3O6KH

Crystal structure of anti-tat hiv fab'11h6h1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWFCQTPEKRLEWVASISSGGSYTYYPDSVKGRFTISRDNARNTLYLQMNSLRSEDTALYYCARDYDYGVDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11H6H1 Fab' light chain
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kH01
5C6PB 4WTZA 1U42A 2NNAA 2F58H 4P5KB 3AVEA 4CL7A 4FG6D 3C5SB 1SJEA 2PF6A 2UY6A 5T1KD 4PGCA 1LO2L 2APBA 5ICYA 2EZ0C 3TC9A 1RUMH 5EIVA 2X10A 2JJTA 5DI8B 2RJMA 4PG9A 4HFWA 3SDCA 5JO5B 4OI9A 4ELME 3KPSA 3MLXL 4F80A 2ZPKL 3FMGH 2QSQA 3OGOE 4OCXL 2EE3A 3ILQD 3TIEA 4CN6A 5JTWA 1TNNA 2OSLA 1J0YA 1I1AD 3GO1H 5ISZD 1YZZA 3GMMB 3TT3H 1SMOA 5B38G 3QA3A 4NFCA 4N0RA 4YFLI 3HI5L 4H5SA 4GH7B 3TWCH 4RFEA 2IWGA 4R2GB 2I26N 2PR4L 3G6JF 4UQ2B 3JTSB 5D7IB 4ENEC 3GEWB 5C0AB 3PDGA 4N9OB 5D96C 4HK0A 1MHEA 2C9AA 4PJIA 4CMMB 1HK6A 4MJIE 1TTGA 4G8FB 3K1KC 4TUJA 5KG9A 2DMCA 4KRMB 1LEGB 4KJWC 4KK5C 2IBZX 3WIIL 2PXYD 1DEEA 5GRJL 1BAFL 2BVEA 5GGSB 3EYVB 3JV0A 1A9EA 4NQVA 1S7WA 5D7JA 5ADPL 4MB5A 2RHEA 1HILB 2R29L 2BXYA 4HWNA 2XNAA 4KDVA 1LO3H 4J1UB 1VFOA 3ROOA 1MCPL 1WBYA 4F7CB 5FHBL 4PLKC 4XBGB 1NMCB 1JN6A 5FUOL 3T0VA 3VFRA 1IFHL 4PRNA 5DD1H 1SBSH 5B21A 5D2NA 3QBTB 3G6JB 1B2WH 2EIEA 1E4KA 1CBVH 4LHUG 3WLBB 3JWDL 1T20A 2G60H 1AGEB 3ZKSD 4PY8J 3PGCA 1Z2KA 3ULUC 4XB8A 3KLHD 3KPRA 5IEHB 2NY4C 1FFOB 1E6JH 4MD4A 4XVUC 2ITCB 5EOTA 3MRGB 2HJKA 1KC5L 1BQSA 3B2VL 5CJQH 4ZUUB 5I1GL 3G9AB 4QRSB 5EU6B 4KI5E 1VGEL 5C1MB 4FXGA 1QYGH 3ARDC 3S37X 2BDNL 3ULVF 3VRLE 1ZHNA 2NY6C 3T09A 5C0DA 1PFCA 4CADA 5DRWB 2NR6C 1J8HA 4JO3L 5DMKA 1IBGH 4JQVA 1A47A 4TPRH 4DKFL 1EFQA 3LKOB 3LKRB 3M1BB 1EO7A 4EI6B 5BO1L 3CFCH 2XZAL 1SEBA 1F8TH 1DQDL 2UUDH 3K0WA 4N90E 3HZKB 5GSRA 4BFEA 2ADGB 4KHXL 3UJIL 2DQTL 3V52L 2C1PA 3KLAB 3RGVA 4ZFFA 3P9WB 3RRQA 1QEWA 2Q1EA 3BPCB 4X5XB 1GHFH 4KU1A 3MV9E 4HAFA 5E5MA 4NQEB 4WWID 1S5IH 3RTQC 3SDDD 2VDML 5IJKA 1FL5B 5HHVL 1WWWX 1NGYA 5B38A 2DD8L 5IW6B 1H5BB 2ESVD 1UM5H 5HI4D 3V6OE 5LWYL 2P5WB 3DVNA 2IQAB 2YZ1A 3SGEH 1KFAH 4NUJB 5IR1A 1CD0A 5GJSH 1YNTB 1CDIA 2ADFL 3HB3C 1BD2A 3ZDXE 2W60B 4OCRH 1GGIH 1CFVL 2X4QA 3P0VL 2V2WB 3MJ9H 3U48A 3OGCB 3KPOA 3F62A 4BM7A 1UJ3B 3CDCA 2HJFB 4Q9CA 5TDOB 2DQFA 3SGKA 4KK6D 5MI0B 3MLPA 4FQCH 4P2OA 4O2FB 2BNQB 3RBGA 3OKDA 3RVWD 3QXAB 1AQDA 3BXNB 3LQAL 1CS6A 3BP5A 1XCTA 3LY6A 3NTCL 2R2HA 4ZAKC 3VWKD 1GC1C 4AEEA 1C5DA 2DM4A 1ACZA 1OWRM 3MRFA 3FRPG 5JPNA 3MRBB 5EOQL 1GAFH 2F74B 5ECJE 1R5WB 3CFJB 3W5MA 4PYHA 1ULVA 3MNVB 4OF3A 1AR1D 5IFJB 4G6AD 1H8SA 1M05B 5JXAL 1Z9SA 3MODH 1EMTH 4JFFD 2Z93A 1B0RB 4LARL 5FGCE 2GK0B 4MLSA 5ID0B 3PWVB 1BBDH 4XCEB 1LO0H 2YXFA 3RKDC 1RZGB 1ZLVH 4P9MH 1BVLB 1S7TA 5K59E 1LILA 2RBLA 1BFOB 1D5ZA 4JQXA 4M1CD 5MEOB 4S1QH 2NNAB 3PL6A 3RL1A 2YPLA 5E08H 2BNRA 4K3HA 2OYPA 4LCWA 6FABL 4OB5H 1IEAA 1N3NA 4R0LB 3MV8D 4PJIF 1U6AL 4A2LA 2WW8A 4XZUA 5ICYB 1P6AB 2NZIA 4PGCB 1YQVH 4PG9B 4HFWB 2W9EH 3K4DA 4B41A 4CDGC 1BHGA 4FZ8L 4NCC1 3PABB 3QUZC 5BRZE 1EDQA 3TIEB 4JFEA 1IAIH 2Z31A 3N06B 4YDIL 1IQWL 1DFBL 1DE4B 5TQ0H 1OOAA 2R0KH 1V3LA 1CWVA 1D6VL 3IGAB 4JHAH 1Z9LA 2VZVA 4H5SB 5DJCA 2J4WL 3QJHA 2DKSA 15C8L 1V3JA 4PRPA 4HK0B 1MHEB 1KTRL 1GC1H 4PJIB 4QXGL 2RCSL 4WUKL 4K23L 3W11D 1KXTB 1KG0A 4TUJB 3EJJX 4QCIA 2P8MA 3GM0A 4L5FH 5EOCH 4F9PC 5I76A 5HJ3A 3HE7C 3RIAF 5HGBA 1ZOXA 1WFTA 5HGDA 1FNHA 4WU7A 4NQVB 1S7WB 3RVTC 1INDL 3MA9L 4XH2A 3KPNB 2VLRA 5EU4A 1ZT1B 2XNAB 4M4PA 5D2LA 4XCNA 4XVJH 3D39D 3VG0H 1OTUC 3NA9H 1WBYB 1R0AH 1JN6B 3X3FL 5ALCH 4Y5XC 4PRNB 5DJ2B 5D2NB 4HJJL 1FNGA 5E9DD 1JZ7A 4HUUB 3VXSD 4F15B 5I1IL 5CEZE 3IVKA 1DDHA 4Z7VF 4GAGH 1UCBH 3LDBC 1T20B 4P5MA 1P2CA 4L4TD 3PGCB 3UZEA 4GRMB 2ZP0T 3GSNH 5IG7A 1U92A 2YBRA 3KPRB 2DQUL 3UBXG 5JXEC 2GJ6A 3CXDL 4L3CA 4MD4B 3TNNA 1YNKH 1YJDH 4UDTA 5E2TH 1M6OA 5EOTB 2HJKB 3QQ3B 2VDRH 1TTFA 4FXGB 2R69H 5E7FA 2C4FT 1CT8A 2QQNH 4M7LT 1ZHNB 2VXSH 4ZMAT 5C0DB 4YUEL 3DMMD 2R0LH 2YA2A 1J8HB 3HG1A 4FTVE 3RNQB 2FX7H 1YN7B 3VFVA 1DZBA 5DMKB 1MHCA 2FGWH 4Z7VB 2H41A 3SE8H 5TQ2H 2CKBH 1MI5B 5JIHA 3C8DA 5L8JB 1M1SA 2MHAA 1S7SB 1IRAY 5I1LB 2VWEE 2JELL 3LCYA 3ARFD 1IGJA 4X98B 2H2SD 4LCCC 3B9DA 3PE9A 4EVNA 4MWFA 5L88L 2C1PB 3RGVB 4ZFFB 1PVHA 1QEWB 3CX2A 4X7CC 5EORH 4BUGA 5E5MB 4ODVL 1D5IH 3GI9L 4WVRA 3K2UL 1RVFL 4O2EA 3GJFH 4BFBD 4M4RA 4S10A 2OL3H 5J9PA 5B38B 1EGJA 2EZ0D 4HKJB 1DQLL 1JNJA 4ONFL 4ZNEA 3DVNB 4J3OC 3QXDA 4PY7A 1I8KA 4GAYB 5IR1B 3STLB 4C56A 4F7EA 1J1XL 4HZLB 3RKPA 1LE5A 1BD2B 4MJ4A 1RULL 2ZUTA 4AIOA 2NY5L 1LNUA 1R5IA 3TN0B 2X4QB 3GI8H 3V0WH 3VD4A 5L7XH 1G7HB 3KPOB 3SBWC 3WHXB 1ITBB 4FFVD 3IDXL 5FGBC 5FYKE 2XWBB 1CGYA 4ENED 4LSTL 5I8KL 1AQDB 1NCBL 4XP1L 3WXVL 25C8H 5I8EB 1P4BH 2Z8RA 2G5RA 2C3XA 4OFPA 5FK9A 1C5DB 3BGMA 4KVNL 1FZJA 4XB7A 2HKFH 4V1DD 5JPNB 1F6FB 4PB9H 4AEFA 3DUSB 1INEL 4KJWD 1A6UL 1NMAL 2I24N 1DQQA 3KVQA 4R4NC 5DHVH 4KPHH 4QRTA 3HMWL 4QF1B 1G9MC 3VXUA 4G8GA 2ICEA 3MOBH 2Q3AA 3ZE2F 2LV4A 4Y4HA 1ZVSA 3X13A 7FABH 4NOFA 4OBRA 4M61A 4TNVF 3D3VA 3EYSH 4WO4C 1IGMH 4OFDA 4JE4B 3VG9C 4RCAA 3QXVA 4PLKD 5FM5M 2VL4A 3CK0H 5E8EA 2H32H 1QFPA 3B2UC 2R2BA 1N6QH 