3O5ZA

Crystal structure of the sh3 domain from p85beta subunit of phosphoinositide 3-kinase (pi3k)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
82
structure length
82
Chain Sequence
GPEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQALGVAEGGERCPQSVGWMPGLNERTRQRGDFPGTYVEFLGPVALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Phosphatidylinositol 3-kinase regulatory subunit beta
publication title X-ray structure of the SH3 domain of the phosphoinositide 3-kinase p85 beta subunit
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 21
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3o5zA00
2HSPA 2KR3A 4DEXA 1NYFA 2RQRA 1NG2A 1K0XA 5FWCA 4J9IA 2YUOA 2GBQA 5I11A 1JXMA 1Z9ZA 2C0IA 2A37A 1WXBA 3CQTA 1GCQC 3UA6A 2V1QA 2ABLA 4DEYA 2KYMA 2YUQA 2MOXA 3VRZA 3I5SA 4J9DA 1X6BA 2VKNA 2E5KA 2J6FA 2VVKA 1UTIA 1RUWA 1RI9A 1FYNA 1M8MA 1PRMC 3U23A 2EYYA 1AEYA 2LZ6B 2K9GA 2DA9A 3TSWA 3EG3A 2OJ2A 1SRMA 2LQWA 1WA7A 1M3CA 2O88A 2GQIA 2EW3A 1N5ZA 1WLPB 2DF6A 2KBTA 4HVVA 2HDAA 1H3HA 2EGEA 2H8HA 1U3OA 2EVRA 1KJWA 3IQLA 4Z88A 1JEGA 4AG1C 3O5ZA 2AK5A 2CH4W 1AVZC 1SSHA 2DRMA 2KRMA 2CT3A 2JS2A 4RTWA 1X6GA 1UJ0A 2C0TA 3C0CA 4LNPA 2RQWA 1KIKA 1NLPC 4OMLA 5IHIA 2D8HA 1T0JA 1U06A 1V1CA 1HD3A 4IIMA 1JO8A 1J3TA 2ED0A 2O9SA 2FPEA 3A98A 1HJDA 1X2KA 2RMOA 1H8KA 4GLMA 2FRWA 2K79A 2KE9A 2DL3A 4J9CA 4CC7A 3QWYA 4Z89A 2L3SA 4E6RA 4FSSA 2JTEA 2FPDA 2P4RA 2RF0A 1KFZA 2DE0X 2RQTA 2LJ1A 4OMOA 4J9HA 2J05A 2JT4A 1QKWA 2A28A 2JM8A 2D8JA 3H41A 3VS7A 1PHTA 1SPKA 1WFWA 4M4ZA 1UJYA 4RTXA 2JMCA 1LCKA 2A08A 1EFNA 4Y92A 2KXCA 1WI7A 2K6DA 2J6KA 4JJDA 2LQNA 3EGUA 3UATA 1S1NA 2OI3A 1NEGA 2KGTA 1ABOA 1UHCA 4GBQA 4JPBW 1BB9A 1TUDA 4AFZC 1WXTA 1ZX6A 2SEMA 4RTVA 2AZVA 3FJ5A 2KYBA 2CUDA 4D8KA 2JMAA 2YUNA 1X69A 2ED1A 1BU1A 2X3XD 1PWTA 1VYUA 2DYBA 4JJBA 1TG0A 2FRYA 4LUDA 2A36A 2DL5A 1OOTA 1VA7A 4RTUA 2PTKA 2EKHA 2X3WD 2RN8A 2JM9A 2EPDA 2BZXA 4F16A 1WIEA 2LMJA 4LUEA 2ROTA 1T3LA 2F2WA 2O9VA 1Y57A 2BTTA 2FPFA 1UUEA 1M3AA 3PE0A 4HVUA 5IHNA 1NLOC 4A63B 4K11A 1GCQA 1NEBA 2DMOA 1UE9A 1QWEA 3EG0A 1ZSGA 4IIOA 1RLPC 2YT6A 1ABQA 1MV0B 1T0HA 2KEAA 1ZUKA 3I5RA 1B07A 1I07A 2DL8A 2CDTA 4CC3A 2EYXA 2ENMA 4J9GA 2CT4A 1A0NB 2ECZA 4RTZA 2LP5A 1GBQA 2W10A 2DL7A 1K4US 2RQUA 1BBZA 2RQVA 4AFUC 2L3QA 1XOVA 2I0NA 1QWFA 3R6NA 1WXUA 4HCKA 1CKAA 4HXJA 1E6HA 2K7AA 1X43A 1W1FA 1HSQA 2C0OA 1WX6A 1CSKA 5I22A 3I9QA 1YWPA 1RLQC 2PZ1A 1B3QA 4ORZA 1QLYA 3M0PA 1E6GA 2BZYA 2GNCA 2QDLA 3M0TA 3UF4A 1YP5A 3PVLA 4LE9A 2IIMA 1AWXA 1AZGB 3VS3A 1UFFA 1E7OA 2KT1A 2O31A 1IO6A 3REAB 3M0QA 1CKBA 1X2QA 2MIOA 3NHNA 2RPNA 5FW9A 1MUZA 2JXBA 1SEMA 1M27C 2DJQA 2EBPA 1K9AA 4KRTA 3I35A 5IH2A 2GTOA 3TSZA 2DM1A 4OMQA 2KRSA 1YNZA 2B86A 2FO0A 3VS0A 2CH4A 2EYWA 1UECA 1ARKA 2NWMA 4AFQC 2YUPA 4EIKA 1M3BA 3H0FA 3KFVA 2CSQA 3VS6A 2HBWA 1VYVA 2CUBA 4JJCA 3VS1A 4AG2C 4RTYA 3M0UA 2G6FX 1Z9QA 1GRIA 3M0RA 4JZ4A 1OV3A 5IXBA 2DLPA 2EYZA 1FMKA 1UDLA 1OPLA 3VRYA 2KROA 1PKSA 2HEQA 3H0HA 2LNHB 1G2BA 2DVJA 1OEBA 5EC7A 4RUGA 1UHFA 2SRCA 2L3PA 3PVQA 1Y0MA 1JXOA 2LJ0A 2L2PA 3THKA 2OAWA 1AWJA 2L0AA 2O2OA 2EQIA 3NMZC 3EG1A 4ZNXA 1AWWA 5IHKA 3ULRB 1JQQA 1WYXA 1OPKA 3RBBB 1GFCA 1GL5A 4OMNA 2M0YA 3EHRA 2XMFA 1ZLMA 5GJVB 1AD5A 4OMPA 2KNBB 1QKXA 4OMMA 4D8DA 1TUCA 1ZUUA 4AFSC 1K0SA 1AOJA 3VS2A 2AKKA 1JU5C 3GBQA 3NGPA 2D0NA 2EGAA 4X1VA 1UGVA 3LH5A 1G83A 1UG1A 4WCIA 5HCKA 2F2VA 1VYTA 1ZBJA 3VS5A 1GBRA 3EHQA 1I0CA 4HVWA 2CSIA 2JW4A 2V1RA 1W6XA 1K1ZA 5GJWB 1YN8A 4LN2A 2LJ3A 1WDXA 2K2MA 2LCSA 2MCNA 2RNAA 3QWXX 1BK2A 2DBMA 2FEIA 2DNUA 2W0ZA 3SEMA 3SHWA 1NYGA 4RTTA 2KRNA 2VWFA 3REBB 2LX7A 1U5SA 5ECAA 2M51A 2KXDA 4J9EA 1K76A 1X27A 2DX1A 2F2XA 3RNJA 1T3SA 1SHFA 2CREA 4ESRA 4QT7A 1SHGA 3M0SA 2ROLA 2HCKA 2NUZA 1SRLA 4J9BA 2AZSA 4JZ3A 4CC4B 1YWOA 3VS4A 5IXFA 2PNIA 3TVTA 2YDLA 3JV3A 2JS0A 2J06A 1GFDA 4Z8AA 1M30A 2K3BA 2KT8A 2BZ8A 1ZUYA 1KSWA 5L23A 1W70A 4F14A 3H0IA 1PNJA 2YSQA 3EG2A 3UA7A 4CC2A 2GTJA 2D1XA 1GCPA 1AWOA 2DILA 1H92A 1NM7A 1YCSB 1QCFA 2J7IA 3NPFA 5FWBA 3ZL7C 2GGRA 2AKLA 1PKTA 2ESWA 2EGCA 1AZEA 2DL4A 2FG0A 1PRLC 4J9FA 4R0KA 2DRKA 2DBKA 2J6OA 4F17A 1I1JA 1MV3A
chains in the Genus database with same CATH superfamily
3OYHA 2HSPA 3EFSA 1NYFA 4B6MA 3VUBA 3CC7Q 1JJ2A 3ASKA 1Z9ZA 2C0IA 1ZSZC 1WXBA 3CQTA 3X20B 2V1QA 3NTKA 2MYSA 1Q81U 4M7AA 3J81E 4MMKA 2QTXA 4NS5A 2VKNA 2CP0A 3E1SA 4BB7A 5EG2A 4Q5WA 3BDLA 3JSCA 3JCMh 4MDWA 4EPCA 1WJSA 2LZ6B 2K5IA 5GAN5 4JRKA 2K9GA 3TSWA 2HKQB 2OTLQ 1WA7A 4PJOG 4M7AB 3HRTA 4B9WA 4JLGA 1QQJA 4N0AC 1N5ZA 4XTXA 1MNEA 2LVMA 3FLGA 4HVVA 5KYXA 1Q7YC 3CC2T 3OYFA 1U3OA 2EVRA 1JEGA 4KGVB 3O5ZA 4AG1C 1D3BA 1WNLA 3CC4A 2QQSA 1SSHA 2CT3A 4ELYC 4RTWA 1WJRA 1X6GA 1OZ3A 1UJ0A 2C0TA 2RQWA 1NLPC 5IHIA 1S72T 5KYXB 4EMKA 1K73U 3JCMe 3PGGA 4M75A 1TU0B 1KQSS 1J3TA 2YLCA 5GAN7 1D3BB 1X2KA 1VQKQ 2GFUA 3OY9A 2KE9A 2DL3A 3L1AA 4J9CA 1NE8A 4CC7A 3OS5A 4EMKB 2DTIA 3E9GA 4M78A 4Z89A 1BIBA 4PJMA 4FSSA 2HQXA 4M75B 5GAOm 2ATCB 1K8AR 2LJ1A 1IHWA 4OMOA 2JT4A 1QKWA 1YJNQ 1PHTA 5DY9A 1PD0A 1UJYA 4C0ZA 3VJPA 1RADB 4A4FA 4M78B 4E47A 1LCKA 4JJDA 2VASA 2LQNA 2OI3A 1U8RA 1ABOA 2COWA 3JCMg 4D6WA 2YRCA 2KAFA 1D0ZA 3CCET 4BDYA 5GAOq 1VOMA 4J5YA 2SEMA 2H3JA 2OTJA 1RAAB 3E9FA 3KBGA 2ED1A 2E3HA 3RESA 2M16A 4FL6A 3QDFA 4OGEA 2PVOB 2MMPA 3QKJA 2BKDN 2PTKA 4ZN3A 3V7CA 4LDWA 4OB1B 4C92E 2CZ0B 2HSEB 1VQNT 4LUEA 1T3LA 1M8VA 3JB9J 1VQLA 4JRIA 3L42A 2BTTA 2XIDA 2E4HA 2P0PA 1M3AA 5IHNA 1NLOC 1D09B 3SWNA 1GCQA 1NEBA 3CBPA 2DMOA 4RCCA 4KT0E 1ZSGA 4IIOA 1Q82C 1WJQA 1ABQA 4WF2A 3OMGA 1BKBA 4ZTJA 1T0HA 1ZBXA 1ZQ1A 4LDYA 2PQWA 3CCST 3O8VA 3T9NA 2DL8A 4AMCA 2EFIA 2EYXA 1FWZA 1VQ7A 2ENMA 2LDMA 4GY5A 3SWNB 3MKDA 2LP5A 4OP0A 3JB9G 3MHXA 3PMIA 4L6V5 2RA2A 5GAMd 5GAN3 3CC2Q 3GIBA 1VQ4A 4ELZC 4KBMB 1QWFA 1C0MA 3CMAA 3R6NA 3JAME 1WXUA 3FC3A 1CKAA 1OQKA 3RUXA 2AT1B 4C8QG 2E64A 4FIBA 2I2LA 3VV0A 4XAXB 1S72Q 2PZ1A 4A54A 4FYVB 3WVEB 1I5OB 2BIVA 3V8JA 1I81A 1QLYA 3M0PA 2QDLA 2DKGA 2DAQA 2EYQA 1RABB 3L2QA 3OYGA 1AWXA 5CAIA 5GAMh 1G3TA 3REAB 3JCMf 1X2QA 2MIOA 3HKSA 2O4XA 1V76A 5FW9A 1YJ9T 1NJIR 1MUZA 3SD4A 1OYXA 4XU2A 3A8GB 1SEMA 3C94A 2EKOA 3G71T 1ZHIA 1TTHB 2RHXA 1VQPT 4FW1A 2DM1A 1DJ7B 2VXEA 2CH4A 