3O6KH

Crystal structure of anti-tat hiv fab'11h6h1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
b'EVKLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWFCQTPEKRLEWVASISSGGSYTYYPDSVKGRFTISRDNARNTLYLQMNSLRSEDTALYYCARDYDYGVDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11H6H1 Fab' light chain
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kH01
1NFIA 4QCIA 4YLQT 3NH7H 4I3RL 1A0QH 3EYUL 3BDBA 3HHRB 3VCLB 3X3FL 5EC2B 3SDXE 3W0WA 4UV7H 2YBRA 3OB8A 3QNZA 4F7CA 2AV7A 4RAHA 1CFQA 3HB3C 3VD4A 3UPRB 3ZDXE 4X7DC 1NC4A 5EUOE 1BQHG 5IV2A 3QEUB 5IHZA 2AJYH 2AXGB 3MV9B 1S3KL 3AS1A 4BA8A 1MLCA 4MDJB 3T0VA 4F7TB 4N1HB 3KNBB 3QZWB 4L8DA 2D4DA 5FV2A 4PLJC 2CLVA 5L8LB 3MRDB 5EFIA 2IG2L 4HIIA 2HFTA 4ZFZB 1CIDA 4HPYL 3VXNB 2O26U 4R2GB 4O4YL 3OR7A 5IHBA 4WW1B 4EVNB 1NANH 2X44D 3OKNA 1RU9L 4CVZA 1Q0YL 4P49A 4B7LA 3MV8B 4A2MA 4D9LL 1HZHL 3ARGD 2GSIB 3BJ91 1Q9LA 5D7LD 4PRHA 3AMLA 5HGGS 1Q9WB 1II4E 2DWEA 2BFVH 3NPSC 1YN6A 5LAXB 1YYLH 1Q38A 4NZRL 3WUZA 3QP3A 3E8UH 3B4NA 1I1YB 4FNLH 4YZFF 4APQC 3CH8A 2V9TA 4D8PA 1FL5A 1U8KA 1QRNB 2GJ6A 3EJZC 2DB8A 3LRSA 4AEEA 4XCEB 2VDQH 2Q86B 2V17H 1BBDH 5GRUH 3U7YL 3QDMA 4RFEB 4YHPB 5SX5H 1J18A 4YWGH 2XQYG 1X7QA 3CC5B 3V52H 2HJFB 3CFKA 2O5YH 4ACPA 4ZUSA 4IS6A 2O93L 1GZPA 1YN7A 4BZ2L 4QHKI 3I50L 1E6JL 3QXAB 2MJWA 3B8YA 1HQRA 4PBWD 1ZA3A 3ROOA 4MB3A 5LQBH 3T0XA 5HHNB 5GISL 4ERSH 4L8BB 3RL2A 5E2VL 2A0LC 1AXSA 4H1LB 3CLEL 5ANME 5D6DC 3ARXA 5KSAB 1U8OA 4N8VA 3GEWB 4LCCC 5T1DL 1UT9A 4GAYB 4Y1AE 3S36H 1JZ7A 3HI1A 2X9WA 4OM0H 1BZ9A 4YDKH 2CPCA 1R3HA 5F6HJ 5C09B 4JFEB 5TE6H 2NW3B 2QHRH 4XAWH 4EXKA 2BP3A 5A2IH 5L8KB 4NM8H 1FE8L 1HQ4A 2DQIL 1JHTB 4Z7VF 4JZJC 5FYJE 1KPUB 3QUZA 4XPTL 2P8MB 4OGXL 1AO7B 3WIIH 3IDGB 3U0TB 2DI7A 2C7UB 1A3LH 4U1KB 3QCVH 3L3OA 3STBA 1X5FA 4O9HL 2C3VA 5IQ9B 3G5XB 3T65B 4ZUVB 2X10A 1AQDB 4YGVA 5J89A 3AS2A 3PWVA 4UDTB 1I8LA 2XN9D 3ES6B 2FBOJ 1DVFD 3D39D 5INDA 5I6XB 5LXGH 5D2NB 3VXRE 5IMKA 3ROLB 4DEPB 3WV0A 2R39A 3P40A 5L9DH 4XI5C 1T5WA 4HV8B 1D3CA 2HH0L 1N64L 4HXBL 3KYNA 8FABA 2MCPL 2VLME 1BZQK 3GO1H 4IIQA 2HKHL 4HBCH 1MEXL 3GSRA 5GZOC 1I9RH 3RU8H 4FG6C 4I0KA 4P23A 1RUKH 5F96H 3SE9H 2RGSA 4O2CB 2X1WL 5FCUL 3N1MC 2F19H 5GSRB 1S9KC 3G6JF 1G84A 4AEIH 2FR4B 4TQEL 2RFXA 3MRCB 4R8WH 1GHFL 1I8KA 4S1RH 4JRWA 3VFMA 2PXYB 5A2KH 2Q8AH 5E6ID 4ZUTA 4LRNL 3C8KB 4L9LB 1XT5A 1ZAGA 1YEGH 1PEZA 4NRXA 4L3AA 2WQRA 4PRPD 4OLEA 3B9EA 5ETUB 1F2QA 3IXAB 4P2RE 1OQXA 2I24N 3L7EA 3FCTB 3JV6B 1ZHBB 4ZAKC 3IF1A 3HRZA 5GS0D 4EDXA 3PIQB 3O3BB 2GW5A 1FYTD 4IJ3B 2Z31C 3DBXA 2GJZB 1BIIB 4RX4D 4FA8A 5BOZG 4I8DA 5HVFB 2IPTL 2EDDA 4PJHF 3SBWC 5IWLA 3G04B 3GSNH 4JFOB 4OI8A 1NAMB 1MCCA 3BP6B 3MOAH 2EYSA 2KZ1B 1EXUB 2CDEA 3FN0L 4KRNA 4K8RL 5HBBA 3OQ3B 1PKQE 2UVEA 2YMXH 1X5AA 1MVUA 3HUJA 3L7FB 1NLDL 4MA1C 1P9MA 5HGBA 5IB4B 3O6LL 4R4BB 3KLAB 3O6FC 4XCFH 1L6XA 5FYKL 1XMWA 1CBVH 4OZGA 4XWOC 1VFBA 4U6YA 4G9FE 4CVWA 5BVJB 2NTFB 1RFDH 5FDWA 1E0OB 2D7QA 1U91B 2YKLL 5HHPA 5M7QA 5EZJA 3PWPB 4IOSD 5FM4A 1E6OL 4PJCB 4MAUH 3FRPA 2QQNL 1XEDA 4ODXA 1MJ8L 4ORGB 1PY9A 3MJ9H 3VWJB 3W9EA 2IMMA 4FQCL 4WENB 3TH3T 5CS7A 5DK0B 4AEHH 2CXKA 2VOTA 1T1XB 4J3OC 4RDQG 5ADPH 3E6FA 2ZSWB 2X4TA 2I9LB 3MCKA 5GHWH 5B38A 3C6LC 1JNNL 3LRHA 3EO9H 3BWUC 3UBXI 4OCSL 3BRGC 4XNMA 5T33H 5T3ZH 1TVBA 1MHCB 4TNWK 3WJJA 5EU3B 1NEZB 4PREB 5HYSG 2ZJSH 3BZEA 1QKZL 1FO0B 4HUNB 1MRCL 4F9PC 4V1DA 2F8OA 1NFDE 2DM3A 2CKBH 4LFHG 3WLWD 4CW1A 4XPAH 1J1XH 3RWEB 5JPNB 4IOIB 2NY3D 5DJ8B 3LZFH 3UJIL 1SBSL 1FH5H 5EO0A 1UM4H 4RAUA 3H42H 4G8GD 2YEZA 2UVFA 5C9JA 2W0LA 3LDBC 4ETQB 3DXAA 1R3JB 2O5ZL 1ZHKB 5TF1H 3D69B 4HXAH 4Z78A 1Y18B 4NO5A 1RZFL 4RDQF 3SKOB 2WWKO 4C58B 2VLRB 3MJ7B 1SEQH 4KC3B 5KANG 5A2FA 3QSKB 