1QFUH 3PL6B 3RL1B 2YPLB 2BNRB 4OLVL 4U4BA 4PJ9A 4LCWB 1F6AA 4CU7A 1N3NB 1IEAB 1JHLL 1IEBB 1NJ9A 2CDGA 4J4PC 4WEMB 2NZ9C 4RBPH 5EO1B 5F7NC 5C0JA 3ULUD 3ZZ1A 5F44A 3DECA 2DM3A 2QADC 3SOBH 5IUSA 4BA8A 1TJGH 2NY4D 4OIBA 1H8NA 2QHRH 1QBLL 2JIXA 1JF5A 3NA4A 2YRZA 1KLUA 2Z31B 2FIRT 2QR0B 5DJDB 3MR9B 1RHFA 1MNUL 1II4E 1RZ7L 4WU5B 3O2DH 4LKXA 4Y2DB 4H8WL 3AM8A 3CNKA 3P40A 2NR6D 1JPTL 4PJAA 4LLAA 1JP5A 1T1XA 5DGRA 3ARGA 5FM5O 1V7NH 2ITDB 1LP9E 3KLDA 4KKBC 1R3LB 4ORGA 3U0WL 1UWEL 3GNML 4OT1L 5AAMA 4O00A 4PRPB 3GHEL 3Q1SH 3WHE0 4K8RH 5C0RL 3V2AR 1KG0B 3DIFA 1NCNA 2P8MB 1CU4H 3IDJB 1NCUA 5I76B 5HJ3B 5HGBB 5HGDB 4MNGE 1WSST 1XIWC 4WU7B 5TE6L 1MEXL 5KVDH 2GSIA 5ISZE 1FVCA 3QIWB 1DUZA 3V4VL 2VLRB 5DWUL 2HT3D 5EU4B 3WN5A 4XCNB 3RWEA 3BH8A 3RTQD 1IZKA 3LKSA 4HEME 3TA3A 2X5PA 1DCLA 1BMGA 1A7PL 3NZHH 4R7DA 3TM6A 3ZKMC 1FNGB 4RSVA 4ETQA 3VXQA 2D3VA 2B0SL 3O11B 5C2UB 3DYMA 2YD6A 5TPWL 1T6VN 1R3KA 3IVKB 4BFGA 3HB3D 4FNLH 4TUOA 2Q8AH 2R0WL 4P5MB 3SKNA 4PLNC 43CAB 1T2QH 2FX8H 2ZOLB 5IVXA 1P2CB 2E9WA 2WV3A 5IG7B 1QD0A 3U2SA 1IC5H 5FHAL 3HTLX 2GJ6B 4L3CB 1E4XI 3WKMH 2Y36L 3EDJA 3IAQA 3C08L 3I3DA 2I07A 4AMKL 4WEBL 4R2GC 1FDLL 2KH2B 2O5YL 2J88L 4OLUH 4ZAKD 3MSPA 4LRIA 4PV9A 5IBTL 5CSBA 1KV3A 3LS5L 1K2DA 4TNWF 3AB0B 3BEWB 4Q7DA 4HQQL 3VGAC 3WFBH 3FN0L 1S9WA 2MHAB 1CFTA 2XACC 1WAAE 5ITBH 3AS0A 2AI0H 2OZ4H 1Q9LB 1HKFA 4OKDA 1IGJB 3F7VA 1K4CB 4XBPA 1DBAL 3U7WL 2Q20A 1K8DA 2X7LA 4KRLB 4X9BA 1OAKH 4ZXBD 1KIPA 4OQTA 4LAQH 1EAJA 3WNPA 5HXMA 1QRNA 2FGZA 4O2EB 4ZFOA 3GMPA 3QIBB 2DRUA 5FV1L 2J7LA 4UTBL 1D9KD 4KKLC 1J0IA 3QXDB 1I8KB 5F89A 5BV7C 3S34H 4C56B 4F7EB 1A5FH 4AG4L 4OLZL 1LE5B 3QUZD 1IKNA 1SVCP 2QKIA 4KMLB 1R5IB 5AYQA 1HHHA 4L4VD 5IHUL 1NFDE 2BVPA 3KG5A 4JZNA 2JB5L 4XCFL 2AJYH 5I18H 2XPGA 5I1DA 3UYPA 1A6PA 5LGHH 4GMTH 4WI7A 3FQUA 2I9LA 2ESVE 3LEYH 1FVEA 5FK9B 1MFBH 3BGMB 2WWMC 5KSBE 1LK2A 1MCWW 1BFVL 3MRMA 2NY1D 3HE6A 3PWUA 2AEPL 4LLMA 3VWJA 1JYVA 1N4XH 1X4ZA 2ARWA 4JPKH 2V9TA 2ZNWA 4JQIH 2AXGB 4LLQA 3HLAB 1MF2H 3TBWA 4QRTB 1F2QA 3VXUB 4G8GB 3VFSA 2FHCA 2ICEB 3ZT5A 3X13B 1ZVSB 2CK0H 1O0VA 3ULVC 4Z7UE 3D3VB 4RMQA 4MS8D 4HWZA 4NO0B 1OSZB 3I6GA 2ICES 2QSCH 3S98A 3V8CA 1OTUD 4DGVH 4I8DA 1BM3H 2VC2L 2NXYB 1H5BC 5DVOA 4HWBA 5DUMH 5E8EB 4LOUC 1P7QD 1NAKH 1RUAH 4TVPH 3WNLA 2P45B 3FT4A 2R2BB 4X4ZA 3C09B 1QSEB 3QO0B 1P84J 2MTPA 2W9DH 1PSKH 1KT2A 4PJ9B 5AWNH 1U2HA 2OJEA 2UYLB 1NJ9B 3LD8B 3X11B 1G0YR 2VXVL 4R26H 4S1SH 1DBMH 3OZ9H 4PP2A 5EDXA 1UJ3C 4N0FA 4KHTH 2X1WL 5E2UH 2FBOJ 4P23A 5MI0C 5BV7H 4JFFE 3IDIA 5GGTH 4UILH 1A3QA 1W8OA 4R90H 4YHKL 2HAZA 5C86A 1XGTA 3S8WA 1FNEA 4ZTPH 5DZOA 1CFNB 3VD3A 2VDPH 1O7SA 3CCHA 5FKAB 5KTEH 1FGVL 4WY7L 1B88A 2G9HB 1C5BL 1RMFH 1T1XB 4H1LG 4U0RB 4FP8H 2FNBA 1MLCA 3ARGB 1ZVYA 4ORGB 3MV8E 4D9QD 3I6KA 4LVNB 2X89A 2D03L 3CLFL 5DQJA 2HWZL 5IVXF 5KZCD 2R56H 2NYYD 1OGAA 5DURD 4X0KA 5F9OH 2WLZA 1HYSC 3N85L 3QWRD 1Q9KA 4JB9H 1A7OH 3S3PA 4Y5VA 2CKBB 4Y19D 4IMKC 2R1XA 2GSIB 2E7CA 1ED3A 4HIJB 1KTLB 2G2RA 3FQTB 5DD0H 5LCVL 4PJXA 3BH8B 2HRPL 5HHPA 5FYLD 5CP7A 2GJZB 3V5HA 3EDDA 2AEQL 4NHUA 5HI3C 2YSSB 3SKOA 3HFMH 2JJTC 1OP3H 2FH8A 5KBNC 3NIFF 3SDCC 1PJ9A 3FO0L 5DEFA 3GJFB 1R3KB 1WIOA 3T2QA 1OCWL 4TUOB 3KPLA 3H6JA 2XWJA 3SKNB 5IVXB 2VXUH 4CVXA 4I3GA 1I4FA 3EYFB 3QCVL 3U2SB 1P1ZA 4JG0H 2YZ8A 5FIEA 1KPUB 3ZSTA 2I07B 5T1LD 3WFCL 3RPIA 1FLRL 3O45A 3D39E 4JN1H 2FRGP 1NQBA 3LIZL 4ETYA 4E5XA 3JVGA 1JGVL 3WDHA 1CLZL 3JV5A 5E9DE 2AV7A 3QEGL 3VXSE 5I75C 5IHBA 4MD0A 1K2DB 1A2YA 4ZUSA 4PGEB 5AYUL 1MCRA 3PQYD 4JZOB 4L4TE 5CD5D 3VFTA 1G9NC 5D7JC 5BXFA 1A64A 2YKLL 1F4HA 3JSSA 1CTNA 5FUCC 5JHDA 5F7EH 4WWKA 2D9QB 3U30B 3CU7A 3F7VB 1QPXA 4O4YH 1KN2L 1GGBH 3OKEA 1FG2A 2PW2A 5D2NC 1K8DB 2ZCHH 1D5XB 4F15C 1CQYA 1KIPB 1KIRB 2N7AA 3B2UD 2H26B 4GOSA 2I27N 1E4KC 4NN6C 2ZKHL 3QDGB 5EBMB 5EUKA 1QRNB 2LE9A 4XCCL 4PRIA 5C92A 4DFIA 1I7RA 5FDWA 4YWGH 4HCRH 3CZJA 1ZSDA 4LSPL 2QADD 2DMKA 4R6UA 3WO4C 3C6LA 5CEZL 4YO0A 3JWOL 5HYSA 3S9DB 5F89B 1RZFH 5DF0A 5L8LB 1KELH 1WC7A 2QTEA 2ZOKA 4WFHD 1DLHB 1UADC 1B0GA 3L3IA 4U1LA 4PJBE 2Y9RT 4M5ZH 1S5HA 4JZNB 2YK1H 3QDMA 3EHBC 2XPGB 3MOAL 4NQSB 5I1DB 1QLFB 3CXHJ 3K7UA 3WS6A 3UMTA 4JQVC 2BHYA 1FORL 3FQUB 2I9LB 3FL7A 1MRFL 3TO2B 3QUXA 3JBG7 3L95A 2VL5A 3BHBA 4X7DC 1FC2D 3FRUA 3MRMB 1BFSA 3HE6B 4LLMB 4N1CA 3VWJB 5KVFH 4OLYL 4NHCH 1TPXB 4LFHG 5AUMA 3LRSA 2VH5L 5ETUA 4LLQB 3VFOA 4G6KL 3CFKB 5SWSA 3TBWB 2AXJA 1XIWD 3RGVC 3VGBA 3VFSB 4QGYA 5J6GA 4FQIL 2G75A 3H0TA 1OM3L 5CGMA 4DFHA 1F00I 1AJ7L 3TGXA 4BELD 4MJ2A 2FJGB 3I6GB 4CDHA 3EDEA 2UZXB 4AT6A 5IJKC 2WINA 2NMSA 5F1KC 5FCSH 3L7FA 4XAWH 5EZLA 3HZMA 3BP4B 4O9HH 4Y8DC 5CJ8A 4BK5A 4HD9A 5J57B 3MRKA 2BERA 5LKNA 1DBJH 4JGMA 1MRDH 2EYTA 5BVPL 4V1DE 3T2PA 2X09A 1TVHB 2Q7YA 5DEZA 3RY4A 3HR5A 1J86A 3PHOA 2GEEA 5I71B 4P9HL 4PP2B 4WHTA 4U3CA 4N0FB 3X12A 4GFTB 1U58A 3N1QC 3T0XA 4Q9QH 4P23B 3EJYC 3SGKC 3QAZC 2R0ZH 4R2GD 4P2OC 2WZPD 1HN1A 4KROB 3VRJA 5C0AD 1P4IL 1XGTB 2V17H 4KJQD 4L1HA 4M8QA 1FNEB 5MP6L 2RIKA 4JM4H 3JXAA 3BX7C 3PWPB 2H8PA 5SX4H 5T3ZD 4FQ2L 4FXKB 5T3XD 3U36A 1MLCB 4GQ9H 3T08A 