EG2 A;  4BY6 B;  1Q81 C;  4QVZ A;  3RR6 A;  4A4H A;  2M51 A;  2J6K A;  4KUL A;  3JCM b;  2D0N A;  4OGE A;  3QSU A;  2MI6 A;  2E65 A;  1VQ5 A;  3VUZ A;  1VQ9 Q;  1Z9Z A;  1I5O B;  1V1C A;  2BE9 B;  4KGX B;  5A0L A;  2EYW A;  1TS9 A;  1M27 C;  1UDL A;  1SHF A;  2H8H A;  1TWB A;  3MPU B;  3SWN A;  2E70 A;  2KRN A;  3I5S A;  4CC2 A;  4Y28 E;  3VS7 A;  1MMD A;  3KBG A;  1ZX6 A;  2VC8 A;  4OVA A;  1Q7Y R;  2HL3 A;  4XU2 A;  1TUG B;  2QDY B;  4IUQ A;  1GFD A;  2EGA A;  4QQD A;  2GFU A;  4Z8A A;  4N4I A;  5LJ5 e;  4EMK C;  4EIK A;  1Z9Q A;  4MDX A;  3LWI A;  3CCQ A;  5CK9 A;  4XTU A;  1MV3 A;  2B86 A;  3EFR A;  2F5K A;  2XDB A;  4GY5 A;  1PWT A;  5LL6 S;  2J7I A;  2MWP A;  3M59 A;  4C92 A;  5GAN d;  3H0F A;  1UGR B;  1KFZ A;  4M78 F;  1WX6 A;  2RF0 A;  4NL3 A;  4XTZ A;  1M9S A;  2CZ6 B;  4MML A;  4JRQ A;  1VQ4 T;  4ELZ C;  1JXM A;  3C12 A;  1YJW A;  2HAX A;  3CCS A;  4AFZ C;  2LZ6 B;  5LJ3 j;  2B8A A;  3MKD A;  4DBR A;  4F04 B;  3EGX B;  4PJL A;  3DB3 A;  4CRI A;  1Q82 U;  4M7A D;  5KE2 A;  1IGQ A;  1WHL A;  1ZUU A;  2DBM A;  3SDZ A;  4F7U A;  1HJD A;  2DL7 A;  1W70 A;  3L42 A;  3MCA B;  5A2Q E;  3EG0 A;  2X4W A;  4JZ4 A;  1KC8 U;  1VQ6 T;  2QXF A;  4KRT A;  2LJ1 A;  4BB7 A;  4B9X A;  3JAM E;  3CCE A;  2LQN A;  4ZGD B;  4PFP A;  3JB9 H;  2AIR B;  4FL6 A;  3EHR A;  5GAM e;  5CIU A;  4N0A A;  3L2R A;  1QP2 A;  3PVL A;  4XTW A;  4IUR A;  3I55 A;  3M57 A;  1M1K R;  2JS0 A;  3RES A;  1AWW A;  1WJS A;  3IQL A;  4BUG A;  3QJY A;  3C4S A;  4Y91 A;  5LJ5 f;  4M78 G;  5ECA A;  4M7A B;  1VIF A;  3JCM d;  2RQT A;  1X69 A;  5D7U A;  5CQX A;  2RI2 A;  1PC0 A;  3U23 A;  2J6O A;  2QTV A;  2D6F A;  1QQJ A;  4A4F A;  2QQA A;  1PRM C;  2XDP A;  1UTI A;  4O6J A;  2DET A;  1CKA A;  1UB4 A;  4XU0 A;  5GAO q;  2QGG A;  1M1K C;  4HT9 A;  5L23 A;  1RAF B;  3DLM A;  3VYG A;  4J8O A;  1K0X A;  5FRO A;  2EYZ A;  2MWO A;  3OS2 A;  1X43 A;  5GAM j;  2ECZ A;  3PMT A;  9ATC B;  2ZCF B;  3C0C A;  3FDR A;  3G71 A;  3CCR A;  1VQ5 Q;  1MNE A;  2KXC A;  1YJ9 T;  2X51 A;  3QKJ A;  3QPH A;  2C0T A;  2JJ9 A;  2G3R A;  1VYV A;  1AEY A;  1JQQ A;  4BE2 A;  3HKS A;  1YI2 A;  1NLP C;  1Y96 B;  4J6X A;  4J6Y A;  3QYG B;  3PGG A;  