4OCWH 3SHSA 3T4AA 4M43L 1F6LL 1AY1H 3KAAA 5T3XD 4NKIL 5DR5L 5BXFA 1LO5A 4XNUL 4DVBB 1DLFH 1ZHNA 5FK9B 1KJ2B 1RULL 5C1MB 4W4NA 3QFJA 1NEUA 1KTLA 3T1FB 1T4KA 4FOMA 4Y1AD 3MLZL 3EYQC 3MBXH 4Q6IA 4CDGC 4X8JB 5DUBA 4JZOB 3EKCA 3JWDL 5HXMA 5IVNA 3VG9B 1K8DA 2C1OB 1FIGH 4JDZB 5FYJD 4KJWD 2YD1A 3D18A 2A9ML 3SE3A 3SQBA 4ENED 5D7JD 4U6VL 2ADIA 2VC2H 2XNAA 1AR1D 1QFWH 3EAKA 1YUHB 3CVIH 3L5HA 1JGUH 3GKWL 4HUVB 2BHZA 3LD8B 1Y6KR 3F8UB 4LLWB 3MRPB 1NBVL 1NCDL 1QFPA 1LO3L 2DLIA 3FB5B 3KJ6H 4BZ1L 5AZ2L 3UPRA 4NKOA 4RRPG 4ELME 3MRFB 4QRQB 4H1LG 3BQUB 3D25B 3QEUA 1A6WL 1C5CL 2QR0B 4QRRB 1EEUA 1ORQB 3ZHDA 4F7TA 1R3LB 3FQWA 4JFDB 4Y4HD 4TOYL 1GZQB 4YHYC 1Z6JT 3KS0H 5DQJA 2DQFB 1G1YA 5IMLA 3GNMH 3MRDA 4UILL 4QHNB 3VH8G 4ZFZA 4G6KL 3VXNA 1OTTD 5GPRA 2UWEF 1K2DA 1NSNL 4NQDB 4WW1A 4DN3L 3BPLC 3NFPB 2XTJE 4OZHB 2CUMA 2FX7H 2EIEA 1MAKA 4GG8B 4RWYH 5T1KB 3ZE0F 5CJOH 4JM4L 4HJ0C 3UO1H 3KLDA 3WDHA 2EH8H 3SDDB 1DTUA 4XHQA 1VSCA 4G6ML 4KDTC 1BHGA 1Q9WA 4OFYD 4U1IB 4R0LC 4P46B 3GI9L 3BGMA 1MHEB 1MJUL 3L5JA 5H8DA 4UMGA 4HDIB 1IGIH 4H0GA 4EEEA 1I1YA 4GAGL 4P2RD 1KCVH 3QIUB 1A2YA 4LCUB 4PG2C 4PRIE 3TP4A 4JN1L 4GG6B 1YEHL 2J8UE 1RZGB 2V2TB 2ZPKL 1MFDL 4KTDL 2Q86A 4DN4L 1K85A 1AD0B 4YHPA 4OTXL 2XRAL 1I1AB 4U33A 3MRRB 3CC5A 2HJFA 4KI5C 1RZIB 3QHTC 2EXYC 2DQGL 1S7TB 4TYUA 3RRQA 5E08L 4GMSL 3WUWG 5D70H 5FF6B 1L9MA 2E7MA 1MJ7H 3QUML 5C8JB 5HHNA 4L8BA 2WWMC 4EN3B 5B4MD 1FZKA 3ZT6A 1IRAY 3GMMB 5I1DB 1OB1B 5KSAA 4Y5VA 1DANU 1W0YT 2XPGB 2NXYB 1QBBA 1GRWA 3MLTB 2AKRB 1OT1A 4GAYA 1NUGA 4G9FD 3DUSA 4YHOH 5C09A 1BZ7B 2QSTA 4JFEA 3G08B 4GOSA 1KACB 2BOCB 3DV6B 5C0IA 1DL7H 2A77H 2P8MA 3HZVB 5L0QB 4ODSL 1AO7A 4Q0XL 3IDGA 1A47A 2C7UA 1YPZB 4U1KA 4LVOB 3G5YA 3NFNA 3NIGE 2GFBB 3ZKMC 4DCQB 5ELIA 3WKMH 3T65A 4ZUVA 2AAVA 1UXWB 1AQDA 1FG9C 2FBJL 3AY4A 3N1FC 3QHFH 5GGSY 5EBMB 1DEEB 3OJVC 2H2SC 1QSZA 3ROLA 1FL3B 1R24B 2BRQA 4ODBD 1AHWC 2HFGL 4P99A 4KFZC 2PYEB 1P7QB 1MIML 1FZOA 1CYGA 1CGSL 3TF7C 2FD6H 1S7VA 4YHML 1ED3A 1JPTH 1P4IL 3FRUA 4LDLB 1CLZL 3CSYA 3B9KD 3ILPA 4O2CA 4PRAB 3D9AL 4XVSH 5IJKA 4PJ5E 2DN7A 2FR4A 4PGBB 2XA8H 2FHFA 1RIUL 3O45B 3QDJE 2CMRH 1EHLH 4LHUG 3KPSB 4X9GA 2X1PA 5CJ8A 3BYTA 1A4KB 2VLJB 4GAJL 4L9LA 5C08E 3F7YA 1Q72L 3V0WL 4BSVB 4PD4K 5AAWA 3I85A 1UKSA 5ETUA 3IXAA 1KLFA 4Q9QL 4FFZL 1NGPL 1UXSA 1NLBL 5CJXC 4WI2A 1A7NH 1DCLA 3PIQA 3O3BA 1T20B 3RI5K 5BOPA 2GJZA 3D5OF 1PG7H 1BIIA 4LU5H 2R4SL 4C55A 2FL5B 3N1PC 3G04A 1DUYB 3MNWB 3M1BB 4H20H 3KDMA 1CIUA 3KPRA 3OF6D 3AMKA 4JFOA 4NJAL 1NAMA 3BP6A 3W2DL 5JORB 1BFVL 1FCCA 4BQ9A 5INCB 3VFPA 1KJMB 1GPOL 2GAZB 4OLUH 1FDLL 3LS4L 3S5LG 4N0UB 4QXTB 3L7FA 5IB4A 1AXTH 5F8RC 3EUUA 4R4BA 4OLWH 3KLAA 2ZOLA 1VB9A 5AYUH 4ZOBA 1MQKH 2XICA 5IVXF 4N0CC 5TH2B 1U8QB 1Z9SA 4MD0B 1MFAH 2Y23A 3I6GB 1DQMH 1U91A 4G6FD 3T08A 3PWPA 4XMPH 1BM3L 3IU4H 5I8CA 5IFHL 4WI9A 5I15L 4FXLA 2C5DC 4KGLA 3GI8L 1U8JB 3NCJH 4ORGA 2FH6A 1HN1A 2BC4B 2JCCE 3VWJA 1K5NB 4JKPL 3BI9X 2EDBA 1ZOXA 5HYQB 3WO4B 4CL7A 1UJ3B 1DZBA 1A6PA 1TXKA 2LFGA 4K3DL 1BGXL 2QSQA 3OR6B 3RIAK 1ACZA 2WP3T 3HI5L 1QO3B 2Y4SA 4ODUB 1IGJB 2I9LA 4OGZA 4XP4H 5CGTA 4I2XA 3RDTB 1T7XA 4BFIB 5CGYC 4NQEB 2RHEA 2QSCH 5E8EB 2XTJD 4LGSB 4AYFA 2CDGB 5DD5L 3RWHA 1NEZA 4DTGH 1QLRB 4X4YB 2GSGA 4RGNC 4XBPB 4LSUL 2YRPA 3B2UD 4LLUB 3WXVL 5DD0H 5F6IB 1K9TA 4C56B 4PJBB 1N2RA 3KR3L 1C16A 3BMWA 3RWEA 2VDLL 4IOIA 1T7ZA 4Z76B 2A6KB 3QNYB 4MQXC 1FNGB 3CZFA 3QDGA 4WTXA 3BPOB 4PRID 5GGVH 3CMOL 5E5MB 1RUPL 1YECL 2ATPB 2EEBA 1Y18A 3TN0B 1KNOA 3SOBL 3SKOA 2VLRA 3TZVC 3TO4D 2BNRE 5FKAB 4L8SB 3PP3K 1AGDB 5D5MB 5C0GB 2CQVA 1JPGB 5SWSE 2ZKHL 1EVTC 2D7NA 2XWTB 3FONA 3OKMB 2DI9A 3GMOA 1L7TL 3MREB 3QI9B 4RISL 5C2BL 1ZANH 3G5ZB 5FK9A 5MENB 2NXZB 4HS8L 4FQLL 