3O62A

Nucleosome core particle modified with a cisplatin 1,3-cis-{pt(nh3)2}2+-d(gptpg) intrastrand cross-link
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
98
structure length
98
Chain Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone H3.2
publication title Consequences of Cisplatin binding on nucleosome structure and dynamics.
pubmed doi rcsb
source organism Xenopus laevis
molecule tags Structural protein/dna
total genus 26
structure length 98
sequence length 98
chains with identical sequence E
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.20.10 Mainly Alpha Orthogonal Bundle Histone, subunit A Histone, subunit A 3o62A00
5B1LB 4G92C 3AZNA 2CV5D 4Z2MG 2YFVB 1P3BD 3R45A 5BT1D 5GXQB 5B24D 1TZYC 4H9SC 5BNXA 4CSRB 4Z2MH 5B33A 5AV6D 4G91C 1P3FA 4ZBJB 4JJNA 2IO5C 5C3IB 4LD9A 5CPJC 5B2IB 1P3MC 2NQBB 3B0CT 3AFAA 3AZMC 3KUYB 3X1UC 3WA9A 2YFVA 1N1JB 3AZNC 5GXQA 3W96D 4CSRA 3C1CB 3B0BA 5B33C 4E45A 3AN2B 1HQ3D 1P3FC 4JJNC 5B2IA 4LD9C 3UTAA 3AFAC 3KUYA 3W99A 3REKB 3AZKB 3RELB 1P3OB 1N1JA 3WA9C 3KWQD 5GXQC 3VH5A 3C1CA 3AN2A 3C1BD 3X1SB 4ZBJC 5JRGD 5C3IC 5B2IC 1P3AD 4EO5B 3AYWD 1M18A 3UTAC 1U35D 5AVBB 5AVCB 3AZKA 3KUYC 3W99C 3RELA 3WTPD 4R8PD 1P3OA 1AOID 3C1CC 2FJ7D 5DNMD 5GSUD 2CV5B 1P3BB 1JFIA 1ZLAD 1BH9A 4CAYB 3X1SA 5B24B 3X1TA 5AV6B 5B1MD 1R4VA 1M18C 5AVBA 5GT0A 3MGPC 1P34A 3AZKC 2RVQC 3RELC 1P3OC 4WV4B 5AV8D 3X1UD 1B67A 5F99A 4QLCD 3AV1D 2CV5A 1P3BA 4CAYA 5B24A 1WWIA 3X1SC 3W96B 5AV6A 3MGRD 3X1TC 4EO5C 5AVBC 1HQ3B 5GT0C 1P34C 4LD9D 2NZDD 3B6GD 3WA9D 3B0DB 3V9RB 5F99C 4XUJC 2CV5C 3KWQB 1P3BC 5BT1C 3W96A 5B24C 3AZFD 1KX3D 5AV6C 1HQ3A 3C1BB 5AV9D 3UT9D 5JRGB 1P3AB 3AYWB 3W99D 1U35B 5JA4B 3W98D 3WTPB 3V9RA 4R8PB 2F8NK 1P3LA 3KWQA 1AOIB 5B32G 4KHAB 4H9RB 3W96C 1P3GD 5G49B 2FJ7B 1P3ID 5DNMB 5GSUB 1ZLAB 3C1BA 1HQ3C 5DNND 5JRGA 1M18D 3MGPD 1P3AA 4WNNA 3AYWA 5B1MB 1U35A 5JA4A 2IO5B 3WTPA 4R8PA 3B0DC 1WWSA 1P3LC 3KWQC 3W97A 1AOIA 3X1UB 5AV8B 4H9RA 1KX5D 5E5AD 5G49A 5CPID 1HTAA 4QLCB 3AV1B 2FJ7A 5DNMA 5GSUA 3R45B 1ZLAA 3A6ND 3C1BC 5BNXB 3LZ0D 3X1TD 5JRGC 4YS3D 4WU8D 5B1MA 5GT0D 4H9OA 3MGRB 3AYWC 1P34D 1P3AC 1U35C 4LD9B 2F8NG 3WTPC 4H9NB 2NZDB 4R8PC 4ZUXA 3X1UA 5AV8A 2F8NH 3B6GB 5FUGB 1AOIC 3W97C 5F99D 4XUJD 3WA9B 5B31D 4QLCA 3AV1A 2FJ7C 5DNMC 5GSUC 3TU4A 1ZLAC 3AZFB 1KX3B 3MGRA 4WU9A 5B1MC 5AV9B 3UT9B 4H9NA 2NZDA 3UTAB 1F66D 4ZUXC 5FUGA 3B6GA 3W99B 5AV8C 3W98B 4QLCC 3AV1C 3MVDA 5B0ZA 5B0YD 3TU4C 4J8WD 5B40D 4J8XA 3AZFA 1P3GB 1KX3A 1P3IB 3MGRC 1Q9CA 4WU9C 5AV9A 3UT9A 5DNNB 4NE6A 1M18B 2NZDC 3MGPB 4AWLB 3B6GC 3W98A 1TAFB 1P3LD 3AZID 3X1VD 3MVDC 5B0ZC 3UTBA 4YM6D 5E5AB 1KX5B 4J8XC 3AZFC 1P3GA 5CPIB 1KX3C 1P3IA 1JFIB 4KUDD 1BH9B 3A6NB 5DNNA 5AV9C 3UT9C 3LZ0B 3X1TB 3MGPA 4WU8B 1P34B 5GT0B 3KXBC 3VH6T 1TAFA 4KGCD 3W98C 3W97D 1KX5A 5E5AA 5F99B 3UTBC 4XUJB 5CPIA 5B31B 1P3GC 1EQZD 3AV2D 1P3IC 3A6NA 3LZ0A 5DNNC 4YS3A 4WU8A 4AWLC 4M6BA 3AZEC 4ZUXD 1F66B 2BYKB 3B6FD 5CPKA 4UUZA 3MGQD 4XUJA 5E5AC 5B31A 1KX5C 5CPIC 3NQUB 3TU4D 3A6NC 5B0YB 4J8WB 5B40B 4NE5A 2HUEC 3LZ0C 4WU9D 4YS3C 4WU8C 5AV5D 1F66A 1H3OA 2BYKA 1ULYA 5CPKC 5B31C 3NQUA 1P3LB 3MVDD 5B0ZD 3AZIB 3X1VB 1M19C 5B0YA 4J8XD 4J8WA 5B40A 4YM6B 4XZQD 4H9PB 4H9QB 4KUDB 5AY8A 1KX4C 3KXBD 4WNNB 1F66C 3AZGA 4KGCB 3WTPE 3AZIA 3AZJA 3X1VA 3W97B 3UTBD 5B0YC 4YM6A 1BH8B 4J8WC 5B40C 4H9PA 1EQZB 4H9QA 5BNVB 4KUDA 3AV2B 3LJAD 4DRBA 5AY8C 4H9OB 5B32D 4Z66D 1P3PA 1P3KD 3AZED 1ID3D 3AZGC 3REJA 4KGCA 4ZUXB 3VH6W 3AZJC 3X1VC 3AZIC 3B6FB 1BH8A 1S32D 2BYMB 3MGQB 4YM6C 1EQZA 5BNVA 3AV2A 3TU4B 4KUDC 4J8VA 1A7WA 4WU9B 3LZ1D 1P3PC 4KGCC 3REJC 5AV5B 4Z5TD 3B6FA 5CPKD 2BYMA 3MGQA 1EQZC 1M19D 3MVDB 5BS7A 3AZHD 5B0ZB 3AV2C 2F8ND 1M1AA 4J8XB 4J8VC 1BFMA 4XZQB 1KX4D 4DRAA 5AV5A 3KXBB 3AZLA 2CWEA 3B6FC 3MGSD 3MGQC 3VH6A 5BS7C 3REHA 3MNND 3UTBB 3VH5W 1M1AC 4XZQA 4J8UA 3O62A 5AY8D 3LJAB 2YFWB 3KXBA 5AV5C 4X23D 5B32B 4Z66B 4HGAB 3AZGD 3AZLC 1P3KB 3NQJA 3AZEB 1ID3B 3AZJD 4WZSB 5B1LA 3LELD 3REHC 1S32B 4XZQC 4J8UC 5GT3D 3O62C 1KU5A 3LJAA 2HUEB 2YFWA 4YS3B 2PYOD 5B32A 1P3PD 4Z66A 3LZ1B 1P3KA 3AZEA 3REJD 1ID3A 2NQBA 4Z5TB 5B2JD 5CPKB 4UUZB 1S32A 5B1LC 2L5AA 1M19B 3WAAD 2HIOD 2JSSA 4J8VD 3AZHB 2F8NB 3LJAC 3REID 3LZ1A 5B32C 4Z66C 4HGAC 1KX4B 1P3KC 1ID3C 1H3OB 2NQBC 4Z5TA 5BO0B 3REKA 3MGSB 3WKJD 5CP6D 1S32C 1M19A 2AROD 3AZHA 1M1AD 2F8NA 3MNNB 1TZYD 3LZ1C 3AN2C 1KX4A 5AY8B 5BO0A 3AZLD 4X23B 4Z5TC 5AVCA 3MGSA 3AZGB 5CPJD 3REKC 1P3MD 3AZMD 3VH5T 3AZJB 3REHD 3AZHC 3MNNA 3LELB 4J8UD 3O62D 3AZND 5GT3B 5KDMB 3KSYA 4NFTA 5B33D 2PYOB 2LY8A 1P3FD 4X23A 1P3PB 4JJND 5AVCC 3MGSC 3REJB 3AFAD 5B1LD 5B2JB 3LELA 3MNNC 3B0CW 5GT3A 5GXQD 3WAAB 2HIOB 5KDMA 4J8VB 3REIB 2PYOA 4X23C 5B2ID 2NQBD 3UTAD 3KUYD 5B2JA 3LELC 5CP6B 4E44A 3WKJB 5GT3C 3WAAA 2HIOA 2AROB 1M1AB 3C1CD 4G92B 3REIA 2PYOC 3AN2D 1TZYB 1B6WA 4G91B 3REKD 3AZKD 3AZLB 2RVQD 3RELD 5B2JC 3WKJA 5CP6A 5CPJB 1P3OD 1P3MB 3AZMB 4NE3A 2AROA 3WAAC 2HIOC 3REHB 4KHAA 4J8UB 3O62B 3REIC 3AZNB 1TZYA 3X1SD 4H9SA 1F1EA 5B33B 5B31G 5AVBD 5AVCD 1P3FB 4JJNB 5CPJA 3NQJB 5CHLB 1P3MA 3WKJC 5CP6C 3AZMA 3AFAB 2AROC