2EYWA 1UECA 2O4XB 2RK1A 2YUPA 1KQSA 5IN1A 1M3BA 3I56A 4TVRA 3HPWA 2ZPBB 4KUDK 1QVFP 1Z9QA 5IXBA 1OV3A 3CMEA 2P84A 2EYZA 4XTYA 3VRYA 3GNGA 3X26B 4C5HA 3OYDA 5KYYA 1N9SA 8ATCB 5GAMe 3CCEQ 2DVJA 3OYKA 3DLLA 2L3PA 8AT1B 2P0QA 1VQ5Q 3D7SB 3FIFA 2O2OA 5GMKe 3HRUA 3A5ZB 5KYYB 3EG1A 4ZNXA 2VXFA 2HBPA 3RBBB 4OMNA 2M0YA 1VQNQ 1BI0A 1K8AU 2Z0WA 1KHCA 3UT1A 3VS2A 1TOVA 3NGPA 5CQYA 4WTOB 1KG1A 2EGAA 3RDVA 3PNWC 1YBYA 1UGVA 2VGMA 3RIRA 2RI2A 1TH7A 1QVFS 3LWIA 2EJGA 5DM7R 3OW2P 2EAYA 1GBRA 3EHQA 4M7DF 1I5LA 1X6OA 5GAMg 3CCSQ 3EG9A 4FU6A 4B9XA 4C92D 3CD6Q 1VQ8T 3OA6A 2DBMA 1M5Q1 2KRNA 4LDUA 4OB0B 3REBB 2LX7A 3P8HA 4PJOC 1EIFA 1M90C 4KGZB 4PJJA 2DIGA 1G3YA 4ESRA 3CPFA 4DBRA 1SRLA 3URGA 1MMNA 2PNIA 3OS1A 5LJ3d 3OYEA 3S3NA 1JJ2S 1HK9A 3JV3A 5D7UA 3DKMA 4PJOF 4V2SA 1VQMA 2XG8D 1YJWA 1YJ9Q 3EH1A 3OW2S 4M77F 5L23A 3FB9A 4M77B 5GMKi 5GAN2 1PNJA 3AT1B 5KCHA 2GTJA 2JZ2A 3CBMA 3G71Q 3CCUT 1PCXA 1VQPQ 1VQOA 4KGXB 2E1HA 4LDVA 4R56A 1PM3A 3X25B 4J6XA 5AT1B 1MHNA 5KYNA 4LXCA 5DLOA 1SKUB 2V8JA 2M1HA 3NPFA 2R5AA 3OS0A 1IB8A 2FG0A 1FX7A 3CCMA 1Q7YR 2DEQA 1KD1U 2JTFA 1I4K1 4F17A 3SDZA 1YHQA 4IUTA 4E7HA 2B8AA 2CP2A 2GBQA 4F7UF 1JXMA 4OB2B 3G6ET 2JOYA 5GAMf 2EIFA 2PVGB 2ABLA 2E70A 3SFMA 5HY6A 2YUQA 2E3IA 2MOXA 3L2RA 1NJIU 1BI1A 2J6FA 1UGSB 1RUWA 1FYNA 3LGLA 2EYYA 4FYXB 5LJ3e 1F1BB 4E2FB 3MO8A 5I2SA 3MPUB 1RAIB 2HNIA 2O88A 2KVQG 2WSEE 1KHIA 3JB9I 3CBOA 1WHKA 2KBTA 2F5TX 1H3HA 2H8HA 4YTLA 3TREA 2GCXA 5LJ5j 2AK5A 1AVZC 1N8RC 1K9MU 5GAN6 2DETA 2JS2A 4QQGA 4XU1A 4DBFA 3C0CA 5GAOl 1KIKA 2E6ZA 3S6WA 1T0JA 1MMGA 2YLBA 2K2VA 1HD3A 1RACB 1JO8A 3ZBDA 4HCCA 3QSUA 1GXIE 3CC4T 4ANJA 5L8RE 3E19A 2FRWA 2KQWA 3GNFB 3CCRA 3BW1A 1QVFA 3OYLA 2V8IA 2CP6A 4FM4B 2YRVA 3BDUA 3CCJA 4X34A 2VB6A 3RERA 3EFOA 3OYCA 1XQHA 3EGDA 2RJFA 2LCCA 2A28A 4C8QC 3VS7A 4X9CA 1VQ9A 1SPKA 3DB4A 2LX9A 3WVDB 3A8MB 3Q1JA 4RTXA 1B34A 3CCUQ 2A08A 4J83A 4Y92A 2Y4XA 2M02A 4RG8A 1WI7A 2K6DA 1YIJA 4PLIA 4HA8A 3EGUA 3UATA 1S1NA 3EFOB 1Q82R 1OU8A 1Q95G 4M7DG 2QTVA 2F5KA 1YITQ 4GBQA 1BB9A 3M59A 1LNXA 1WXTA 2LQKA 4QVDA 3JB9H 4RTVA 1SG5A 1B34B 2COZA 2KSSA 1HYOA 4D8KA 4C0DC 4C92A 4RCBA 1BU1A 3X28B 3CXCP 1PWTA 4JJBA 2FRYA 3OW2A 1R8OB 2X35A 2EQJA 1VA7A 4MDXA 4RTUA 2QA4A 2X3WD 4Z02A 2RN8A 2E41A 3M5AA 2OTJT 3G6EQ 1MNDA 4QKUA 4QQ6A 1WIEA 3UWNA 2F2WA 4C92B 1PSEA 3TQ7P 3LGFA 2O9VA 4MZPA 3PE0A 4M7AF 1KD1C 3ER0A 1ZSZA 3G4SA 2DK3A 3META 3CCQA 2LTOA 1RLPC 2O01E 4M77G 3CPWS 2KEAA 3RMSA 2GF7A 5D6YA 2DEUA 4FW2A 9ATCB 1I07A 5LJ3f 1VQLT 2IPOB 4J9GA 2CT4A 2ECZA 4RTZA 1ZSZB 2W10A 3LX7A 1BBZA 3C4SA 1Q7YU 4J6WA 5A0LA 4AFUC 3CXCS 1VQKA 3GOXA 2I0NA 1ACMB 4N0AA 1BI3A 1X75C 3QYHB 3CCLA 3JCMc 4F04B 1E6HA 2K7AA 2AIRB 1VQ7T 2C0OA 1WX6A 1YWPA 3RKYA 1WHJA 1I8FA 5KYWA 1VQ4T 2GNCA 1RAGB 2EQUA 2DO3A 2MPXC 3CC4Q 2C06A 4ZGEB 3CMAT 4M75F 4F7UG 1AZGB 4II1A 1YJNA 1E7OA 1IO6A 3M0QA 3RKWA 4EDUA 3HSBA 5KYWB 3QZ5B 1IHVA 5J39A 4KH1B 4M78F 4QVZA 5IH2A 2GTOA 1QCOA 3TSZA 2KRSA 1RI0A 1UGPB 2JVVA 3LLRA 1M1FA 2WSCE 1ARKA 4HT9A 4ME7A 4EIKA 2FZKB 2DFUA 1VYVA 2CUBA 4PNOA 2DXBA 2R5MA 3WXMB 2DLPA 1FMKA 2HAXA 4FCYA 1OPLA 2NLUA 3JCMJ 1FMVA 4PFPA 3QIIA 4C8QE 1OEBA 4RUGA 2LC4A 3PVQA 3I56T 1JXOA 4ZGJB 4PJOD 2EQKA 3A8OB 3THKA 1AT1B 2L0AA 5GANd 3CMET 2COYA 3MP6A 1IGQA 1AWWA 2ZAEA 3V7SA 1O9SA 3QBYA 1M90R 1WYXA 3QXEB 1GL5A 5GAOr 2QK0A 2XMFA 3QJYA 4OB3B 2OTJQ 5GJVB 4ZTFA 1QKXA 4OMMA 2DD5A 2CP5A 4D8DA 2RI5A 1TUCA 1TUGB 2AKKA 1JU5C 3GBQA 3KUFA 2D0NA 3TEEA 1PG5B 1KQ1A 4X1VA 2QI2A 2BUDA 1EX4A 3LH5A 2NYSA 4X9DA 3RKXA 1XJWB 2F2VA 1ZBJA 2K3XA 4XU3A 3VS5A 2R57A 1Q82U 1I0CA 1MGQA 3AHUA 3QG1A 3A8HB 1VQLQ 3BE3A 1W6XA 1K1ZA 2QQRA 2L3RA 3EGXA 4LN2A 1WDXA 2MCNA 1OZ2A 7AT1B 1C1AA 4MZTA 3OSSC 1WZOA 4A4EA 2LRQA 4RTTA 2HD0A 2RHYA 2VWFA 3G1JA 1NBEB 4J9EA 1K76A 5A0DA 2F2XA 1VQ6A 3EGXB 1VQ7Q 1G8XA 2CREA 3NTIA 4QT7A 1OU9A 3C12A 2ROLA 3CPWA 2YRDA 4O6JA 4CC4B 2HKNA 4QVCA 5IXFA 5KE2A 1VQ4Q 5GANe 2JTMA 1Y71A 3CMAQ 2ZPHB 2X4YA 1OX8A 3H6ZA 5IAYA 4Z8AA 1FMWA 1M30A 5GMKh 3MEUA 2K3BA 2BZ8A 2E6NA 1KSWA 5HKCA 1W70A 1WPYA 4M7AG 3CXCA 3EG2A 1RAFB 4CC2A 2YHTA 3PIOA 3PT9A 3S3OA 1GCPA 5LL6S 1AWOA 2DILA 1H92A 1NM7A 3CCEA 4E7ZA 1VQMT 3PMTA 2XDDA 2H3EB 1YJWT 3JCMX 2MK5A 4PFZA 5CKDA 1NZ9A 1VQ5A 3ZL7C 2DXCA 5D6XA 1VQOT 1YI2A 2DBKA 2J6OA 1N6AA 1I1JA 1N8RR 3HL8A 4HCZA 2KR3A 4DEXA 5IT9E 2P4TA 2RQRA 3I56Q 4J9IA 2YUOA 3V8KA 2CZ7B 4J7IA 3CCMT 4DEYA 2RI3A 3CMEQ 4M7DC 3VRZA 3OMCA 4XK8E 1ZA1B 3JB9D 3I5SA 4J9DA 4PK4A 3OS2A 2VVKA 4VUBA 4M75G 3MP1A 1YHQT 1UTIA 3UPUA 4J6YA 5LJ5e 3OYAA 1PRMC 3U23A 4DBHA 3GF5A 1BI2A 1SF9A 2M9UA 2DA9A 3CD6A 3EG3A 2Y4YA 1SRMA 4E7SA 4C8QD 2LQWA 3PFSA 2GQIA 4M78G 1QVPA 1JBMA 2EW3A 1WHHA 2ZPFB 3TCJA 3ZFJA 1WLPB 2KY9A 2HDAA 3LWHA 2RHZA 3G7ZA 1MMAA 2XICA 4PLLA 3CCVT 2DRMA 2KRMA 3FRNA 5FLXE 2ZCFB 4EMHA 5CIUA 3EG9B 4NL2A 2FB7A 4LNPA 4O5VA 4OMLA 2D8HA 4M77C 3OYJA 2IG0A 1V1CA 4IIMA 2LQ8A 2EQMA 1VUBA 2O9SA 2DTHA 2FHDA 1M90U 3I55A 2FYKA 2QG9B 3QHSA 4N4HA 4JS4A 2CKKA 3HP9A 4E6RA 2QEXA 2JTEA 1QW1A 2RF0A 1KFZA 2KK4A 2J05A 5GMKl 4KUIA 1JB0E 3H41A 3E2UA 4RKUE 4JRQA 4JRPA 3CCRT 3OYNA 3M4YA 2JMCA 2FL7A 2DXUA 5LJ3h 4BI4A 2J6KA 4XTWA 1NEGA 1VQMQ 2KGTA 2HQHA 5CVIA 5FRNA 1QVGP 1YJWQ 4JPBW 2JNGA 1NPRA 4AFZC 3GPLA 4N4GA 1KC8R 2XDBA 1M9SA 3VYHB 3KXTA 5FU7B 2KYBA 2JMAA 1M1KC 5GAN4 1YIJT 1X69A 2D0QB 3MEVA 2DERA 3P8DA 1VQOQ 2A7YA 2X3XD 4LUDA 2PU9B 2XK0A 2VUBA 1OOTA 3OBYA 4PKCC 2EKHA 3M56A 1K73R 2JM9A 1QP2A 4KH0B 2X4WA 3R6OA 4C0FA 2BZXA 3J80E 4F16A 2D9TA 5FU6B 2LMJA 1M1GA 2EJFA 4IUUA 2FPFA 2F1LA 1UUEA 3BFMA 1UEBA 2LT4A 4A63B 4K11A 2DZCA 5GAMj 1UE9A 1M2VA 1QWEA 2QA4T 2YT6A 2X9HA 2FVUA 3QUIA 1MV0B 2AHJB 2RO0A 4OGCA 1QVGS 3EH2A 1AHJB 4BI8B 3I5RA 1YCYA 2HMAA 4L5GA 4M7DE 1GBQA 3G4ST 2DL7A 1M2VB 2RQUA 2E65A 1VQ8Q 3CCQT 4BY6C 3INZA 1WHLA 3HRSA 5FRMA 1XOVA 3CCVQ 1G5VA 2BE9B 1TS9A 1N8RU 3M53A 2QDYB 2LT1A 4HXJA 1WGSA 1HSQA 1UGRB 3BY7A 5LJ3g 2GFAA 1IZ6A 1EZZB 3HFNA 3M0TA 3UF4A 4RG2A 4J8OA 3OYBA 4LE9A 5D6WA 3M55A 3VS3A 4PJNA 1UFFA 3CCLT 2QXFA 2O31A 2KT1A 5KYUA 1B7TA 1CKBA 3UDCA 2WSFE 2DJZA 3JCMQ 2RJEA 4PJOE 1M27C 1PD1A 4FT4A 2P0KA 2VYTA 4BE2A 2EBPA 4XTZA 3OSVA 2E10A 4M77E 1YITA 4A4HA 1YJNT 2X4XA 3MEWA 5KYUB 1YNZA 1YFNA 3OBWA 2L5QA 3VS0A 