4ZNX A;  1YWO A;  2QGF B;  2BZY A;  3PIP A;  3I56 T;  4LUD A;  3HSB A;  2DFU A;  3CCR T;  2E6N A;  4M77 B;  2LNH B;  4J9G A;  3VYH B;  1M90 U;  2JM9 A;  2K6D A;  5C0M A;  2CP0 A;  2AT1 B;  2P4R A;  1KG1 A;  2O4X B;  1U3O A;  3X24 B;  3A98 A;  1BCM A;  3RKX A;  4J9D A;  3ZEH A;  3S3N A;  3M9Q A;  2G6F X;  3EAE A;  2YDL A;  5FU7 C;  3LLR A;  2DRK A;  3CEY A;  4PJO G;  3EGD B;  2P0P A;  4C5G A;  4PJO D;  4C92 F;  3MO8 A;  4PJJ A;  2F2V A;  2BZX A;  4DEX A;  3G4S A;  3V7S A;  2CSQ A;  4OB2 B;  1VA7 A;  1YIT Q;  1GCP A;  3FEO A;  4ZTF A;  1K9M R;  3J7A F;  1JB0 E;  1LOJ A;  4RMO A;  2M0O A;  2O88 A;  3I9Q A;  3A8G B;  4XTX A;  1ZHI A;  1G2B A;  1RAD B;  1D3B B;  4FSS A;  1N9R A;  1N9S A;  3FLG A;  2QEX T;  4DBQ A;  1QVF S;  2DTI A;  3JCM W;  1I0C A;  3RIR A;  1PD1 A;  3CPW S;  1FWZ A;  2DJZ A;  4ANJ A;  2W10 A;  2C06 A;  3CC2 T;  5CKF A;  4JDS A;  4M78 E;  2E12 A;  4N4G A;  2CYZ B;  4M7A C;  3R6N A;  1RUW A;  3OYB A;  4D8D A;  2PVO B;  3V8K A;  1YP5 A;  1WHM A;  5J26 A;  2GTJ A;  2XK0 A;  5GAM g;  1OZ3 A;  5IHI A;  3ASK A;  1NEB A;  5GAO n;  1QWF A;  2CT3 A;  1J3T A;  4LN2 A;  3REB B;  4C8Q A;  4E7L A;  2K2V A;  3ZFJ A;  3UT1 A;  1YFN A;  3OQ5 A;  1N27 A;  4MZT A;  3VS2 A;  2VGN A;  2YXY A;  1M30 A;  5GMK l;  5CCA A;  3CCJ A;  4KH1 B;  3LGL A;  2GNC A;  2JNG A;  2RHI A;  2HBP A;  2QQ9 A;  4PJO E;  2DYB A;  1K9M C;  4OB0 B;  1WXT A;  4FYY B;  1X27 A;  3M58 A;  1WIE A;  2M9U A;  1UUE A;  3JCM f;  1KQS P;  2LJ3 A;  2JTE A;  2HQH A;  1K73 R;  1JJ2 S;  4Q5W A;  5DLO A;  4JUV A;  5I11 A;  3JCM Q;  3MP6 A;  4HT8 A;  1KQ2 A;  3RUX A;  3M54 A;  1NJI C;  3SB2 A;  4CC4 B;  3TQ7 P;  3A8M B;  1VQP Q;  5GAO m;  1G83 A;  4OMN A;  2E10 A;  3GPL A;  4HVW A;  3HL8 A;  2L3P A;  4A63 B;  2BIV A;  4PKC C;  3NGP A;  1RAH B;  2KEA A;  4PLL A;  2DX1 A;  4VUB A;  4DBH A;  2A28 A;  2VAS A;  1M8V A;  3M0Q A;  3JCM g;  4ZTJ A;  4J9E A;  1VQ4 Q;  2CRE A;  1I8F A;  4B6M A;  4JZ3 A;  2D0Q B;  3ER0 A;  1WHH A;  1KQ1 A;  2HD0 A;  4AFQ C;  1WGS A;  2YWW A;  2FRY A;  1MUZ A;  2SRC A;  3HRU A;  4YTL A;  3CC4 T;  3UDC A;  3VS4 A;  1RI9 A;  1KHI A;  5KH6 A;  3L2Q A;  1AD5 A;  3QUI A;  5FWB A;  3I55 T;  3THK A;  2C0O A;  