chains in the Genus database with same CATH superfamily
3A1KA 5B1LB 4G92C 3AZNA 2CV5D 4Z2MG 2YFVB 1P3BD 3R45A 5BT1D 5GXQB 5B24D 1TZYC 4H9SC 5BNXA 4CSRB 4Z2MH 5B33A 5AV6D 4G91C 1P3FA 2J8PA 4ZBJB 4JJNA 2IO5C 5C3IB 4LD9A 5CPJC 5B2IB 1P3MC 2NQBB 3B0CT 3AFAA 3AZMC 3KUYB 2Y2OA 3X1UC 3WA9A 2YFVA 1N1JB 3AZNC 5GXQA 3W96D 4CSRA 3C1CB 3B0BA 5B33C 2ZY5A 4E45A 2FFFB 3AN2B 1HQ3D 1P3FC 4JJNC 5B2IA 4LD9C 3UTAA 3AFAC 3KUYA 3W99A 3REKB 3AZKB 3RELB 1P3OB 1N1JA 3WA9C 3KWQD 5GXQC 3VH5A 3C1CA 3P5JB 3AN2A 3C1BD 3X1SB 2DQNC 4ZBJC 5JRGD 5C3IC 5B2IC 1P3AD 4EO5B 3AYWD 1M18A 3UTAC 1U35D 5AVBB 5AVCB 3AZKA 3KUYC 3W99C 3RELA 3WTPD 4R8PD 1P3OA 3H0RC 3H0LC 1Z2CB 1AOID 2BG1A 3C1CC 2FJ7D 5DNMD 5GSUD 2CV5B 1P3BB 1JFIA 1ZLAD 1BH9A 4CAYB 3X1SA 5B24B 3X1TA 5AV6B 5B1MD 1R4VA 1M18C 5AVBA 5GT0A 3MGPC 1P34A 3AZKC 2RVQC 3RELC 1P3OC 4WV4B 5AV8D 3X1UD 1B67A 5F99A 4QLCD 3AV1D 2CV5A 1P3BA 4CAYA 5B24A 1WWIA 3X1SC 3W96B 2Y2QA 5AV6A 3MGRD 3X1TC 4EO5C 5AVBC 1HQ3B 5GT0C 1P34C 4LD9D 2NZDD 3B6GD 3WA9D 3B0DB 2XD5A 3V9RB 5F99C 2Y2JA 4XUJC 2CV5C 2DF4C 3KWQB 1P3BC 5BT1C 3W96A 5B24C 3AZFD 4WJ3C 1KX3D 5AV6C 1HQ3A 3C1BB 5AV9D 3UT9D 5JRGB 1P3AB 3AYWB 3W99D 1U35B 5JA4B 3IP4C 3WTPB 3W98D 3V9RA 4R8PB 2F8NK 1P3LA 3KWQA 3EPHA 1AOIB 5B32G 4KHAB 4H9RB 3W96C 1P3GD 5G49B 2FJ7B 1P3ID 5DNMB 5GSUB 1ZLAB 3C1BA 1HQ3C 2Y2IA 5DNND 5JRGA 1M18D 3EPKA 3MGPD 1P3AA 4WNNA 3AYWA 5B1MB 1U35A 5JA4A 2IO5B 3WTPA 4R8PA 3B0DC 1WWSA 1P3LC 3KWQC 3W97A 1AOIA 2Y2NA 5AV8B 3X1UB 4H9RA 1KX5D 5E5AD 2F2AC 5G49A 1HTAA 4QLCB 3AV1B 5CPID 5DNMA 5GSUA 3R45B 1ZLAA 2FJ7A 3A6ND 2G5HC 3C1BC 5BNXB 3LZ0D 3X1TD 5JRGC 4YS3D 4WU8D 5B1MA 5GT0D 4H9OA 3MGRB 3AYWC 1P34D 1P3AC 1U35C 4LD9B 2F8NG 3WTPC 4H9NB 2NZDB 4R8PC 4ZUXA 3X1UA 5AV8A 2F8NH 3B6GB 5FUGB 1AOIC 3W97C 2Y2PA 5F99D 4XUJD 3WA9B 5B31D 4QLCA 3AV1A 2FJ7C 5DNMC 5GSUC 3TU4A 1ZLAC 3AZFB 1KX3B 3MGRA 4WU9A 5B1MC 5AV9B 3UT9B 4H9NA 2NZDA 3UTAB 1F66D 4ZUXC 5FUGA 3B6GA 3W99B 5AV8C 4DQYB 3W98B 4QLCC 3AV1C 2ZY4A 3MVDA 5B0ZA 5B0YD 3TU4C 4J8WD 5B40D 4J8XA 3AZFA 1P3GB 1KX3A 1P3IB 3MGRC 1Q9CA 4WU9C 5AV9A 2Y2LA 2Y2MA 3UT9A 5DNNB 4NE6A 1M18B 2NZDC 3MGPB 4AWLB 3B6GC 3FDDA 3KFUG 3W98A 1TAFB 2ZY2A 1P3LD 3AZID 3X1VD 3MVDC 2G5IC 5B0ZC 3UTBA 4YM6D 5E5AB 1KX5B 4J8XC 3AZFC 1P3GA 5CPIB 1KX3C 1P3IA 1JFIB 4KUDD 1BH9B 3A6NB 3F6TA 5DNNA 5AV9C 3UT9C 4UPKA 3LZ0B 2Y2GA 3X1TB 3MGPA 4WU8B 1P34B 5GT0B 3KXBC 3VH6T 1TAFA 4KGCD 3W98C 3W97D 3EPLA 1KX5A 5E5AA 5F99B 3UTBC 4XUJB 5CPIA 1PZRA 5B31B 1P3GC 1EQZD 3AV2D 1P3IC 3A6NA 3LZ0A 5DNNC 4YS3A 4WU8A 4AWLC 3AL0C 4M6BA 3AZEC 4ZUXD 1F66B 2BYKB 3B6FD 2XD1A 5CPKA 4UUZA 3MGQD 4XUJA 5E5AC 5B31A 1KX5C 5CPIC 3NQUB 3TU4D 3A6NC 5B0YB 4J8WB 5B40B 4NE5A 2Y2HA 2HUEC 3LZ0C 4WU9D 4YS3C 4WU8C 5AV5D 1F66A 1H3OA 2BYKA 1ULYA 5CPKC 3A1IA 5B31C 3NQUA 1P3LB 3MVDD 5B0ZD 3AZIB 3X1VB 1M19C 5B0YA 4J8XD 4J8WA 5B40A 4YM6B 4XZQD 4H9PB 4H9QB 4KUDB 3EG5B 5AY8A 1KX4C 3KXBD 4WNNB 1F66C 3AZGA 4KGCB 3WTPE 3AZIA 3AZJA 3X1VA 3W97B 3UTBD 5B0YC 4YM6A 1BH8B 4J8WC 5B40C 4H9PA 1EQZB 4H9QA 5BNVB 4KUDA 3AV2B 3LJAD 4DRBA 5AY8C 4H9OB 5B32D 4Z66D 3H0MC 1P3PA 2JCHA 1P3KD 3AZED 1ID3D 3AZGC 3REJA 4KGCA 4ZUXB 3VH6W 3AZJC 3X1VC 3AZIC 3B6FB 2ZM5A 1BH8A 1S32D 2BYMB 3MGQB 4YM6C 1EQZA 5BNVA 3AV2A 3TU4B 4KUDC 4J8VA 1A7WA 4WU9B 3LZ1D 1P3PC 4KGCC 3REJC 5AV5B 4Z5TD 3B6FA 5CPKD 2BYMA 3MGQA 1EQZC 1M19D 3MVDB 5BS7A 3AZHD 5B0ZB 3AV2C 2F8ND 1M1AA 1T3UA 4J8XB 4J8VC 2JE5A 1BFMA 4XZQB 1KX4D 4DRAA 5AV5A 3KXBB 3AZLA 2CWEA 3B6FC 3MGSD 3MGQC 3VH6A 5BS7C 2Y2KA 3MNND 3REHA 3UTBB 3VH5W 1M1AC 4XZQA 4J8UA 3O62A 5AY8D 3LJAB 2YFWB 3KXBA 5AV5C 4X23D 5B32B 4Z66B 4HGAB 3AZGD 3AZLC 1P3KB 3NQJA 3AZEB 1ID3B 3AZJD 4WZSB 5B1LA 3LELD 3REHC 1S32B 4XZQC 4J8UC 5GT3D 3O62C 1KU5A 3LJAA 2HUEB 2YFWA 4YS3B 2PYOD 2RIQA 5B32A 1P3PD 4Z66A 3LZ1B 1P3KA 3AZEA 3REJD 1ID3A 2NQBA 4Z5TB 5B2JD 5CPKB 4UUZB 1S32A 5B1LC 2L5AA 1M19B 3WAAD 2HIOD 