3CCRQ 3EGDB 3CC7A 3LYIA 4AFQC 1RAEB 2DYIA 2Y90A 3KFVA 3VUZA 4C8QA 2CSQA 3VS6A 2HBWA 4JJCA 3VS1A 4AG2C 3S3MA 1RAHB 3M0RA 2G6FX 1M2OA 4JZ4A 4PJLA 3M58A 2E5QA 5M9OA 1D0YA 2KROA 2HEQA 4FYYB 3G6EA 2LNHB 2RJCA 4M7AC 1BYMA 5EC7A 1Y0MA 4C8QB 4HT8A 3FDRA 1YIJQ 1TWBA 1AWJA 2F69A 1Q81C 2OTLA 2K57A 4Y28E 4C92F 2EQIA 2DD4A 4F7UE 2PVDB 1JQQA 4R55A 3LW5E 1ZLMA 2RHUA 3MCAB 4C5EA 1AD5A 1Y7XA 1KQSP 4QW2A 2NUPA 1K0SA 2HL5C 1AOJA 4JLIA 3NTHA 4C0DB 1G83A 3M4GA 1UG1A 2QA4Q 4WCIA 2A0FB 4EMGA 4DOWA 4BE1A 2V26A 1KC8C 1U1SA 2M0OA 2CSIA 2QQ9A 2NUPB 2JW4A 2V1RA 1R0CB 4EMKC 2XDPA 4M75C 5DLQE 2LJ3A 2K2MA 1KC8U 3G4SQ 2RNAA 3QWXX 4XTVA 4DQ2A 2FEIA 2DNUA 2W0ZA 3V7RA 3CCQQ 1K73C 1LVKA 5LJ3j 1U5SA 2IVWA 5ECAA 2KXDA 4M78C 1X27A 2CP7A 3VYGA 2FZGB 4CRIA 3RMQA 2CGHA 2AZSA 3RR6A 4HCBA 4JZ3A 1YWOA 3TVTA 4J7FA 4NOYA 1QVGA 4M7DD 3L2ZA 2JS0A 3CCLQ 1IRXA 1VIFA 3ME9A 2JN0A 3N5BB 1VQ6T 1LJOA 4RMOA 4F14A 3H0IA 3UA7A 2A3LA 1Y96A 5J26A 1YCSB 2ZPIB 3HHTB 1QCFA 3C95A 3HFOA 5FWBA 1WQWA 2GGRA 4Y91A 6AT1B 2DL4A 4A4KA 4E7IA 2YXYA 2DIQA 2QQBA 1OX9A 1Y96B 2BE7D 2RHIA 2MF2A 2MI6A 4M77D 4XTUA 1NG2A 3OYYA 1K0XA 2VC8A 4IURA 5FWCA 1VQ5T 1KQ2A 5I11A 3SWNC 5I2MA 2A37A 1GCQC 3UA6A 2KYMA 3OYIA 2EWNA 1U1TA 4BE0A 1YI2T 4GLKA 1X6BA 2E5KA 1N27A 1RI9A 1NPPA 1M8MA 3L2VA 5KCOA 3CC2A 1AEYA 4OVAA 4JS5A 4M7AE 3JCMV 5GANh 2OJ2A 1M3CA 2CZ1B 1TSFA 2QYZA 3L2WA 4IUQA 3NFCA 4BI3A 4C5IA 2DF6A 4BDZA 1S72A 1QP3A 2EGEA 4MMLA 4BACA 1KJWA 3IQLA 4Z88A 2CH4W 5CKEA 3CD6T 1C6VX 1V29B 2MWPA 4E7KA 4IUVA 2JUFA 5CO7A 2K5LA 4QQDA 4FT2A 2G3RA 2R58A 2D6FA 5CR2A 2DPPB 1U06A 5KE3A 2FZCB 2ED0A 1KD1R 4E7LA 2FPEA 3A98A 3L2UA 1HJDA 5LJ5d 4JDSA 2RMOA 1M1KR 3QZ9B 3GP8A 1H8KA 4GLMA 2K79A 1UGQB 4A53A 4FYWB 4C92G 1M4ZA 3J7AF 2LNVA 4M75E 2ZPGB 1LPLA 3QWYA 3M57A 2L3SA 4OF1A 3V8LA 2FPDA 2P4RA 1N9RA 2DE0X 2RQTA 4C0GA 2MAMA 1IGUA 4J9HA 1VQ6Q 1XNIA 5A2QE 2JM8A 2D8JA 2VV5A 4M78E 1WFWA 4M4ZA 5LJ5h 3I55T 3EFRA 4DBQA 3JCMP 2LCLA 1EFNA 3OQ5A 2KXCA 2QEXT 5C0MA 3QJ6A 4A4GA 3DB3A 1JRIA 5J3BA 1UHCA 4NL3A 1TUDA 5KH6A 1G3SA 1ZX6A 5GAOn 2AZVA 1W4SA 4XQ3A 3FJ5A 2L89A 2ZZDA 5GANg 1VQNA 2CUDA 4LD6A 2YUNA 1G3WA 4FSXA 1K9MR 1IXDA 1Q86R 1PC0A 1VYUA 2DYBA 1TG0A 2A36A 2DL5A 4E7JA 2RJDA 2EPDA 3M54A 3MJXA 4JJNK 1K8AC 1H641 1D1BA 1R77A 3QDRB 2ROTA 1W2BP 3CCSA 3A1PA 1YI2Q 1Y57A 2HZYA 4HVUA 3TU4K 2NUTA 2XKOC 4P5NA 3EG0A 4M7DA 1OI1A 1Y07A 3PTAA 2DVEA 3X24B 1JJ2P 1KK7A 1ZUKA 4AT1B 1B07A 2CDTA 2CYZB 4CC3A 1A0NB 2QASA 2NUTB 1K4US 2RQVA 4CI0C 4M7DB 3M9QA 2L3QA 5CK9A 4IUPA 4HCKA 5CCAA 2RD1A 1X43A 1W1FA 4M7AD 1YJ9A 4JUVA 5LJ5g 1CSKA 1WHGA 5I22A 3I9QA 1RLQC 1W2BS 5C6SA 1B3QA 4ORZA 1WHMA 4LDXA 1E6GA 2BZYA 3G71A 1YP5A 3PVLA 4PJOA 1VQPA 3QO3A 2IIMA 2VGNA 4M77A 1D1CA 1Q81R 3NHNA 5CQXA 2RPNA 2K4YA 5HK0A 2JXBA 5GANf 2XHCA 2DJQA 5FROA 5FU7C 2WACA 1K9AA 4KRTA 2HL3A 3I35A 4PJOB 3F70A 4OMQA 3CCJT 3LH0A 2B86A 2FO0A 2QGFB 2X4JA 1ZA2B 3I55Q 2NWMA 3H0FA 3MEAA 1BIAA 4ZN1A 2QEXQ 1VQ9T 4DA4A 4RTYA 3OYMA 3M0UA 5GANj 2KI7A 1GRIA 5FU6C 1YITT 2GQVA 2RK2A 2JJ9A 4M75D 1O75A 1UDLA 1X01A 3QPHA 1PKSA 3H0HA 2L8DA 1G2BA 1LOJA 4F7UA 3CC7T 2ZGWA 2OAUA 1UHFA 4DOVA 2SRCA 1MMDA 5GAN8 5CKFA 2K3YA 5GAOp 2LJ0A 2L2PA 1M1KU 4M78D 3H8ZA 2OAWA 3VU3C 2RM4A 2DZ9A 3CCMQ 3JCMW 1NJIC 3H9NA 3NMZC 2QGGA 5IHKA 3ULRB 3A8LB 2ZPEB 1OPKA 1QMCA 1GFCA 3HTRA 3EHRA 4F7UB 1HXDA 3VKIA 1YHQQ 1XTDA 1FXXA 4OMPA 1SSFA 2KNBB 3QYGB 4N4IA 1ZUUA 4AFSC 2V8KA 2KMTA 3CEYA 2OTLT 4ATOA 3MP8A 5I21A 1VQ8A 1WQ7A 5LJ5f 3EAEA 2QQAA 1VIEA 2MWOA 3CCVA 5HCKA 1VYTA 4MZMA 5GMKj 2OX7A 3ZEHA 5HK3A 4HVWA 3P8BB 1K9MC 4HKEA 4ZGDB 5GJWB 1YN8A 1BCOA 1Q86C 2PUKB 1D0XA 2LCSA 1H3ZA 1R0BG 1RL2A 1BK2A 3JRZA 3SEMA 3SHWA 2EJ9A 1NYGA 2QAZA 2XD0A 4XU0A 2E12A 3JCMb 1BCMA 1Q86U 2KDSA 1PSFA 2M51A 4BUGA 2DX1A 1VQKT 2DXTA 3RNJA 1T3SA 2PUOB 1SHFA 2K5FA 1D1AA 4PL6A 1SHGA 3M0SA 4IKFA 3PIPA 2HCKA 2NUZA 3FJPA 4J9BA 2XI9A 3VS4A 3CCUA 2CS7A 2YDLA 2RB6A 1IREB 5A0GA 1TXQA 2J06A 1GFDA 1UB4A 2YWWA 2DTOA 4C5GA 4BY6B 4KULA 2KT8A 1ZUYA 4OMFB 4LD9K 5AYFA 2YSQA 2CZ6B 1P92A 2HQEA 3OB9A 2D1XA 3GLXA 3CCJQ 3JB9F 5CKHA 3FEOA 4C92C 1W2BA 3SB2A 2J7IA 2RH2A 4UC4A 1QCNA 4L59A 2AKLA 1VQ9Q 5CKBA 1PKTA 2ESWA 2EGCA 3CPWP 1AZEA 1PRLC 4J9FA 3JCMd 4PFOA 4R0KA 2DRKA 4C8QF 2CP3A 2X51A 1OULA 4BD3A 3DLMA 2XU8A 1MV3A 5GMKm
chains in the Genus database with same CATH topology
2HSPA 2KR3A 4DEXA 1NYFA 2RQRA 1NG2A 1K0XA 5FWCA 4J9IA 2YUOA 2GBQA 5I11A 1JXMA 1Z9ZA 2C0IA 2A37A 1WXBA 3CQTA 1GCQC 3UA6A 2V1QA 2ABLA 4DEYA 2KYMA 2YUQA 2MOXA 3VRZA 3I5SA 4J9DA 1X6BA 2VKNA 2E5KA 2J6FA 2VVKA 1UTIA 1RUWA 1RI9A 1FYNA 1M8MA 1PRMC 3U23A 2EYYA 1AEYA 2LZ6B 2K9GA 2DA9A 3TSWA 3EG3A 2OJ2A 1SRMA 2LQWA 1WA7A 1M3CA 2O88A 2GQIA 2EW3A 1N5ZA 1WLPB 2DF6A 2KBTA 4HVVA 2HDAA 1H3HA 2EGEA 2H8HA 1U3OA 2EVRA 1KJWA 3IQLA 4Z88A 1JEGA 4AG1C 3O5ZA 2AK5A 2CH4W 1AVZC 1SSHA 2DRMA 2KRMA 2CT3A 2JS2A 4RTWA 1X6GA 1UJ0A 2C0TA 3C0CA 4LNPA 2RQWA 1KIKA 1NLPC 4OMLA 5IHIA 2D8HA 1T0JA 1U06A 1V1CA 1HD3A 4IIMA 1JO8A 1J3TA 2ED0A 2O9SA 2FPEA 3A98A 1HJDA 1X2KA 2RMOA 1H8KA 4GLMA 2FRWA 2K79A 2KE9A 2DL3A 4J9CA 4CC7A 3QWYA 4Z89A 2L3SA 4E6RA 4FSSA 2JTEA 2FPDA 2P4RA 2RF0A 1KFZA 2DE0X 2RQTA 2LJ1A 4OMOA 4J9HA 2J05A 2JT4A 1QKWA 2A28A 2JM8A 2D8JA 3H41A 3VS7A 1PHTA 1SPKA 1WFWA 4M4ZA 1UJYA 4RTXA 2JMCA 1LCKA 2A08A 1EFNA 4Y92A 2KXCA 1WI7A 2K6DA 2J6KA 4JJDA 2LQNA 3EGUA 3UATA 1S1NA 2OI3A 1NEGA 2KGTA 1ABOA 1UHCA 4GBQA 4JPBW 1BB9A 1TUDA 4AFZC 1WXTA 1ZX6A 2SEMA 4RTVA 2AZVA 3FJ5A 2KYBA 2CUDA 4D8KA 2JMAA 2YUNA 1X69A 2ED1A 1BU1A 2X3XD 1PWTA 1VYUA 2DYBA 4JJBA 1TG0A 2FRYA 4LUDA 2A36A 2DL5A 1OOTA 1VA7A 4RTUA 2PTKA 2EKHA 2X3WD 2RN8A 2JM9A 2EPDA 2BZXA 4F16A 1WIEA 2LMJA 4LUEA 2ROTA 1T3LA 2F2WA 2O9VA 1Y57A 2BTTA 2FPFA 1UUEA 1M3AA 3PE0A 4HVUA 5IHNA 1NLOC 4A63B 4K11A 1GCQA 1NEBA 2DMOA 1UE9A 1QWEA 3EG0A 1ZSGA 4IIOA 1RLPC 2YT6A 1ABQA 1MV0B 1T0HA 2KEAA 1ZUKA 3I5RA 1B07A 1I07A 2DL8A 2CDTA 4CC3A 2EYXA 2ENMA 4J9GA 2CT4A 1A0NB 2ECZA 4RTZA 2LP5A 1GBQA 2W10A 2DL7A 1K4US 2RQUA 1BBZA 2RQVA 4AFUC 2L3QA 1XOVA 2I0NA 1QWFA 3R6NA 1WXUA 4HCKA 1CKAA 4HXJA 1E6HA 2K7AA 1X43A 1W1FA 1HSQA 2C0OA 1WX6A 1CSKA 5I22A 3I9QA 1YWPA 1RLQC 2PZ1A 1B3QA 4ORZA 1QLYA 3M0PA 1E6GA 2BZYA 2GNCA 2QDLA 3M0TA 3UF4A 1YP5A 3PVLA 4LE9A 2IIMA 