4MJIA 1FO0L 3I6KB 1H3VA 1NGXB 2KL6A 3ULUE 2XTJB 5DQJB 1M7XA 4XVSH 3C2AH 4HS6B 3TZVD 5F8QC 5DYOB 8CGTA 1OGAB 4MQSB 1AI1L 4FN0A 2EH8H 3FHQA 1A4JB 2C26A 2VZTA 1Q9KB 1G7PA 1P7KB 5KSUB 3V5KA 4JRYB 3NIGF 2AABH 4HFUL 2A83A 4JQXC 1VFBA 1ED3B 1MHPH 4GRLB 2G2RB 3PL6C 5CMAA 4PJGE 4JJHA 2ARJA 4NZRL 3TT1H 3DRQA 1ORQA 2GFBB 5CP7B 3IDUA 1XGQA 3BMWA 3SKOB 5DR5L 2FBJH 3HCVA 5D1QA 3HAEH 5DEFB 4G3YL 1BIIA 5EU6D 3KPLB 2XWJB 1UG9A 1XF2A 4CVXB 4F3FB 2Z31C 1AQKL 1G7LB 1I4FB 3HZVB 3KYKH 4TTDC 3BDBA 1QG3A 5C70A 2ATKA 3NAAL 3WXWH 1JWSA 1HNGA 1LD9A 5EC2B 1O5DT 2N4IA 3BESR 3L3GB 2XG4A 3O4OC 4K94C 1BP3B 3RPIB 2XZZA 4DGYH 4OM1H 5IF0A 3O45B 4NN7C 2X6MA 4ZS6C 1ZLWK 2DLGA 2UWEA 5D93B 5HYFA 2VDQL 2J5LB 5ILTL 3S35H 4GRWE 4YHLL 3QIUA 1NC4B 1KCUH 3HAEG 1XCQA 3BZ4A 3RNKA 1CDBA 4AK1A 3VFTB 3TESA 3IJHA 3K1DA 1FFNA 3QNYA 1KPRB 1A7NL 1LHZA 1FFPB 2EDHA 4NQED 3ULVD 1TJHL 1L9MA 2E6JA 3VXPB 5D72L 5JHDB 1G6RL 4CMHB 2X1XR 5E6IB 2AJZA 2DLHA 2B39A 2DKUA 1N0LA 1RU9L 1KB5L 2P5WD 3ARXA 4YXHL 5BQ7B 5IV2B 1X5KA 2E5EA 4LSRL 5J0BA 5EUKB 5DA4A 5I1EL 4KC3B 4PRIB 1EA9C 1I7RB 1YMMB 5SX5K 4YHYB 1TQCB 4FQJL 2KQNA 4PJHF 3C6LB 4PJFE 4LSQH 5HYSB 1JGUL 4H1LB 1FFQA 3PDOA 5BZWA 1WC7B 2ZOKB 5F96L 4WGVB 1RUKL 2GQHA 2BNQD 5C0IB 1B0GB 3L3IB 4S1DC 1IJ9A 2W0FB 2V2XA 3KJ6L 3SHSA 3QDMB 4UV7L 4OZIE 4RNRB 4N5UA 1HHGA 4YHOH 4UQ3A 4CN4A 5DRZA 1S78C 3DO3A 4K94H 4PBVC 3QQ4A 4M6NL 4YBLB 5ANMB 1OPGL 3EYQD 3GUTA 2SEBB 5EFIB 2VL5B 4I3SH 5JHLL 4GKSA 4Y4FB 5KW9L 4IRZL 4X7EC 4PJHB 1HYSD 3QP3A 3RHWF 3VFOB 2CGRL 1WFOA 1I9RL 5EWIH 2B1HL 3GSOB 3WNNA 1T83A 2B20A 4LF3A 5JQHC 2DWEA 3BP6A 3VD7A 2XT1B 5J6GB 3H0TB 3MLSH 5IQ7H 1UVQA 2RB8A 4ZD3H 3SE3A 1A6VL 3WFDH 3N1FC 4YQXH 4XPHL 2WIMA 2WINB 3L7FB 5GXBB 4HK3J 5EZLB 2VN4A 4QRPA 1A7QL 5E4EC 4U6VH 2Q86B 1KSRA 5DK0A 1CF8L 4JREB 3EDFA 4NKOA 3ETBF 4P3WA 3DGGB 3MRKB 1BQHG 2ERJB 1CGVA 4M48H 3REVB 3ALXA 5DJ0B 3D85A 3GK8L 2A6KA 3QUMA 5LAXB 2OXGA 4JLRB 1RJZB 5ESQB 2M2DA 3PHOB 2CQVA 2LAAA 1HSAA 3ZTNL 1RK0A 4JPIB 1F90H 1DBBH 3X12B 5CHNA 1U58B 2NY0B 4ONGL 4HIEA 5T5FL 1XGPB 5GZNC 3NABH 4XPFL 4KZDL 1R3HB 3RHWK 3VRJB 2IG2L 1G7IA 4LPWA 2GI7A 4K3JL 3VFGH 4KMTL 2EIZA 4WNQB 1YC7A 2Z4QA 1N5AB 1JZ2A 3D0LA 5DS8B 1CTOA 2H8PB 3BPLB 1KLFA 1UGNA 5A2FA 3U36B 1Y6MR 5IMMA 5FKPA 1OP9A 3NCBB 1UXSA 1MWAA 4Y4HC 3S36X 1W72L 3EZ8A 3TYGH 1JV5A 1S9KC 5E5RB 2PYEB 3U79A 2GYSA 1JRHL 4JY4A 1X4XA 1AGFA 3PP4H 1GSMA 1HZHL 3TO4A 3V5KB 3V7AE 4NZDA 5DMJB 4GO6B 5ACZA 1X5GA 4DVBA 2CIIA 1N64L 3SE9L 4M9OA 5CMAB 4ZFGH 2ARJB 3MV11 4PJ9C 2XKSA 4NM8L 3MUJA 3LD8C 4P57B 5E8DL 3OAYK 1HIML 2VE6A 3KPRD 5DZLA 4D9QE 3HCVB 4E41A 5D1QB 1E4JA 3MLXH 2ZPKH 4JGUA 2OTWA 4OCXH 2ORBH 1XF2B 3C87A 4M6OH 5MHSD 3DI3B 3OJDA 4Y7MA 3MO1A 1LD9B 4Y19E 4NCC2 3AM8C 1EXUA 1PLGL 3RWDB 3HI5H 2X4UA 1J8HD 4U0RC 4Z7WF 4LCUB 1JPGA 3ARGC 4WW2F 5IF0B 3WIHA 4LVNC 4O58H 1NMBL 5FYLE 3FFCB 4WHYH 4FTVA 2UWEB 1WQVT 1MI5D 4F33B 4PBWD 1HH6B 5D1XA 1UH3A 2OR9L 1A0QH 2VAAB 2QQLL 4KKAD 4A6YL 3P0GB 2R15A 1XCQB 3BZ4B 5EO0B 4BFIB 3L3OB 2PETA 4NBYB 3PGFH 1K9TA 5D9SA 5GRJH 1NAML 4WRLA 3W0WA 3D9AH 3RGVD 3IJHB 3V4PL 3VXOA 1FFNB 3QNYB 4WFFD 1IM3B 5FAAA 4XWOD 2R29H 3WN5C 5I9QB 3TA3C 1MCPH 3OHXB 5FFLA 2AJZB 1S9XA 2HKHH 5I66A 1A6AB 5FUOH 5IVZA 3F5WA 5CFHA 1QA9A 4Z7WB 4JO2H 3V95A 4OZHF 1EFXB 2R4RL 4OGXL 3JWDH 4EUPA 3L1OL 3RVVD 2EECA 2BC4B 3TN0D 4DEPB 1J05A 1KC5H 3B2VH 1NGQL 3EJYD 5BZWB 3VH8A 5I1GH 1U3HB 4MZ3A 5J11C 3PGDA 1NLBL 2HFFA 4JN2B 4I3RL 2YHGA 1YEKH 3CZFA 3OR6B 2Y23A 1F4AA 4Y4KA 1GGTA 1RIUH 4LRIC 1Z9OA 3OWEA 2B4CC 3DX7A 1HHGB 4P99A 4TQEL 5M95B 4UQ3B 3DX8A 1WISA 5DRZB 5GGVH 4GLRH 1UEMA 4NO2A 4DKFH 3QQ4B 2A6JA 2AP2A 5BO1H 3GUTB 3RIFK 3FMGL 5JNYA 1MHHA 1DQDH 4GKSB 3KPTA 2C1OA 4NQTA 4DWHA 3GO1L 3U30C 3QYCA 4WFHE 4KHXH 2VTFA 5ACMA 3UJIH 3HNSL 3V52H 4ZFZA 3FZUC 4WFGD 1JF6A 4LF3B 3BP6B 3HNVL 3L9RA 3O4LA 4Q58C 4M00A 3E2HB 1UVQB 3PL6D 2ZUQB 2YPLD 3BOVA 4BSJA 1KCRL 1IQDA 2BNRD 3ARYA 2VDMH 1T4KA 2QSVA 3JWNC 2ARJQ 4LCWD 5HHVH 5C6TH 2DD8H 4FQ1L 3S4SA 4X83A 1NKOA 4QRPB 1YYMH 5DK0B 4HXBH 5DJ8A 4NKOB 1MCNA 4IOFC 1X6NA 2Y6SC 5C0BA 2ADFH 5EPMA 3RUGA 5C08A 1KF9B 3EO1A 1IKNC 2BY1A 3D85B 2A6KB 3MRRA 3QUMB 3LHPL 2YC1A 2Z31D 4ODSL 1A14L 1YEIL 1T5WA 3P0VH 4TTDD 3V8OA 1EJOL 2DI9A 5CIPH 1HCFX 4M43H 4GAJL 3BWUC 1HSAB 2ICWI 1RK0B 3AMKA 4Y2DD 3MREB 4HIEB 2JF1A 5I2IA 3G5YA 4HKXA 1H3TA 2P24A 5DVNA 4ZS6D 1T7XA 3LQAH 4HAGA 1G7IB 3NTCH 4PRPD 3ZE0E 5AAWA 5J89A 2HT2C 4F58L 2EIZB 4MXWH 4F7PB 3CUPA 2Z4QB 5EB9A 5DRNA 3D25B 3D0LB 2B4CH 3HE6C 3GHBL 3GSVB 2EDEA 5EOQH 3IJSA 4P59L 3VWJC 3E6HA 1Q0YL 2R9HC 5T1KA 4NUGL 4XPAL 2Q3ZA 3MUHL 1MCBA 2K9UA 4QT5A 5IMMB 4NSKB 1JNHA 5FKPB 1MLBA 5JXAH 3QIWD 2WBJB 3RVUD 1IARB 5I16A 1JV5B 1RZIA 3U82B 1WV7T 1I8IA 2IANA 1N5YL 2J8HA 1F3JB 1AGFB 3HPLA 5D7IE 5IEKA 3TO4B 4MCYA 1FL3A 5C0AE 1QVOA 4DVBB 3GIZL 3BD3A 4Z18A 2CIIB 4F37K 5ID1B 1IBGL 1U3JA 5EIIA 5JQ6L 4X4YB 3O3UN 1U6AH 4UBDC 4H88L 5T3ZE 5T3XE 1T04B 2X4TA 3UTQA 1ZTXL 5E94A 2VE6B 5DJYB 1F8TL 4E41B 2GJ6D 2WQ8A 2L7UA 4LPVA 5C3LD 4FZ8H 2PXYA 3HR6A 3LKPB 2OTWB 4JFDA 4KROC 3TYFA 3KYNA 1FVDB 1T1WB 4OUUB 4LASL 3QPQC 4YDIH 