2ICES 4PIRF 3IDYB 1GL4B 4M61A 4OD2B 2AEQL 4NO0D 4GXVL 2Q7NA 4X8JA 1TZGH 1KLUB 1CCZA 4JZOA 4G8EB 1RMFH 4K94L 4KUZH 1Q8MA 5JXAH 3A6BL 2C1OA 5JHDA 4L4JA 3X14A 4GFTB 5D2LF 3A6OA 3RZCC 3U1SL 1QYGH 2KZWA 2J3SA 5DURD 2HYMA 1H3PH 4HUVA 5IR1B 3RWCA 2Z0BA 4M5ZL 4LLWA 3MRPA 4JRXE 4LQFH 5T5FH 5I8EB 5LBSL 3UAJC 3TNNA 4L3EE 2VIRB 1DLHA 2AK4E 3L3JB 4QRQA 4GW4B 2QV2A 5LG1A 4LPTA 5CP3A 3QXDA 4QRRA 2BMKA 5D1QA 1ORQA 1FCGA 3T3MF 1R3LA 1GZQA 2F58H 2DQFA 3BOVA 1RVFL 1KLGA 3DO3A 2XQBL 5D1ZC 4Z7WE 1IT9H 1GAFL 4YDIH 3U9PL 4QHNA 5HDBE 3BN3B 3H7BB 2HRPH 3NFPA 4PJ5D 3DX8B 2VNCA 1ONQB 3EYVB 3ARDD 1XF2B 3PQYA 3WE6B 2R69H 4RZCA 1WTGT 1OM3H 1GGIL 2NY0D 3QDJD 2F9BT 2PNDA 2VDKL 2Q20A 3LEXB 4DGYL 1G9NL 4HD9A 4HLZH 4GW5A 1DBML 4JPWH 5F1NB 4ZFFA 4P46A 5JW4R 4HS3B 5IB5B 2G5BA 3OV6A 1CXFA 1Y6NR 3RUGE 3U48A 3WNLA 3OGOE 4GG6A 1KYOJ 2FO4A 2VQTA 4IRJD 1RZGA 2OTWA 4LAQH 2DIBA 4ZUWB 3V6FB 5HYJB 3HMWH 1U3HB 1ZGLM 3GJFK 1AD0A 4GBXD 3P30H 1I1AA 1H9VA 3MRRA 1IAMA 1ZT7B 1AJ7L 2WLYA 1RZIA 3AFLA 4R7DB 1AKJA 3BT2L 2ADGB 1S7TA 2P5WE 4JFYB 1U2CA 1QBLL 5FF6A 3CFCH 2GK0B 1CTOA 4LMQE 4NKDB 4QXUH 3RY6A 2E7LC 5FM8A 4EN3A 4WUKH 3NFSL 1BD2D 2KL6A 1WAAE 1JGVL 3GMMA 3ZL4H 5I1DA 1OB1A 4D3CL 2XPGA 3MV7D 3QIBC 4YC2B 5DUMH 3C60C 1J1PH 2XOTA 4KRPC 2X89D 3TJHC 2QBWA 4XWGL 5EOCJ 1U36A 4CUCA 2BOCA 3T0WA 2FIKB 3HKFA 4RMUA 3HZVA 2AP2A 5KZCD 1T21B 1HHIB 2DF3A 1EUUA 1YPZA 4K2UH 4N5EC 4Z5RB 4DCQA 4DZ8B 3OJDB 3VGEA 1V3MA 4Y4KC 1FGVH 2ITDB 1LEKB 1NGQH 3UDWA 4K7PX 1P7HL 1FFQA 5EBMA 3SPVB 1DEEA 2L7JA 4M62L 4I5BB 5C0BE 1FVCB 4DFHA 2W9DL 4WWKA 1P7KB 1A7PH 4FQHB 2DDQL 5F97E 4OLXL 3MFFA 5DVMA 1J8HE 2PYEA 1ZLUK 5J11C 4P2QE 4JPIA 2IFFH 4HFWA 2NY2D 3MJGX 3C08L 2Q1EA 4JB9L 1P4BL 4R3SA 3DWTA 2DD8L 2X4NB 5FOBA 3IU3A 5JW4N 4PRAA 4OFPA 2XFXA 3RWDB 5FDYA 3ZKNC 3QQ3B 4PGBA 2VL5B 5J3HC 3KPOA 2Q76B 2QJDA 3JWOC 5F21B 2ZCKH 3S3SA 3TV3L 2IAMD 1ZA6A 1MY5A 2BK8A 4PJ8C 2VLJA 4ISVB 2W07A 4CN4A 1H5BA 3FHQA 1OGAE 4BSVA 4CU6A 2FH8A 4KQ4L 5DHVA 2ZCLH 2ED8A 1G6RB 2EDQA 4YHZH 4NQCE 1TQBC 1FVDB 4O5LL 2ITCA 1HHGA 1EGJH 3HE7B 2XKSA 4U3CA 4W81A 3VXMB 1M7XA 1IC5L 1T20A 5GRZA 1IC4L 4JO1H 5EBLB 1RV6X 1TENA 3PXHA 4WNQB 4RGMB 3VXQA 3TPUB 3HAEA 1OP5H 3KPQA 1DUYA 3M1BA 2YSSB 4J6RH 4MJIE 5JORA 2BCKA 5C9KA 3CMGA 1F58L 4NOBA 4JG1H 4LHQB 4QNPE 1IM9A 1QPXA 3TNMB 1KJMA 4OCXH 5EU5B 5KANI 3KJ4C 3TCLA 4N0UA 4QXTA 3LMJL 3R0NA 5KTEL 3EBAA 1IL1B 3KWWB 4NIKB 1JI2A 3RWGB 4XP9H 1HH6A 3UCRA 2XZCH 3BP4B 5ESQA 1CF8H 1GVIA 1DQLH 4FXGB 1T0MA 3S35H 4LBEA 4YUEL 4NCC2 1AGEB 5TH2A 3RVWD 4W6WB 3MRQB 2QQKH 3CH1A 4JRXD 2X4OB 1KENL 2L4OA 4ONOA 5CP7A 4M5YL 3OKDB 4V2CB 5D7KD 3MX0A 1U8JA 4L3ED 2BC4A 3QXWA 4LOUD 1K5NA 4FS0A 5GZND 4PLOB 3UROR 2AK4D 4P48A 4YHNA 4XRCA 5HYQA 4AEFA 3D3VB 1KB5H 2J88L 3W5MA 2IBGA 2EDYA 3OR6A 1MI5E 4LDEB 3V0VB 4DVRH 5I1JL 1OTUC 1IGJA 2C1PA 3HE6D 1FNLA 2VZ1A 4OZFA 3CU7A 3RDTA 1EAJA 2CH8A 3AREA 4BFIA 5I1KL 5JXEC 1H3TA 4NQEA 4P2OD 5GRJH 5E8EA 5HDLA 3QXTA 3F7QA 4KVNH 2ERJB 3L3GB 4X4YA 4XBPA 5KVFH 3CNKA 3CXDH 2OM5A 3NPSB 1NMBL 3O2VH 3K81A 4GAFB 4AMKL 1X9QA 3UYRL 4LLUA 5E99L 1F4WH 5IG7A 5L88H 5TGBA 1JGEB 3ETBF 4LCWD 4APQB 4I3SL 4C56A 4PJBA 3R1GL 5CEYB 4Z6AT 1RZ7H 4U05A 2UZXB 3KPTA 4UT6L 3NTCH 5CEZL 4Z76A 1DFBL 2A6KA 3QNYA 4X80H 5LGKA 1Q0XL 4MD4B 6FABL 5GXBB 3TBYB 1PX4A 1QNZL 3SN6N 4DJMA 4KDVA 5I18L 1RIVL 4NYLB 3MLVL 5DJXB 4FN0A 3L5XL 4WV1C 4WFGE 3TN0A 4UIKL 1S5IL 3MLPA 3PP4L 4KKLC 4I0CC 3EYSL 5D7LB 4XB7A 1M1SA 2H9GB 4EOWH 4X6FB 5FKAA 3FQRB 4L8SA 4JO4H 4DZBB 1AGDA 5FGBA 5D5MA 2LU7A 5C0GA 3KPMB 1JPGA 1YQVH 1QLFB 1KCRL 1A7RL 4U1GC 2XWTA 4LCCB 5DGQA 1DN2A 3GMQB 3MRBB 1NPUA 2HT3D 3MREA 1UZ8B 4NQVA 5CJBA 4OGAC 2LTQC 2F5BL 3LQAL 3TT1L 2V7HB 5DI8B 4JZJB 4OD2A 1XIWD 4LQ1A 4JGMA 1KLUA 