1AWXA 1AZGB 3VS3A 1UFFA 1E7OA 2KT1A 2O31A 1IO6A 3REAB 3M0QA 1CKBA 1X2QA 2MIOA 3NHNA 2RPNA 5FW9A 1MUZA 2JXBA 1SEMA 1M27C 2DJQA 2EBPA 1K9AA 4KRTA 3I35A 5IH2A 2GTOA 3TSZA 2DM1A 4OMQA 2KRSA 1YNZA 2B86A 2FO0A 3VS0A 2CH4A 2EYWA 1UECA 1ARKA 2NWMA 4AFQC 2YUPA 4EIKA 1M3BA 3H0FA 3KFVA 2CSQA 3VS6A 2HBWA 1VYVA 2CUBA 4JJCA 3VS1A 4AG2C 4RTYA 3M0UA 2G6FX 1Z9QA 1GRIA 3M0RA 4JZ4A 1OV3A 5IXBA 2DLPA 2EYZA 1FMKA 1UDLA 1OPLA 3VRYA 2KROA 1PKSA 2HEQA 3H0HA 2LNHB 1G2BA 2DVJA 1OEBA 5EC7A 4RUGA 1UHFA 2SRCA 2L3PA 3PVQA 1Y0MA 1JXOA 2LJ0A 2L2PA 3THKA 2OAWA 1AWJA 2L0AA 2O2OA 2EQIA 3NMZC 3EG1A 4ZNXA 1AWWA 5IHKA 3ULRB 1JQQA 1WYXA 1OPKA 3RBBB 1GFCA 1GL5A 4OMNA 2M0YA 3EHRA 2XMFA 1ZLMA 5GJVB 1AD5A 4OMPA 2KNBB 1QKXA 4OMMA 4D8DA 1TUCA 1ZUUA 4AFSC 1K0SA 1AOJA 3VS2A 2AKKA 1JU5C 3GBQA 3NGPA 2D0NA 2EGAA 4X1VA 1UGVA 3LH5A 1G83A 1UG1A 4WCIA 5HCKA 2F2VA 1VYTA 1ZBJA 3VS5A 1GBRA 3EHQA 1I0CA 4HVWA 2CSIA 2JW4A 2V1RA 1W6XA 1K1ZA 5GJWB 1YN8A 4LN2A 2LJ3A 1WDXA 2K2MA 2LCSA 2MCNA 2RNAA 3QWXX 1BK2A 2DBMA 2FEIA 2DNUA 2W0ZA 3SEMA 3SHWA 1NYGA 4RTTA 2KRNA 2VWFA 3REBB 2LX7A 1U5SA 5ECAA 2M51A 2KXDA 4J9EA 1K76A 1X27A 2DX1A 2F2XA 3RNJA 1T3SA 1SHFA 2CREA 4ESRA 4QT7A 1SHGA 3M0SA 2ROLA 2HCKA 2NUZA 1SRLA 4J9BA 2AZSA 4JZ3A 4CC4B 1YWOA 3VS4A 5IXFA 2PNIA 3TVTA 2YDLA 3JV3A 2JS0A 2J06A 1GFDA 4Z8AA 1M30A 2K3BA 2KT8A 2BZ8A 1ZUYA 1KSWA 5L23A 1W70A 4F14A 3H0IA 1PNJA 2YSQA 3EG2A 3UA7A 4CC2A 2GTJA 2D1XA 1GCPA 1AWOA 2DILA 1H92A 1NM7A 1YCSB 1QCFA 2J7IA 3NPFA 5FWBA 3ZL7C 2GGRA 2AKLA 1PKTA 2ESWA 2EGCA 1AZEA 2DL4A 2FG0A 1PRLC 4J9FA 4R0KA 2DRKA 2DBKA 2J6OA 4F17A 1I1JA 1MV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HSP A;  2KR3 A;  4DEX A;  1NYF A;  2RQR A;  1NG2 A;  1K0X A;  5FWC A;  4J9I A;  2YUO A;  2GBQ A;  5I11 A;  1JXM A;  1Z9Z A;  2C0I A;  2A37 A;  1WXB A;  3CQT A;  1GCQ C;  3UA6 A;  2V1Q A;  2ABL A;  4DEY A;  2KYM A;  2YUQ A;  2MOX A;  3VRZ A;  3I5S A;  4J9D A;  1X6B A;  2VKN A;  2E5K A;  2J6F A;  2VVK A;  1UTI A;  1RUW A;  1RI9 A;  1FYN A;  1M8M A;  1PRM C;  3U23 A;  2EYY A;  1AEY A;  2LZ6 B;  2K9G A;  2DA9 A;  3TSW A;  3EG3 A;  2OJ2 A;  1SRM A;  2LQW A;  1WA7 A;  1M3C A;  2O88 A;  2GQI A;  2EW3 A;  1N5Z A;  1WLP B;  2DF6 A;  2KBT A;  4HVV A;  2HDA A;  1H3H A;  2EGE A;  2H8H A;  1U3O A;  2EVR A;  1KJW A;  3IQL A;  4Z88 A;  1JEG A;  4AG1 C;  3O5Z A;  2AK5 A;  2CH4 W;  1AVZ C;  1SSH A;  2DRM A;  2KRM A;  2CT3 A;  2JS2 A;  4RTW A;  1X6G A;  1UJ0 A;  2C0T A;  3C0C A;  4LNP A;  2RQW A;  1KIK A;  1NLP C;  4OML A;  5IHI A;  2D8H A;  1T0J A;  1U06 A;  1V1C A;  1HD3 A;  4IIM A;  1JO8 A;  1J3T A;  2ED0 A;  2O9S A;  2FPE A;  3A98 A;  1HJD A;  1X2K A;  2RMO A;  1H8K A;  4GLM A;  2FRW A;  2K79 A;  2KE9 A;  2DL3 A;  4J9C A;  4CC7 A;  3QWY A;  4Z89 A;  2L3S A;  4E6R A;  4FSS A;  2JTE A;  2FPD A;  2P4R A;  2RF0 A;  1KFZ A;  2DE0 X;  2RQT A;  2LJ1 A;  4OMO A;  4J9H A;  2J05 A;  2JT4 A;  1QKW A;  2A28 A;  2JM8 A;  2D8J A;  3H41 A;  3VS7 A;  1PHT A;  1SPK A;  1WFW A;  4M4Z A;  1UJY A;  4RTX A;  2JMC A;  1LCK A;  2A08 A;  1EFN A;  4Y92 A;  2KXC A;  1WI7 A;  2K6D A;  2J6K A;  4JJD A;  2LQN A;  3EGU A;  3UAT A;  1S1N A;  2OI3 A;  1NEG A;  2KGT A;  1ABO A;  1UHC A;  4GBQ A;  4JPB W;  1BB9 A;  1TUD A;  4AFZ C;  1WXT A;  1ZX6 A;  2SEM A;  4RTV A;  2AZV A;  3FJ5 A;  2KYB A;  2CUD A;  4D8K A;  2JMA A;  2YUN A;  1X69 A;  2ED1 A;  1BU1 A;  2X3X D;  1PWT A;  1VYU A;  2DYB A;  4JJB A;  1TG0 A;  2FRY A;  4LUD A;  2A36 A;  2DL5 A;  1OOT A;  1VA7 A;  4RTU A;  2PTK A;  2EKH A;  2X3W D;  2RN8 A;  2JM9 A;  2EPD A;  2BZX A;  4F16 A;  1WIE A;  2LMJ A;  4LUE A;  2ROT A;  1T3L A;  2F2W A;  2O9V A;  1Y57 A;  2BTT A;  2FPF A;  1UUE A;  1M3A A;  3PE0 A;  4HVU A;  5IHN A;  1NLO C;  4A63 B;  4K11 A;  1GCQ A;  1NEB A;  2DMO A;  1UE9 A;  1QWE A;  3EG0 A;  1ZSG A;  4IIO A;  1RLP C;  2YT6 A;  1ABQ A;  1MV0 B;  1T0H A;  2KEA A;  1ZUK A;  3I5R A;  1B07 A;  1I07 A;  2DL8 A;  2CDT A;  4CC3 A;  2EYX A;  2ENM A;  4J9G A;  2CT4 A;  1A0N B;  2ECZ A;  4RTZ A;  2LP5 A;  1GBQ A;  2W10 A;  2DL7 A;  1K4U S;  2RQU A;  1BBZ A;  2RQV A;  4AFU C;  2L3Q A;  1XOV A;  2I0N A;  1QWF A;  3R6N A;  1WXU A;  4HCK A;  1CKA A;  4HXJ A;  1E6H A;  2K7A A;  1X43 A;  1W1F A;  1HSQ A;  2C0O A;  1WX6 A;  1CSK A;  5I22 A;  3I9Q A;  1YWP A;  1RLQ C;  2PZ1 A;  1B3Q A;  4ORZ A;  1QLY A;  3M0P A;  1E6G A;  2BZY A;  2GNC A;  2QDL A;  3M0T A;  3UF4 A;  1YP5 A;  3PVL A;  4LE9 A;  2IIM A;  1AWX A;  1AZG B;  3VS3 A;  1UFF A;  1E7O A;  2KT1 A;  2O31 A;  1IO6 A;  3REA B;  3M0Q A;  1CKB A;  1X2Q A;  2MIO A;  3NHN A;  2RPN A;  5FW9 A;  1MUZ A;  2JXB A;  1SEM A;  1M27 C;  2DJQ A;  2EBP A;  1K9A A;  4KRT A;  3I35 A;  5IH2 A;  2GTO A;  3TSZ A;  2DM1 A;  4OMQ A;  2KRS A;  1YNZ A;  2B86 A;  2FO0 A;  3VS0 A;  2CH4 A;  2EYW A;  1UEC A;  1ARK A;  2NWM A;  4AFQ C;  2YUP A;  4EIK A;  1M3B A;  3H0F A;  3KFV A;  2CSQ A;  3VS6 A;  2HBW A;  1VYV A;  2CUB A;  4JJC A;  3VS1 A;  4AG2 C;  4RTY A;  3M0U A;  2G6F X;  1Z9Q A;  1GRI A;  3M0R A;  4JZ4 A;  1OV3 A;  5IXB A;  2DLP A;  2EYZ A;  1FMK A;  1UDL A;  1OPL A;  3VRY A;  2KRO A;  1PKS A;  2HEQ A;  3H0H A;  2LNH B;  1G2B A;  2DVJ A;  1OEB A;  5EC7 A;  4RUG A;  1UHF A;  2SRC A;  2L3P A;  3PVQ A;  1Y0M A;  1JXO A;  2LJ0 A;  2L2P A;  3THK A;  2OAW A;  1AWJ A;  2L0A A;  2O2O A;  2EQI A;  3NMZ C;  3EG1 A;  4ZNX A;  1AWW A;  5IHK A;  3ULR B;  1JQQ A;  1WYX A;  1OPK A;  3RBB B;  1GFC A;  1GL5 A;  4OMN A;  2M0Y A;  3EHR A;  2XMF A;  1ZLM A;  5GJV B;  1AD5 A;  4OMP A;  2KNB B;  1QKX A;  4OMM A;  4D8D A;  1TUC A;  1ZUU A;  4AFS C;  1K0S A;  1AOJ A;  3VS2 A;  2AKK A;  1JU5 C;  3GBQ A;  3NGP A;  2D0N A;  2EGA A;  4X1V A;  1UGV A;  3LH5 A;  1G83 A;  1UG1 A;  4WCI A;  5HCK A;  2F2V A;  1VYT A;  1ZBJ A;  3VS5 A;  1GBR A;  3EHQ A;  1I0C A;  4HVW A;  2CSI A;  2JW4 A;  2V1R A;  1W6X A;  1K1Z A;  5GJW B;  1YN8 A;  4LN2 A;  2LJ3 A;  1WDX A;  2K2M A;  2LCS A;  2MCN A;  2RNA A;  3QWX X;  1BK2 A;  2DBM A;  2FEI A;  2DNU A;  2W0Z A;  3SEM A;  3SHW A;  1NYG A;  4RTT A;  2KRN A;  2VWF A;  3REB B;  2LX7 A;  1U5S A;  5ECA A;  2M51 A;  2KXD A;  4J9E A;  1K76 A;  1X27 A;  2DX1 A;  2F2X A;  3RNJ A;  1T3S A;  1SHF A;  2CRE A;  4ESR A;  4QT7 A;  1SHG A;  3M0S A;  2ROL A;  2HCK A;  2NUZ A;  1SRL A;  4J9B A;  2AZS A;  4JZ3 A;  4CC4 B;  1YWO A;  3VS4 A;  5IXF A;  2PNI A;  3TVT A;  2YDL A;  3JV3 A;  2JS0 A;  2J06 A;  1GFD A;  4Z8A A;  1M30 A;  2K3B A;  2KT8 A;  2BZ8 A;  1ZUY A;  1KSW A;  5L23 A;  1W70 A;  4F14 A;  3H0I A;  1PNJ A;  2YSQ A;  3EG2 A;  3UA7 A;  4CC2 A;  2GTJ A;  2D1X A;  1GCP A;  1AWO A;  2DIL A;  1H92 A;  1NM7 A;  1YCS B;  1QCF A;  2J7I A;  3NPF A;  5FWB A;  3ZL7 C;  2GGR A;  2AKL A;  1PKT A;  2ESW A;  2EGC A;  1AZE A;  2DL4 A;  2FG0 A;  1PRL C;  4J9F A;  4R0K A;  2DRK A;  2DBK A;  2J6O A;  4F17 A;  1I1J A;  1MV3 A; 