3ZO0A 5JW4R 1IQWH 1DFBH 4S1DD 3MUY1 1GHFL 3FONA 2Q6WA 5CJ5A 5IHZA 3MO1B 1S5IL 1D6VH 1FN4B 3G6JE 1R3JA 3QZWA 2J4WH 1Y0LB 1IGTA 3N1MC 1JPGB 1JZ6A 1S78D 3G5VA 5IM7B 5DHXB 4QY8A 2XTJC 2WQRA 2RCSH 3BGFB 5E2VL 1M71B 1P4LB 5D1XB 1GGIL 3MRLB 1RD6A 5EU6E 1RPQA 5DQ9A 3ULUL 4K7PX 5D9SB 4JFOA 4Y5VC 1T1ZA 3W0WB 3FCTA 4LHJB 5ICZA 3I75B 5FUZL 3MA9H 3STZB 3NCEB 3DHJA 3W9EB 2PNDA 3SDAA 3P9LA 4IOIA 3QIBD 1BPVA 2NY3B 3WBDA 4FXLA 3LPWA 5I66B 5IVZB 5IP4A 3F5WB 1S8DA 4KUZL 2IFGA 4MMZC 4HJJH 4JEGB 4M7KL 1GAFL 4C56D 5ICXB 1EAPB 1IAKA 2XQYK 4EUPB 4PJ7F 2E7HA 4ZPTA 2VDKL 2CH8A 5DC4B 3MRNA 5L2JA 1ZA3B 4G9FB 3AC0A 1WGOA 2R1WA 3PWLA 1K6QL 3IU4L 1G7JA 2LU7A 2XYCA 3LPFA 4RRPG 1YUHB 4JVPA 3KJ4B 3X3GL 2FO4A 5TE7H 1NSNL 3KXFB 3OKYA 3VH8B 4NQEE 5GZND 4YEFA 3ULVE 1QHPA 1NFDA 3PGDB 3RWIB 5JW4N 3BH9A 3IU3A 1ZLUK 4MDIB 4NKDA 3HNTH 3HMXL 5IB4A 2FR4A 1UXWA 3JVGC 5D93C 5DGQA 3U6RB 1CXIA 1Q72L 4Y4KB 2J5LC 2VSCA 5KAQG 1AY1L 3SDDA 3DX7B 3G5XA 4F2MA 3MBXL 5KS9A 1CD9B 4S0SD 4ZPVA 4LLDA 2ESVA 1XGRA 1S7UB 4P3DB 1YQVL 4NO2B 2E9BA 2A6JB 3V9FA 2W9EL 3RUGF 3VXUD 4G8GD 4PJ7B 3AMLA 5JNYB 5GJTL 3SO3B 3D3VD 1U8MA 3H2WA 4NO0D 2UV3A 1FGNL 4WWKC 3AXLA 1MFCL 5EG6C 2OS7A 1BIHA 2NXYD 5TQ0L 5IIEA 2BK8A 2FEDD 3WUWA 4Z7UA 5L88H 4O2CA 3FQWA 5FA3A 3L9RB 4HV8B 3LKNB 3O4LB 4ODVH 3GI9H 1QSED 3K2UH 1RVFH 4WI8A 1IQDB 4PJ9D 1T4KB 2DJSA 3VWKA 3S4SB 1F11A 4UIKL 1GC1L 1DQLH 3C6LC 5DLMH 4ONFH 2E6QA 3I2CL 3T2NH 1JPFB 5DA0B 1J1XH 3RGHA 3RUGB 5EPMB 5C08B 3EO1B 1UWGL 2Z8WC 2HRLA 3RZCA 2IPUK 2YC1B 5HD8C 2VLLA 4R96B 1I85A 4JFFA 4DJMA 4GSDL 2W1NA 4XVJL 4H26B 4XNZB 2BSRA 4NN5B 1ZLWH 3AS2A 3IDXH 3IFNL 3O6FB 1X5IA 3G5YB 3ARGD 3WS6C 4YBLC 4LSTH 5I8KH 5LXGH 1NCBH 2XFXA 3O0RH 4XP1H 2E8ZA 5CJBA 4QXUH 3HUJF 4AY0A 5D6DA 2ZCKL 2YUZA 3BKCL 3QUXC 4KVNH 4L8DA 4GAGL 4YHIA 4ZOAA 1UCBL 4HGMA 2DLIA 5DRNB 2GTWB 1INEH 1PY4A 1A6UH 3UPAA 1NMAH 3GSNL 1CD1B 1NGZB 4QHMB 1CI5A 1JNHB 2EDWA 1ND0A 4ODHL 5E2TL 1TDQA 1MLBB 1Z0NA 1TXKA 1T21A 3L7EA 2VDRL 1T0MB 3NACH 5I16B 2NW3B 3K4AA 1KB9K 1I8IB 1NEZG 2IANB 5GRUH 3T4AA 1RJYA 5A3ID 2QQNL 3HPLB 1NANI 3TVMA 3GBNL 4NQDB 2VXSL 5HBBA 4MCYB 3L5WB 4JREC 2OI9C 5IVOA 2VR9A 2FX7L 3BAEL 4PJIE 5SX5H 1BGXL 3CLEL 1A6WL 1EZVY 2NTFB 5EIIB 2FGWL 1JHLH 1NCAL 2YD4A 3HI6H 3SE8L 3UZQA 3IDGA 1KOAA 2X4TB 3IDMB 4HJGA 5HHMB 2OCFD 3UTQB 1CGXA 5E94B 3U4BH 4WGWB 3QNZA 3PWNB 3S5LG 1QBLH 1FNSH 2H6PB 4JFDB 3KYNB 4TVSa 1IGYA 1MUJB 2V9RA 1IVLA 1MREH 2BZDA 1I9EA 1OSPH 1R5VB 5IFHH 3NCYP 1MNUH 3TPUA 3FONB 1RZ7H 1D5IL 5IHZB 1XGYH 1ZHKB 5D2NE 4H8WH 5AG8A 3D39A 1JPTH 1QSFB 2QJDA 4U2ZA 4U1NA 1JPSL 3B4NA 3BPLC 3QZWB 1QFOA 4PRAB 2AK1H 4CGTA 3G5VB 1UWEH 3GNMH 3S96A 1HHJB 3GHEH 4QY8B 2ED7A 2BRQA 1RUQH 5CKAA 4HIXH 5D7LB 1G7QA 4HJ0D 3KPRE 5C0RH 1VPOL 2AV1A 1GYAA 3DHMA 3MGOB 4GW5A 5INCA 2AJSH 2CPCA 1CL7L 2X70A 1ADQA 4XNUL 4NO3A 4XXDA 3T4YA 5J7CC 4U1HA 4EI5B 4ONHA 2YUWA 3FZUD 4JFOB 4OFYA 3LSOA 5A43C 5ICZB 2N56A 4RMRA 2MWCA 5ALBL 1RZKC 4F9LA 1QPPA 3MCG1 3SDAB 3QDGD 3BKJH 3GGWA 5E2JA 1QRND 3NPSC 4TULL 1A21A 1J8HE 1KJ3L 2CK2A 3QJFA 1P4BL 4J8RB 3AY4A 1KULA 2HTKC 1A7PH 4Z7VE 1S8DB 1OGTA 3DXAB 2B0SH 1MI5E 2Y6SD 5TPWH 3SQBA 4QHNA 1X5HA 4C58B 3Q3GA 3CMGA 2K1MA 4KPHL 5B8CA 2R1WB 3PWLB 5LG1A 1FNAA 7FABL 1G7JB 2Q87A 2VIRA 5FHAH 1JE6A 3MRDA 1HXMA 2FO4B 3MX0A 4NRXA 2LTQB 2Y36H 1X5JA 1IGML 4WFFE 3IB4A 3DROA 1XFPA 3DPBA 1FDLH 2HJLA 1KTDB 3BH9B 3IU3B 2O5YH 2J88H 1F6LL 4DUXA 5IB4B 2FR4B 1UXWB 2OBGA 5CSZA 2HT2D 3MMEB 3R0MA 1HQRB 1U36A 4WFED 3QIUC 1G1CA 3G5XB 3HE6D 2GIYA 3LS5H 4F2MB 1OW0A 4GW1A 3VWJD 2WSKA 3GBLA 4ZPVB 5FYLL 1BD2E 4HQQH 2B5IB 1X5ZA 5J1AB 3FT2A 1QUNA 3FN0H 5CGYC 4NIKB 4YPJA 4O51A 5F3HA 3UAJD 3BPOB 1U8MB 1G84A 1I1YA 5I9QC 5JPMA 4IMLA 4EBQH 3HC0A 4U2YA 1U2CA 3MRQA 1C12B 3SDXA 5IIEB 1DBAH 2VSDA 1P5VA 5CP3A 3U7WH 2VISA 4O2CB 3FQWB 1NFIA 3HC3L 4CJ0A 5FA3B 2E8YA 2A9NL 4YDVA 5F7MC 4X6CA 2JKXA 4JO1H 1RZKH 4IS6B 1V7NL 1NUGA 3ROLA 5DMYA 2BSSA 1T22A 4UBDD 4KZEL 4DEPC 3Q1SL 2HYMA 1VEPA 3TFKC 4ZUTA 3ZSSA 1BQUA 4DK3A 4PB0L 3UTZA 4WV1A 2X1OA 3T04D 4P23D 3GMNA 4OLZH 1A6TA 3FOLB 5TDPA 4KROD 3TJEL 4R9HA 3IKKA 3RZCB 1GOFA 3QPQD 1G9ML 5D4QA 5IHUH 1QFHA 4Y1AA 5IMOA 3BT2H 2XOTA 1NEUA 4WFGE 1T0PB 3EDKA 1FZKB 2BSRB 4YGAB 3PWPD 1OAXH 3CU1A 5DMIH 2JJSA 2YPLE 1L0QA 2Q7NA 3IJYA 2BNRE 4LCWE 3NZHL 4G42A 3JV4A 1HDMB 2XFXB 2XTJD 5HPMB 4L8DB 4IJ3B 4YHIB 4XPTL 1BFVH 1JBJA 1OGAD 1T2QL 2FX8L 3DETC 2AEPH 3NOIA 3AGVA 3I50L 2CO6B 4M62H 2LAGB 1W0VB 2EE6A 3ZE2E 3ZYOA 1IC5L 3VD5A 3QPXH 3MC0A 4JRYD 4MXQC 3VMPA 1T83C 1KXQE 1NBYA 4N8VA 1T21B 3L7EB 4GRLD 2EH7L 3E2HC 2VITA 3SE3C 2ZUQC 4APQB 5CZKA 3T4AB 1RJYB 3P73A 2OJZL 2VC2H 3SPVB 4LVHB 2FL5B 3TVMB 4Z77B 1OWWA 1FP5A 4PRPE 4R8WL 1PW3A 1CFSA 2IADB 5JUEH 3BKML 4PG2A 3UC0L 3U0PB 1FJ1A 1U8IA 2LABA 1QFWI 4D0BA 4L3EB 1RY7B 3TH2T 3X17A 2VXVH 3IKCA 4HJGB 3OAUH 1I3RA 5ITBL 2A0LC 2AEIT 4J3UA 3AUVA 1H3XA 2ED8A 3HA0A 1VEOA 2VLRE 5C0GB 1LK3L 4R7NA 1IGYB 1MSPA 5HDBF 4YHKH 1S7VA 1OAKL 4DZ8A 4LAQL 2CRIA 1VENA 3G9VA 4JAMA 1NC4D 1FGVH 3OMZA 2YD7A 1CE1H 4U1NB 5F7WC 5I73B 3H9HA 5GS2D 1X3DA 1F4WL 1GZPA 1U95A 3WDIA 4UIMA 5AEAA 3S96B 