1G0DA 1JV5B 2AJXL 1TTFA 4OLYH 1IFHH 5EA0H 5F6HI 5AUMB 5LGHH 4AG4H 4MDIB 2Y36L 5F7EL 1ITCA 1QUNA 5D71L 4KPHL 4M7LH 2N7BA 3G6DH 3C9NB 3S88L 1N3NB 3ZT7A 2IH3A 1KIUA 4CADB 1K4DB 4LIQH 3WFZA 5F7YC 3ZDZE 3FB7B 3I3BA 3RX8A 2EEDA 4XX1E 3MUGB 3Q6FB 4NM4H 4R7NB 5I8EA 5MI0C 4EZMA 5E8DL 3P73A 2Z35A 3V7AE 5E5RB 1S7RB 2R4RL 3L3JA 1FV1B 4GW4A 1MAMH 1UACL 3GFUA 1MHPH 4PV9A 5J1SC 5FGCE 4OFKA 3LVEA 2X05A 5E4IA 1N4XL 1KIRB 1I7RA 3PNWB 5EU6A 4XAKE 5IKCB 3TA3D 3H7BA 1BIHA 2PO6C 2B8OT 2IANB 3DX8A 1F3RB 1XF2A 2XN9B 4NQSB 4ODHH 3WE6A 2RB8A 1DVFB 3PV6A 1EO8H 4GW1B 4S1DD 1ZTXH 3LEXA 2XWBB 4YPGB 4JN2B 4LLQB 3NCEB 5DHXB 1JZ6A 3LN5A 3SGKC 3OMZA 1UM5H 2BJMH 2UY7A 3GMRB 4AENB 4Y2DD 1OGAD 3I2CL 2XKNB 2P5EA 4HS3A 4XNZB 4ZAKB 2CRIA 2XG4A 2Z31B 5CSBA 5TPWL 3ZMRA 4FXKB 4NBYB 5IMMB 1D5XA 3V6FA 5HYJA 1W72L 4MS8D 3PF2A 3D0VB 2FGWH 2JJUA 4PJXB 3MJ6A 2BSTB 5FGRA 4KKAD 3SGJC 1CDIA 1FYHB 2XACC 4R7DA 1MHHB 5DK2A 4UIMB 3L5WB 2ADGA 2FRGP 4KTYA 3GSUA 3QJFB 1NAML 4XP5H 3EOTL 2OZ4A 5C92A 2B7DT 3HI6H 2XT1B 1XGPB 4GXUM 4OCYL 2GK0A 15C8H 4PRPB 3O6FB 4M93B 3DETC 3GSNB 2VDRL 5EN2B 1FRGL 2K9UA 4M1CC 5DC0A 3ARBC 4PJAB 4WW2C 2DQDH 1SM3H 1CDYA 2YN5A 5E2TL 3S37X 3DNKA 4NHCH 1FYTB 25C8H 5I1AB 1CZ8H 4POYA 4FQ2L 1UWXK 4Z7UE 4QOKE 1OSPL 3W0WD 1DQDH 1X6LA 2LU4A 3OZ9H 4A6YH 1PD6A 1E4KA 4HIXH 4XPHL 1QQDA 2C3WA 5EWIL 2ICWB 5BRZB 5IGXL 1F3JB 2CR3A 4JDTH 1NCAH 5EG6C 1NC4D 3C6LB 3LKSB 3PJSB 3DX9B 5IT2L 1XF1A 4PJ7B 3OJDA 5EO9B 4DZ8A 1T80A 3WXWH 3HR5A 4QRTB 4JFQB 2ITDA 3QRGH 2FSEB 1GGUA 4IM8A 1LEKA 2DIJA 2FX8L 1AP2B 3MCLL 1JZ8A 4PJEF 5ITFA 1V7ML 1G9ML 4LLMB 5F9AC 3W39B 3H8NA 4TULH 1IGCH 4J4PA 2GKIA 4OF5A 4FQHA 1D5BB 1GYAA 3A0OA 4PJHA 4OFVA 5CJQL 1W8OA 2OTUB 1HEZA 1T2QL 1FO0L 2R1YB 5FUCE 4N68A 4F9LA 5B3JE 4GT7A 2HTLC 2LQRA 4PRHD 3BXNA 2P49B 3LDBB 2FATL 2X4NA 4X5XB 1S5HB 4OQTA 3T0EC 3SGDH 4UV4H 4FZEL 2Z93A 3VFRB 1DBJL 2CKBB 3VFWB 4CAGA 1T7WA 3RWDA 5I1HH 3QQ3A 4JKWA 2VL5A 1FLRH 2Q76A 4DW2H 3FT4A 4N0FB 4NJ9H 4IOFD 4AY0A 1ZS8B 3ZT5A 2PTTA 2Y6SC 4LNRA 4X6CE 1MCQA 4QRUA 3UTTB 1YJDL 3DPBA 4NP4H 5DUPL 4ISVA 3UTPE 4YQXL 3ALWA 3QDMD 4I13B 1CLOL 1CD0A 4O51B 1HK6A 3QRFM 5CINL 1N0XH 4K7PY 1A6VL 5L2KA 4OGYL 3ECBA 4U1MB 3MACH 1G6RA 1LNUB 1HWHB 3DGCR 3P2TA 3DURB 3SQOH 2P46B 1BBJB 1LK2B 3LQMA 3HE7A 2RCSL 4G6JH 1BQUA 3S3JA 2CUIA 3B9AA 3KYMB 3VXMA 1JNLL 4TN9A 4WEBH 3IYLW 4G8GB 5F1KC 2OMBA 5EBLA 4AT6A 3BUTA 3L1OH 5TE7L 3TPUA 1SY6A 1KJ2L 4O2EB 3QFJE 4CU7A 5HI5C 1R0AH 4HUXB 4AM0B 1CLYL 2VXSH 2HG5B 3TNMA 3BVNA 4PY7A 5EU5A 1F4XL 4Z0BH 2PN5A 1MFBL 3OXRB 3RWGA 2BHYA 1TIUA 3QUZD 1WK0A 4HIEB 3LIZL 3BP4A 2L0DA 1G7QB 4FXGA 1NDMB 3GSWB 1J0HA 1YY9D 1U41A 1J8KA 2ATKB 2XY2A 1ZMYA 3LS5H 1KEGL 2Q7YA 1HIML 1CG9B 5B39B 3O2WH 5K9JH 1RUMH 1UG9A 2Q3ZA 4NZUL 5J7CC 2OX5A 4YHYB 3HTLX 3HPLB 4JY5L 2GEEA 3BX7C 3MV9E 1N59A 3V0VA 1IM3B 5FV1L 3BPLB 1MRDL 3O6KH 4KK8D 5EZOH 1A1OB 5JO5A 1QPPA 1RJLB 1XZ0B 2KQMA 4P23D 3BE1L 5J8OA 3HNSL 5EBWB 5E95B 1X44A 5HYSA 3SCMC 4F3FB 3L3GA 4MA8L 3WNKA 4R0LB 4XNYL 3MV8E 3FL7A 2BY2A 4KV5F 4YR6B 4YXKH 1G7PB 5IW3A 3ZTNH 4NNYB 4XPBL 4NRYB 4M6OH 4AQ1B 2Y5EA 3O3UN 4APQA 3SE4C 4OZ4A 1QR1A 1OVZA 5CEYA 4K3EL 5E03A 5CEZE 2CO6B 3C6SA 2VQ1B 1F6FB 5KS9F 2OL3H 5CJ5A 4ZS7H 2NY1C 4MX7A 2VXQH 2ZUUA 4OB5L 4XTRD 1FFOA 5JA8B 1GXEA 4JHAH 1QRNE 4XBGA 3RBGA 4NYLA 3SY0B 2BSED 4ZTPL 4XT1C 2XQYK 1YA5A 4FMFA 5JDJA 1KPRA 4ONFH 4ALAH 4V2BA 5D7SL 3V79C 1G7JB 2H9GA 3FOLA 5ID0A 3FQRA 4MJ4A 4DZBA 5D6DA 5DF0A 3GSOB 3KPMA 3PGFL 3V4VH 2J8OA 4EI6B 1LP9F 4LCCA 3MRBA 3BDYH 2OCFD 1N26A 1JNJA 1P84J 3MGAA 1UZ8A 1FFPB 2N4IA 4JR9H 12E8H 3O6MH 2I27N 4LSRL 5GS2H 2PKDA 5DI8A 2UWEA 4GRMA 4JZJA 3F12B 3O0RH 3U0WH 2X5PA 4IDLA 4K23H 5C09E 4G6AD 2X40A 3ARFC 2YD2A 4JFEE 3HC3H 3SDYH 2Z8WC 3HPJB 