#chains in the Genus database with same CATH topology
 3OYH A;  2HSP A;  3EFS A;  1NYF A;  4B6M A;  3VUB A;  3CC7 Q;  1JJ2 A;  3ASK A;  1Z9Z A;  2C0I A;  1ZSZ C;  1WXB A;  3CQT A;  3X20 B;  2V1Q A;  3NTK A;  2MYS A;  1Q81 U;  4M7A A;  3J81 E;  4MMK A;  2QTX A;  4NS5 A;  2VKN A;  2CP0 A;  3E1S A;  4BB7 A;  5EG2 A;  4Q5W A;  3BDL A;  3JSC A;  3JCM h;  4MDW A;  4EPC A;  1WJS A;  2LZ6 B;  2K5I A;  5GAN 5;  4JRK A;  2K9G A;  3TSW A;  2HKQ B;  2OTL Q;  1WA7 A;  4PJO G;  4M7A B;  3HRT A;  4B9W A;  4JLG A;  1QQJ A;  4N0A C;  1N5Z A;  4XTX A;  1MNE A;  2LVM A;  3FLG A;  4HVV A;  5KYX A;  1Q7Y C;  3CC2 T;  3OYF A;  1U3O A;  2EVR A;  1JEG A;  4KGV B;  3O5Z A;  4AG1 C;  1D3B A;  1WNL A;  3CC4 A;  2QQS A;  1SSH A;  2CT3 A;  4ELY C;  4RTW A;  1WJR A;  1X6G A;  1OZ3 A;  1UJ0 A;  2C0T A;  2RQW A;  1NLP C;  5IHI A;  1S72 T;  5KYX B;  4EMK A;  1K73 U;  3JCM e;  3PGG A;  4M75 A;  1TU0 B;  1KQS S;  1J3T A;  2YLC A;  5GAN 7;  1D3B B;  1X2K A;  1VQK Q;  2GFU A;  3OY9 A;  2KE9 A;  2DL3 A;  3L1A A;  4J9C A;  1NE8 A;  4CC7 A;  3OS5 A;  4EMK B;  2DTI A;  3E9G A;  4M78 A;  4Z89 A;  1BIB A;  4PJM A;  4FSS A;  2HQX A;  4M75 B;  5GAO m;  2ATC B;  1K8A R;  2LJ1 A;  1IHW A;  4OMO A;  2JT4 A;  1QKW A;  1YJN Q;  1PHT A;  5DY9 A;  1PD0 A;  1UJY A;  4C0Z A;  3VJP A;  1RAD B;  4A4F A;  4M78 B;  4E47 A;  1LCK A;  4JJD A;  2VAS A;  2LQN A;  2OI3 A;  1U8R A;  1ABO A;  2COW A;  3JCM g;  4D6W A;  2YRC A;  2KAF A;  1D0Z A;  3CCE T;  4BDY A;  5GAO q;  1VOM A;  4J5Y A;  2SEM A;  2H3J A;  2OTJ A;  1RAA B;  3E9F A;  3KBG A;  2ED1 A;  2E3H A;  3RES A;  2M16 A;  4FL6 A;  3QDF A;  4OGE A;  2PVO B;  2MMP A;  3QKJ A;  2BKD N;  2PTK A;  4ZN3 A;  3V7C A;  4LDW A;  4OB1 B;  4C92 E;  2CZ0 B;  2HSE B;  1VQN T;  4LUE A;  1T3L A;  1M8V A;  3JB9 J;  1VQL A;  4JRI A;  3L42 A;  2BTT A;  2XID A;  2E4H A;  2P0P A;  1M3A A;  5IHN A;  1NLO C;  1D09 B;  3SWN A;  1GCQ A;  1NEB A;  3CBP A;  2DMO A;  4RCC A;  4KT0 E;  1ZSG A;  4IIO A;  1Q82 C;  1WJQ A;  1ABQ A;  4WF2 A;  3OMG A;  1BKB A;  4ZTJ A;  1T0H A;  1ZBX A;  1ZQ1 A;  4LDY A;  2PQW A;  3CCS T;  3O8V A;  3T9N A;  2DL8 A;  4AMC A;  2EFI A;  2EYX A;  1FWZ A;  1VQ7 A;  2ENM A;  2LDM A;  4GY5 A;  3SWN B;  3MKD A;  2LP5 A;  4OP0 A;  3JB9 G;  3MHX A;  3PMI A;  4L6V 5;  2RA2 A;  5GAM d;  5GAN 3;  3CC2 Q;  3GIB A;  1VQ4 A;  4ELZ C;  4KBM B;  1QWF A;  1C0M A;  3CMA A;  3R6N A;  3JAM E;  1WXU A;  3FC3 A;  1CKA A;  1OQK A;  3RUX A;  2AT1 B;  4C8Q G;  2E64 A;  4FIB A;  2I2L A;  3VV0 A;  4XAX B;  1S72 Q;  2PZ1 A;  4A54 A;  4FYV B;  3WVE B;  1I5O B;  2BIV A;  3V8J A;  1I81 A;  1QLY A;  3M0P A;  2QDL A;  2DKG A;  2DAQ A;  2EYQ A;  1RAB B;  3L2Q A;  3OYG A;  1AWX A;  5CAI A;  5GAM h;  1G3T A;  3REA B;  3JCM f;  1X2Q A;  2MIO A;  3HKS A;  2O4X A;  1V76 A;  5FW9 A;  1YJ9 T;  1NJI R;  1MUZ A;  3SD4 A;  1OYX A;  4XU2 A;  3A8G B;  1SEM A;  3C94 A;  2EKO A;  3G71 T;  1ZHI A;  1TTH B;  2RHX A;  1VQP T;  4FW1 A;  2DM1 A;  1DJ7 B;  2VXE A;  2CH4 A;  2EYW A;  1UEC A;  2O4X B;  2RK1 A;  2YUP A;  1KQS A;  5IN1 A;  1M3B A;  3I56 A;  4TVR A;  3HPW A;  2ZPB B;  4KUD K;  1QVF P;  1Z9Q A;  5IXB A;  1OV3 A;  3CME A;  2P84 A;  2EYZ A;  4XTY A;  3VRY A;  3GNG A;  3X26 B;  4C5H A;  3OYD A;  5KYY A;  1N9S A;  8ATC B;  5GAM e;  3CCE Q;  2DVJ A;  3OYK A;  3DLL A;  2L3P A;  8AT1 B;  2P0Q A;  1VQ5 Q;  3D7S B;  3FIF A;  2O2O A;  5GMK e;  3HRU A;  3A5Z B;  5KYY B;  3EG1 A;  4ZNX A;  2VXF A;  2HBP A;  3RBB B;  4OMN A;  2M0Y A;  1VQN Q;  1BI0 A;  1K8A U;  2Z0W A;  1KHC A;  3UT1 A;  3VS2 A;  1TOV A;  3NGP A;  5CQY A;  4WTO B;  1KG1 A;  2EGA A;  3RDV A;  3PNW C;  1YBY A;  1UGV A;  2VGM A;  3RIR A;  2RI2 A;  1TH7 A;  1QVF S;  3LWI A;  2EJG A;  5DM7 R;  3OW2 P;  2EAY A;  1GBR A;  3EHQ A;  4M7D F;  1I5L A;  1X6O A;  5GAM g;  3CCS Q;  3EG9 A;  4FU6 A;  4B9X A;  4C92 D;  3CD6 Q;  1VQ8 T;  3OA6 A;  2DBM A;  1M5Q 1;  2KRN A;  4LDU A;  4OB0 B;  3REB B;  2LX7 A;  3P8H A;  4PJO C;  1EIF A;  1M90 C;  4KGZ B;  4PJJ A;  2DIG A;  1G3Y A;  4ESR A;  3CPF A;  4DBR A;  1SRL A;  3URG A;  1MMN A;  2PNI A;  3OS1 A;  5LJ3 d;  3OYE A;  3S3N A;  1JJ2 S;  1HK9 A;  3JV3 A;  5D7U A;  3DKM A;  4PJO F;  4V2S A;  1VQM A;  2XG8 D;  1YJW A;  1YJ9 Q;  3EH1 A;  3OW2 S;  4M77 F;  5L23 A;  3FB9 A;  4M77 B;  5GMK i;  5GAN 2;  1PNJ A;  3AT1 B;  5KCH A;  2GTJ A;  2JZ2 A;  3CBM A;  3G71 Q;  3CCU T;  1PCX A;  1VQP Q;  1VQO A;  4KGX B;  2E1H A;  4LDV A;  4R56 A;  1PM3 A;  3X25 B;  4J6X A;  5AT1 B;  1MHN A;  5KYN A;  4LXC A;  5DLO A;  1SKU B;  2V8J A;  2M1H A;  3NPF A;  2R5A A;  3OS0 A;  1IB8 A;  2FG0 A;  1FX7 A;  3CCM A;  1Q7Y R;  2DEQ A;  1KD1 U;  2JTF A;  1I4K 1;  4F17 A;  3SDZ A;  1YHQ A;  4IUT A;  4E7H A;  2B8A A;  2CP2 A;  2GBQ A;  4F7U F;  1JXM A;  4OB2 B;  3G6E T;  2JOY A;  5GAM f;  2EIF A;  2PVG B;  2ABL A;  2E70 A;  3SFM A;  5HY6 A;  2YUQ A;  2E3I A;  2MOX A;  3L2R A;  1NJI U;  1BI1 A;  2J6F A;  1UGS B;  1RUW A;  1FYN A;  3LGL A;  2EYY A;  4FYX B;  5LJ3 e;  1F1B B;  4E2F B;  3MO8 A;  5I2S A;  3MPU B;  1RAI B;  2HNI A;  2O88 A;  2KVQ G;  2WSE E;  1KHI A;  3JB9 I;  3CBO A;  1WHK A;  2KBT A;  2F5T X;  1H3H A;  2H8H A;  4YTL A;  3TRE A;  2GCX A;  5LJ5 j;  2AK5 A;  1AVZ C;  1N8R C;  1K9M U;  5GAN 6;  2DET A;  2JS2 A;  4QQG A;  4XU1 A;  4DBF A;  3C0C A;  5GAO l;  1KIK A;  2E6Z A;  3S6W A;  1T0J A;  1MMG A;  2YLB A;  2K2V A;  1HD3 A;  1RAC B;  1JO8 A;  3ZBD A;  4HCC A;  