5IB1A 2P47B 4B0MM 1N6VA 3S34L 2HWZH 3RJDA 2AV1B 2GJ6E 3NN8A 5I17B 3GMOA 3FQXA 5JHDD 4GW5B 5INCB 5E6ID 4NCDA 2X70B 1MCFA 2DS4A 4GG6F 4NO3B 4XXDB 3T4YB 5T5NG 4I77L 2P1YA 3TO4C 4YIQA 1YEEL 3LSOB 4HGKC 5HVHC 1JPST 4JY5L 2YR3A 2PTVA 1T3FB 2X9WA 5LGHL 3GGWB 5LCVH 4WW1A 4PRID 3QJFB 1YMMD 4NT6A 5F9AC 3ARSA 4X99B 2Y7QB 3PNWB 4TVPD 3C6LD 3DUHA 1YPZF 2QBWA 1Q1JH 1N4XL 3QQ9C 3FO0H 4FOMA 4QHNB 2O5ZH 2HVJA 4X5WA 4LKCA 1OCWH 5T3XL 4PJFA 4PTUB 3U4EA 2Y5TA 1LEKB 4UU9A 4JRXB 3MCKB 2CKNA 4U3HA 1DLFL 4YXLL 2M1KA 3MLZL 5B8CB 1I7ZA 2EXYC 5GZOD 2VIRB 4GG6B 2YPVH 3PXJA 3QDMD 1HXMB 4PJ8B 4NRXB 3P0YH 4K55A 4KQ3H 4J3SA 3VGEA 2FYYA 2MOVA 4PJEA 3WFCH 1VADA 1FLRH 1K4DA 2HJLB 1VESA 5CEYA 1NAKL 1UZ6F 4GW4A 4X6CF 3LIZH 4ZXBA 4HS3B 3WFEL 1JGVH 5CSZB 1CLZH 5F72S 3TCLA 4ZNEE 3SY0A 5D1XC 1QNZH 2AQ1A 4Y4FD 1BREA 1QLRA 1IL1A 1YEFL 2XXMB 3BN9C 3OJ2C 3QEGH 5AWNL 4LSSL 5IOPA 4GW1B 4C56E 4NKIL 3EYUL 1YPZB 4HUXA 5AYUH 5DFVC 4MSWB 3FT2B 1A3LH 5EZJB 2A2QT 3OKNB 4MB3A 3MBEA 4MX7A 5BV7L 2J6EL 5TF0A 4O51B 5JMRA 4J12A 1CDJA 3P4NA 1I1YB 5JPMB 3MTRA 3FFDA 3HC0B 1FC1A 4L4VA 1DQML 3SDXB 1KN2H 2DYPA 2VDPL 1KGCD 3JUYA 2VISB 1NFIB 2CD0A 4U6HA 2BY2A 1OB1A 4YDVB 2XY2A 4X6CB 4YBQD 2ZKHH 3EYOB 4O02L 4Z0XB 3ROLB 2ICWA 4LSPH 2X4PA 4P9HC 4ZUTB 2R56L 5CEZH 4KDTA 3JWOH 4G6FB 1E4XH 5FO8A 4I2XA 4G8GE 3VXUE 4HIIA 4S2SA 4N0CD 1QRKA 35C8H 3UTZB 2NY0D 3NGBC 3GMNB 1PKOA 1A6TB 3D3VE 5TDPB 1A7OL 4X4XB 1U8LA 3DO7A 1HE7A 1ZS8A 4FMFA 4OZ4A 2OTUA 1S9YB 1N7ML 3GSQA 4Y16A 3WD5L 1MOEA 1EVTC 4Y1AB 3HZYA 4Y4KC 3ULVL 1W0WA 4YR6B 2IPKA 5EUOA 4X8JA 3ULSB 1X5AA 4CRPA 4N0UA 4DTGL 3DYOA 1QSEE 3MNWB 1KJVA 2MNUA 3B9KA 3O81A 3IJYB 4PS4H 4POZC 1XGUA 4G42B 3JV4B 2DIAA 2ZSVB 3DJ9A 5FYJD 2CLZB 3ZHLA 4JY6A 2PYED 4YXKL 2VXUL 3MXWL 4OLYH 5H37G 2HT4C 5BJTB 3BIBX 5IFAL 1NBYB 1UM6L 1OM3H 3INUL 4N8VB 4H25A 3EOYG 1FYTA 2H3NA 2BVQB 3GRWL 3BN3B 3P73B 5AG9A 3WFHA 3U0TB 5DQDL 4YK4C 1EIBA 3DBXA 5D1QD 4IBLT 5EBWB 4XNQA 5FO7A 4LHQB 5AZ2H 2ZSWB 1CFSB 5SWZB 2OK0H 4KRPC 2VZSA 1FJ1B 4G43B 4D0BB 3W2DH 3O6KL 4JKPL 5HY9A 3HPJB 4P9HH 1I3RB 3TF7C 1GZQA 1ZLUH 4LFHD 2X1PA 4NN5C 1I7TA 4PTTA 3BW9B 3QWRA 4QTIL 4M03A 3S37L 4Y19A 3FFCD 1P4IH 5DUBA 1S7VB 4Z6AT 3MYJA 5MP6H 3OXRA 4DZ8B 4N5EC 4KMQA 5FYKH 3U9PH 3K46A 4FG6C 2GSGA 2P8LB 3QR2A 5HI5D 4FQ2H 1K3IA 3H9HB 1BJ1J 5IVXE 1GZPB 1NH6A 4UIMB 1FO0H 1AIFB 1J8KA 1OAZL 5CGYD 2HLAA 5IB1B 1K85A 1RZFL 3VA6A 4NJAL 5DDHA 2V7HA 1YECH 2PN5A 3ILQC 5DD3L 3NN8B 5IWLA 3NFPB 1AI1H 1MJUH 1I1AC 4M5ZL 4QGTA 4K2UL 5IK3A 4Q9RL 5K9OA 2X9XA 5KOMC 5C9JA 4YIQB 4KXZI 2CUHA 2W38A 5E1HB 5LBSL 1EFXD 1TCRB 1FE8H 3BZFA 3IFPA 4P4KA 5E56A 4WW1B 3C5ZB 2VJXA 2RFXA 3NIFE 3B9EA 1EEYB 3J8F7 4MJ5B 3TFKD 4J6RL 5GGRA 3UPRA 3CXHK 4AQ1B 2GCYA 3RWFA 5F88B 1IKFL 4X9HA 4G3YH 2PXYC 2HVJB 2O26U 4HBCH 1AGBA 2PTUA 1U3HD 3PQYA 1JF1B 2D31B 4U6XB 5CCKL 1GRWA 4LEXL 3D5OF 3U4EB 5IW1B 4UU9B 3V7MA 1G9NL 1HHIA 3NAAH 3NIDF 4Q74A 4U1GB 5F7DA 5GISL 2YRLA 1PZ5B 3N1GC 4HWUA 4PJEB 2WBKA 3QDGE 5DK2A 1QRNE 2EDOA 4LGRB 1S7XB 4O9HL 1ZWIA 4MCZA 5CEYB 2VZOA 4K71B 3FHAA 4LDEB 4Z7NE 2VDQH 3PXHA 4BSWB 1INQA 5ILTH 3TCLB 2Y25A 5BOZG 3JTTA 2V2TB 1QLRB 1T03H 4LGSB 4AM0A 3EZJB 4YNYB 4HUXB 3H7BA 1TQBC 5EU3B 4ZDHA 3MBEB 3HC4L 1A7NH 2R0ZL 4MX7B 3MPCA 5D1ZB 1MJ7H 2D7PA 3SDAC 5D72H 3U46B 1G6RH 3HRZB 3FFDB 4YDJA 4H0GA 2V17L 2DYPB 4QRPD 4YHZH 4YXHH 2K3TA 2WWKO 4FQXB 1LQSR 1B6UA 1H9VA 5EZIL 4X6FB 4HUVA 1OB1B 2NXZB 5IB2A 1FZOA 2GHWB 4GQ9L 5I1EH 4WFEE 1LGVA 1IAII 5GGQL 3D85D 3CVHA 4YZFF 4XP6L 2X4PB 4FQJH 4LQFL 1JWUA 3C8KB 3QCUH 2A0LD 3ISWA 1RZ8A 3QO1B 4I2XB 4S2SB 4PV8A 1CVSC 4HWEH 5E8OB 5F96H 1RUKH 2FDBP 1ZXQA 1U8PA 3KPMA 3T2OA 1U8LB 2AABL 4RQQA 1ZS8B 1N0XL 4Y16B 5HYEA 5FDYA 4XCYA 5INDA 4UV7H 4IRJA 3SDDC 2IPKB 5EUOB 2DQJH 5I1CH 4N0UB 3B9KB 5DI8A 2B5IC 2FBJL 1XGUB 1OPGH 3Q5OA 3OKLB 3H42L 2WBJD 5IT2L 4PLJD 2YXMA 4GS7B 2FIKA 4JY6B 2L7JA 2W07A 4IRZH 2CDEB 4LEOB 4FQLL 1VA9A 3LVEA 3AU1B 3BP7A 3WXWL 2CGRH 3C9NB 1RSFA 2B1HH 3TO4D 4MNQA 4KK6C 3WJLA 1AP2B 1FYTB 3UXFA 1A6VH 4X7FC 1CE6A 3D2UB 3PWPE 1GOHA 4XPHH 3VWKC 3WFHB 3ESUF 3JV6A 3HHRB 4PP1C 1V3KA 1CF8H 3DBXB 4NKQB 4E41D 3O6LL 4QEGA 5HGAB 2XTJE 3QQ9D 2F8XC 1CN4A 1A1MA 1U8QA 4R97C 2YRPA 3UZVB 4AIZA 1OGAE 2ZJSH 3EYVA 1A8JH 3RQ3A 3GK8H 3RZCC 1LWRA 5E99H 1S7RA 3P3YA 5HY9B 1I85C 3TZVA 5B39A 4JRYE 5FA4B 1GZQB 4ZO9A 4ONGH 1I7TB 5T5FH 2NQCA 3OSKA 5DJ6B 5DZNA 2YD2A 4XBGA 4KZDH 2EYSB 2EDBA 2IG2H 5DUBB 4L8CA 1WVZA 3MYJB 4KMTH 4ZUVB 5D6DC 1TZGL 3OXRB 1S7QA 4JANA 3IF1B 5D1XD 1AGEA 1WF5A 1F58L 4MVBC 2C3HA 2GSGB 4NBZB 1OAYH 1QSVA 4GUPA 5DFVD 3W0WD 2ITCA 2HLAB 3MV7A 4ZUUA 5DDHB 4B5EA 2FLRT 2V7HB 3LZFL 2F19L 1T7VA 4JKMA 2YD3A 4PJ5A 3NIGE 4X7TB 1AD9B 5K9OB 2NY3D 3TVMC 4BQBA 5GS0D 5EA0L 4QRRA 5DRWA 3WO3B 2LU3A 4YHOL 5DD5L 3IFLL 3BZFB 3IFPB 4P4KB 2AW2A 1N64H 4JVUA 2VQTA 4K94L 4JM2F 3LKOA 3M1BA 2J8UF 2NY2B 4HT1L 2RFXB 4NM8H 5BS0A 4G9FD 5E8DH 4UOW1 5EIQA 2VXQL 4MNHA 1KJ2A 1HIMH 5LQBH 3W11C 1A7BA 4I3SL 3FO1B 4LVOC 6CGTA 2Z35B 5HPOA 1VB9A 1CD8A 2GCYB 3KXFD 3RWFB 2ADGA 4DKEL 4NC0B 1DR9A 1AGBB 2GK2A 3O3AB 2FB4L 5JHDE 5MENB 1AO7A 3BPCA 1MCJA 4X5XA 