2BRRL 4ZS6C 4MDIA 5JHLH 1YEKH 2VSDA 1I75A 2EKSB 3X3GH 4PD4J 3PWNA 2R8SH 1AO7E 1IVLA 1DSFH 3KYOB 3MMEB 5HPOA 1K4DA 4ZOAA 1XF3B 4Y5YB 3FB7A 4YK4C 4P9HL 3MUGA 2XWJA 4DUXA 1ETZB 1YEEL 3Q6FA 2VABA 2VDNL 4R7NA 1AHWB 5FB8A 2HFFA 1B6DA 3CDFA 1C5DB 5AG9A 3QHZH 4Y19B 3O9WC 3F58H 3WFEL 5D2NE 2WIMA 1S7RA 3T3PF 1FV1A 4MSWB 2CK0H 4RIRB 2NY6D 5CZKA 5DMIL 1A6UL 3VD7A 2MOVA 4N9GB 2V5SA 2DIAA 4K3JL 2UUDK 1JRHH 3VH8A 4V1DD 1IC7H 5I8KL 3ZTJG 1H8OA 2R2EB 4UQ2B 1H3VA 5FAAA 3IFNL 5IKCA 2J12B 3B3IB 3REWB 3FO2A 5L7XL 4JVPA 2IANA 3QWQB 5I1GL 4JANB 4FFVD 4NQSA 1T2XA 2AXFB 3QO0A 1HKLH 4HX1B 1EMTH 2J4WH 2XWBA 3DXAD 2Y5TA 4JN2A 3W11C 2YK1H 2GCYB 4Q97A 5CD5C 1MREH 4MD5A 3UTPD 1JJUA 2LV4A 2FEDD 2XKNA 4Q2ZA 4ZAKA 5BO1L 2NZIA 4XZUA 1O7SA 3EJYD 2Z31A 3DGGB 2ZUWA 3WN5C 4TVPL 2VH5H 4LCIH 1FBIL 4FXKA 1I8IB 4NC1E 3WEXB 4KXZI 5AAMA 2R2HB 1K3ZA 3B9KB 3VGAB 3GKZA 3SBWA 1G1CA 1FN4B 1KF9B 2JB6B 2ZNWA 3CVHH 1E28A 4JZNA 1U8LB 4XBEL 3D0VA 5C3TA 2R0WH 4DKEL 4FABH 1VADB 5H37G 3QFJD 5K59F 4UIMA 4O58H 1PBYA 1EJOL 4HS6A 4R26L 1XGPA 3O6FA 1SVCP 5EIIB 4EBQL 5DRWA 5BZWA 5EN2A 5M95B 4ONGL 1IEAB 3JUZA 3ZDYE 2PW1B 4GMTL 4X7CC 4JPKH 3DVNB 3CFEB 4Y89A 5I9QC 1YQ2A 1S7QB 5I1AA 4WO4C 5LJYH 1WFOA 1BVKB 5C07A 2YPKB 1P1ZA 3PWPE 3SDXF 1A8JH 4PJCE 2L7UA 1W8NA 3D0LB 2IH1A 1MF2H 3N1GC 1GOFA 1WBYB 4NUJB 4JFFA 5BRZA 1KTKE 1WCBA 4Y8DC 3NCYS 4PLKC 3PL6C 3C6LA 3LKSA 4WI8A 5KBNC 2M2DA 3ZDXF 3MRGB 2W0PA 1U95B 4XC3H 5EUOF 4KHTH 5FEBA 1KFAL 4QRTA 4JFQA 1BLNB 2H1PH 4GH7B 3QEQA 2AXHA 1PLGH 4QRPA 4X6DB 2FSEA 5C3LD 1AP2A 5EPMB 4RGNB 3MJ8B 5I8OH 3BKJL 1UA6L 3CDCA 4LLMA 4YHKL 3G9VA 5JW4Q 4F58L 1FNAA 4KGJA 5FIEA 3W39A 4R2GD 4LCYB 4F9PA 5CD3A 1UB6A 1A7BA 4G6FB 4MNHA 5AG8A 2WMPA 4LKCB 2EYTB 3VGBA 4NDMB 1D5BA 2BVPB 2OTUA 3C09C 1UZ6E 1PQZB 5A3IC 4AIXA 1UM6H 5D8JH 1DBKL 4MNQA 4ZNEA 4X5XA 1PZ5B 5F72S 1U58A 5C0AB 3VFRA 2CKBA 2UZYB 3MV01 4EDWH 2JE8A 1MELA 4JRYB 1F3DJ 1HILB 4OLVH 1KCUH 3QQ9D 3VJ6B 2VLLB 2APXA 1ZS8A 3QH3A 3BPNC 4XPFL 5C0ND 5LCVL 3RA7H 5IVXA 2B2XL 3TZVB 4OIIL 3UTTA 1I1CA 4XXDB 3SE8H 3N50A 4O51A 1IKNC 1INQB 2X1OA 3WBDA 4U1MA 2VLRE 3CK0L 1KXTB 5E2UL 1LNUA 1B4JL 1M71B 1LK2A 1TNMA 3MYJB 1S3KH 2BVYA 5EZIL 3KYMA 3QFDA 3REVB 3FZUC 1KCLA 1VPOL 1I1FA 2FX9H 4MXQD 1EERB 2IG2H 5A2LH 1SEBB 3IDXH 2HKFL 4O2EA 3P0YL 5KSAD 2HJKB 4KJPD 1JWSB 1RU9H 4HUXA 1E4XH 4AM0A 2EIDA 2HG5A 3RZCB 4AJ0A 3S5LA 3PP3H 5C09D 3UJTL 4D9LH 1HZHH 1XH3B 4JFED 3TBSB 2BVUA 1GC1L 1WEJH 1PYWB 5J13C 3H9SB 2F74B 4GQPH 2DLFL 5DJZB 4ZFGL 1AO7D 3NGBC 3S4SB 1G7QA 3ARTA 1FORL 1JL8A 1MCKA 1EO5A 4POZC 4U7SA 3GSWA 3K1DA 2VR5A 3LSOB 1J0YA 1JUFA 2ATKA 1MH5A 4XHJC 2ADFL 4PLNC 1CG9A 5B39A 4YHIB 5A1AA 3D48R 2P43B 4WUUB 4A2LA 5DJ2B 5D1ZB 3DSNA 2IMNA 2AK1H 4QRRE 4JQXC 4J1UB 3T4YB 1RK0B 2G60L 3HLAA 4BZ2H 5SWZB 3I50H 4JFDE 5ACLA 3HC4H 1I9IL 3DTXB 1KC5L 1RJLA 5FFLA 1QSEA 2CSPA 4NQDE 1ZLVK 3VGDA 2DLHA 3CLEH 2B5IC 2CGRL 4OZHE 4KDTA 4F3FA 2VTFA 5KG9B 4R0LA 1HHJB 4GSDL 4IHOA 4YR6A 2NX5A 4NNYA 5IHLB 4NRYA 2DKMA 2DKSA 1F4YH 2DLTA 4S0TD 3AY4C 4KAQH 5E1HB 4XPTH 2H32A 5IBLD 4U6XB 1OF2A 1WISA 4OSUL 2VQ1A 3L6FB 2WBJC 4LDOB 1F11B 1X3DA 4GG6E 3DVIA 2P47B 3EZJB 5BV7H 5EH1A 1CDUA 1ADQA 2NY0B 1D6EB 5HDQL 1JI1A 1Z3GL 4U1SB 1B9ZA 4RSVA 4M7KL 5F7WC 2ESVA 3KPRD 3QUXC 2V5YA 3HC0A 2HH0H 1A7OH 1AD9A 3GSOA 4EI6A 4GKNA 5ESVB 1TDQA 5DQDL 4KROC 1K8IB 1CE6B 3QIBB 2DQHH 3QXUA 3GJFH 5BCAA 3C60B 3UZVB 3BSZH 3KYAA 5HYEA 5J6GB 4JCMA 1ORSA 5FCUH 3OB0K 3TBWA 4OF0A 2AEPL 4GLRI 4TQEH 4ONHB 2R9HC 1GHFH 2FJHB 1NGWA 2WV3A 1INEH 1F6AB 1ZVSB 3HPJA 3PWPD 5IF0B 3U6RB 2K7PA 5JR1H 4TUKL 1T0PB 3VD3A 3VWJD 1UWEH 3I3EA 1NL0H 4DGVH 1C5BL 1V05A 1UYWL 3VFVB 4HSQA 4OUOA 3MMEA 4PRBA 1BD2B 3ULSA 4NWUL 4UNTA 5GJTL 1ETZA 3MV7B 5BMFH 1AHWA 4U49A 