2JSSA 4J8VD 3AZHB 2F8NB 3LJAC 3REID 3LZ1A 5B32C 4Z66C 4HGAC 1KX4B 1P3KC 1ID3C 1H3OB 2NQBC 4Z5TA 5BO0B 1W2EA 3REKA 3MGSB 3WKJD 5CP6D 1S32C 1M19A 2AROD 3AZHA 1M1AD 2F8NA 3MNNB 1TZYD 3LZ1C 3AN2C 1KX4A 5AY8B 5BO0A 3AZLD 4X23B 4Z5TC 5AVCA 3MGSA 3AZGB 5CPJD 3REKC 1P3MD 3AZMD 3VH5T 3AZJB 3REHD 3AZHC 3MNNA 3LELB 4J8UD 3O62D 3AZND 5GT3B 5KDMB 3KSYA 4NFTA 5B33D 2PYOB 2LY8A 1P3FD 4X23A 1P3PB 4JJND 5AVCC 3MGSC 3REJB 3AFAD 5B1LD 5B2JB 3LELA 2VQRA 3MNNC 3B0CW 5GT3A 5GXQD 3WAAB 2HIOB 5KDMA 4J8VB 3REIB 2PYOA 4X23C 2UWXA 5B2ID 2NQBD 3UTAD 3KUYD 5B2JA 3LELC 5CP6B 2W8SA 4E44A 3WKJB 5GT3C 3WAAA 2HIOA 2AROB 1M1AB 3C1CD 4G92B 3REIA 2PYOC 3AN2D 2ZY3A 1TZYB 1B6WA 4G91B 3REKD 3AZKD 3AZLB 2RVQD 3RELD 5B2JC 3WKJA 5CP6A 5CPJB 1P3OD 1P3MB 3AZMB 4NE3A 2AROA 3WAAC 2HIOC 3REHB 4KHAA 4J8UB 3O62B 3REIC 3AZNB 1TZYA 3X1SD 4H9SA 1F1EA 5B33B 5B31G 5AVBD 5AVCD 1P3FB 4JJNB 5CPJA 3NQJB 5CHLB 1P3MA 3WKJC 5CP6C 3AZMA 3EPJA 3AFAB 2AROC
chains in the Genus database with same CATH topology
3A1KA 5B1LB 4G92C 3AZNA 2CV5D 4Z2MG 2YFVB 1P3BD 3R45A 5BT1D 5GXQB 5B24D 1TZYC 4H9SC 5BNXA 4CSRB 4Z2MH 5B33A 5AV6D 4G91C 1P3FA 2J8PA 4ZBJB 4JJNA 2IO5C 5C3IB 4LD9A 5CPJC 5B2IB 1P3MC 2NQBB 3B0CT 3AFAA 3AZMC 3KUYB 2Y2OA 3X1UC 3WA9A 2YFVA 1N1JB 3AZNC 5GXQA 3W96D 4CSRA 3C1CB 3B0BA 5B33C 2ZY5A 4E45A 2FFFB 3AN2B 1HQ3D 1P3FC 4JJNC 5B2IA 4LD9C 3UTAA 3AFAC 3KUYA 3W99A 3REKB 3AZKB 3RELB 1P3OB 1N1JA 3WA9C 3KWQD 5GXQC 3VH5A 3C1CA 3P5JB 3AN2A 3C1BD 3X1SB 2DQNC 4ZBJC 5JRGD 5C3IC 5B2IC 1P3AD 4EO5B 3AYWD 1M18A 3UTAC 1U35D 5AVBB 5AVCB 3AZKA 3KUYC 3W99C 3RELA 3WTPD 4R8PD 1P3OA 3H0RC 3H0LC 1Z2CB 1AOID 2BG1A 3C1CC 2FJ7D 5DNMD 5GSUD 2CV5B 1P3BB 1JFIA 1ZLAD 1BH9A 4CAYB 3X1SA 5B24B 3X1TA 5AV6B 5B1MD 1R4VA 1M18C 5AVBA 5GT0A 3MGPC 1P34A 3AZKC 2RVQC 3RELC 1P3OC 4WV4B 5AV8D 3X1UD 1B67A 5F99A 4QLCD 3AV1D 2CV5A 1P3BA 4CAYA 5B24A 1WWIA 3X1SC 3W96B 2Y2QA 5AV6A 3MGRD 3X1TC 4EO5C 5AVBC 1HQ3B 5GT0C 1P34C 4LD9D 2NZDD 3B6GD 3WA9D 3B0DB 2XD5A 3V9RB 5F99C 2Y2JA 4XUJC 2CV5C 2DF4C 3KWQB 1P3BC 5BT1C 3W96A 5B24C 3AZFD 4WJ3C 1KX3D 5AV6C 1HQ3A 3C1BB 5AV9D 3UT9D 5JRGB 1P3AB 3AYWB 3W99D 1U35B 5JA4B 3IP4C 3WTPB 3W98D 3V9RA 4R8PB 2F8NK 1P3LA 3KWQA 3EPHA 1AOIB 5B32G 4KHAB 4H9RB 3W96C 1P3GD 5G49B 2FJ7B 1P3ID 5DNMB 5GSUB 1ZLAB 3C1BA 1HQ3C 2Y2IA 5DNND 5JRGA 1M18D 3EPKA 3MGPD 1P3AA 4WNNA 3AYWA 5B1MB 1U35A 5JA4A 2IO5B 3WTPA 4R8PA 3B0DC 1WWSA 1P3LC 3KWQC 3W97A 1AOIA 2Y2NA 5AV8B 3X1UB 4H9RA 1KX5D 5E5AD 2F2AC 5G49A 1HTAA 4QLCB 3AV1B 5CPID 5DNMA 5GSUA 3R45B 1ZLAA 2FJ7A 3A6ND 2G5HC 3C1BC 5BNXB 3LZ0D 3X1TD 5JRGC 4YS3D 4WU8D 5B1MA 5GT0D 4H9OA 3MGRB 3AYWC 1P34D 1P3AC 1U35C 4LD9B 2F8NG 3WTPC 4H9NB 2NZDB 4R8PC 4ZUXA 3X1UA 5AV8A 2F8NH 3B6GB 5FUGB 1AOIC 3W97C 2Y2PA 5F99D 4XUJD 3WA9B 5B31D 4QLCA 3AV1A 2FJ7C 5DNMC 5GSUC 3TU4A 1ZLAC 3AZFB 1KX3B 3MGRA 4WU9A 5B1MC 5AV9B 3UT9B 4H9NA 2NZDA 3UTAB 1F66D 4ZUXC 5FUGA 3B6GA 3W99B 5AV8C 4DQYB 3W98B 4QLCC 3AV1C 2ZY4A 3MVDA 5B0ZA 5B0YD 3TU4C 4J8WD 5B40D 4J8XA 3AZFA 1P3GB 1KX3A 1P3IB 3MGRC 1Q9CA 4WU9C 5AV9A 2Y2LA 2Y2MA 3UT9A 5DNNB 4NE6A 1M18B 2NZDC 3MGPB 4AWLB 3B6GC 3FDDA 3KFUG 3W98A 1TAFB 2ZY2A 1P3LD 3AZID 3X1VD 3MVDC 2G5IC 5B0ZC 3UTBA 4YM6D 5E5AB 1KX5B 4J8XC 3AZFC 1P3GA 5CPIB 1KX3C 1P3IA 1JFIB 4KUDD 1BH9B 3A6NB 3F6TA 5DNNA 5AV9C 3UT9C 4UPKA 3LZ0B 2Y2GA 3X1TB 3MGPA 4WU8B 1P34B 5GT0B 3KXBC 3VH6T 1TAFA 4KGCD 3W98C 3W97D 3EPLA 1KX5A 5E5AA 5F99B 3UTBC 4XUJB 5CPIA 1PZRA 5B31B 1P3GC 1EQZD 3AV2D 1P3IC 3A6NA 3LZ0A 5DNNC 4YS3A 4WU8A 4AWLC 3AL0C 4M6BA 3AZEC 4ZUXD 1F66B 2BYKB 3B6FD 2XD1A 5CPKA 4UUZA 3MGQD 4XUJA 5E5AC 5B31A 1KX5C 5CPIC 3NQUB 3TU4D 3A6NC 5B0YB 4J8WB 5B40B 4NE5A 2Y2HA 2HUEC 3LZ0C 4WU9D 4YS3C 4WU8C 5AV5D 1F66A 1H3OA 2BYKA 1ULYA 5CPKC 3A1IA 5B31C 3NQUA 1P3LB 3MVDD 5B0ZD 3AZIB 3X1VB 1M19C 5B0YA 4J8XD 4J8WA 5B40A 4YM6B 4XZQD 4H9PB 4H9QB 4KUDB 3EG5B 5AY8A 1KX4C 3KXBD 4WNNB 1F66C 3AZGA 4KGCB 3WTPE 3AZIA 3AZJA 3X1VA 3W97B 3UTBD 5B0YC 4YM6A 1BH8B 4J8WC 5B40C 4H9PA 1EQZB 4H9QA 5BNVB 4KUDA 3AV2B 3LJAD 4DRBA 5AY8C 4H9OB 5B32D 4Z66D 3H0MC 1P3PA 2JCHA 1P3KD 3AZED 1ID3D 3AZGC 3REJA 4KGCA 4ZUXB 3VH6W 3AZJC 3X1VC 3AZIC 3B6FB 2ZM5A 1BH8A 1S32D 2BYMB 3MGQB 4YM6C 1EQZA 5BNVA 3AV2A 3TU4B 4KUDC 4J8VA 1A7WA 4WU9B 3LZ1D 1P3PC 4KGCC 3REJC 5AV5B 4Z5TD 3B6FA 5CPKD 2BYMA 3MGQA 1EQZC 1M19D 3MVDB 5BS7A 3AZHD 5B0ZB 3AV2C 2F8ND 1M1AA 1T3UA 4J8XB 4J8VC 2JE5A 1BFMA 4XZQB 1KX4D 4DRAA 5AV5A 3KXBB 3AZLA 2CWEA 3B6FC 3MGSD 3MGQC 3VH6A 5BS7C 2Y2KA 3MNND 3REHA 3UTBB 3VH5W 1M1AC 4XZQA 4J8UA 