1KJMA 1HHIB 5DMGD 4NQEA 1OP5K 5M7QA 4Y4KD 5C09B 3EUUA 4YQXL 1VERA 4ODUA 3QQNA 5DK2B 2P5WA 4PRIE 4MCZB 1VHPA 1NMBH 1V05A 2ZUWA 1YMME 4NUJA 2FATL 4OD1L 2BMKB 4JM2B 4HMEA 3CDYA 1YNTA 2J8UB 5TF1L 2QLVB 2OR9H 3JTTB 5FECB 1C8PA 3VDCA 2ZNXA 5EO9A 2QQLH 4A6YH 2VAJA 3QNXA 4KK9C 1Q8MA 1W0YT 2Z92A 2HT4D 1L4IA 3H7BB 1NAMH 4ZTOH 3WCYA 2X4SA 2HJFA 3V4PH 2FLBT 4TOYL 2VLJA 7CGTA 4LNVA 3NABL 3O4LD 5D71L 4O2FA 4F9LC 4PRHA 1NKRA 2BNQA 3QDME 3DSFH 1LO4L 3BXNA 3AY4C 3VFGL 4OZFG 5ANME 4C55A 1CIDA 3MRBA 4KK8C 3O8XB 4HUVB 1D7FA 2R4RH 5C08D 5IB2B 2PO6B 1FZOB 3CFJA 5HHXH 4J3TA 1RUPL 4PJHE 5IFJA 1AGDB 5B8CC 2RQ8A 3TYGL 1JWUB 2DQIL 4P2QA 1HXYA 4OQ1A 1RZ8B 3PWVA 4UT9L 3ARFC 4XCEA 1NGQH 3PP4L 4PV8B 3DYPA 2DLFL 2AXHA 1RZGA 2H2SC 3O6FD 4XNYL 3RWJA 1BVLA 4M1GL 1U8PB 1BFOA 3KPMB 1NLBH 3VMOA 4RQQB 1MQKL 3F8UB 4I3RH 1X5FA 2HFEB 5MEOA 1MCDA 1BZ9A 1KGCE 1A4KA 4XCYB 5INDB 4N5ED 5ABDE 4ZFGL 4IRJB 5LGKA 4R0LA 1FBIL 4TQEH 1OW0C 2PKDA 1P69B 4M9PA 4HHAB 1ZANH 1EGJL 3UDWA 5ITFA 1JNNL 1KTKE 2EC8A 5CJXA 3F7YB 3PABA 3I02B 4LPCA 3WJJA 4KFZC 2C3WA 2FIKB 2XV6B 4QHLB 4PREA 2ORBL 4NQCB 2IAND 4M6OL 1DJSA 2DQEH 1DE4A 3GBML 4JR9H 5GRXG 2CMRL 2F5AL 1ADQH 3BP7B 3HNSH 4NQDD 5IBLD 3IGAA 4XPBH 3HNVH 4MNQB 5C0CB 1SJXA 4FFVC 4PGBB 1BOGB 3VFMA 1EUUA 1CE6B 1KCRH 5E6ZA 2VQ1B 3KNBA 4O58L 1J0ZA 4ODTH 2BSTA 4FQ1H 1Z9MA 5HHMD 4U31A 3JV6B 1A1NA 3W81A 1A0QL 5FYJE 4WV1C 5K93A 1A1MB 1U8QB 4IIQA 2C5DC 3PGFL 3BFOA 2PYEE 4BH7B 3QUYA 4JFDD 3MRPA 4AIZB 5A40E 3D9AL 3LHPH 4ODSH 1LP9F 3ARED 1A14H 1YEIH 1EJOH 1S7RB 3KPNA 4LK4A 4JCMA 4GAJH 3TZVB 1A9BA 1ZT1A 5B39B 2LVCA 3TIDA 5EH1A 3DOSA 5J3HD 2E7BA 4JZJA 1QSFD 1C16A 1MCOL 2JJSC 2HKHL 2H2PD 2IGFL 1YY9C 5DJ2A 1UB5A 3UTTA 2EC9U 1YEHH 4HUUA 4JO2L 5CBAB 4M7LL 1WWCA 4L8CB 5D7LD 4F58H 1S7QB 2FSEA 4JANB 1J12A 1PDKA 1J1OL 3GHBH 4TSCL 2GAZA 4GRMA 4P59H 4OZFA 1Q0YH 3SEPA 4NUGH 2VKXA 5ESVB 4XPAH 4LPXA 3MJ7A 5KSAB 4EI5D 1QFWM 4GUPB 3UEZA 5J6HA 2O5XL 3L6FB 3MV7B 3QQ3A 4I5BA 2VMFA 3SDAD 1NCWL 1N5YH 4PJ5B 1EBPA 1YEKL 5JOFA 2Y1VA 1RIUL 1EEUA 3DXAD 4QRRB 4YJZL 3FFCE 3RL2B 4B50A 1ORSA 3ZYJA 4HK3N 1MPAH 2UWEE 3Q0HA 3RNQA 1CDHA 1YN7A 3GIZH 3KHQA 3OG4B 4PG2C 4OZGA 5IB5B 5GGVL 3DURA 4Z7VA 3CH1A 5JQ6H 3OAZK 1PG7X 3SCMA 4H88H 2PCPB 1KB5B 1MI5A 5BS0B 5J1TC 3BKYL 1ZTXH 4MNHB 1KJ2B 5T33H 1S7SA 5I1LA 1JNLH 4X98A 5JIIA 4DN3L 1G9EA 4WIQA 3K3QA 4BQCA 3T0EA 4LASH 3DV6A 4KQ4H 1AO7B 1JI2A 1HH9B 1V3MA 1KJMB 4IDLA 2AJ3B 3F6LA 3J7HA 2HT3C 2NTSP 4Z7WE 3GFUA 3T1WA 1Q9WB 4PR5A 2JJVA 1K5NB 5C6TL 4ODUB 1F4YL 4HKJA 2XKNB 1YYML 3NZ8B 4XC1H 1TVBB 4HXBL 2ZCLL 4UB0L 5GSVA 1WWBX 4GAYA 2IC2A 3STLA 3NCFB 4N8CL 4HZLA 5HVFB 5E2VH 4OD2B 2EDFA 5EO9B 3TN0A 1AC6A 3QNXB 3RP1A 1XF1A 1ZK9A 2Z92B 3ULUH 1G7HA 4M43L 4X80L 3WHXA 1UJTA 2X4SB 3SJVA 3A67L 4HS8H 5FUZH 2DBJA 3VCLA 4FA8A 2VLJB 5I1KL 1S3KL 4PRHB 2XWBA 4GXUN 5I8EA 4YHNB 3ARTA 1FHGA 1UACL 4RWYH 4MHHG 4MXWL 4PP1D 4KUZH 1XR9A 2XTLA 2B4CL 3DUSA 3BE1L 2MKLC 4M7KH 4TN9A 4W6WB 5KVEL 3GKWL 3RU8L 3MV01 4QF1A 3S3JA 3RZCD 2VDKH 3FB8B 2D7TL 3OPZH 3H3KA 1DQTA 4LHUA 2E7LA 1K6QH 1F97A 3MQIA 1GVIA 3IU4H 3U9UB 4P2QB 3X3GH 1HXYB 1FAIL 1NSNH 1SVZA 3FB7B 4D3CL 1VGKA 3PF2A 4K9EC 2EDTA 3RWJB 1ZHBB 3MLVL 2X42A 4LPYA 1HCVA 3HMXH 3C6SB 4M7JL 2ICCA 4ZXBC 4QRPE 1BZ9B 4OQTL 1Q72H 3NFSL 1A4KB 2PUQT 3WS3B 1AY1H 1JVKA 3HI1A 1IEBA 5EO1A 4ZFOL 1YA5A 3I3EA 3MBXH 4MVBD 1X4YA 4U7MA 1D9KC 4FFYH 3MACH 1A22B 2IMMA 4X6EB 4YDKH 1NUNB 4UINH 4LLVB 5ITFB 4GRWH 1BVKA 1FYHB 4RMWA 3MBEC 1B9ZA 5GJTH 4BZYA 4APQD 2DLTA 4PREB 1FGNH 4I0PB 4KRNA 4LL9A 1MFCH 2QR0A 5DJDA 3O2WH 3MR9A 1PEZA 3TVMD 3VW3L 4WU5A 3RZWA 1LMKA 2F53B 4Y2DA 2VLMD 4OI7A 1N6UA 3QG6A 1W72B 1AH1A 4HGWA 5DO2C 5FF6A 3VFMB 2ITDA 1R3LA 3PV7A 1N8ZA 3KNBB 4L3ED 2BSTB 5HGGS 1IAOA 4NC1C 4UIKH 1ZMYA 1WIPA 4OD3L 2YWYA 3I2CH 1A1NB 3IETA 2VB5A 4KDTC 2NY1C 3LN4B 5I0ZA 4ISVA 3BO8B 3VI4E 2FEEL 4ERSH 3IDJA 3KYMA 4IIQB 1UWGH 3QUYB 1BZ7A 3CGTA 3MRPB 3EFFB 2AK4A 4HUWB 1I1FB 1WICA 1L6ZA 2VKWA 3QIWA 3WV0A 4Y16C 1WK0A 3B3IB 1A9BB 4GSDH 4FFZH 4MQ7B 1Y18B 3CVIH 3FT3A 4MS8C 3TIDB 3VJ6A 4C57C 1V5JA 4RMSA 3A6CL 4YHML 4X6BA 2HFTA 4JZJB 1C16B 1L6XA 3SGDI 3IFNH 1I3UA 3B9KC 4IDJL 4HWBL 1L0XA 1UB5B 3UTTB 3O11A 4OZGF 2ZCKH 3BKCH 2X4NB 4LCYA 5CLWA 1Q9OB 4RAUB 2FSEB 2BSED 2IBZY 4E41E 5FGRA 43CAA 2ZOLA 3Q6GL 2GAZB 4OJFL 4OZFB 4KK9D 1JGDA 5JR1L 3FRPA 2PTTB 1KB9J 4PFEA 1Q0XL 4D0CB 3MJ7B 2C4FU 4OFYD 5J6HB 1CICB 5TE7L 4ODHH 1TZIB 2P5EB 4I5BB 1DSFL 2DWDA 3MJ9A 3HNTL 3RIAK 4LDLB 4KTDL 1I7UB 5JOFB 3GBNH 5TE4L 2YN3A 4PPTA 5I19H 1ORSB 4KK8D 3BAEH 1BGXH 3BEWA 3CLEH 1A6WH 4OZGB 5ACLA 3DURB 3NCCB 3CH1B 5H2BB 1NCAH 3SCMB 4JRXD 1T89A 3KR3L 2I9TB 1ODAA 3RI5F 1AKJB 1CLOL 2FECI 3W0WE 1OF2B 2NYYC 4PJ8D 3T0BA 5M94B 1Q9LA 3VXRA 5B3NA 1K4CA 4NNYA 2Z8VC 3T0EB 2OP4L 3K8LA 3DV6B 1WT5A 4CBPA 1KYOK 2KBGA 2YD9A 2VR4A 1OL0A 4X9GA 2I25N 3QIBA 5J12B 4PR5B 5F97E 2WLYA 1JPSH 2P7TA 2HG5B 4QRUA 3W9DA 5DLML 3BI9X 5GSVB 3T2NL 2NY7L 4G9FE 1GJIA 4DUVA 1WJ3A 3V0AC 1VPOH 5AD0A 3FJTA 2Y5EA 5IWLC 3KXFE 1WBZB 4TUKH 1CL7H 5C8JA 4XNUH 2EDKA 3LS4L 1AHWA 4V2BA 5E7BA 3SJVB 2EXWD 4GXVH 3VCLB 1UA6L 4CU6A 