1G3S A;  2QDL A;  1OX8 A;  3CPW P;  2HQX A;  2GQV A;  3NTH A;  4R0K A;  2FPF A;  2KRM A;  4E7K A;  1UEB A;  4QT7 A;  5CAI A;  3CCU Q;  4C92 C;  1VQL Q;  2V1R A;  2X4X A;  2CT4 A;  2QG9 B;  3VS1 A;  1PRL C;  4EMG A;  3BDU A;  2XKO C;  3OYJ A;  2CP3 A;  3SHW A;  2K2M A;  3CME T;  3CCU A;  3CCJ T;  4PK4 A;  1QVG S;  2DKG A;  4FU6 A;  1E6G A;  2F2W A;  2XG8 D;  3EFS A;  2NUT A;  4BDZ A;  1NPP A;  1SSH A;  2PZ1 A;  1XNI A;  1YWP A;  2DJQ A;  2DXB A;  3CCE Q;  2D8H A;  3P8H A;  2DTO A;  1WQW A;  2LCS A;  4PNO A;  2E64 A;  2QTX A;  4KT0 E;  1UHC A;  3CC2 Q;  1K9A A;  2V26 A;  1M5Q 1;  1M3B A;  4MDW A;  4LDV A;  3OW2 S;  4NOY A;  3EG9 B;  5GAN j;  4C8Q E;  3QG1 A;  3SWN B;  4E47 A;  4OMQ A;  5GMK h;  4QVD A;  2AKL A;  1MMG A;  5CKD A;  3OBW A;  1FMK A;  4JRI A;  4CC7 A;  2QQR A;  1AHJ B;  3G6E A;  2KAF A;  1I4K 1;  3LWH A;  2EW3 A;  1JU5 C;  3VU3 C;  2KNB B;  2JW4 A;  3ULR B;  2DIQ A;  2EYX A;  2RI5 A;  4GLK A;  2OX7 A;  1WXB A;  4ATO A;  1M3C A;  1S1N A;  2V8I A;  4IUU A;  5CO7 A;  2YSQ A;  4L5G A;  3OYD A;  1M2V A;  1SF9 A;  2COY A;  2IIM A;  1D1C A;  1RAB B;  2D8J A;  4M7D C;  3VJP A;  2DZ9 A;  3OMG A;  1R0C B;  3G1J A;  2RH2 A;  1I81 A;  4F17 A;  3R6O A;  2DEU A;  3CCJ Q;  3OSV A;  3CCL Q;  4M77 F;  4RCC A;  5CKH A;  1T0H A;  3QWY A;  4RTY A;  2L0A A;  5CR2 A;  1Q82 C;  2XMF A;  3L2V A;  8AT1 B;  2HCK A;  3BE3 A;  4PL6 A;  1R77 A;  2EGE A;  5A0G A;  3DB4 A;  3CXC P;  3CBP A;  1I1J A;  4II1 A;  5GMK e;  4LDU A;  3MEA A;  3MJX A;  5GAN e;  4C92 B;  2L3R A;  2AKK A;  4PFZ A;  3BFM A;  3X28 B;  1BI0 A;  1S72 Q;  2LX9 A;  2OTL T;  3A8L B;  2JTM A;  2K3Y A;  3KXT A;  3HFO A;  4C8Q D;  2MPX C;  4C92 G;  5FU7 B;  2LT1 A;  3CMA T;  3LH5 A;  2EWN A;  4ESR A;  1Q86 C;  1YBY A;  1PM3 A;  1JRI A;  4LUE A;  2E5Q A;  3PNW C;  1T3S A;  1QP3 A;  3L2W A;  1BU1 A;  4E6R A;  2FZC B;  4E7J A;  1M3A A;  2NWM A;  3NPF A;  2BKD N;  2MIO A;  3PE0 A;  4C8Q C;  1WFW A;  1NM7 A;  1Q95 G;  2AK5 A;  2EVR A;  3QDR B;  3RKY A;  2R58 A;  3MEW A;  1Q82 R;  1BCO A;  2CH4 W;  3CXC S;  3G4S Q;  2KGT A;  4C92 D;  1M2V B;  3M0T A;  4XK8 E;  1OQK A;  2LQK A;  1K76 A;  5IN1 A;  1OU8 A;  4N0A C;  3M4Y A;  1Y07 A;  2PQW A;  