3O62A 5AY8D 3LJAB 2YFWB 3KXBA 5AV5C 4X23D 5B32B 4Z66B 4HGAB 3AZGD 3AZLC 1P3KB 3NQJA 3AZEB 1ID3B 3AZJD 4WZSB 5B1LA 3LELD 3REHC 1S32B 4XZQC 4J8UC 5GT3D 3O62C 1KU5A 3LJAA 2HUEB 2YFWA 4YS3B 2PYOD 2RIQA 5B32A 1P3PD 4Z66A 3LZ1B 1P3KA 3AZEA 3REJD 1ID3A 2NQBA 4Z5TB 5B2JD 5CPKB 4UUZB 1S32A 5B1LC 2L5AA 1M19B 3WAAD 2HIOD 2JSSA 4J8VD 3AZHB 2F8NB 3LJAC 3REID 3LZ1A 5B32C 4Z66C 4HGAC 1KX4B 1P3KC 1ID3C 1H3OB 2NQBC 4Z5TA 5BO0B 1W2EA 3REKA 3MGSB 3WKJD 5CP6D 1S32C 1M19A 2AROD 3AZHA 1M1AD 2F8NA 3MNNB 1TZYD 3LZ1C 3AN2C 1KX4A 5AY8B 5BO0A 3AZLD 4X23B 4Z5TC 5AVCA 3MGSA 3AZGB 5CPJD 3REKC 1P3MD 3AZMD 3VH5T 3AZJB 3REHD 3AZHC 3MNNA 3LELB 4J8UD 3O62D 3AZND 5GT3B 5KDMB 3KSYA 4NFTA 5B33D 2PYOB 2LY8A 1P3FD 4X23A 1P3PB 4JJND 5AVCC 3MGSC 3REJB 3AFAD 5B1LD 5B2JB 3LELA 2VQRA 3MNNC 3B0CW 5GT3A 5GXQD 3WAAB 2HIOB 5KDMA 4J8VB 3REIB 2PYOA 4X23C 2UWXA 5B2ID 2NQBD 3UTAD 3KUYD 5B2JA 3LELC 5CP6B 2W8SA 4E44A 3WKJB 5GT3C 3WAAA 2HIOA 2AROB 1M1AB 3C1CD 4G92B 3REIA 2PYOC 3AN2D 2ZY3A 1TZYB 1B6WA 4G91B 3REKD 3AZKD 3AZLB 2RVQD 3RELD 5B2JC 3WKJA 5CP6A 5CPJB 1P3OD 1P3MB 3AZMB 4NE3A 2AROA 3WAAC 2HIOC 3REHB 4KHAA 4J8UB 3O62B 3REIC 3AZNB 1TZYA 3X1SD 4H9SA 1F1EA 5B33B 5B31G 5AVBD 5AVCD 1P3FB 4JJNB 5CPJA 3NQJB 5CHLB 1P3MA 3WKJC 5CP6C 3AZMA 3EPJA 3AFAB 2AROC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1L B;  4G92 C;  3AZN A;  2CV5 D;  4Z2M G;  2YFV B;  1P3B D;  3R45 A;  5BT1 D;  5GXQ B;  5B24 D;  1TZY C;  4H9S C;  5BNX A;  4CSR B;  4Z2M H;  5B33 A;  5AV6 D;  4G91 C;  1P3F A;  4ZBJ B;  4JJN A;  2IO5 C;  5C3I B;  4LD9 A;  5CPJ C;  5B2I B;  1P3M C;  2NQB B;  3B0C T;  3AFA A;  3AZM C;  3KUY B;  3X1U C;  3WA9 A;  2YFV A;  1N1J B;  3AZN C;  5GXQ A;  3W96 D;  4CSR A;  3C1C B;  3B0B A;  5B33 C;  4E45 A;  3AN2 B;  1HQ3 D;  1P3F C;  4JJN C;  5B2I A;  4LD9 C;  3UTA A;  3AFA C;  3KUY A;  3W99 A;  3REK B;  3AZK B;  3REL B;  1P3O B;  1N1J A;  3WA9 C;  3KWQ D;  5GXQ C;  3VH5 A;  3C1C A;  3AN2 A;  3C1B D;  3X1S B;  4ZBJ C;  5JRG D;  5C3I C;  5B2I C;  1P3A D;  4EO5 B;  3AYW D;  1M18 A;  3UTA C;  1U35 D;  5AVB B;  5AVC B;  3AZK A;  3KUY C;  3W99 C;  3REL A;  3WTP D;  4R8P D;  1P3O A;  1AOI D;  3C1C C;  2FJ7 D;  5DNM D;  5GSU D;  2CV5 B;  1P3B B;  1JFI A;  1ZLA D;  1BH9 A;  4CAY B;  3X1S A;  5B24 B;  3X1T A;  5AV6 B;  5B1M D;  1R4V A;  1M18 C;  5AVB A;  5GT0 A;  3MGP C;  1P34 A;  3AZK C;  2RVQ C;  3REL C;  1P3O C;  4WV4 B;  5AV8 D;  3X1U D;  1B67 A;  5F99 A;  4QLC D;  3AV1 D;  2CV5 A;  1P3B A;  4CAY A;  5B24 A;  1WWI A;  3X1S C;  3W96 B;  5AV6 A;  3MGR D;  3X1T C;  4EO5 C;  5AVB C;  1HQ3 B;  5GT0 C;  1P34 C;  4LD9 D;  2NZD D;  3B6G D;  3WA9 D;  3B0D B;  3V9R B;  5F99 C;  4XUJ C;  2CV5 C;  3KWQ B;  1P3B C;  5BT1 C;  3W96 A;  5B24 C;  3AZF D;  1KX3 D;  5AV6 C;  1HQ3 A;  3C1B B;  5AV9 D;  3UT9 D;  5JRG B;  1P3A B;  3AYW B;  3W99 D;  1U35 B;  5JA4 B;  3W98 D;  3WTP B;  3V9R A;  4R8P B;  2F8N K;  1P3L A;  3KWQ A;  1AOI B;  5B32 G;  4KHA B;  4H9R B;  3W96 C;  1P3G D;  5G49 B;  2FJ7 B;  1P3I D;  5DNM B;  5GSU B;  1ZLA B;  3C1B A;  1HQ3 C;  5DNN D;  5JRG A;  1M18 D;  3MGP D;  1P3A A;  4WNN A;  3AYW A;  5B1M B;  1U35 A;  5JA4 A;  2IO5 B;  3WTP A;  4R8P A;  3B0D C;  1WWS A;  1P3L C;  3KWQ C;  3W97 A;  1AOI A;  3X1U B;  5AV8 B;  4H9R A;  1KX5 D;  5E5A D;  5G49 A;  5CPI D;  1HTA A;  4QLC B;  3AV1 B;  2FJ7 A;  5DNM A;  5GSU A;  3R45 B;  1ZLA A;  3A6N D;  3C1B C;  5BNX B;  3LZ0 D;  3X1T D;  5JRG C;  4YS3 D;  4WU8 D;  5B1M A;  5GT0 D;  4H9O A;  3MGR B;  3AYW C;  1P34 D;  1P3A C;  1U35 C;  4LD9 B;  2F8N G;  3WTP C;  4H9N B;  2NZD B;  4R8P C;  4ZUX A;  3X1U A;  5AV8 A;  2F8N H;  3B6G B;  5FUG B;  1AOI C;  3W97 C;  5F99 D;  4XUJ D;  3WA9 B;  5B31 D;  4QLC A;  3AV1 A;  2FJ7 C;  5DNM C;  5GSU C;  3TU4 A;  1ZLA C;  3AZF B;  1KX3 B;  3MGR A;  4WU9 A;  5B1M C;  5AV9 B;  3UT9 B;  4H9N A;  2NZD A;  3UTA B;  1F66 D;  4ZUX C;  5FUG A;  3B6G A;  3W99 B;  5AV8 C;  3W98 B;  4QLC C;  3AV1 C;  3MVD A;  5B0Z A;  5B0Y D;  3TU4 C;  4J8W D;  5B40 D;  4J8X A;  3AZF A;  1P3G B;  1KX3 A;  1P3I B;  3MGR C;  1Q9C A;  4WU9 C;  5AV9 A;  3UT9 A;  5DNN B;  4NE6 A;  1M18 B;  2NZD C;  3MGP B;  4AWL B;  3B6G C;  3W98 A;  1TAF B;  1P3L D;  3AZI D;  3X1V D;  3MVD C;  5B0Z C;  3UTB A;  4YM6 D;  5E5A B;  1KX5 B;  4J8X C;  3AZF C;  1P3G A;  5CPI B;  1KX3 C;  1P3I A;  1JFI B;  4KUD D;  1BH9 B;  3A6N B;  5DNN A;  5AV9 C;  3UT9 C;  3LZ0 B;  3X1T B;  3MGP A;  4WU8 B;  1P34 B;  5GT0 