3NPZB 4Y19A 1GGYA 3B43A 3GBMH 3M8OH 5E00B 3NA9L 4RIRA 2OR9L 3RGVC 2BXZA 5HPMB 3K3QA 4L3CA 4AL8L 4GRWE 4M1GL 2ZG3A 1TJIL 3MRHB 2PYEE 4WEMB 2JELH 4GUPB 4HAGA 2OSLB 5CWSB 4J3SA 4K8RH 2R2EA 4UQ2A 3KXFB 1TTUA 4ZSOB 1CFVL 1NFDF 2XZQH 1KJ3L 2D2OA 3EHBD 3L3HA 3RI5F 4OT1H 3B3IA 3REWA 3FTGB 2D03L 5FYKH 2AXFA 3NIDE 3RJDA 5EOCL 4KY1L 4HX1A 3OG4B 5K9KB 3QDGD 1TJGL 1T22B 1JZ2A 43CAB 5HD8D 1SJEB 4ZG1A 3KPSE 1YNKH 4K8RC 2GCYA 1TQBB 3ULUD 2VDMH 5HGAB 2VLJE 4QTIL 2QQNH 4XMLL 5FYLE 5CJXA 4F57L 3UC0H 5IM7B 5FUZL 2VLRD 2NY2B 3DGGA 4FQCH 1CDCA 4TVPE 4YPJA 1I8IA 1N5AB 4IDJH 4P5KA 1RZJH 3WEXA 1U0QA 5D96C 1FN4A 4KK6C 2JB6A 4HH9B 3K4DA 5L6YL 1BP3B 2BNQB 1U8LA 3ULUH 5JIPA 1WJ3A 1BJ1H 1EBPA 1VADA 2IAMB 3KJ4B 4OCSH 5FO8B 5JOEA 1HYSC 2EDJA 3VDAA 3B2VL 5GGRY 5DSCA 3RVUC 2DMCA 3P77B 2R0KH 3OXSB 3Q6GH 1MRCH 4OD3H 4N0UE 1UB5B 3KLHD 1IEAA 5JHDD 4C4KO 1ZEAL 2BHUA 1NANI 5TDOB 3KG5A 2VE6A 5F3HA 3UJIH 1AE6H 1GGTA 2GY5A 1BVKA 3U30C 3VFGH 5J0BA 2VKWA 3TJEH 2YPKA 1MWAA 2YHGA 2OXHA 3NH7L 1JGLH 5DEGB 2O5ZH 1U6AH 1N8ZB 1JPST 1WBYA 2EE9A 4XVJH 1YEJH 5DFVC 4UV7L 1KJVA 2I07A 4X5LA 3IDUA 4ELMF 4CMMB 3MRGA 1U95A 4QRRD 4BK4A 5I16A 5DWUL 2ENYA 2EYRA 4M43H 2XKUA 2ED9A 1KB5B 2B20A 4BJLA 2AJYL 1G7LA 4LCYA 4NQEE 4NQDD 3IFPB 3DVFA 2EYTA 3MROB 4J3XA 3PQYD 2BVPA 4F2MB 2I5YH 1IMHC 1O5DT 1PQZA 1FG2B 3VGGA 2AJ3B 1D9KC 5JA9A 5EC1B 2RIKA 4C56E 4PJBE 5FECA 3BW9B 1B0WA 4P46D 3HE6B 3L3KB 5C0AA 3DYMA 5F9WB 3ARQA 4W6XB 4U6VH 2C4FT 3FFCA 4JRYA 4N0YH 4WV1B 3K1KC 2BFVL 1HILA 5D1QC 4I0PC 3VJ6A 3TIDB 4LPWA 2YPLA 3GKWH 4HCRL 1P2CB 3TZVA 3E8UL 1CWVA 4JM2C 1OW0C 2J8UF 2YC1B 1NBVH 3HMXA 4XXDA 3PWJA 3PDGA 5HHXL 2Z9TA 1EEZB 1LO3H 4UT9L 2ZG2A 3WMSA 3OL2A 1I1AD 4U1GB 1J10A 3D87B 3BH8A 4OUUA 1AC6A 2VDQL 4LCWB 2V17L 1AKJD 2X9XA 5GRUL 4L8CB 3BISA 1M71A 3MYJA 4E9LA 5E8NB 2LTQB 5IVZA 5D5ME 3THMH 1EEYA 2O5YL 4M8QB 5DDHB 2GUOB 2NR6D 2PCPB 4QYOA 3REVA 3V6ZB 3EYFB 3MZTA 4EN3D 1ES0B 5D93B 4KH2A 5MENE 5LQBL 1MLBB 5D6CB 5F93C 4ERSL 3I6KB 3QAZC 2HJKA 1KGCE 2NXYD 4DN3H 1PY4A 4Z95H 1EIBA 3GSQB 5C0FB 3RZCA 1XH3A 3TBSA 4MAYC 3S36L 1PYWA 4OM0L 4YDKL 3H9SA 5JLZB 2F74A 1QFOA 5TE6L 5DJZA 1D6VH 1CFBA 1OAUH 2O5XL 1T03L 3S4SA 4EIZC 2CJUH 4QEGA 4QF1B 3ILQC 1DQQA 3LSOA 1M6OB 4GAGH 3EIFA 3NIGF 4PFEA 3RTQC 3K4ZA 4ZPVB 1A3LL 1VFAB 3GJEA 4YHIA 1FNSH 2ZPKH 1NGXB 4OM1H 4R4ND 4WUUA 4Z8FH 5E4EC 5ICZA 3NZ8B 2DQUL 4NN7C 3EOYG 2XRAH 5DJ2A 4IMLB 5D1ZA 3FQNA 1CGTA 4HFUH 3VA6A 3MO1B 4WWKD 3MBEC 5LXGL 5SWZA 2R2BB 3TESA 2PYED 4YJZL 4Q9RL 2EKJA 4GMSH 1MCDA 1YEIH 5L9DL 3U0PB 3FB8A 3DTXA 3ZYIA 2F8XC 3DUUB 5L8JB 3LN9A 1XR9A 3GO1L 2IQ9L 2ZUTA 3TC9A 2BVOB 2XZZA 4NKQB 5CZVL 4KKCC 3ALXA 4YX2H 4H8WL 5KG9A 3RU8L 1GH7A 3JTTB 1RUKL 5F96L 2C3XA 4IRSC 5J12C 3SE9L 3V5HB 3MXVH 2F19L 4NNPH 4AEIL 3KPSD 4ZNCD 1IAII 5JIKA 3IJSA 2EC9T 1V7NH 4R8WL 2VLJD 4S1RL 1CXEA 5FYLD 4F7PB 2APWA 3IS1X 4WCYL 1LMKA 1VACB 2Q8AL 5IOPA 5I73B 3L6FA 5EU7C 3TA3B 1TITA 4LASL 3GDBA 4JE4B 2EZ0C 3MRLB 5HYJE 5BJTB 5I66A 4HGMA 3CFDA 5DS8B 5IW6A 4JREC 3V8CA 4U1SA 5DZNA 2E7LA 1C08B 4WW2B 1CFTB 3QDAA 3MRJB 2DQJH 1XCTB 1TPXC 1KIQA 1IM9D 3FO0H 3GMPA 4UB0L 2WINB 3GSNL 5JW5B 1YMME 1K8IA 3QIBA 4YHMH 5KSUB 3C60A 5I0ZA 1W0WA 3VXPA 5J6GA 3HAEH 4R9HA 5GS0L 1C7TA 1IAIL 5TQ2L 5LVEA 1UH2A 4BUHA 4ONHA 1RIUH 1X4XA 4XCFL 2FJHA 1C1EL 1CBVL 1ZVSA 1F6AA 4D9RE 1ZT1B 5E94A 5IF0A 3UYOD 3RNQA 1OHQA 4Y4KA 1RFDL 4FQIH 3X12B 1GGCL 4QT5B 3QULB 1Q72H 2FYYB 5C0DA 1N7MH 4MB5A 3VFVA 2JCCF 4MAUL 4A6YB 4YHLL 8CGTA 3MJ9L 4WU7A 2H2PC 2DBJA 3TVMC 1UWXH 4AEHL 3ULVH 3CLFL 1KCSH 3RDTD 2FCBA 5ADPL 2NYYC 3RAJH 2R4SH 4NO2B 4OBRA 4L29B 4NQED 5GHWL 2YBRB 5M94B 4F7CB 4X9HA 1TFHA 3EO9L 3MRHA 3T0EB 2W92A 5AWNL 4TSCH 5T33L 5T3ZL 4GUPA 1B3JA 2VDPH 1JF1B 1GPOH 1NC4B 