5ALBH 4P4KC 4DGIL 5LXGL 4TULH 2NY2C 3O0RL 4F7MB 1KJ3H 1UQSA 3C5JA 4QXUL 4RGMC 3BZEA 1UYWL 1T6WA 1XR9B 4G6FD 3D18A 4PJ7E 4OCMC 2AXGA 4NDMA 1GIGH 3HLAA 5CD5C 2YD8A 4Y89A 1A7RH 1KIQB 3FO9A 4LHUB 2ED9A 5DD6B 3K80A 3NACL 4Y1AD 1U93A 3BPNB 4DVRL 2WANA 4NO0A 1OSZA 5GRUL 3QEUB 3O4LE 3UBXA 1VGKB 3B8SA 3MLWL 4U1IB 1YY9D 1T2XA 2VNCA 5IQ9A 2A6DB 3ES6A 3TH3T 3CDGA 2XI9A 2E9IA 3TBVB 1GPOH 3QO0A 1QSEA 5IROA 4AIXA 4PRBB 1CG9A 4U05A 3HI1B 2UYLA 3HI6L 5FYLH 3X11A 1EBAA 5C0BE 3RUGE 5C08E 1IAIM 3F58L 3U4BL 2ADIB 4P3CL 1FNSL 1BVKB 1H8OA 1IT9L 3LN5B 4G6ML 5MERA 3MRIA 3Q6FB 4HZAA 4KTEH 5BZDA 1MREL 1U0QA 1OSPL 2JCCF 4NFDA 4UNTA 5IFHL 1JYNA 1CFNA 3RAJH 4HH8A 1XGYL 5FKAA 3QG6B 3HC3H 4TNVK 1FNLA 1CIUA 2C3GA 2G9HA 2VZUA 2A9NH 4HGWB 5SWZD 3HN3A 4X9IA 5FF6B 2AK1L 4BZ2L 4Z5RA 1N8ZB 1IILE 4L29B 4KZEH 3P4MB 1IAOB 1REIA 1RUQL 4BJLA 4X6DF 4HIXL 1AXIB 4ZYKB 3AS3A 4YGVA 3TV3L 3IETB 4PB0H 4ISVB 2AJSL 3NCJL 1KCLA 2DB8A 3KYMB 5F1SA 4HDIA 3PHQA 1OP5H 3TJEH 1UKTA 4G9DA 1L7IH 1BZ7B 2CKBA 2IANE 2AK4B 1G9MH 1I9JL 5I1AB 5TGBA 1EHLH 4OKVA 4HIJA 1CDYA 1KTLA 4NQDE 5IGXL 3FQTA 3B9AA 2JCCB 4XI5D 3BKJL 3RVXD 3FT3B 3ZL4L 1QLEL 3VJ6B 4IRJC 4X6BB 1Q94B 2GJZA 5CWSA 5HYIA 3HE7A 2YSSA 2UUDK 3BMVA 4D0DA 4QXTA 3NFNA 3LEXA 5HHME 3GJFA 4GBXA 4HW6A 4M3KB 4LCYB 2OL3A 4XPTH 3OTTA 1QTYT 4X6DB 4JKLA 3Q48A 3EYFA 3I50H 4MA3A 4XWGL 5CAYB 1JGDB 1C1EL 1MCQA 2WUCL 4JFDE 3GSWA 4XP9H 5C9KA 1KPUA 4RA0C 3WJLC 2EH7H 4UT6H 3UTOA 2DWDB 5I8CB 3C5ZD 5EULV 1QSFE 4QRQB 2OJZH 1TITA 2IH1A 4KJQC 2PYFA 2Z8SA 3BGAA 3IDNA 1KN4L 1BECA 3L5JA 4EDWH 2C4XA 4R8WH 2UY7A 1OT2A 5D7LE 3LMJL 2VERN 3BKMH 3UC0H 4PGEA 4FMKA 3ARDB 4NRZB 1RAMA 2AKRB 4JZOA 2NY6B 2HH0H 1H3UA 3CVHH 4BKLA 5FYJL 1E6OL 3FN9A 3O9WD 3UP1A 2ZWLT 3TZVC 2AJUH 4HMCA 4EBQL 3ME0A 3VXRB 3KLSA 4HG4K 2AJXL 5DHVA 4HUKB 2MQ3A 1NUDA 1LK3H 4NNYB 1NMCC 2W91A 3QB7C 3IT8D 1NLDH 1D5XA 2DIJA 1KIRA 1MFDL 2H26A 4JO1L 1RZKL 3QDGA 5EBMA 4OUOA 3DX6A 3MJ6A 2P7TB 2H32A 3ZHKA 4QRUB 3U7YL 1F4WH 3W9DB 3P2TA 4LSUH 2FO1A 4E9LA 5JW3H 2XA3A 1ZLVK 2P43B 3MBED 5D1ZD 1DLHA 2UVFA 5DSCA 4F7TB 2H1PH 5E70A 5AD0B 5DVLA 4TNWK 3BQUA 5F6IB 4HC1A 5J13B 5C8JB 2VZ1A 1JZ5A 4GKZA 2EDXA 2DYPD 3BT2L 4HH9A 4I77H 4L9DA 5L6YL 1AHWB 1YEEH 2C3VB 2FWOB 3OB8A 4FQXD 1OAXL 4NQSA 4JY5H 2NXZD 4HLJA 1QLFA 1ES0A 5DMIL 5DO2D 3F12B 4Z0BH 3IXAA 3MLUL 4FFWD 4G7YH 4K7FB 5KS9E 1RZJC 1UQSB 3C5JB 2ZUVA 3TO2A 3O2DA 1QBAA 3E6FA 5HHQA 3BZEB 2KQMA 4M5YH 5KJRH 3H9SA 3EKCA 3D18B 2HVKA 4MJ6B 1CGTA 3BYTA 3QRFM 5T3ZH 5T3XH 4M62L 4NDMB 3CFKA 3QPXL 3ARWA 1AXTL 2B8OT 1B0WA 4NKMB 1DLFH 4YXLH 1U8NB 1WCBB 3FO9B 3MLZH 4Y16D 4L8SA 3L5XL 2CRZA 1U93B 2F54A 2FJGA 1KNOB 4ODXB 2APVA 2AS5M 1MIEL 3UBXB 4NZJA 3BEVA 4L4JA 3B9KD 3BP4A 5IQ9B 4LRNH 5J4MA 5DEGA 3ES6B 4HF5L 3CDGB 4U0QB 3O2VL 3WFEH 3P4LA 3ZYIA 5JUEL 3H3BC 4KJPC 5TH2A 1CG9B 1TVHA 1YEFH 1A1OB 5J1SC 4LSSH 4HLZH 4S11A 4NKIH 3EYUH 5SV4A 3UTSA 2ID5A 3OAUL 1GXEA 3NPZB 5JOEA 2CJUH 1HSBB 2J6EH 3S36L 5MERB 4DW2L 3MRIB 5BVJA 4KAQL 2OMBA 1FYTD 3DSNA 1I8MB 1G6VK 3D2UD 5BZDB 4N8PA 3GSNB 3C2SA 4UZGA 1SY6A 4MA7H 1DQMH 2J12B 1JMXA 3OAZH 4MD5B 3PWPA 4WUUA 3ZTJH 4Q9BA 1CE1L 1CVRA 2DI8A 4FXKA 4UDUB 5ELIA 2YA1A 4O02H 4Z5RB 2XRAL 2FJFB 3CFBB 4XRCB 3EYQC 4EKXA 1NGXA 3QEHA 4DK6A 1PGRB 1RZJH 3JUZA 3SQOH 1WFNA 4HS6A 3KDMA 4YGVB 5DYOA 4LQ1A 4AH2B 4MMXC 3WFZA 1CXLA 2CLVA 1A4JA 1RIVL 4HDIB 3PHQB 1P7KA 5GRVK 5KSUA 4G9DB 4KKCC 4JRYA 3CAFA 4C59B 1EERB 4JFQA 5TGBB 1N7MH 4OKVB 3WD5H 2VLKA 4GRLA 5F71A 5I30H 2OZ4A 2VLME 3ULVH 4JKWA 4R0LC 4YDLB 4DTGH 2GFBA 5CWSB 4Q0XL 1HINH 3HE7B 3EJZC 4OCLC 4D0DB 1M7IB 4QXTB 3UDWC 3E8UL 3NFNB 3LEXB 3S88L 3THML 2PW1A 5CJXC 1Q1JL 2O5ZL 2F5BL 1QR4A 3H7LA 4GBXB 4MQTB 2OL3B 3WJJC 1B4JL 2EDRA 4YXKH 3TP4A 1OQXA 3BRGC 3MXWH 4F3FA 1G7LA 3QUML 3HZVA 2FH6A 3I3BA 4MA3B 4NZUL 4Y5XB 3GJFK 1ZHLB 3ARZA 3GSWB 4GAFB 3UJTL 5EC2A 5IFAH 2YPVL 4RMVA 1O7VA 3KPQA 3P0YL 3V0VB 4I4WA 1UM6H 4KQ3L 3L3GA 3INUH 5CD3A 3SKMA 3LDBB 5J56B 4P4KD 2R8SH 4JFZL 2EE9A 1ETZA 3GZKA 3C8HA 3UYRL 3VE0B 3GRWH 2NY2D 2IH1B 2PYFB 2MFNA 3IDNB 3L3DA 5DQDH 4C83A 4BYHA 1QNZL 5JZ7C 1NC4A 2R39A 2YN5A 3GSXB 3UPCA 4MDJA 4IIQC 2YA0A 3QUYC 5MEND 1L7TL 1G0XA 3O6KH 1A3LL 4HPYH 4JKPH 4BKLB 1KPRA 4E0RA 1FFPA 1MWAL 1N59B 1MCHA 5C09D 3VXPA 5GS1A 5E6IA 4JZJC 4QTIH 2HLFC 3I6LD 5DHVB 5HDBE 1PEWA 4GLRI 3S37H 3BVNA 3G08A 5BQ7A 1KUMA 1FIGL 3GJEB 5IV2A 5DC0A 4JM2D 3ILPA 3V5DA 4PGZA 3DX6B 4ZUWB 1LE9A 1YMMA 4LNRB 2H32B 2IMNA 3QHTC 1E4XL 4JRXE 4OGAD 1OAZH 4H1LA 35C8L 4NJAH 2AQ2A 5DSCB 3ALPA 3MROB 5DD3H 3RA7L 5C0IA 2WAHA 3RX5A 2M8XA 2CLRA 3BQUB 2XQBL 2IH3A 1R6VA 4K2UH 4Q9RH 4HMDA 4GKZB 3RX8A 3QXTA 1JWMB 2W0FA 4HH9B 3G6AA 4LMQI 4RNRA 5K9JL 4LP5A 5GGVY 2BNUB 3L3JA 4WTZG 5LBSH 2ILLA 3O8XD 3BDYL 1ES0B 5GGTA 3A0OA 2PO6D 4PS4L 1AFVL 3FQNA 3IXAB 5ANMA 3SCMC 4F8QA 4M6ML 3WIHL 1YPZE 4J6RH 5HHQB 3E6FB 2SEBA 5EFIA 1OTSC 4Y4FA 3H9SB 1FH5L 4PJHA 4KKAC 4B7IA 4J2XA 2HVKB 1IKFH 2O93L 3BD4A 5CCKH 2HTLD 1WLHA 3T0EC 1KEMH 3GSOA 4LEXH 5HTSA 5DFTA 1G9NH 1ZA6B 4U1SB 3SDXE 4XWOC 4L8SB 2F54B 1T5XB 2WUBL 3R0NA 4IRJD 5GISH 3K4ZA 4CUCA 1UZ6E 4K3DL 4X6CE 4XMPH 3WYRA 