B;  3KXB C;  3VH6 T;  1TAF A;  4KGC D;  3W98 C;  3W97 D;  1KX5 A;  5E5A A;  5F99 B;  3UTB C;  4XUJ B;  5CPI A;  5B31 B;  1P3G C;  1EQZ D;  3AV2 D;  1P3I C;  3A6N A;  3LZ0 A;  5DNN C;  4YS3 A;  4WU8 A;  4AWL C;  4M6B A;  3AZE C;  4ZUX D;  1F66 B;  2BYK B;  3B6F D;  5CPK A;  4UUZ A;  3MGQ D;  4XUJ A;  5E5A C;  5B31 A;  1KX5 C;  5CPI C;  3NQU B;  3TU4 D;  3A6N C;  5B0Y B;  4J8W B;  5B40 B;  4NE5 A;  2HUE C;  3LZ0 C;  4WU9 D;  4YS3 C;  4WU8 C;  5AV5 D;  1F66 A;  1H3O A;  2BYK A;  1ULY A;  5CPK C;  5B31 C;  3NQU A;  1P3L B;  3MVD D;  5B0Z D;  3AZI B;  3X1V B;  1M19 C;  5B0Y A;  4J8X D;  4J8W A;  5B40 A;  4YM6 B;  4XZQ D;  4H9P B;  4H9Q B;  4KUD B;  5AY8 A;  1KX4 C;  3KXB D;  4WNN B;  1F66 C;  3AZG A;  4KGC B;  3WTP E;  3AZI A;  3AZJ A;  3X1V A;  3W97 B;  3UTB D;  5B0Y C;  4YM6 A;  1BH8 B;  4J8W C;  5B40 C;  4H9P A;  1EQZ B;  4H9Q A;  5BNV B;  4KUD A;  3AV2 B;  3LJA D;  4DRB A;  5AY8 C;  4H9O B;  5B32 D;  4Z66 D;  1P3P A;  1P3K D;  3AZE D;  1ID3 D;  3AZG C;  3REJ A;  4KGC A;  4ZUX B;  3VH6 W;  3AZJ C;  3X1V C;  3AZI C;  3B6F B;  1BH8 A;  1S32 D;  2BYM B;  3MGQ B;  4YM6 C;  1EQZ A;  5BNV A;  3AV2 A;  3TU4 B;  4KUD C;  4J8V A;  1A7W A;  4WU9 B;  3LZ1 D;  1P3P C;  4KGC C;  3REJ C;  5AV5 B;  4Z5T D;  3B6F A;  5CPK D;  2BYM A;  3MGQ A;  1EQZ C;  1M19 D;  3MVD B;  5BS7 A;  3AZH D;  5B0Z B;  3AV2 C;  2F8N D;  1M1A A;  4J8X B;  4J8V C;  1BFM A;  4XZQ B;  1KX4 D;  4DRA A;  5AV5 A;  3KXB B;  3AZL A;  2CWE A;  3B6F C;  3MGS D;  3MGQ C;  3VH6 A;  5BS7 C;  3REH A;  3MNN D;  3UTB B;  3VH5 W;  1M1A C;  4XZQ A;  4J8U A;  3O62 A;  5AY8 D;  3LJA B;  2YFW B;  3KXB A;  5AV5 C;  4X23 D;  5B32 B;  4Z66 B;  4HGA B;  3AZG D;  3AZL C;  1P3K B;  3NQJ A;  3AZE B;  1ID3 B;  3AZJ D;  4WZS B;  5B1L A;  3LEL D;  3REH C;  1S32 B;  4XZQ C;  4J8U C;  5GT3 D;  3O62 C;  1KU5 A;  3LJA A;  2HUE B;  2YFW A;  4YS3 B;  2PYO D;  5B32 A;  1P3P D;  4Z66 A;  3LZ1 B;  1P3K A;  3AZE A;  3REJ D;  1ID3 A;  2NQB A;  4Z5T B;  5B2J D;  5CPK B;  4UUZ B;  1S32 A;  5B1L C;  2L5A A;  1M19 B;  3WAA D;  2HIO D;  2JSS A;  4J8V D;  3AZH B;  2F8N B;  3LJA C;  3REI D;  3LZ1 A;  5B32 C;  4Z66 C;  4HGA C;  1KX4 B;  1P3K C;  1ID3 C;  1H3O B;  2NQB C;  4Z5T A;  5BO0 B;  3REK A;  3MGS B;  3WKJ D;  5CP6 D;  1S32 C;  1M19 A;  2ARO D;  3AZH A;  1M1A D;  2F8N A;  3MNN B;  1TZY D;  3LZ1 C;  3AN2 C;  1KX4 A;  5AY8 B;  5BO0 A;  3AZL D;  4X23 B;  4Z5T C;  5AVC A;  3MGS A;  3AZG B;  5CPJ D;  3REK C;  1P3M D;  3AZM D;  3VH5 T;  3AZJ B;  3REH D;  3AZH C;  3MNN A;  3LEL B;  4J8U D;  3O62 D;  3AZN D;  5GT3 B;  5KDM B;  3KSY A;  4NFT A;  5B33 D;  2PYO B;  2LY8 A;  1P3F D;  4X23 A;  1P3P B;  4JJN D;  5AVC C;  3MGS C;  3REJ B;  3AFA D;  5B1L D;  5B2J B;  3LEL A;  3MNN C;  3B0C W;  5GT3 A;  5GXQ D;  3WAA B;  2HIO B;  5KDM A;  4J8V B;  3REI B;  2PYO A;  4X23 C;  5B2I D;  2NQB D;  3UTA D;  3KUY D;  5B2J A;  3LEL C;  5CP6 B;  4E44 A;  3WKJ B;  5GT3 C;  3WAA A;  2HIO A;  2ARO B;  1M1A B;  3C1C D;  4G92 B;  3REI A;  2PYO C;  3AN2 D;  1TZY B;  1B6W A;  4G91 B;  3REK D;  3AZK D;  3AZL B;  2RVQ D;  3REL D;  5B2J C;  3WKJ A;  5CP6 A;  5CPJ B;  1P3O D;  1P3M B;  3AZM B;  4NE3 A;  2ARO A;  3WAA C;  2HIO C;  3REH B;  4KHA A;  4J8U B;  3O62 B;  3REI C;  3AZN B;  1TZY A;  3X1S D;  4H9S A;  1F1E A;  5B33 B;  5B31 G;  5AVB D;  5AVC D;  1P3F B;  4JJN B;  5CPJ A;  3NQJ B;  5CHL B;  1P3M A;  3WKJ C;  5CP6 C;  3AZM A;  3AFA B;  2ARO C; 
#chains in the Genus database with same CATH topology
 3A1K A;  5B1L B;  4G92 C;  3AZN A;  2CV5 D;  4Z2M G;  2YFV B;  1P3B D;  3R45 A;  5BT1 D;  5GXQ B;  5B24 D;  1TZY C;  4H9S C;  5BNX A;  4CSR B;  4Z2M H;  5B33 A;  5AV6 D;  4G91 C;  1P3F A;  2J8P A;  4ZBJ B;  4JJN A;  2IO5 C;  5C3I B;  4LD9 A;  5CPJ C;  5B2I B;  1P3M C;  2NQB B;  3B0C T;  3AFA A;  3AZM C;  3KUY B;  2Y2O A;  3X1U C;  3WA9 A;  2YFV A;  1N1J B;  3AZN C;  5GXQ A;  3W96 D;  4CSR A;  3C1C B;  3B0B A;  5B33 C;  2ZY5 A;  4E45 A;  2FFF B;  3AN2 B;  1HQ3 D;  1P3F C;  4JJN C;  5B2I A;  4LD9 C;  3UTA A;  3AFA C;  3KUY A;  3W99 A;  3REK B;  3AZK B;  3REL B;  1P3O B;  1N1J A;  3WA9 C;  3KWQ D;  5GXQ C;  3VH5 A;  3C1C A;  3P5J B;  3AN2 A;  3C1B D;  3X1S B;  2DQN C;  4ZBJ C;  5JRG D;  5C3I C;  5B2I C;  1P3A D;  4EO5 B;  3AYW D;  1M18 A;  3UTA C;  1U35 D;  5AVB B;  5AVC B;  3AZK A;  3KUY C;  3W99 C;  3REL A;  3WTP D;  4R8P D;  1P3O A;  3H0R C;  3H0L C;  1Z2C B;  1AOI D;  2BG1 A;  3C1C