3ULVC 1FDLH 4OZFH 5IV2B 5IHZB 3KXFA 3K2MC 5FHAH 4ZSOA 4C56D 1MLCB 2BZDA 3FTGA 4HJGA 1Z5LA 5IK3B 1UEMA 2GY7B 4PJ8A 1DEDA 2CKBL 1MCFA 2CLVB 1ULVA 4HIIB 1T22A 1J1XL 3OR7B 43CAA 2DQCL 5JW4M 4PJGB 3ME0A 4KWUA 4HT1L 1UM4L 5I1IL 3H42L 4XB8A 4KJQC 5HGAA 1BM3H 5HHOA 3DUHA 2QADD 3TN0D 3AREC 5CIPH 5I15H 5GRXG 3L5IA 3GI8H 5IM7A 1Q9LB 5TF1L 4JKPH 4JJ5A 4HXAL 5E9DA 4PRHB 3ARSA 1F90H 4L4VA 4CDHA 3G6AA 4G8IA 2ZUXA 4JFPB 4UQ3B 4PGEA 1YN6B 2E9BA 3HI5H 3QWOB 3WNMA 3RJQB 1SEQL 3VXME 4HH9A 1FJ1B 1MFEH 2B1AL 2BNQA 2ZCHH 5HHVL 3WNNA 2HRLA 4D8PB 4WHTB 3P0GB 4KK5C 1RJYA 2ZSVA 1FL5B 2NXZD 5JMRA 1G7HA 5FO8A 4PJEA 2GJ6B 1KGCD 1S78D 1N6VA 2PR4H 3LRSB 3RX7A 1IQDB 2FLRT 1DLFL 3QDMB 4ZTOH 5DO2D 4BFBD 4F15C 5B3NA 2OTPA 4M1DH 1KCKA 4NUGH 1GZPB 1CICC 1YN7B 1RIHH 3MBXL 4JM2F 4W4OC 4XVUC 1CDJA 1HQRB 1ZA3B 3ROOB 5T3XL 3VFUB 2V2WB 5D7IE 2EDKA 5TDOA 1FIGL 2VDLH 1QBAA 5ILTH 4NSKA 2AS5M 1IAOA 1AXSB 1HNGA 3CMOH 1VKXB 1RUPH 3LKPA 3AVEA 4N8VB 5DEFA 1TNNA 4R96A 3T04D 1EVUA 3CVIL 1JGUL 3K0WA 4LNVA 3IDJB 5F9OH 3DI3B 2CRMA 1IGTA 4L5FH 2YZ8A 1WZ1H 5J1TC 1XR8A 3SDAC 4J8RB 3D3VE 3EFFA 4CMMA 1QP1A 1HQ4B 5JXEA 4FQ1L 3KJ6L 3VFSA 3QUZB 4P59H 4Z7QE 5F7NC 2DAVA 1KB5A 1RSFA 4KKBC 3SCMB 4U3HA 1KTDB 2ZKHH 1OD7A 3S3PA 3RHWF 5EU6D 3L3OB 4Z7WF 1HYRC 1L7TH 3WS6C 2C3VB 5HDBF 3IFPA 4HS8H 3MROA 1LO4L 1NCWL 3GNML 3HG1A 3F62A 4F2MA 3WS3B 5IMKB 2RAMA 3E3QE 2FX7L 4D2NA 2AJ3A 2YD3A 3UO1L 2HMID 1Q94A 2EH8L 1TMCB 5BS0B 1T83C 2IC2A 2P5ED 3CPLA 2J6EA 2A74B 1NGYA 4WV1A 3QCUH 1IQWL 3U1SH 1WV7T 3RUGF 3TIDA 2P4AB 1IGIL 1QA9A 3B9DA 3QCTH 3L9RB 2DJ4A 5HYJD 2OL3B 2YC1A 1H0DB 4G43A 1QACA 1KCVL 3WIFA 3GSVB 1EEZA 3OAZH 4ZUTB 5J6HB 5D7LE 1KOAA 2EIBA 3LEVH 1VFMA 3NZHL 2OBGA 5I1EH 3TPKA 5E8NA 3V0AC 2GUOA 2PCPA 3V6ZA 4NRZA 3EYFA 1L7IH 2ICEA 1RVFH 5GGTA 1ES0A 3IJYB 1MLBA 3ARFB 3IETB 4UU9A 5I1CL 1WAAF 1OAYL 3IF1B 4HKBB 4WU5A 4EDXB 3HZYA 3DBXB 3STLB 3GRWH 5ID1B 3GSQA 3RWFB 1F5WA 1CT8B 1QHPA 4PJIF 4TPRH 1OAZH 4YH6A 1BQLH 2VDKH 3RKDC 3ZE0E 1OPGH 5FO9B 2HT4C 5EUKA 4DGYH 1G9NH 2EYSB 2OQJA 1CS6A 3K8LA 1DBMH 3HR6A 3BZFB 1JPFB 1WITA 2ILLA 2VISB 2CDEB 1NCCL 4N5UA 3HUJB 1FC1A 3BAEH 1DL7L 2A77L 4URTB 1M6OA 3O9WB 5HGBB 3S97C 3DMMC 3MUJA 4ZPVA 1B90A 5KS9A 1VFAA 1G9NC 4JKLA 4OZGB 1MCWM 1VFBB 4U6YB 1NGXA 4Y88A 4NWTH 3NZ8A 4PP1D 2ZUQC 5HHPB 5EZJB 5ENWA 4CU8A 4J4PD 1AJ7H 5HI3C 3SDCC 3QHFL 1BX2A 4ZXBC 1J88A 3JWNC 1WIPA 3BT2H 5TE4L 1ERNA 4ODXB 2R2BA 2PO6A 1U2HA 4M00A 3W9EB 4ZOEA 3MUHL 4LP4A 2AI0H 2F54B 3GUTB 4P5TC 1I7TA 1E4KC 4EUPG 1LP9A 4WDIB 4HEPG 2M8XA 1KYOK 2IANE 3SGKA 1WTLA 2OJEB 1JPTL 3QQ4A 35C8H 2XN9E 5JQ6H 3RVXD 4U0RB 1KEMH 3V5HA 3KYKH 1TVBB 2NY6B 2UUDH 1BREA 3WN5B 5ECJE 1EFQA 2XA8L 3MLSH 3BZEB 4RMTA 2EEAA 4WFHD 2CMRL 5FM5M 4F7PA 1EHLL 4OQTH 1YEFH 1IGML 4V1DB 5L2KD 3TFKD 1CD1B 1UQSB 3V8OA 5F7LB 3HE7D 3SGJA 4C59B 5F7KC 5I30H 5C6PB 3HNTH 3WIHL 1A3RL 3ZYJA 3VXMD 3MRLA 5BJTA 5DS8A 2HLFC 2RR3A 2VL4A 1DN0A 2HA1A 2YEZB 5JZ7C 5C9JB 4PJXE 5BW7C 4KVCH 3DXAB 3CVHB 2NY4C 3ARBA 2AVGA 4Z78B 3L95B 4LU5L 4GQ9L 3MRJA 2DDQH 4HWBA 2ARWA 4FFWC 3EOBB 4LGRB 4PRPE 4H20L 4TNVF 5CZXD 2WINA 5JW5A 2NTSP 4QNPF 5I9QB 5DMKB 4PJAE 4TTDC 4X5WB 4JB9H 5KSUA 1MAJA 1AGBA 5J4MA 4OLUL 1SY6H 2JKXA 1NFDB 1FYTE 3OKYA 5CCKL 4NKMA 4NO3B 1R5WB 1ZHNB 3KPNB 4HWEH 5CHNB 3HB3D 2BVQB 4OLWL 4F37F 1KTLB 3PL6B 2C3HA 1MQKL 2DQTH 5FA3B 5FUCC 3TV3H 3UXFA 1LDPL 1ZT1A 1CFNB 5F3BB 4PP2B 5DJAB 1MFAL 3X12A 2DYPB 4QT5A 5CKAA 1DQML 5FGSA 3FT2B 5BRZE 3QULA 4PLJD 1OCWL 1PW3A 2X70B 4KQ4H 3IU4L 4A6YA 5DJCB 3D3VD 4PJ7E 1J1OL 2J8HA 4HPOH 3HZKB 4Y4FC 2XNAB 1MNUH 4UOW1 3ZLQC 3BESR 4WEUD 4NO2A 4L29A 4DUWA 4KU1A 1HWGB 1BJMA 3NCFB 5DD1H 2A6IB 1JVKA 3A67L 3T0EA 4JFXB 5T3ZE 4NKOB 5DJYA 1JF1A 4DTGL 4IMKC 1ZLSL 4PTTA 4GRLC 