3QSU A;  1GXI E;  3CC4 T;  4ANJ A;  5L8R E;  3E19 A;  2FRW A;  2KQW A;  3GNF B;  3CCR A;  3BW1 A;  1QVF A;  3OYL A;  2V8I A;  2CP6 A;  4FM4 B;  2YRV A;  3BDU A;  3CCJ A;  4X34 A;  2VB6 A;  3RER A;  3EFO A;  3OYC A;  1XQH A;  3EGD A;  2RJF A;  2LCC A;  2A28 A;  4C8Q C;  3VS7 A;  4X9C A;  1VQ9 A;  1SPK A;  3DB4 A;  2LX9 A;  3WVD B;  3A8M B;  3Q1J A;  4RTX A;  1B34 A;  3CCU Q;  2A08 A;  4J83 A;  4Y92 A;  2Y4X A;  2M02 A;  4RG8 A;  1WI7 A;  2K6D A;  1YIJ A;  4PLI A;  4HA8 A;  3EGU A;  3UAT A;  1S1N A;  3EFO B;  1Q82 R;  1OU8 A;  1Q95 G;  4M7D G;  2QTV A;  2F5K A;  1YIT Q;  4GBQ A;  1BB9 A;  3M59 A;  1LNX A;  1WXT A;  2LQK A;  4QVD A;  3JB9 H;  4RTV A;  1SG5 A;  1B34 B;  2COZ A;  2KSS A;  1HYO A;  4D8K A;  4C0D C;  4C92 A;  4RCB A;  1BU1 A;  3X28 B;  3CXC P;  1PWT A;  4JJB A;  2FRY A;  3OW2 A;  1R8O B;  2X35 A;  2EQJ A;  1VA7 A;  4MDX A;  4RTU A;  2QA4 A;  2X3W D;  4Z02 A;  2RN8 A;  2E41 A;  3M5A A;  2OTJ T;  3G6E Q;  1MND A;  4QKU A;  4QQ6 A;  1WIE A;  3UWN A;  2F2W A;  4C92 B;  1PSE A;  3TQ7 P;  3LGF A;  2O9V A;  4MZP A;  3PE0 A;  4M7A F;  1KD1 C;  3ER0 A;  1ZSZ A;  3G4S A;  2DK3 A;  3MET A;  3CCQ A;  2LTO A;  1RLP C;  2O01 E;  4M77 G;  3CPW S;  2KEA A;  3RMS A;  2GF7 A;  5D6Y A;  2DEU A;  4FW2 A;  9ATC B;  1I07 A;  5LJ3 f;  1VQL T;  2IPO B;  4J9G A;  2CT4 A;  2ECZ A;  4RTZ A;  1ZSZ B;  2W10 A;  3LX7 A;  1BBZ A;  3C4S A;  1Q7Y U;  4J6W A;  5A0L A;  4AFU C;  3CXC S;  1VQK A;  3GOX A;  2I0N A;  1ACM B;  4N0A A;  1BI3 A;  1X75 C;  3QYH B;  3CCL A;  3JCM c;  4F04 B;  1E6H A;  2K7A A;  2AIR B;  1VQ7 T;  2C0O A;  1WX6 A;  1YWP A;  3RKY A;  1WHJ A;  1I8F A;  5KYW A;  1VQ4 T;  2GNC A;  1RAG B;  2EQU A;  2DO3 A;  2MPX C;  3CC4 Q;  2C06 A;  4ZGE B;  3CMA T;  4M75 F;  4F7U G;  1AZG B;  4II1 A;  1YJN A;  1E7O A;  1IO6 A;  3M0Q A;  3RKW A;  4EDU A;  3HSB A;  5KYW B;  3QZ5 B;  1IHV A;  5J39 A;  4KH1 B;  4M78 F;  4QVZ A;  5IH2 A;  2GTO A;  1QCO A;  3TSZ A;  2KRS A;  1RI0 A;  1UGP B;  2JVV A;  3LLR A;  1M1F A;  2WSC E;  1ARK A;  4HT9 A;  4ME7 A;  4EIK A;  2FZK B;  2DFU A;  1VYV A;  2CUB A;  4PNO A;  2DXB A;  2R5M A;  3WXM B;  2DLP A;  1FMK A;  2HAX A;  4FCY A;  1OPL A;  2NLU A;  3JCM J;  1FMV A;  4PFP A;  3QII A;  4C8Q E;  1OEB A;  4RUG A;  2LC4 A;  3PVQ A;  3I56 T;  1JXO A;  4ZGJ B;  4PJO D;  2EQK A;  3A8O B;  3THK A;  1AT1 B;  2L0A A;  5GAN d;  3CME T;  2COY A;  3MP6 A;  1IGQ A;  1AWW A;  2ZAE A;  3V7S A;  1O9S A;  3QBY A;  1M90 R;  1WYX A;  3QXE B;  1GL5 A;  5GAO r;  2QK0 A;  2XMF A;  3QJY A;  4OB3 B;  2OTJ Q;  5GJV B;  4ZTF A;  1QKX A;  4OMM A;  2DD5 A;  2CP5 A;  4D8D A;  2RI5 A;  1TUC A;  1TUG B;  2AKK A;  1JU5 C;  3GBQ A;  3KUF A;  2D0N A;  3TEE A;  1PG5 B;  1KQ1 A;  4X1V A;  2QI2 A;  2BUD A;  1EX4 A;  3LH5 A;  2NYS A;  4X9D A;  3RKX A;  1XJW B;  2F2V A;  1ZBJ A;  2K3X A;  4XU3 A;  3VS5 A;  2R57 A;  1Q82 U;  1I0C A;  1MGQ A;  3AHU A;  3QG1 A;  3A8H B;  1VQL Q;  3BE3 A;  1W6X A;  1K1Z A;  2QQR A;  2L3R A;  3EGX A;  4LN2 A;  1WDX A;  2MCN A;  1OZ2 A;  7AT1 B;  1C1A A;  4MZT A;  3OSS C;  1WZO A;  4A4E A;  2LRQ A;  4RTT A;  2HD0 A;  2RHY A;  2VWF A;  3G1J A;  1NBE B;  4J9E A;  1K76 A;  5A0D A;  2F2X A;  1VQ6 A;  3EGX B;  1VQ7 Q;  1G8X A;  2CRE A;  3NTI A;  4QT7 A;  1OU9 A;  3C12 A;  2ROL A;  3CPW A;  2YRD A;  4O6J A;  4CC4 B;  2HKN A;  4QVC A;  5IXF A;  5KE2 A;  1VQ4 Q;  5GAN e;  2JTM A;  1Y71 A;  3CMA Q;  2ZPH B;  2X4Y A;  1OX8 A;  3H6Z A;  5IAY A;  4Z8A A;  1FMW A;  1M30 A;  5GMK h;  3MEU A;  2K3B A;  2BZ8 A;  2E6N A;  1KSW A;  5HKC A;  1W70 A;  1WPY A;  4M7A G;  3CXC A;  3EG2 A;  1RAF B;  4CC2 A;  2YHT A;  3PIO A;  3PT9 A;  3S3O A;  1GCP A;  5LL6 S;  1AWO A;  2DIL A;  1H92 A;  1NM7 A;  3CCE A;  4E7Z A;  1VQM T;  3PMT A;  2XDD A;  2H3E B;  1YJW T;  3JCM X;  2MK5 A;  4PFZ A;  5CKD A;  1NZ9 A;  1VQ5 A;  3ZL7 C;  2DXC A;  5D6X A;  1VQO T;  1YI2 A;  2DBK A;  2J6O A;  1N6A A;  1I1J A;  1N8R R;  3HL8 A;  4HCZ A;  2KR3 A;  4DEX A;  5IT9 E;  2P4T A;  2RQR A;  3I56 Q;  4J9I A;  2YUO A;  3V8K A;  2CZ7 B;  4J7I A;  3CCM T;  4DEY A;  2RI3 A;  3CME Q;  4M7D C;  3VRZ A;  3OMC A;  4XK8 E;  1ZA1 B;  3JB9 D;  3I5S A;  4J9D A;  4PK4 A;  3OS2 A;  2VVK A;  4VUB A;  4M75 G;  3MP1 A;  1YHQ T;  1UTI A;  3UPU A;  4J6Y A;  5LJ5 e;  3OYA A;  1PRM C;  3U23 A;  4DBH A;  3GF5 A;  1BI2 A;  1SF9 A;  2M9U A;  2DA9 A;  3CD6 A;  3EG3 A;  2Y4Y A;  1SRM A;  4E7S A;  4C8Q D;  2LQW A;  3PFS A;  2GQI A;  4M78 G;  1QVP A;  1JBM A;  2EW3 A;  1WHH A;  2ZPF B;  3TCJ A;  3ZFJ A;  1WLP B;  2KY9 A;  2HDA A;  3LWH A;  2RHZ A;  3G7Z A;  1MMA A;  2XIC A;  4PLL A;  3CCV T;  2DRM A;  2KRM A;  3FRN A;  5FLX E;  2ZCF B;  4EMH A;  5CIU A;  3EG9 B;  4NL2 A;  2FB7 A;  4LNP A;  4O5V A;  4OML A;  2D8H A;  4M77 C;  3OYJ A;  2IG0 A;  1V1C A;  4IIM A;  2LQ8 A;  2EQM A;  1VUB A;  2O9S A;  2DTH A;  2FHD A;  1M90 U;  3I55 A;  2FYK A;  2QG9 B;  3QHS A;  4N4H A;  4JS4 A;  2CKK A;  3HP9 A;  4E6R A;  2QEX A;  2JTE A;  1QW1 A;  2RF0 A;  1KFZ A;  2KK4 A;  2J05 A;  5GMK l;  4KUI A;  1JB0 E;  3H41 A;  3E2U A;  4RKU E;  4JRQ A;  4JRP A;  3CCR T;  3OYN A;  3M4Y A;  2JMC A;  2FL7 A;  2DXU A;  5LJ3 h;  4BI4 A;  2J6K A;  4XTW A;  1NEG A;  1VQM Q;  2KGT A;  2HQH A;  5CVI A;  5FRN A;  1QVG P;  1YJW Q;  4JPB W;  2JNG A;  1NPR A;  4AFZ C;  3GPL A;  4N4G A;  1KC8 R;  2XDB A;  1M9S A;  3VYH B;  3KXT A;  5FU7 B;  2KYB A;  2JMA A;  1M1K C;  5GAN 4;  1YIJ T;  1X69 A;  2D0Q B;  3MEV A;  2DER A;  3P8D A;  1VQO Q;  2A7Y A;  2X3X D;  4LUD A;  2PU9 B;  2XK0 A;  2VUB A;  1OOT A;  3OBY A;  4PKC C;  2EKH A;  3M56 A;  1K73 R;  2JM9 A;  1QP2 A;  4KH0 B;  2X4W A;  3R6O A;  4C0F A;  2BZX A;  3J80 E;  4F16 A;  2D9T A;  5FU6 B;  2LMJ A;  1M1G A;  2EJF A;  4IUU A;  2FPF A;  2F1L A;  1UUE A;  3BFM A;  1UEB A;  2LT4 A;  4A63 B;  4K11 A;  2DZC A;  5GAM j;  1UE9 A;  1M2V A;  1QWE A;  2QA4 T;  2YT6 A;  2X9H A;  2FVU A;  3QUI A;  1MV0 B;  2AHJ B;  2RO0 A;  4OGC A;  1QVG S;  3EH2 A;  1AHJ B;  4BI8 B;  3I5R A;  1YCY A;  2HMA A;  4L5G A;  4M7D E;  1GBQ A;  3G4S T;  2DL7 A;  1M2V B;  2RQU A;  2E65 A;  1VQ8 Q;  3CCQ T;  4BY6 C;  3INZ A;  1WHL