C;  2FJ7 D;  5DNM D;  5GSU D;  2CV5 B;  1P3B B;  1JFI A;  1ZLA D;  1BH9 A;  4CAY B;  3X1S A;  5B24 B;  3X1T A;  5AV6 B;  5B1M D;  1R4V A;  1M18 C;  5AVB A;  5GT0 A;  3MGP C;  1P34 A;  3AZK C;  2RVQ C;  3REL C;  1P3O C;  4WV4 B;  5AV8 D;  3X1U D;  1B67 A;  5F99 A;  4QLC D;  3AV1 D;  2CV5 A;  1P3B A;  4CAY A;  5B24 A;  1WWI A;  3X1S C;  3W96 B;  2Y2Q A;  5AV6 A;  3MGR D;  3X1T C;  4EO5 C;  5AVB C;  1HQ3 B;  5GT0 C;  1P34 C;  4LD9 D;  2NZD D;  3B6G D;  3WA9 D;  3B0D B;  2XD5 A;  3V9R B;  5F99 C;  2Y2J A;  4XUJ C;  2CV5 C;  2DF4 C;  3KWQ B;  1P3B C;  5BT1 C;  3W96 A;  5B24 C;  3AZF D;  4WJ3 C;  1KX3 D;  5AV6 C;  1HQ3 A;  3C1B B;  5AV9 D;  3UT9 D;  5JRG B;  1P3A B;  3AYW B;  3W99 D;  1U35 B;  5JA4 B;  3IP4 C;  3WTP B;  3W98 D;  3V9R A;  4R8P B;  2F8N K;  1P3L A;  3KWQ A;  3EPH A;  1AOI B;  5B32 G;  4KHA B;  4H9R B;  3W96 C;  1P3G D;  5G49 B;  2FJ7 B;  1P3I D;  5DNM B;  5GSU B;  1ZLA B;  3C1B A;  1HQ3 C;  2Y2I A;  5DNN D;  5JRG A;  1M18 D;  3EPK A;  3MGP D;  1P3A A;  4WNN A;  3AYW A;  5B1M B;  1U35 A;  5JA4 A;  2IO5 B;  3WTP A;  4R8P A;  3B0D C;  1WWS A;  1P3L C;  3KWQ C;  3W97 A;  1AOI A;  2Y2N A;  5AV8 B;  3X1U B;  4H9R A;  1KX5 D;  5E5A D;  2F2A C;  5G49 A;  1HTA A;  4QLC B;  3AV1 B;  5CPI D;  5DNM A;  5GSU A;  3R45 B;  1ZLA A;  2FJ7 A;  3A6N D;  2G5H C;  3C1B C;  5BNX B;  3LZ0 D;  3X1T D;  5JRG C;  4YS3 D;  4WU8 D;  5B1M A;  5GT0 D;  4H9O A;  3MGR B;  3AYW C;  1P34 D;  1P3A C;  1U35 C;  4LD9 B;  2F8N G;  3WTP C;  4H9N B;  2NZD B;  4R8P C;  4ZUX A;  3X1U A;  5AV8 A;  2F8N H;  3B6G B;  5FUG B;  1AOI C;  3W97 C;  2Y2P A;  5F99 D;  4XUJ D;  3WA9 B;  5B31 D;  4QLC A;  3AV1 A;  2FJ7 C;  5DNM C;  5GSU C;  3TU4 A;  1ZLA C;  3AZF B;  1KX3 B;  3MGR A;  4WU9 A;  5B1M C;  5AV9 B;  3UT9 B;  4H9N A;  2NZD A;  3UTA B;  1F66 D;  4ZUX C;  5FUG A;  3B6G A;  3W99 B;  5AV8 C;  4DQY B;  3W98 B;  4QLC C;  3AV1 C;  2ZY4 A;  3MVD A;  5B0Z A;  5B0Y D;  3TU4 C;  4J8W D;  5B40 D;  4J8X A;  3AZF A;  1P3G B;  1KX3 A;  1P3I B;  3MGR C;  1Q9C A;  4WU9 C;  5AV9 A;  2Y2L A;  2Y2M A;  3UT9 A;  5DNN B;  4NE6 A;  1M18 B;  2NZD C;  3MGP B;  4AWL B;  3B6G C;  3FDD A;  3KFU G;  3W98 A;  1TAF B;  2ZY2 A;  1P3L D;  3AZI D;  3X1V D;  3MVD C;  2G5I C;  5B0Z C;  3UTB A;  4YM6 D;  5E5A B;  1KX5 B;  4J8X C;  3AZF C;  1P3G A;  5CPI B;  1KX3 C;  1P3I A;  1JFI B;  4KUD D;  1BH9 B;  3A6N B;  3F6T A;  5DNN A;  5AV9 C;  3UT9 C;  4UPK A;  3LZ0 B;  2Y2G A;  3X1T B;  3MGP A;  4WU8 B;  1P34 B;  5GT0 B;  3KXB C;  3VH6 T;  1TAF A;  4KGC D;  3W98 C;  3W97 D;  3EPL A;  1KX5 A;  5E5A A;  5F99 B;  3UTB C;  4XUJ B;  5CPI A;  1PZR A;  5B31 B;  1P3G C;  1EQZ D;  3AV2 D;  1P3I C;  3A6N A;  3LZ0 A;  5DNN C;  4YS3 A;  4WU8 A;  4AWL C;  3AL0 C;  4M6B A;  3AZE C;  4ZUX D;  1F66 B;  2BYK B;  3B6F D;  2XD1 A;  5CPK A;  4UUZ A;  3MGQ D;  4XUJ A;  5E5A C;  5B31 A;  1KX5 C;  5CPI C;  3NQU B;  3TU4 D;  3A6N C;  5B0Y B;  4J8W B;  5B40 B;  4NE5 A;  2Y2H A;  2HUE C;  3LZ0 C;  4WU9 D;  4YS3 C;  4WU8 C;  5AV5 D;  1F66 A;  1H3O A;  2BYK A;  1ULY A;  5CPK C;  3A1I A;  5B31 C;  3NQU A;  1P3L B;  3MVD D;  5B0Z D;  3AZI B;  3X1V B;  1M19 C;  5B0Y A;  4J8X D;  4J8W A;  5B40 A;  4YM6 B;  4XZQ D;  4H9P B;  4H9Q B;  4KUD B;  3EG5 B;  5AY8 A;  1KX4 C;  3KXB D;  4WNN B;  1F66 C;  3AZG A;  4KGC B;  3WTP E;  3AZI A;  3AZJ A;  3X1V A;  3W97 B;  3UTB D;  5B0Y C;  4YM6 A;  1BH8 B;  4J8W C;  5B40 C;  4H9P A;  1EQZ B;  4H9Q A;  5BNV B;  4KUD A;  3AV2 B;  3LJA D;  4DRB A;  5AY8 C;  4H9O B;  5B32 D;  4Z66 D;  3H0M C;  1P3P A;  2JCH A;  1P3K D;  3AZE D;  1ID3 D;  3AZG C;  3REJ A;  4KGC A;  4ZUX B;  3VH6 W;  3AZJ C;  3X1V C;  3AZI C;  3B6F B;  2ZM5 A;  1BH8 A;  1S32 D;  2BYM B;  3MGQ B;  4YM6 C;  1EQZ A;  5BNV A;  3AV2 A;  3TU4 B;  4KUD C;  4J8V A;  1A7W A;  4WU9 B;  3LZ1 D;  1P3P C;  4KGC C;  3REJ C;  5AV5 B;  4Z5T D;  3B6F A;  5CPK D;  2BYM A;  3MGQ A;  1EQZ C;  1M19 D;  3MVD B;  5BS7 A;  3AZH D;  5B0Z B;  3AV2 C;  2F8N D;  1M1A A;  1T3U A;  4J8X B;  4J8V C;  2JE5 A;  1BFM A;  4XZQ B;  1KX4 D;  4DRA A;  5AV5 A;  3KXB B;  3AZL A;  2CWE A;  3B6F C;  3MGS D;  3MGQ C;  3VH6 A;  5BS7 C;  2Y2K A;  3MNN D;  3REH A;  3UTB B;  3VH5 W;  1M1A C;  4XZQ A;  4J8U A;  3O62 A;  5AY8 D;  3LJA B;  2YFW B;  3KXB A;  5AV5 C;  4X23 D;  5B32 B;  4Z66 B;  4HGA B;  3AZG D;  3AZL C;  1P3K B;  3NQJ A;  3AZE B;  1ID3 B;  3AZJ D;  4WZS B;  5B1L A;  3LEL D;  3REH C;  1S32 B;  4XZQ C;  4J8U C;  5GT3 D;  3O62 C;  1KU5 A;  3LJA A;  2HUE B;  2YFW A;  4YS3 B;  2PYO D;  2RIQ A;  5B32 A;  1P3P D;  4Z66 A;  3LZ1 B;  1P3K A;  3AZE A;  3REJ D;  1ID3 A;  2NQB A;  4Z5T B;  5B2J D;  5CPK B;  4UUZ B;  1S32 A;  5B1L C;  2L5A A;  1M19 B;  3WAA D;  2HIO D;  2JSS A;  4J8V D;  3AZH B;  2F8N B;  3LJA C;  3REI D;  3LZ1 A;  5B32 C;  4Z66 C;  4HGA C;  1KX4 B;  1P3K C;  1ID3 C;  1H3O B;  2NQB C;  4Z5T A;  5BO0 B;  1W2E A;  3REK A;  3MGS B;  3WKJ D;  5CP6 D;  1S32 C;  1M19 A;  2ARO D;  3AZH A;  1M1A D;  2F8N A;  3MNN B;  1TZY D;  3LZ1 C;  3AN2 C;  1KX4 A;  5AY8 B;  5BO0 A;  3AZL D;  4X23 B;  4Z5T C;  5AVC A;  3MGS A;  3AZG B;  5CPJ D;  3REK C;  1P3M D;  3AZM D;  3VH5 T;  3AZJ B;  3REH D;  3AZH C;  3MNN A;  3LEL B;  4J8U D;  3O62 D;  3AZN D;  5GT3 B;  5KDM B;  3KSY A;  4NFT A;  5B33 D;  2PYO B;  2LY8 A;  1P3F D;  4X23 A;  1P3P B;  4JJN D;  5AVC C;  3MGS C;  3REJ B;  3AFA D;  5B1L D;  5B2J B;  3LEL A;  2VQR A;  3MNN C;  3B0C W;  5GT3 A;  5GXQ D;  3WAA B;  2HIO B;  5KDM A;  4J8V B;  3REI B;  2PYO A;  4X23 C;  2UWX A;  5B2I D;  2NQB D;  3UTA D;  3KUY D;  5B2J A;  3LEL C;  5CP6 B;  2W8S A;  4E44 A;  3WKJ B;  5GT3 C;  3WAA A;  2HIO A;  2ARO B;  1M1A B;  3C1C D;  4G92 B;  3REI A;  2PYO C;  3AN2 D;  2ZY3 A;  1TZY B;  1B6W A;  4G91 B;  3REK D;  3AZK D;  3AZL B;  2RVQ D;  3REL D;  5B2J C;  3WKJ A;  5CP6 A;  5CPJ B;  1P3O D;  1P3M B;  3AZM B;  4NE3 A;  2ARO A;  3WAA C;  2HIO C;  3REH B;  4KHA A;  4J8U B;  3O62 B;  3REI C;  3AZN B;  1TZY A;  3X1S D;  4H9S A;  1F1E A;  5B33 B;  5B31 G;  5AVB D;  5AVC D;  1P3F B;  4JJN B;  5CPJ A;  3NQJ B;  5CHL B;  1P3M A;  3WKJ C;  5CP6 C;  3AZM A;  3EPJ A;  3AFA B;  2ARO C; 
#chains in the Genus database with same CATH homology
 3A1K A;  5B1L B;  4G92 C;  3AZN A;  2CV5 D;  4Z2M G;  2YFV B;  1P3B D;  3R45 A;  5BT1 D;  5GXQ B;  5B24 D;  1TZY C;  4H9S C;  5BNX A;  4CSR B;  4Z2M H;  5B33 A;  5AV6 D;  4G91 C;  1P3F A;  2J8P A;  4ZBJ B;  4JJN A;  2IO5 C;  5C3I B;  4LD9 A;  5CPJ C;  5B2I B;  1P3M C;  2NQB B;  3B0C T;  3AFA A;  3AZM C;  3KUY B;  2Y2O A;  3X1U C;  3WA9 A;  2YFV A;  1N1J B;  3AZN C;  5GXQ A;  3W96 D;  4CSR A;  3C1C B;  3B0B A;  5B33 C;  2ZY5 A;  4E45 A;  2FFF B;  3AN2 B;  1HQ3 D;  1P3F C;  4JJN C;  5B2I A;  4LD9 C;  3UTA A;  3AFA C;  3KUY A;  3W99 A;  3REK B;  3AZK B;  3REL B;  1P3O B;  1N1J A;  3WA9 C;  3KWQ D;  5GXQ C;  3VH5 A;  3C1C A;  3P5J B;  3AN2 A;  3C1B D;  3X1S B;  2DQN C;  4ZBJ C;  5JRG D;  5C3I C;  5B2I C;  1P3A D;  4EO5 B;  3AYW D;  1M18 A;  3UTA C;  1U35 D;  5AVB B;  5AVC B;  3AZK A;  3KUY C;  3W99 C;  3REL A;  3WTP D;  4R8P D;  1P3O A;  3H0R C;  3H0L C;  1Z2C B;  1AOI D;  2BG1 A;  3C1C C;  2FJ7 D;  5DNM D;  5GSU D;  2CV5 B;  1P3B B;  1JFI A;  1ZLA D;  1BH9 A;  4CAY B;  3X1S A;  5B24 B;  3X1T A;  5AV6 B;  5B1M D;  1R4V A;  1M18 C;  5AVB A;  5GT0 A;  3MGP C;  1P34 A;  3AZK C;  2RVQ C;  3REL C;  1P3O C;  4WV4 B;  5AV8 D;  3X1U D;  1B67 A;  5F99 A;  4QLC D;  3AV1 D;  2CV5 A;  1P3B A;  4CAY A;  5B24 A;  1WWI A;  3X1S C;  3W96 B;  2Y2Q A;  5AV6 A;  3MGR D;  3X1T C;  4EO5 C;  5AVB C;  1HQ3 B;  5GT0 C;  1P34 C;  4LD9 D;  2NZD D;  3B6G D;  3WA9 D;  3B0D B;  2XD5 A;  3V9R B;  5F99 C;  2Y2J A;  4XUJ C;  2CV5 C;  2DF4 C;  3KWQ B;  1P3B C;  5BT1 C;  3W96 A;  5B24 C;  3AZF D;  4WJ3 C;  1KX3 D;  5AV6 C;  1HQ3 A;  3C1B B;  5AV9 D;  3UT9 D;  5JRG B;  1P3A B;  3AYW B;  3W99 D;  1U35 B;  5JA4 B;  3IP4 C;  3WTP B;  3W98 D;  3V9R A;  4R8P B;  2F8N K;  1P3L A;  3KWQ A;  3EPH A;  1AOI B;  5B32 G;  4KHA B;  4H9R B;  3W96 C;  1P3G D;  5G49 B;  2FJ7 B;  1P3I D;  5DNM B;  5GSU B;  1ZLA B;  3C1B A;  1HQ3 C;  2Y2I A;  5DNN D;  5JRG A;  1M18 D;  3EPK A;  3MGP D;  1P3A A;  4WNN A;  3AYW A;  5B1M B;  1U35 A;  5JA4 A;  2IO5 B;  3WTP A;  4R8P A;  3B0D C;  1WWS A;  1P3L C;  3KWQ C;  3W97 A;  1AOI A;  2Y2N A;  5AV8 B;  3X1U B;  4H9R A;  1KX5 D;  5E5A D;  2F2A C;  5G49 A;  1HTA A;  4QLC B;  3AV1 B;  5CPI D;  5DNM A;  5GSU A;  3R45 B;  1ZLA A;  2FJ7 A;  3A6N D;  2G5H C;  3C1B C;  5BNX B;  3LZ0 D;  3X1T D;  5JRG C;  4YS3 D;  4WU8 D;  5B1M A;  5GT0 D;  4H9O A;  3MGR B;  3AYW C;  1P34 D;  1P3A C;  1U35 C;  4LD9 B;  2F8N G;  3WTP C;  4H9N B;  2NZD B;  4R8P C;  4ZUX A;  3X1U A;  5AV8 A;  2F8N H;  3B6G B;  5FUG B;  1AOI C;  3W97 C;  2Y2P A;  5F99 D;  4XUJ D;  3WA9 B;  5B31 D;  4QLC A;  3AV1 A;  2FJ7 C;  5DNM C;  5GSU C;  3TU4 A;  1ZLA C;  3AZF B;  1KX3 B;  3MGR A;  