1U06 A;  4LDY A;  1CKB A;  1OI1 A;  3JCM h;  1D3B A;  5LJ3 e;  5KYX A;  1ZUY A;  2K9G A;  2LTO A;  4X1V A;  2J6F A;  3CQT A;  4Z02 A;  1VQ5 T;  1SG5 A;  2EJ9 A;  1NJI R;  1XOV A;  1WHJ A;  2IG0 A;  1KC8 R;  2FEI A;  4JS5 A;  1M1K U;  1VQ7 T;  1ARK A;  1YJW Q;  2CZ1 B;  4M7A G;  4QKU A;  4OB1 B;  1Y57 A;  1UHF A;  2VKN A;  2DZC A;  1N8R C;  1KK7 A;  4OP0 A;  4M78 A;  2QEX A;  3CC4 A;  4V2S A;  3G71 Q;  1AOJ A;  3O8V A;  1JJ2 A;  4M4Z A;  1B07 A;  4OMF B;  2WSF E;  2CZ7 B;  1HSQ A;  2KDS A;  1AWO A;  2H3J A;  1KD1 U;  1D1A A;  3QHS A;  4IKF A;  1MGQ A;  1GXI E;  1QCF A;  2DPP B;  2HZY A;  2KXD A;  2DTH A;  3CME A;  4RCB A;  3CCV Q;  1S72 T;  2CUD A;  1PSE A;  2OTL Q;  1RAG B;  5A0D A;  4KGV B;  3TVT A;  5L8R E;  1WZO A;  4C5H A;  3JB9 D;  1BI3 A;  3BY7 A;  4BD3 A;  2O31 A;  1MHN A;  1PSF A;  5D6Y A;  1BYM A;  3CCU T;  1M8M A;  1VQK A;  4AFU C;  2E1H A;  4M77 A;  1KC8 C;  4XTY A;  1GBQ A;  3CMA A;  1K4U S;  1BB9 A;  2EQK A;  2CP6 A;  4PFO A;  1UGV A;  3V8J A;  1Y7X A;  3URG A;  3ZBD A;  2YUN A;  1VQO T;  5EC7 A;  2EYY A;  1YN8 A;  4NL2 A;  2RQR A;  2RMO A;  1QWE A;  2JOY A;  4Z89 A;  2ZPG B;  3M0U A;  1NYG A;  2KVQ G;  2VWF A;  1WA7 A;  4A4G A;  4XQ3 A;  1UE9 A;  3OYE A;  2P4T A;  1M90 R;  2BUD A;  2L5Q A;  4MZP A;  4LD6 A;  2Z0W A;  4M75 D;  1NLO C;  1U1T A;  2HDA A;  1H64 1;  3WVD B;  3WVE B;  2XD0 A;  3CBO A;  1G5V A;  4DBF A;  1YIT A;  4OMO A;  3S3M A;  1W4S A;  3HPW A;  1Q7Y C;  3L2Z A;  3M0S A;  1Y71 A;  3CC7 A;  3PMI A;  4JJD A;  2GCX A;  1WPY A;  4M75 F;  3MHX A;  3FC3 A;  3TRE A;  3SFM A;  1NPR A;  2GBQ A;  2HQE A;  4FYV B;  4X9C A;  2M16 A;  2FHD A;  3RNJ A;  1RAC B;  5HK0 A;  1N6A A;  2ROL A;  3SWN C;  4LD9 K;  1RAA B;  2EQI A;  3CXC A;  1Q81 U;  2OTJ Q;  2OJ2 A;  2P0Q A;  4XU3 A;  1QVF A;  3VV0 A;  2E5K A;  1MV0 B;  1SHG A;  3NTK A;  1D0Z A;  2LQW A;  2PVG B;  2PTK A;  2YRD A;  3NHN A;  4EDU A;  4A54 A;  2R57 A;  3EGU A;  1KD1 C;  4M75 B;  3EG9 A;  1VIE A;  2OI3 A;  5LJ3 h;  1YJN T;  2OTL A;  2ESW A;  4MZM A;  1H92 A;  3LW5 E;  4HCZ A;  1KIK A;  2A3L A;  1VQ9 T;  1G3W A;  1TTH B;  5LJ5 h;  4E7I A;  3JV3 A;  5DY9 A;  3ME9 A;  3OB9 A;  3S6W A;  4J9H A;  2XID A;  2AZV A;  