A;  3HRS A;  5FRM A;  1XOV A;  3CCV Q;  1G5V A;  2BE9 B;  1TS9 A;  1N8R U;  3M53 A;  2QDY B;  2LT1 A;  4HXJ A;  1WGS A;  1HSQ A;  1UGR B;  3BY7 A;  5LJ3 g;  2GFA A;  1IZ6 A;  1EZZ B;  3HFN A;  3M0T A;  3UF4 A;  4RG2 A;  4J8O A;  3OYB A;  4LE9 A;  5D6W A;  3M55 A;  3VS3 A;  4PJN A;  1UFF A;  3CCL T;  2QXF A;  2O31 A;  2KT1 A;  5KYU A;  1B7T A;  1CKB A;  3UDC A;  2WSF E;  2DJZ A;  3JCM Q;  2RJE A;  4PJO E;  1M27 C;  1PD1 A;  4FT4 A;  2P0K A;  2VYT A;  4BE2 A;  2EBP A;  4XTZ A;  3OSV A;  2E10 A;  4M77 E;  1YIT A;  4A4H A;  1YJN T;  2X4X A;  3MEW A;  5KYU B;  1YNZ A;  1YFN A;  3OBW A;  2L5Q A;  3VS0 A;  3CCR Q;  3EGD B;  3CC7 A;  3LYI A;  4AFQ C;  1RAE B;  2DYI A;  2Y90 A;  3KFV A;  3VUZ A;  4C8Q A;  2CSQ A;  3VS6 A;  2HBW A;  4JJC A;  3VS1 A;  4AG2 C;  3S3M A;  1RAH B;  3M0R A;  2G6F X;  1M2O A;  4JZ4 A;  4PJL A;  3M58 A;  2E5Q A;  5M9O A;  1D0Y A;  2KRO A;  2HEQ A;  4FYY B;  3G6E A;  2LNH B;  2RJC A;  4M7A C;  1BYM A;  5EC7 A;  1Y0M A;  4C8Q B;  4HT8 A;  3FDR A;  1YIJ Q;  1TWB A;  1AWJ A;  2F69 A;  1Q81 C;  2OTL A;  2K57 A;  4Y28 E;  4C92 F;  2EQI A;  2DD4 A;  4F7U E;  2PVD B;  1JQQ A;  4R55 A;  3LW5 E;  1ZLM A;  2RHU A;  3MCA B;  4C5E A;  1AD5 A;  1Y7X A;  1KQS P;  4QW2 A;  2NUP A;  1K0S A;  2HL5 C;  1AOJ A;  4JLI A;  3NTH A;  4C0D B;  1G83 A;  3M4G A;  1UG1 A;  2QA4 Q;  4WCI A;  2A0F B;  4EMG A;  4DOW A;  4BE1 A;  2V26 A;  1KC8 C;  1U1S A;  2M0O A;  2CSI A;  2QQ9 A;  2NUP B;  2JW4 A;  2V1R A;  1R0C B;  4EMK C;  2XDP A;  4M75 C;  5DLQ E;  2LJ3 A;  2K2M A;  1KC8 U;  3G4S Q;  2RNA A;  3QWX X;  4XTV A;  4DQ2 A;  2FEI A;  2DNU A;  2W0Z A;  3V7R A;  3CCQ Q;  1K73 C;  1LVK A;  5LJ3 j;  1U5S A;  2IVW A;  5ECA A;  2KXD A;  4M78 C;  1X27 A;  2CP7 A;  3VYG A;  2FZG B;  4CRI A;  3RMQ A;  2CGH A;  2AZS A;  3RR6 A;  4HCB A;  4JZ3 A;  1YWO A;  3TVT A;  4J7F A;  4NOY A;  1QVG A;  4M7D D;  3L2Z A;  2JS0 A;  3CCL Q;  1IRX A;  1VIF A;  3ME9 A;  2JN0 A;  3N5B B;  1VQ6 T;  1LJO A;  4RMO A;  4F14 A;  3H0I A;  3UA7 A;  2A3L A;  1Y96 A;  5J26 A;  1YCS B;  2ZPI B;  3HHT B;  1QCF A;  3C95 A;  3HFO A;  5FWB A;  1WQW A;  2GGR A;  4Y91 A;  6AT1 B;  2DL4 A;  4A4K A;  4E7I A;  2YXY A;  2DIQ A;  2QQB A;  1OX9 A;  1Y96 B;  2BE7 D;  2RHI A;  2MF2 A;  2MI6 A;  4M77 D;  4XTU A;  1NG2 A;  3OYY A;  1K0X A;  2VC8 A;  4IUR A;  5FWC A;  1VQ5 T;  1KQ2 A;  5I11 A;  3SWN C;  5I2M A;  2A37 A;  1GCQ C;  3UA6 A;  2KYM A;  3OYI A;  2EWN A;  1U1T A;  4BE0 A;  1YI2 T;  4GLK A;  1X6B A;  2E5K A;  1N27 A;  1RI9 A;  1NPP A;  1M8M A;  3L2V A;  5KCO A;  3CC2 A;  1AEY A;  4OVA A;  4JS5 A;  4M7A E;  3JCM V;  5GAN h;  2OJ2 A;  1M3C A;  2CZ1 B;  1TSF A;  2QYZ A;  3L2W A;  4IUQ A;  3NFC A;  4BI3 A;  4C5I A;  2DF6 A;  4BDZ A;  1S72 A;  1QP3 A;  2EGE A;  4MML A;  4BAC A;  1KJW A;  3IQL A;  4Z88 A;  2CH4 W;  5CKE A;  3CD6 T;  1C6V X;  1V29 B;  2MWP A;  4E7K A;  4IUV A;  2JUF A;  5CO7 A;  2K5L A;  4QQD A;  4FT2 A;  2G3R A;  2R58 A;  2D6F A;  5CR2 A;  2DPP B;  1U06 A;  5KE3 A;  2FZC B;  2ED0 A;  1KD1 R;  4E7L A;  2FPE A;  3A98 A;  3L2U A;  1HJD A;  5LJ5 d;  4JDS A;  2RMO A;  1M1K R;  3QZ9 B;  3GP8 A;  1H8K A;  4GLM A;  2K79 A;  1UGQ B;  4A53 A;  4FYW B;  4C92 G;  1M4Z A;  3J7A F;  2LNV A;  4M75 E;  2ZPG B;  1LPL A;  3QWY A;  3M57 A;  2L3S A;  4OF1 A;  3V8L A;  2FPD A;  2P4R A;  1N9R A;  2DE0 X;  2RQT A;  4C0G A;  2MAM A;  1IGU A;  4J9H A;  1VQ6 Q;  1XNI A;  5A2Q E;  2JM8 A;  2D8J A;  2VV5 A;  4M78 E;  1WFW A;  4M4Z A;  5LJ5 h;  3I55 T;  3EFR A;  4DBQ A;  3JCM P;  2LCL A;  1EFN A;  3OQ5 A;  2KXC A;  2QEX T;  5C0M A;  3QJ6 A;  4A4G A;  3DB3 A;  1JRI A;  5J3B A;  1UHC A;  4NL3 A;  1TUD A;  5KH6 A;  1G3S A;  1ZX6 A;  5GAO n;  2AZV A;  1W4S A;  4XQ3 A;  3FJ5 A;  2L89 A;  2ZZD A;  5GAN g;  1VQN A;  2CUD A;  4LD6 A;  2YUN A;  1G3W A;  4FSX A;  1K9M R;  1IXD A;  1Q86 R;  1PC0 A;  1VYU A;  2DYB A;  1TG0 A;  2A36 A;  2DL5 A;  4E7J A;  2RJD A;  2EPD A;  3M54 A;  3MJX A;  4JJN K;  1K8A C;  1H64 1;  1D1B A;  1R77 A;  3QDR B;  2ROT A;  1W2B P;  3CCS A;  3A1P A;  1YI2 Q;  1Y57 A;  2HZY A;  4HVU A;  3TU4 K;  2NUT A;  2XKO C;  4P5N A;  3EG0 A;  4M7D A;  1OI1 A;  1Y07 A;  3PTA A;  2DVE A;  3X24 B;  1JJ2 P;  1KK7 A;  1ZUK A;  4AT1 B;  1B07 A;  2CDT A;  2CYZ B;  4CC3 A;  1A0N B;  2QAS A;  2NUT B;  1K4U S;  2RQV A;  4CI0 C;  4M7D B;  3M9Q A;  2L3Q A;  5CK9 A;  4IUP A;  4HCK A;  5CCA A;  2RD1 A;  1X43 A;  1W1F A;  4M7A D;  1YJ9 A;  4JUV A;  5LJ5 g;  1CSK A;  1WHG A;  5I22 A;  3I9Q A;  1RLQ C;  1W2B S;  5C6S A;  1B3Q A;  4ORZ A;  1WHM A;  4LDX A;  1E6G A;  2BZY A;  3G71 A;  1YP5 A;  3PVL A;  4PJO A;  1VQP A;  3QO3 A;  2IIM A;  2VGN A;  4M77 A;  1D1C A;  1Q81 R;  3NHN A;  5CQX A;  2RPN A;  2K4Y A;  5HK0 A;  2JXB A;  5GAN f;  2XHC A;  2DJQ A;  5FRO A;  5FU7 C;  2WAC A;  1K9A A;  4KRT A;  2HL3 A;  3I35 A;  4PJO B;  3F70 A;  4OMQ A;  3CCJ T;  3LH0 A;  2B86 A;  2FO0 A;  2QGF B;  2X4J A;  1ZA2 B;  3I55 Q;  2NWM A;  3H0F A;  3MEA A;  1BIA A;  4ZN1 A;  2QEX Q;  1VQ9 T;  4DA4 A;  4RTY A;  3OYM A;  3M0U A;  5GAN j;  2KI7 A;  1GRI A;  5FU6 C;  1YIT T;  2GQV A;  2RK2 A;  2JJ9 A;  4M75 D;  1O75 A;  1UDL A;  1X01 A;  3QPH A;  1PKS A;  3H0H A;  2L8D A;  1G2B A;  1LOJ A;  4F7U A;  3CC7 T;  2ZGW A;  2OAU A;  1UHF A;  4DOV A;  2SRC A;  1MMD A;  5GAN 8;  5CKF A;  2K3Y A;  5GAO p;  2LJ0 A;  2L2P A;  1M1K U;  4M78 D;  3H8Z A;  2OAW A;  3VU3 C;  2RM4 A;  2DZ9 A;  3CCM Q;  3JCM W;  1NJI C;  3H9N A;  3NMZ C;  2QGG A;  5IHK A;  3ULR B;  3A8L B;  2ZPE B;  1OPK A;  1QMC A;  1GFC A;  3HTR A;  3EHR A;  4F7U B;  1HXD A;  3VKI A;  1YHQ Q;  1XTD A;  1FXX A;  4OMP A;  1SSF A;  2KNB B;  3QYG B;  4N4I A;  1ZUU A;  4AFS C;  2V8K A;  2KMT A;  3CEY A;  2OTL T;  4ATO A;  3MP8 A;  5I21 A;  1VQ8 A;  1WQ7 A;  5LJ5 f;  3EAE A;  2QQA A;  1VIE A;  2MWO A;  3CCV A;  5HCK A;  1VYT A;  4MZM A;  5GMK j;  2OX7 A;  3ZEH A;  5HK3 A;  4HVW A;  3P8B B;  1K9M C;  4HKE A;  4ZGD B;  5GJW B;  1YN8 A;  1BCO A;  1Q86 C;  2PUK B;  1D0X A;  2LCS A;  1H3Z A;  1R0B G;  1RL2 A;  1BK2 A;  3JRZ A;  3SEM A;  3SHW A;  2EJ9 A;  1NYG A;  2QAZ A;  2XD0 A;  4XU0 A;  2E12 A;  3JCM b;  1BCM A;  1Q86 U;  2KDS A;  1PSF A;  2M51 A;  4BUG A;  2DX1 A;  1VQK T;  2DXT A;  3RNJ A;  1T3S A;  2PUO B;  1SHF A;  2K5F A;  1D1A A;  4PL6 A;  1SHG A;  3M0S A;  4IKF A;  3PIP A;  2HCK A;  2NUZ A;  3FJP A;  4J9B A;  2XI9 A;  3VS4 A;  3CCU A;  2CS7 A;  2YDL A;  2RB6 A;  1IRE B;  5A0G A;  1TXQ A;  2J06 A;  1GFD A;  1UB4 A;  2YWW A;  2DTO A;  4C5G A;  4BY6 B;  4KUL A;  2KT8 A;  1ZUY A;  4OMF B;  4LD9 K;  5AYF A;  2YSQ A;  2CZ6 B;  1P92 A;  2HQE A;  3OB9 A;  2D1X A;  3GLX A;  3CCJ Q;  3JB9 F;  5CKH A;  3FEO A;  4C92 C;  1W2B A;  3SB2 A;  2J7I A;  2RH2 A;  4UC4 A;  1QCN A;  4L59 A;  2AKL A;  1VQ9 Q;  5CKB A;  1PKT A;  2ESW A;  2EGC A;  3CPW P;  1AZE A;  1PRL C;  4J9F A;  3JCM d;  4PFO A;  4R0K A;  2DRK A;  4C8Q F;  2CP3 A;  2X51 A;  1OUL A;  4BD3 A;  3DLM A;  2XU8 A;  1MV3 A;  5GMK m; 
