3O6EX

Crystal structure of human hiwi1 paz domain (residues 277-399) in complex with 14-mer rna (12-bp + 2-nt overhang) containing 2'-och3 at its 3'-end
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
117
structure length
107
Chain Sequence
ETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPVLVSQPKGPAMLIPELCYLTGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Piwi-like protein 1
publication title Inaugural Article: Structural basis for piRNA 2'-O-methylated 3'-end recognition by Piwi PAZ (Piwi/Argonaute/Zwille) domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 20
structure length 107
sequence length 117
ec nomenclature
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 3o6eX00
1R6ZA 1R4KA 4NH6A 3QIRA 2XFMA 1T2SA 3O7VX 4NGDA 4Z4FA 2FFLA 4W5OA 2L5DA 4KREA 1T2RA 4NGCA 4OLAA 3O6EX 4NHAA 4KRFA 4Z4IA 5JS1A 3O3IX 3MJ0A 4W5TA 4NH5A 5KI6A 1SI2A 4W5RA 4F3TA 4Z4CA 4NGFA 4W5NA 4NH3A 4Z4GA 1SI3A 2L5CA 3O7XA 1VYNA 4W5QA 4Z4EA 4NGGA 4Z4HA 5T7BA 4OLBA 4NGBA 2QVWA 5JS2A
chains in the Genus database with same CATH superfamily
3HVRA 1R6ZA 1R4KA 3HJFA 3QIRA 4NH6A 2XFMA 1T2SA 3O7VX 4NGDA 4Z4FA 3U1UA 3HK2A 2FFLA 4W5OA 2L5DA 4KREA 1T2RA 4NGCA 4OLAA 3HM9A 3O6EX 4NHAA 4KRFA 4Z4IA 5JS1A 2BZEA 3O3IX 3MJ0A 3DLBA 2DB9A 4W5TA 4NH5A 5KI6A 1SI2A 4W5RA 1Z26A 4F3TA 1U04A 4Z4CA 3F73A 4NGFA 4W5NA 4NH3A 4Z4GA 1SI3A 2L5CA 3O7XA 1VYNA 4L1PA 4W5QA 4L1UA 4Z4EA 4Z4HA 4NGGA 5T7BA 4OLBA 4NGBA 3DA5A 3HO1A 1Z25A 3DLHA 2QVWA 5JS2A
chains in the Genus database with same CATH topology
3HVRA 1R6ZA 1R4KA 3HJFA 3QIRA 4NH6A 2XFMA 1T2SA 3O7VX 4NGDA 4Z4FA 3U1UA 3HK2A 2FFLA 4W5OA 2L5DA 4KREA 1T2RA 4NGCA 4OLAA 3HM9A 3O6EX 4NHAA 4KRFA 4Z4IA 5JS1A 2BZEA 3O3IX 3MJ0A 3DLBA 2DB9A 4W5TA 4NH5A 5KI6A 1SI2A 4W5RA 1Z26A 4F3TA 1U04A 4Z4CA 3F73A 4NGFA 4W5NA 4NH3A 4Z4GA 1SI3A 2L5CA 3O7XA 1VYNA 4L1PA 4W5QA 4L1UA 4Z4EA 4Z4HA 4NGGA 5T7BA 4OLBA 4NGBA 3DA5A 3HO1A 1Z25A 3DLHA 2QVWA 5JS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R6Z A;  1R4K A;  4NH6 A;  3QIR A;  2XFM A;  1T2S A;  3O7V X;  4NGD A;  4Z4F A;  2FFL A;  4W5O A;  2L5D A;  4KRE A;  1T2R A;  4NGC A;  4OLA A;  3O6E X;  4NHA A;  4KRF A;  4Z4I A;  5JS1 A;  3O3I X;  3MJ0 A;  4W5T A;  4NH5 A;  5KI6 A;  1SI2 A;  4W5R A;  4F3T A;  4Z4C A;  4NGF A;  4W5N A;  4NH3 A;  4Z4G A;  1SI3 A;  2L5C A;  3O7X A;  1VYN A;  4W5Q A;  4Z4E A;  4NGG A;  4Z4H A;  5T7B A;  4OLB A;  4NGB A;  2QVW A;  5JS2 A; 
#chains in the Genus database with same CATH topology
 3HVR A;  1R6Z A;  1R4K A;  3HJF A;  3QIR A;  4NH6 A;  2XFM A;  1T2S A;  3O7V X;  4NGD A;  4Z4F A;  3U1U A;  3HK2 A;  2FFL A;  4W5O A;  2L5D A;  4KRE A;  1T2R A;  4NGC A;  4OLA A;  3HM9 A;  3O6E X;  4NHA A;  4KRF A;  4Z4I A;  5JS1 A;  2BZE A;  3O3I X;  3MJ0 A;  3DLB A;  2DB9 A;  4W5T A;  4NH5 A;  5KI6 A;  1SI2 A;  4W5R A;  1Z26 A;  4F3T A;  1U04 A;  4Z4C A;  3F73 A;  4NGF A;  4W5N A;  4NH3 A;  4Z4G A;  1SI3 A;  2L5C A;  3O7X A;  1VYN A;  4L1P A;  4W5Q A;  4L1U A;  4Z4E A;  4Z4H A;  4NGG A;  5T7B A;  4OLB A;  4NGB A;  3DA5 A;  3HO1 A;  1Z25 A;  3DLH A;  2QVW A;  5JS2 A; 
#chains in the Genus database with same CATH homology
 3HVR A;  1R6Z A;  1R4K A;  3HJF A;  3QIR A;  4NH6 A;  2XFM A;  1T2S A;  3O7V X;  4NGD A;  4Z4F A;  3U1U A;  3HK2 A;  2FFL A;  4W5O A;  2L5D A;  4KRE A;  1T2R A;  4NGC A;  4OLA A;  3HM9 A;  3O6E X;  4NHA A;  4KRF A;  4Z4I A;  5JS1 A;  2BZE A;  3O3I X;  3MJ0 A;  3DLB A;  2DB9 A;  4W5T A;  4NH5 A;  5KI6 A;  1SI2 A;  4W5R A;  1Z26 A;  4F3T A;  1U04 A;  4Z4C A;  3F73 A;  4NGF A;  4W5N A;  4NH3 A;  4Z4G A;  1SI3 A;  2L5C A;  3O7X A;  1VYN A;  4L1P A;  4W5Q A;  4L1U A;  4Z4E A;  4Z4H A;  4NGG A;  5T7B A;  4OLB A;  4NGB A;  3DA5 A;  3HO1 A;  1Z25 A;  3DLH A;  2QVW A;  5JS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...