4JLI A;  2LRQ A;  1D1B A;  6AT1 B;  5LJ3 g;  1ACM B;  4C8Q G;  1VQ8 T;  4ZN1 A;  2DF6 A;  1TG0 A;  2SEM A;  3E1S A;  1HYO A;  3DLL A;  4OF1 A;  1AZG B;  2LDM A;  4HVU A;  5KYW A;  3CC2 A;  1UJY A;  1V76 A;  1QW1 A;  2ZZD A;  2EQM A;  1QCN A;  1X75 C;  3MEU A;  3NFC A;  2OTJ A;  1GCQ A;  5IXB A;  3JSC A;  1ZSZ B;  2O9V A;  3HFN A;  4M77 G;  1TU0 B;  1GFC A;  3QO3 A;  5D6X A;  1BI2 A;  1K73 U;  2RJE A;  3OW2 P;  2COW A;  2K4Y A;  4M77 E;  1GBR A;  1G3T A;  3I56 A;  4JLG A;  4OGC A;  5IXF A;  2GTO A;  4FYW B;  1HD3 A;  2RI3 A;  5GAO l;  3FB9 A;  2RPN A;  1RAE B;  2KK4 A;  1YHQ A;  2CDT A;  5GJW B;  3JB9 I;  2O9S A;  4ZGJ B;  4CI0 C;  4C8Q F;  3I5R A;  4DQ2 A;  2YUP A;  1YHQ T;  3LGF A;  3JRZ A;  2Y4X A;  3M55 A;  4LDW A;  3CC7 T;  2DL8 A;  2L3S A;  1YIJ T;  3QYH B;  3PIO A;  4EMH A;  2DXU A;  3TU4 K;  1SPK A;  5C6S A;  2M02 A;  1ZSZ A;  4KUD K;  4OMM A;  3INZ A;  2FG0 A;  2KRS A;  3OYG A;  1OPL A;  2RK2 A;  3G4S T;  2CP2 A;  1D0Y A;  3EFO A;  1H3H A;  5GAN 4;  1T0J A;  2ZPI B;  4ME7 A;  2HL5 C;  4AG2 C;  4PJO B;  5KYX B;  5GAM h;  2ZPB B;  3I56 Q;  1XTD A;  1YHQ Q;  1WXU A;  1W6X A;  1PKS A;  2F2X A;  3GF5 A;  1BI1 A;  1MMN A;  3DKM A;  5I22 A;  1CSK A;  1NYF A;  1F1B B;  5J39 A;  4BI8 B;  2HMA A;  1ZUK A;  4A53 A;  3A8O B;  2DVJ A;  3OYY A;  5GAN 2;  3UWN A;  4PJO C;  1WHK A;  2ZAE A;  2FPE A; 
#chains in the Genus database with same CATH homology
 2D8J A;  2EGC A;  3REA B;  1ZUU A;  2DBM A;  4F17 A;  1HJD A;  1BBZ A;  1YNZ A;  2DL7 A;  1W70 A;  5HCK A;  3EG0 A;  2BTT A;  1H8K A;  2RNA A;  4JZ4 A;  1UFF A;  4KRT A;  2LJ1 A;  1T0H A;  2EPD A;  1RLP C;  3QWY A;  1Y0M A;  1WDX A;  2L0A A;  2LQN A;  4RTY A;  2XMF A;  4IIO A;  2DL4 A;  2DA9 A;  2HCK A;  4JPB W;  3EHR A;  4OMP A;  2GGR A;  2EGE A;  3TSW A;  1PHT A;  1OV3 A;  1GCQ C;  1VYT A;  3PVL A;  1I1J A;  2JS0 A;  1OPK A;  5GJV B;  1AWW A;  3IQL A;  2LX7 A;  2DRM A;  1RLQ C;  4J9B A;  1ZLM A;  2AKK A;  5ECA A;  2A36 A;  1T3L A;  2RQT A;  1X69 A;  1JXO A;  3I35 A;  2CSI A;  3LH5 A;  3U23 A;  2J6O A;  1X2Q A;  4DEY A;  4ESR A;  3QWX X;  2J06 A;  1PRM C;  4LUE A;  1T3S A;  1BU1 A;  1LCK A;  1UTI A;  4E6R A;  2X3W D;  1M3A A;  2NWM