#chains in the Genus database with same CATH homology
 2HSP A;  2KR3 A;  4DEX A;  1NYF A;  2RQR A;  1NG2 A;  1K0X A;  5FWC A;  4J9I A;  2YUO A;  2GBQ A;  5I11 A;  1JXM A;  1Z9Z A;  2C0I A;  2A37 A;  1WXB A;  3CQT A;  1GCQ C;  3UA6 A;  2V1Q A;  2ABL A;  4DEY A;  2KYM A;  2YUQ A;  2MOX A;  3VRZ A;  3I5S A;  4J9D A;  1X6B A;  2VKN A;  2E5K A;  2J6F A;  2VVK A;  1UTI A;  1RUW A;  1RI9 A;  1FYN A;  1M8M A;  1PRM C;  3U23 A;  2EYY A;  1AEY A;  2LZ6 B;  2K9G A;  2DA9 A;  3TSW A;  3EG3 A;  2OJ2 A;  1SRM A;  2LQW A;  1WA7 A;  1M3C A;  2O88 A;  2GQI A;  2EW3 A;  1N5Z A;  1WLP B;  2DF6 A;  2KBT A;  4HVV A;  2HDA A;  1H3H A;  2EGE A;  2H8H A;  1U3O A;  2EVR A;  1KJW A;  3IQL A;  4Z88 A;  1JEG A;  4AG1 C;  3O5Z A;  2AK5 A;  2CH4 W;  1AVZ C;  1SSH A;  2DRM A;  2KRM A;  2CT3 A;  2JS2 A;  4RTW A;  1X6G A;  1UJ0 A;  2C0T A;  3C0C A;  4LNP A;  2RQW A;  1KIK A;  1NLP C;  4OML A;  5IHI A;  2D8H A;  1T0J A;  1U06 A;  1V1C A;  1HD3 A;  4IIM A;  1JO8 A;  1J3T A;  2ED0 A;  2O9S A;  2FPE A;  3A98 A;  1HJD A;  1X2K A;  2RMO A;  1H8K A;  4GLM A;  2FRW A;  2K79 A;  2KE9 A;  2DL3 A;  4J9C A;  4CC7 A;  3QWY A;  4Z89 A;  2L3S A;  4E6R A;  4FSS A;  2JTE A;  2FPD A;  2P4R A;  2RF0 A;  1KFZ A;  2DE0 X;  2RQT A;  2LJ1 A;  4OMO A;  4J9H A;  2J05 A;  2JT4 A;  1QKW A;  2A28 A;  2JM8 A;  2D8J A;  3H41 A;  3VS7 A;  1PHT A;  1SPK A;  1WFW A;  4M4Z A;  1UJY A;  4RTX A;  2JMC A;  1LCK A;  2A08 A;  1EFN A;  4Y92 A;  2KXC A;  1WI7 A;  2K6D A;  2J6K A;  4JJD A;  2LQN A;  3EGU A;  3UAT A;  1S1N A;  2OI3 A;  1NEG A;  2KGT A;  1ABO A;  1UHC A;  4GBQ A;  4JPB W;  1BB9 A;  1TUD A;  4AFZ C;  1WXT A;  1ZX6 A;  2SEM A;  4RTV A;  2AZV A;  3FJ5 A;  2KYB A;  2CUD A;  4D8K A;  2JMA A;  2YUN A;  1X69 A;  2ED1 A;  1BU1 A;  2X3X D;  1PWT A;  1VYU A;  2DYB A;  4JJB A;  1TG0 A;  2FRY A;  4LUD A;  2A36 A;  2DL5 A;  1OOT A;  1VA7 A;  4RTU A;  2PTK A;  2EKH A;  2X3W D;  2RN8 A;  2JM9 A;  2EPD A;  2BZX A;  4F16 A;  1WIE A;  2LMJ A;  4LUE A;  2ROT A;  1T3L A;  2F2W A;  2O9V A;  1Y57 A;  2BTT A;  2FPF A;  1UUE A;  1M3A A;  3PE0 A;  4HVU A;  5IHN A;  1NLO C;  4A63 B;  4K11 A;  1GCQ A;  1NEB A;  2DMO A;  1UE9 A;  1QWE A;  3EG0 A;  1ZSG A;  4IIO A;  1RLP C;  2YT6 A;  1ABQ A;  1MV0 B;  1T0H A;  2KEA A;  1ZUK A;  3I5R A;  1B07 A;  1I07 A;  2DL8 A;  2CDT A;  4CC3 A;  2EYX A;  2ENM A;  4J9G A;  2CT4 A;  1A0N B;  2ECZ A;  4RTZ A;  2LP5 A;  1GBQ A;  2W10 A;  2DL7 A;  1K4U S;  2RQU A;  1BBZ A;  2RQV A;  4AFU C;  2L3Q A;  1XOV A;  2I0N A;  1QWF A;  3R6N A;  1WXU A;  4HCK A;  1CKA A;  4HXJ A;  1E6H A;  2K7A A;  1X43 A;  1W1F A;  1HSQ A;  2C0O A;  1WX6 A;  1CSK A;  5I22 A;  3I9Q A;  1YWP A;  1RLQ C;  2PZ1 A;  1B3Q A;  4ORZ A;  1QLY A;  3M0P A;  1E6G A;  2BZY A;  2GNC A;  2QDL A;  3M0T A;  3UF4 A;  1YP5 A;  3PVL A;  4LE9 A;  2IIM A;  1AWX A;  1AZG B;  3VS3 A;  1UFF A;  1E7O A;  2KT1 A;  2O31 A;  1IO6 A;  3REA B;  3M0Q A;  1CKB A;  1X2Q A;  2MIO A;  3NHN A;  2RPN A;  5FW9 A;  1MUZ A;  2JXB A;  1SEM A;  1M27 C;  2DJQ A;  2EBP A;  1K9A A;  4KRT A;  3I35 A;  5IH2 A;  2GTO A;  3TSZ A;  2DM1 A;  4OMQ A;  2KRS A;  1YNZ A;  2B86 A;  2FO0 A;  3VS0 A;  2CH4 A;  2EYW A;  1UEC A;  1ARK A;  2NWM A;  4AFQ C;  2YUP A;  4EIK A;  1M3B A;  3H0F A;  3KFV A;  2CSQ A;  3VS6 A;  2HBW A;  1VYV A;  2CUB A;  4JJC A;  3VS1 A;  4AG2 C;  4RTY A;  3M0U A;  2G6F X;  1Z9Q A;  1GRI A;  3M0R A;  4JZ4 A;  1OV3 A;  5IXB A;  2DLP A;  2EYZ A;  1FMK A;  1UDL A;  1OPL A;  3VRY A;  2KRO A;  1PKS A;  2HEQ A;  3H0H A;  2LNH B;  1G2B A;  2DVJ A;  1OEB A;  5EC7 A;  4RUG A;  1UHF A;  2SRC A;  2L3P A;  3PVQ A;  1Y0M A;  1JXO A;  2LJ0 A;  2L2P A;  3THK A;  2OAW A;  1AWJ A;  2L0A A;  2O2O A;  2EQI A;  3NMZ C;  3EG1 A;  4ZNX A;  1AWW A;  5IHK A;  3ULR B;  1JQQ A;  1WYX A;  1OPK A;  3RBB B;  1GFC A;  1GL5 A;  4OMN A;  2M0Y A;  3EHR A;  2XMF A;  1ZLM A;  5GJV B;  1AD5 A;  4OMP A;  2KNB B;  1QKX A;  4OMM A;  4D8D A;  1TUC A;  1ZUU A;  4AFS C;  1K0S A;  1AOJ A;  3VS2 A;  2AKK A;  1JU5 C;  3GBQ A;  3NGP A;  2D0N A;  2EGA A;  4X1V A;  1UGV A;  3LH5 A;  1G83 A;  1UG1 A;  4WCI A;  5HCK A;  2F2V A;  1VYT A;  1ZBJ A;  3VS5 A;  1GBR A;  3EHQ A;  1I0C A;  4HVW A;  2CSI A;  2JW4 A;  2V1R A;  1W6X A;  1K1Z A;  5GJW B;  1YN8 A;  4LN2 A;  2LJ3 A;  1WDX A;  2K2M A;  2LCS A;  2MCN A;  2RNA A;  3QWX X;  1BK2 A;  2DBM A;  2FEI A;  2DNU A;  2W0Z A;  3SEM A;  3SHW A;  1NYG A;  4RTT A;  2KRN A;  2VWF A;  3REB B;  2LX7 A;  1U5S A;  5ECA A;  2M51 A;  2KXD A;  4J9E A;  1K76 A;  1X27 A;  2DX1 A;  2F2X A;  3RNJ A;  1T3S A;  1SHF A;  2CRE A;  4ESR A;  4QT7 A;  1SHG A;  3M0S A;  2ROL A;  2HCK A;  2NUZ A;  1SRL A;  4J9B A;  2AZS A;  4JZ3 A;  4CC4 B;  1YWO A;  3VS4 A;  5IXF A;  2PNI A;  3TVT A;  2YDL A;  3JV3 A;  2JS0 A;  2J06 A;  1GFD A;  4Z8A A;  1M30 A;  2K3B A;  2KT8 A;  2BZ8 A;  1ZUY A;  1KSW A;  5L23 A;  1W70 A;  4F14 A;  3H0I A;  1PNJ A;  2YSQ A;  3EG2 A;  3UA7 A;  4CC2 A;  2GTJ A;  2D1X A;  1GCP A;  1AWO A;  2DIL A;  1H92 A;  1NM7 A;  1YCS B;  1QCF A;  2J7I A;  3NPF A;  5FWB A;  3ZL7 C;  2GGR A;  2AKL A;  1PKT A;  2ESW A;  2EGC A;  1AZE A;  2DL4 A;  2FG0 A;  1PRL C;  4J9F A;  4R0K A;  2DRK A;  2DBK A;  2J6O A;  4F17 A;  1I1J A;  1MV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...