2JE8A 4RGNB 3BEVB 2Q86A 2AVGA 2ATPA 5DVMA 5DEGB 3DRTA 5HYJA 3DGGA 4DCQA 1MIML 4JDTH 5AZ2L 4WO4B 4BQ9A 1A6ZA 2OK0L 5TH2B 1KENH 3REVA 3RVVC 5DJ0A 4O5LH 4NQCD 5LAXA 3TN0C 3W2DL 4JLRA 1RJZA 5ESQA 4MGXA 1QR1A 3UTSB 2XWTB 3GIVA 2GKIA 1RIHL 4JPIA 4MQXD 1IM9A 4PGDB 4MNQD 5C0CD 1XGPA 2FD6H 3HC4H 4Y1AE 5F8RC 5BVJB 1R3HA 4JDZA 4RFNB 4YE4L 1MCIA 1JGLL 2J8OA 1AXSA 1JHTA 2KZWA 4WNQA 4RAHA 4WHCA 5IBUG 5CZXC 5I1JL 1N5AA 5FYKL 3U9PL 1RHHB 5DS8A 3I84A 3QUKB 3LRHA 4WUUB 5EZIH 4HBQA 1GL4B 4HXAH 4GKNA 4HPOL 5GGQH 3QEHB 2ICWJ 4XP6H 3TBSB 2E7LC 5DHYB 1KIUA 4LQFH 3ZDYF 1YECL 3WIFB 2PYEA 3KDMB 2I60H 3QHFH 1MJUL 2BVTA 5JDJA 3P4OA 3ZLQC 2CLVB 5EU5A 1SEQL 4YFDB 4OF7A 1X5YA 2KZ1B 4P5TA 5B3JF 4JFQB 2BOCA 1N0XH 4Z7QF 2VLKB 1FE8L 1UT9A 5CEXA 4UUJB 4H0HB 1KPVB 1CXFA 4U33A 1MRCH 4P57A 1CFQB 4R4FH 4AEHL 5KSAD 4JG1L 3CSPA 1MVFA 1X6LA 3H42H 5D7IF 2PW1B 3MV7D 4HBCL 5IT2H 5F7FA 3VFUA 1MY5A 4PRDA 3UX9B 4HCRA 4EZMA 4PJ5D 4FQLH 1C5CL 3QI9A 1OT1A 4K7PL 1E28B 4Y2DC 4QRRD 3RWDA 2VXTL 3KPQB 3DWTA 4I4WB 3IAGC 3ZE1E 1WZKA 5CD3B 3SKMB 1ACYH 4LCUA 2VDNH 1CR9L 3OF6D 5DJAB 1ETZB 4HEPG 3FFCA 1Y6KR 5E6YA 3V6FB 5BS0D 3RY5A 3L3DB 4F33A 1HH6A 2JK5A 4G5ZL 4NM4L 3UJJH 4C83B 1U91A 3O6LH 1HHKA 2VAAA 4BFIA 4P2RB 1F42A 5EO0A 1T03L 3L3OA 4MDJB 4JFXA 4M8VA 1WZ1H 4PUBH 1PKQB 3MCLL 1AO7D 2DN7A 2Y07L 3QIWC 3RVUC 3DV4A 4GJTB 1IM3A 4E0RB 3O3EA 1MJ7L 5KN5A 2EEDA 2IFFL 1S9VB 3ARBA 2FZ3A 2NX5B 5GS1B 1MAML 3GMLB 1OARH 3V4UL 3OHXA 3VGAB 5F70A 1A6AA 4YHZL 5A2LH 4Z7WA 3BVNB 3G08B 1EO8L 3QDJA 4WW2A 1EFXA 3MZGB 1TZGH 3ILPB 2E7MA 4KJPD 3V5DB 1YC8A 4WI2A 5GHWL 1F58H 2BC4A 5L2KA 2EO9A 3DVGA 5ADOL 1LE9B 3EO9L 3VFPA 5C3TA 1GH7A 3QCUL 1IC7H 2APXA 2VLJD 1U3HA 4HWEL 3VXMB 3LZFH 3BUTA 4PRHD 4RISH 1DBKL 2EC9T 2CLRB 2F19H 4HKBA 4JN2A 2IH3B 4KI1A 4B53A 4S1RL 4PJEE 3S3SA 4TRPL 3OR6A 3WE6A 2C7UB 3G6AB 5EA0H 5BV7B 5CZVL 2DQJL 2YWZA 3L3JB 5I1CL 5DD5H 3AB0C 3IFLH 5DJZB 5EBLA 5CS7A 1TTUA 4OZHA 3FQNB 1JTPA 4HT1H 2BOBB 1T89C 2DL2A 2HMID 2CO7B 2VXQH 1H0DB 4P2QD 4U1MB 2COQA 3CIQA 4DKEH 2FB4H 4XX1E 4KKCD 2JTDA 1B4RA 4XPGH 1QBML 3NIDE 2B1AH 2MCPL 4ZO8A 1WT5C 4L4VE 5GPRA 1BFTA 4L8BB 3UO1L 1FG9C 3MFGB 1PYWA 3QIBC 4ZS7L 4NRYB 3EJZD 4OV6F 1IGIL 3S7GA 5JMOC 5TDNA 3MGTA 2ATPB 4I18A 4PJCF 3DRTB 4U1KB 2FATH 4OD1H 5HYJB 4NC1E 4DCQB 1A6ZB 4UV4H 5TF1H 3FAXA 2ZJSL 4I2XE 3DTXB 4PJDF 3ET9F 4I0PD 2A1WL 2QQKH 5F6IC 5J13C 3DUUB 5E99L 1QR1B 3CSYA 3GIVB 3HAEA 3OKOB 3O3DA 3PWJA 4KXZH 5C0NC 1AHWC 2F53D 1IM9B 4TOYH 3MREA 1YYLL 1OP3K 2BCKA 3CSGA 5D71H 4U7SA 4X4MA 2LFGA 4MXVF 4JDZB 1LO4H 1ZV5A 5EUOE 4IEFB 4N0UE 1AXSB 1UWXK 2D7OA 1RV6X 1JHTB 5H94B 4F7PA 3QRGL 3D25A 5JZ7D 3GSVA 1AC0A 4LIQE 3MNZA 4UNVA 4PJCB 5HHOA 1I75A 4L9LA 4YZFE 3TPKA 1OAYL 2P46B 1IGFH 4ZG1A 3QUYD 4GKNB 3T3MF 4NSKA 1RUPH 3H9YA 4LGPB 2WBJA 4PJDB 1RI8A 1P5UA 1L0YA 1OAQL 2DQIH 1WZMA 5FYKU 2L0DA 4G8EA 4UT9H 3P4OB 1F3JA 2R4SL 5EU5B 1Z5LA 2DLFH 2HLFD 1CGSL 1FYTE 2NXYC 4XNYH 2FEDC 4P5TB 3FKUS 4M1GH 5IESL 5IMKA 2NPLX 1NDGB 1MQKH 3UTTD 3T3PF 2BOCB 3EOTL 2J2ZA 5ID1A 3C09C 5IROC 5CEXB 3W39A 4X4YA 1FBIH 4DZBA 1T04A 1T0NB 5LQBL 1EGJH 4FZEL 5DJYA 1T66C 3MA7A 1JNNH 1BQLL 2DM2A 4QWWC 1CICD 4HIHA 3LKPA 2P5ED 3A6OA 1HWGB 3VFUB 1FVDA 4UT7L 1T1WA 4OUUA 1I8LA 4PRDB 4JO4L 1SJEB 1ROWA 1YNLL 2X9YA 3RWCA 3GBMH 3QI9B 3KYAA 4M3JA 2CMRH 2F5AH 1JHKH 3SDCB 1YJDC 4OIAA 3GSUA 3KPSB 1FN4A 2W9LA 2EE2A 2FCBA 3E1F1 43C9A 4RZCA 4ZQKA 1Y0LA 2OSLB 5K9QG 5E24E 5IM7A 1GCFA 3ZKND 3SCMD 1NBVL 4NGHL 3TBTA 3QA3B 4EQ2A 1M71A 1P4LA 1YMHA 2JK5B 1AKJD 1OTSD 1U91B 2Y72A 1HHKB 4RFEB 1OY3B 3MRLA 2R2EA 3LRGA 4JFXB 2YEZA 3FN3A 4ZTOL 3T0ED 1BQHA 3I75A 4OCWH 3STZA 3DV4B 3O3EB 3W9EA 5KN5B 5CSGA 5I75B 3ARBB 3DSFL 5KG9B 2FZ3B 4LPTA 5A3IC 1F2XK 4YDLC 1DEEB 2JB6A 4K3EL 1MCOH 2VOTA 1KBGL 1PBYA 2IGFH 4N9GA 1A9EB 2BHUA 1ZGLA 5D7JB 2FHBA 5CILH 3QDJB 1WITA 1NGWA 4M7LH 4WHYG 4WW2B 5ICXA 1EAPA 4GBXC 4BQ8A 1J1OH 5HHXL 3ROOB 4TSCH 5L2KB 1EK3A 3DVGB 1ZA3A 4G9FA 4EEEA 5IBUB 3VFPB 3VFRB 3PQYE 3S35X 1TJIH 2IALA 4OIIL 4LPUA 5MENE 1YUHA 5DRXA 5E03A 3QFJA 2O5XH 3SJVD 2RAMA 3KWWA 3KXFA 4NN6B 4QXWA 2Z0BA 3RWIA 5C09E 1NCWH 3MZTA 4MDIA 1GGCL 1RURH 4HKBB 4YAQA 4Q97A 3I6LE 2XN9A 3WO4B 3K74B 3U6RA 5CZXD 3T0AA 3WE6B 4JHWH 3GMQA 5B4MC 1P9MA 4PD4K 2J8UE 5CINL 4L1DA 4N1HB 5EBLB 4NWUL 1ZANL 1S7UA 4OZHB 4P3DA 3QEQA 3RWGA 2Q8BL 4PJ7A 3BKYH 4LHUD 4HJ0C 4NBXB 1FPTH 4CADB 4CN1A 4XP4L 1ZGLM 2GITA 1NL0L 3P11H 4LCIL 1ZT7A 2DQEL 3CFDA 4JR9L 4GMSL 4CVWA 1ADQL 4DN3H 2E3VA 1R3IL 4XPBL 4XC3H 2E6PA 1L9NA 3GB7A 4OLXH 4HV8A 3LKNA 1SEBB 3K81A 2XZQL 4NNPH 5GSRB 1PYWB 5F7LB 4ODTL 1F4YH 2ZG1A 2DAVA 3E0GA 5TDNB 3KYOA 3MGTB 4I18B 2ZCLH 4UB0H 4JPVL 5TFSL 1JTOA 1G7MA 1JPFA 4WHDA 4N8CH 1WBXA 2EDQA 3BQUC 1NGYB 4ORZC 1EH9A 1M4KA 4DQOL 2A9ML 4R96A 4Z7OF 1BEYL 3CSYB 3KS0J 4X80H 3HAEB 3PWJB 3O3DB 4H26A 4MAUL 3A67H 4FS0A 1A3RL 2IAMA 2BCKB 5I1KH 1MVUA 1S3KH 3O6FA 3Q5TA 4CNIA 5FV2A 4OF5A 1YEHL 1UACH 1NCDL 3IAPA 3VA2C 2F9BT 3M8OL 3T77A 1NDMA 2DQFB 3QAZB 2DLEA 2GTWA 3BE1H 3MNZB 4NFBA 2DQCL 4P2OB 5HHOB 1TPXC 4L9LB 3OKDB 3GKWH 5KVEH 5HGHA 1CD1A 1NGZA 4QHMA 3RU8H 3BP5B 1XCTB 4NQCE