4WU9 A;  5B1M C;  5AV9 B;  3UT9 B;  4H9N A;  2NZD A;  3UTA B;  1F66 D;  4ZUX C;  5FUG A;  3B6G A;  3W99 B;  5AV8 C;  4DQY B;  3W98 B;  4QLC C;  3AV1 C;  2ZY4 A;  3MVD A;  5B0Z A;  5B0Y D;  3TU4 C;  4J8W D;  5B40 D;  4J8X A;  3AZF A;  1P3G B;  1KX3 A;  1P3I B;  3MGR C;  1Q9C A;  4WU9 C;  5AV9 A;  2Y2L A;  2Y2M A;  3UT9 A;  5DNN B;  4NE6 A;  1M18 B;  2NZD C;  3MGP B;  4AWL B;  3B6G C;  3FDD A;  3KFU G;  3W98 A;  1TAF B;  2ZY2 A;  1P3L D;  3AZI D;  3X1V D;  3MVD C;  2G5I C;  5B0Z C;  3UTB A;  4YM6 D;  5E5A B;  1KX5 B;  4J8X C;  3AZF C;  1P3G A;  5CPI B;  1KX3 C;  1P3I A;  1JFI B;  4KUD D;  1BH9 B;  3A6N B;  3F6T A;  5DNN A;  5AV9 C;  3UT9 C;  4UPK A;  3LZ0 B;  2Y2G A;  3X1T B;  3MGP A;  4WU8 B;  1P34 B;  5GT0 B;  3KXB C;  3VH6 T;  1TAF A;  4KGC D;  3W98 C;  3W97 D;  3EPL A;  1KX5 A;  5E5A A;  5F99 B;  3UTB C;  4XUJ B;  5CPI A;  1PZR A;  5B31 B;  1P3G C;  1EQZ D;  3AV2 D;  1P3I C;  3A6N A;  3LZ0 A;  5DNN C;  4YS3 A;  4WU8 A;  4AWL C;  3AL0 C;  4M6B A;  3AZE C;  4ZUX D;  1F66 B;  2BYK B;  3B6F D;  2XD1 A;  5CPK A;  4UUZ A;  3MGQ D;  4XUJ A;  5E5A C;  5B31 A;  1KX5 C;  5CPI C;  3NQU B;  3TU4 D;  3A6N C;  5B0Y B;  4J8W B;  5B40 B;  4NE5 A;  2Y2H A;  2HUE C;  3LZ0 C;  4WU9 D;  4YS3 C;  4WU8 C;  5AV5 D;  1F66 A;  1H3O A;  2BYK A;  1ULY A;  5CPK C;  3A1I A;  5B31 C;  3NQU A;  1P3L B;  3MVD D;  5B0Z D;  3AZI B;  3X1V B;  1M19 C;  5B0Y A;  4J8X D;  4J8W A;  5B40 A;  4YM6 B;  4XZQ D;  4H9P B;  4H9Q B;  4KUD B;  3EG5 B;  5AY8 A;  1KX4 C;  3KXB D;  4WNN B;  1F66 C;  3AZG A;  4KGC B;  3WTP E;  3AZI A;  3AZJ A;  3X1V A;  3W97 B;  3UTB D;  5B0Y C;  4YM6 A;  1BH8 B;  4J8W C;  5B40 C;  4H9P A;  1EQZ B;  4H9Q A;  5BNV B;  4KUD A;  3AV2 B;  3LJA D;  4DRB A;  5AY8 C;  4H9O B;  5B32 D;  4Z66 D;  3H0M C;  1P3P A;  2JCH A;  1P3K D;  3AZE D;  1ID3 D;  3AZG C;  3REJ A;  4KGC A;  4ZUX B;  3VH6 W;  3AZJ C;  3X1V C;  3AZI C;  3B6F B;  2ZM5 A;  1BH8 A;  1S32 D;  2BYM B;  3MGQ B;  4YM6 C;  1EQZ A;  5BNV A;  3AV2 A;  3TU4 B;  4KUD C;  4J8V A;  1A7W A;  4WU9 B;  3LZ1 D;  1P3P C;  4KGC C;  3REJ C;  5AV5 B;  4Z5T D;  3B6F A;  5CPK D;  2BYM A;  3MGQ A;  1EQZ C;  1M19 D;  3MVD B;  5BS7 A;  3AZH D;  5B0Z B;  3AV2 C;  2F8N D;  1M1A A;  1T3U A;  4J8X B;  4J8V C;  2JE5 A;  1BFM A;  4XZQ B;  1KX4 D;  4DRA A;  5AV5 A;  3KXB B;  3AZL A;  2CWE A;  3B6F C;  3MGS D;  3MGQ C;  3VH6 A;  5BS7 C;  2Y2K A;  3MNN D;  3REH A;  3UTB B;  3VH5 W;  1M1A C;  4XZQ A;  4J8U A;  3O62 A;  5AY8 D;  3LJA B;  2YFW B;  3KXB A;  5AV5 C;  4X23 D;  5B32 B;  4Z66 B;  4HGA B;  3AZG D;  3AZL C;  1P3K B;  3NQJ A;  3AZE B;  1ID3 B;  3AZJ D;  4WZS B;  5B1L A;  3LEL D;  3REH C;  1S32 B;  4XZQ C;  4J8U C;  5GT3 D;  3O62 C;  1KU5 A;  3LJA A;  2HUE B;  2YFW A;  4YS3 B;  2PYO D;  2RIQ A;  5B32 A;  1P3P D;  4Z66 A;  3LZ1 B;  1P3K A;  3AZE A;  3REJ D;  1ID3 A;  2NQB A;  4Z5T B;  5B2J D;  5CPK B;  4UUZ B;  1S32 A;  5B1L C;  2L5A A;  1M19 B;  3WAA D;  2HIO D;  2JSS A;  4J8V D;  3AZH B;  2F8N B;  3LJA C;  3REI D;  3LZ1 A;  5B32 C;  4Z66 C;  4HGA C;  1KX4 B;  1P3K C;  1ID3 C;  1H3O B;  2NQB C;  4Z5T A;  5BO0 B;  1W2E A;  3REK A;  3MGS B;  3WKJ D;  5CP6 D;  1S32 C;  1M19 A;  2ARO D;  3AZH A;  1M1A D;  2F8N A;  3MNN B;  1TZY D;  3LZ1 C;  3AN2 C;  1KX4 A;  5AY8 B;  5BO0 A;  3AZL D;  4X23 B;  4Z5T C;  5AVC A;  3MGS A;  3AZG B;  5CPJ D;  3REK C;  1P3M D;  3AZM D;  3VH5 T;  3AZJ B;  3REH D;  3AZH C;  3MNN A;  3LEL B;  4J8U D;  3O62 D;  3AZN D;  5GT3 B;  5KDM B;  3KSY A;  4NFT A;  5B33 D;  2PYO B;  2LY8 A;  1P3F D;  4X23 A;  1P3P B;  4JJN D;  5AVC C;  3MGS C;  3REJ B;  3AFA D;  5B1L D;  5B2J B;  3LEL A;  2VQR A;  3MNN C;  3B0C W;  5GT3 A;  5GXQ D;  3WAA B;  2HIO B;  5KDM A;  4J8V B;  3REI B;  2PYO A;  4X23 C;  2UWX A;  5B2I D;  2NQB D;  3UTA D;  3KUY D;  5B2J A;  3LEL C;  5CP6 B;  2W8S A;  4E44 A;  3WKJ B;  5GT3 C;  3WAA A;  2HIO A;  2ARO B;  1M1A B;  3C1C D;  4G92 B;  3REI A;  2PYO C;  3AN2 D;  2ZY3 A;  1TZY B;  1B6W A;  4G91 B;  3REK D;  3AZK D;  3AZL B;  2RVQ D;  3REL D;  5B2J C;  3WKJ A;  5CP6 A;  5CPJ B;  1P3O D;  1P3M B;  3AZM B;  4NE3 A;  2ARO A;  3WAA C;  2HIO C;  3REH B;  4KHA A;  4J8U B;  3O62 B;  3REI C;  3AZN B;  1TZY A;  3X1S D;  4H9S A;  1F1E A;  5B33 B;  5B31 G;  5AVB D;  5AVC D;  1P3F B;  4JJN B;  5CPJ A;  3NQJ B;  5CHL B;  1P3M A;  3WKJ C;  5CP6 C;  3AZM A;  3EPJ A;  3AFA B;  2ARO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...