A;  3NPF A;  2MIO A;  3PE0 A;  2RN8 A;  1WYX A;  1CKA A;  1WFW A;  1NM7 A;  2AK5 A;  2FRW A;  5L23 A;  2EVR A;  1TUD A;  1K0X A;  1AWX A;  4RTU A;  2EYZ A;  4WCI A;  4HVV A;  1X43 A;  2ECZ A;  4J9C A;  4LNP A;  3RBB B;  2CH4 W;  1KSW A;  3C0C A;  2KGT A;  2KXC A;  3M0T A;  2O2O A;  1K76 A;  2C0T A;  1FYN A;  1VYV A;  1AEY A;  1JQQ A;  1X6B A;  2ROT A;  2JMC A;  1NLP C;  2D1X A;  1QKX A;  4HCK A;  3PVQ A;  4ZNX A;  1U06 A;  1YWO A;  2BZY A;  1CKB A;  2RQU A;  1WLP B;  4LUD A;  2K7A A;  1ZUY A;  2DBK A;  2LNH B;  2K9G A;  2W0Z A;  5FW9 A;  4J9G A;  2DE0 X;  4X1V A;  2J6F A;  2JM9 A;  2K6D A;  3CQT A;  3O5Z A;  1U5S A;  2P4R A;  2FO0 A;  4HXJ A;  1XOV A;  1X2K A;  2ABL A;  2L2P A;  1U3O A;  3A98 A;  2FEI A;  2DNU A;  4RUG A;  4J9D A;  1ARK A;  3VRY A;  2G6F X;  1Y57 A;  3VS3 A;  2KE9 A;  2YDL A;  2DRK A;  1UHF A;  2DLP A;  2EKH A;  2VKN A;  2CH4 A;  1AZE A;  2F2V A;  2BZX A;  1K0S A;  4DEX A;  2DIL A;  1AOJ A;  2CSQ A;  1IO6 A;  1OOT A;  4M4Z A;  2YUQ A;  1B07 A;  1VA7 A;  3M0P A;  1HSQ A;  2LJ0 A;  1AWO A;  1GCP A;  2O88 A;  4RTZ A;  3I9Q A;  1QCF A;  2KXD A;  1K1Z A;  1NEG A;  1G2B A;  2CUD A;  5IH2 A;  2EBP A;  3TVT A;  2OAW A;  4FSS A;  5IHK A;  2I0N A;  2M0Y A;  2KBT A;  1UG1 A;  2VVK A;  1I0C A;  2O31 A;  2W10 A;  2ED0 A;  3VRZ A;  2BZ8 A;  1M8M A;  1VYU A;  4AFU C;  3R6N A;  1EFN A;  1RUW A;  4RTV A;  3EG2 A;  1GBQ A;  3H41 A;  1QLY A;  4GLM A;  4D8D A;  1YP5 A;  3TSZ A;  2GTJ A;  1K4U S;  1BB9 A;  2L3Q A;  1UGV A;  5IHI A;  4Y92 A;  3UA7 A;  1OEB A;  2KYM A;  1QKW A;  1NEB A;  1QWF A;  2CT3 A;  1J3T A;  2YUN A;  4LN2 A;  5EC7 A;  2EYY A;  3REB B;  1YN8 A;  4AG1 C;  2K79 A;  2RQR A;  2RQV A;  2RMO A;  1QWE A;  4Z89 A;  3VS2 A;  4GBQ A;  1M30 A;  3M0U A;  1NYG A;  2VWF A;  2YUO A;  1WA7 A;  2GNC A;  1UE9 A;  1BK2 A;  2A08 A;  2ENM A;  3UF4 A;  2DYB A;  4J9I A;  3NMZ C;  1WXT A;  4D8K A;  1W1F A;  1X27 A;  4J9F A;  1NLO C;  3UA6 A;  2JM8 A;  1WIE A;  2HDA A;  1UUE A;  2KR3 A;  4OMO A;  2LJ3 A;  2JTE A;  3M0S A;  4JJD A;  5I11 A;  2DL5 A;  3FJ5 A;  4CC3 A;  2KYB A;  1E7O A;  1N5Z A;  4CC4 B;  2C0I A;  2KT8 A;  2GBQ A;  2DL3 A;  2LMJ A;  2FPD A;  1G83 A;  3M0R A;  4OMN A;  3RNJ A;  3VS5 A;  1PNJ A;  4HVW A;  4JJC A;  2L3P A;  4A63 B;  1SEM A;  2HBW A;  2ROL A;  1NG2 A;  3UAT A;  2EQI A;  2OJ2 A;  3NGP A;  1AWJ A;  2KEA A;  4IIM A;  2E5K A;  1MV0 B;  1WI7 A;  1SHG A;  2DX1 A;  1KJW A;  2LQW A;  1E6H A;  2PTK A;  2GQI A;  3NHN A;  2A28 A;  3EGU A;  3M0Q A;  3KFV A;  3EG3 A;  4F16 A;  4J9E A;  2OI3 A;  2PNI A;  2CRE A;  1JEG A;  1YCS B;  4JZ3 A;  3EHQ A;  3GBQ A;  2ESW A;  1H92 A;  4AFQ C;  3VS6 A;  1KIK A;  2DMO A;  1I07 A;  3H0I A;  4AFS C;  2YT6 A;  2FRY A;  3JV3 A;  1MUZ A;  2SRC A;  1TUC A;  1UJ0 A;  1ZSG A;  2X3X D;  4J9H A;  2MOX A;  2AZV A;  3VS4 A;  1AVZ C;  2JXB A;  1RI9 A;  3ZL7 C;  1AD5 A;  2DF6 A;  1TG0 A;  2CUB A;  2NUZ A;  2SEM A;  5FWB A;  4F14 A;  3THK A;  2C0O A;  2QDL A;  1AZG B;  4LE9 A;  1ABQ A;  4HVU A;  2JMA A;  2LP5 A;  1UJY A;  4R0K A;  2FPF A;  1JO8 A;  1GL5 A;  2ED1 A;  2KRM A;  4JJB A;  4QT7 A;  1GCQ A;  4K11 A;  5IHN A;  2RQW A;  5IXB A;  2V1R A;  2CT4 A;  2O9V A;  2J05 A;  2JS2 A;  1GFC A;  1ABO A;  3VS1 A;  1PRL C;  3SEM A;  1GBR A;  3SHW A;  2K2M A;  3H0H A;  4RTT A;  1PKT A;  2DM1 A;  2M51 A;  2J6K A;  1E6G A;  1UEC A;  2F2W A;  5IXF A;  2D0N A;  2V1Q A;  2GTO A;  2MCN A;  1HD3 A;  1Z9Z A;  1SSH A;  1V1C A;  2RPN A;  2CDT A;  2EYW A;  2PZ1 A;  5GJW B;  1SRL A;  1YWP A;  1M27 C;  1UDL A;  1SHF A;  2DJQ A;  2H8H A;  2D8H A;  2O9S A;  3EG1 A;  1ZBJ A;  4ORZ A;  2A37 A;  2KRN A;  3I5S A;  4CC2 A;  3I5R A;  3VS7 A;  2YUP A;  2LCS A;  1ZX6 A;  4Z88 A;  2KRO A;  1UHC A;  2JT4 A;  2HEQ A;  1K9A A;  1GFD A;  2DL8 A;  1M3B A;  2EGA A;  2L3S A;  4Z8A A;  2HSP A;  1SPK A;  4OMM A;  2AZS A;  2FG0 A;  2KRS A;  4EIK A;  1OPL A;  1Z9Q A;  4OMQ A;  1X6G A;  4RTX A;  1H3H A;  2AKL A;  1MV3 A;  2B86 A;  2K3B A;  1FMK A;  2KT1 A;  1T0J A;  1PWT A;  4AG2 C;  2J7I A;  4CC7 A;  3H0F A;  1A0N B;  1KFZ A;  1WX6 A;  1SRM A;  2RF0 A;  2EW3 A;  1JU5 C;  2KNB B;  2JW4 A;  1WXU A;  1W6X A;  3ULR B;  1JXM A;  2EYX A;  1PKS A;  2F2X A;  1WXB A;  4AFZ C;  5I22 A;  4OML A;  1CSK A;  1NYF A;  1M3C A;  1S1N A;  2LZ6 B;  1GRI A;  1ZUK A;  5FWC A;  2DVJ A;  2YSQ A;  4RTW A;  1B3Q A;  3VS0 A;  2FPE A;  2IIM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...