3T8XA 3EOAB 4LPUA 4APQD 2Z8VC 1IBGH 3FQWB 3BPNB 5IK3A 1QEWA 2JJTC 4MJ5B 5DQJB 3RY4A 5IUSA 3EJZD 4XCNA 5DD0L 2IBZX 5IMLB 1K4CA 1ZT4A 1PVHA 3WO3B 1K2DB 4PJGA 2AJSH 4MGXA 2ZUVA 1JHKH 3UTTE 3QPQC 3C5ZC 5GGVL 3B5GA 1OY3B 1SYVB 2NZ9C 2IADB 3SDXA 4CBPA 3B6SA 3WFCH 1DBAH 1T1ZA 4XX1G 4JFPA 2A0LD 4KMLB 4UQ3A 1MFNA 4PJFB 1SMAA 3BGMB 3QWOA 5I1JH 3V7AG 1X5LA 4ODVH 5F7HA 4K7PH 1FJ1A 1FGNH 4YBQC 4G8GE 3SEPA 2ARJA 4WWID 1A2YB 4WHTA 4ZO9A 3OGCB 3GHEH 5TFSL 4R4FH 1IQDA 5J13B 3LHPL 3S6CA 5KOMC 3NGBB 4OI7A 2GQHA 4MYWB 2P44B 3OPZH 4AH2B 4BH7B 4R90L 1TZGL 3HN3A 3VFUA 5T3XE 2V2WA 1WWBX 4KUZL 4U4BA 4UT6H 3CAFA 3OJ2C 2FNBA 4OI9A 1FZKB 4Q7DA 4KMQA 3GMNB 6FABH 1RD6A 3IVKB 2ZWLT 3TYFB 2WIIB 1VGKB 4Y5VB 2YXMA 1X5YA 3ZDZF 4MLIA 1VKXA 1RIVH 4XI5D 3MLVH 3IDJA 3L5XH 3BHBB 3Q48A 3DUSB 4UIKH 1H3PL 1R3IH 1I3GH 1S5IH 1OTSC 3PP4H 5ICYB 1I9JH 1WWCA 4LQFL 1AI1H 1BMGA 3LV3B 4J8RA 5T5FL 3ZZ1A 2WNGA 3EYSH 4X4ZA 5GZOD 2B39A 1QD0A 3SKJH 4FG6D 5C0IB 3QEHB 4WJ5B 4JLRB 1MCOL 2F15A 1T1WA 3SCMA 2VZSA 1KTDA 3G5YB 2P1YA 3NFNB 4ODTH 3I75A 1LEGB 5CLTA 5K9QG 1AH1A 3K8KA 1Z2KA 2IAND 3INUH 4FMKA 4YDIL 3TT1H 3SE4A 4ZUUA 3IAGC 5FO7B 2HRPL 3WS3A 1WT5C 2D3VA 2FECL 4NT6A 3TIEB 1Z9OA 5F9JA 3C8DA 4RMQA 2R69L 2GTWB 2WBJB 1OM3L 5F7EH 4P57A 1EH9A 5BS0A 4KPHH 4UTAH 1FZOB 1JFQH 4ZAKD 4M48H 2A74A 1ZLVH 2YPVH 5JIHA 2Z31D 4MJ2A 1S7VB 1ED3B 3FRUB 4WIQA 5IBTH 3CSYB 4HUMB 3FRPG 3ILPB 5DRNB 1M7DA 4KI5E 4MMXC 5CMAB 2VZVA 3L9RA 5GGQL 2OL3A 1H0DA 2HTKC 1AR2A 3T2QA 1INDH 4MNGB 3WHE0 3GSVA 5DHYB 4NOFA 4MA7H 5E8DH 5BV7B 3TLRA 1T66C 5J6HA 1UACH 4KROB 5B38G 3P30L 3F7YB 4KTEL 3VXRA 1A14H 3O6FD 2MQ3A 1DANT 2LVEA 4XWOD 1N4XH 2FO1A 1UXSB 3CFCL 4JY4A 2JK5A 4LF3B 2X4QA 3IJYA 3TYGH 3ARFA 2Q8BH 4E5XA 3IETA 4YXLH 5DLMH 5D2NC 4QXUL 5SV4A 4HKBA 4DEPC 2HAZA 4WUKL 5FYKU 3VD9A 3B5HA 3STLA 5ID1A 3X17A 3RWFA 1BQSA 3GJFB 2F8VA 4I4WA 2D0GA 1CT8A 4UBDC 3HRPA 5ERWB 5C07D 5EOQH 5FO9A 1BFTA 3KDMB 3KPRB 4Z7UF 3TO2A 3CCHA 3LPFA 3E6HB 1J1PL 3BZFA 1JPFA 3BZDA 5KVEL 3VFPB 1RPQA 2VISA 3C2SA 4LARL 5BRZD 5C6TH 3VWKC 2VYRE 1I3VA 1MJJA 4Z18A 4U2ZA 3C6LD 4XCYB 3OB0H 5TPWH 3O9WA 5C08B 2E7CA 2ZOLB 3RGVB 3QEQD 4QRPD 3O41B 1SVZA 2R0ZL 2PXYC 4K2UL 4YBLC 4M4PA 1W72H 1HINL 4Y19E 4PR5B 3U7AA 3K8MA 1NGQL 3MA7A 4JJHA 4RGOL 5I8CB 1MSPA 2X1XR 4HMEA 1NUNB 3U9UB 1I85C 1CVRA 2OP4H 1J05B 5T3ZD 3CUPB 3WD5H 1UWGH 1XGQA 2OR8A 5F7MC 2F54A 3GUTA 4MXVE 1A7PL 1D5ZA 4LKXB 3LPWA 3C5JA 4MNQD 4HG4J 5B3JF 1X4ZA 4WDIA 4B50A 1SBBA 4LPVA 3V2AR 3U4AA 2IFFL 2OJEA 3Q2CA 4I2XB 4J7RA 1CDHA 1ZHLB 4BK5A 5HHQA 2XZAH 1CGXA 4L9DA 5KAQG 3WN5A 1BOGA 3RWHB 3UTTD 4MA3B 3KPLB 2GSGB 4X6CF 5C0JB 3K46A 2ZCKL 4OF8A 1JWUB 3BKYH 1NJ9B 3EDFA 1FAIL 1CD1A 1UQSA 3OHXB 4JFZH 3KPPB 1D5IL 3T0AA 1N2RB 1TJHL 1C16B 2ZCLL 3QUYC 1OT2A 3BD3A 3OJMB 2AJVH 4F8QA 4LRIC 1ZGLA 1HXMB 1EGJL 3EYQD 3G9AB 2D7TL 3CZFB 3QDGB 1V7MH 5EB9A 1YDPA 1UCBH 4XMKH 3CVHA 5D1XC 1I3RB 3QZWG 3GSXB 5JDSB 3L95A 5AZEL 4RNRA 1BVZA 1QLEH 1KNOB 3EOBA 3MLXH 4RBPK 5DMKA 4H25A 4J6RL 3DX7B 2N1KA 4WO4A 3BIAX 2EDFA 5DJDB 2D4FA 4JG1L 4PJDB 4X5WA 5DD3H 1H3WM 1G9MC 3U30B 3P9LB 4OCXL 3F65A 1NFDA 4FZEH 3FONB 5KAQF 5TDPB 1DBJH 2AGJH 1IC1A 4NO3A 5DMGC 3GMOB 4XP9L 1SJVA 4XNQA 1R5WA 5GGVY 3KPNA 5CHNA 2BVQA 1O0VA 2A6JA 1NMAL 4HKXB 1CF8L 1VGEH 1DQLL 3PL6A 5FA3A 3S35L 2X4PB 3LQZA 1FLTX 1CFNA 4M61B 2WANA 4MQ7B 4PP2A 5DJAA 5F3BA 2DYPA 1PGRB 2FB4H 3FT2A 1CLOH 4BQ6A 2QQKL 1A6VH 2X70A 4OGYH 4DWHA 5DJCA 4JDVB 5JHDB 2FZ3B 5FHBH 3X14B 5I17B 3HZKA 1MFCH 4X6DE 4NN5B 4HJ0D 2BNRB 1YJDC 4RGNE 4DVRL 3DSFL 1QSED 1A5FH 3F7VA 3RWCB 3P0VL 1JCKA 2A6IA 3TNNB 1LILA 4JFXA 5KJRH 1DLHB 5GRJL 2NX5D 1KTRL 4KVNL 1F4XH 3QXDB 4D0BA 1JMXA 1MFBH 2BMKB 5KVFL 1DP0A 3CXDL 3EOAA 4LPYA 5D1QB 3O2VL 4N8CH 3U4BL 5GJSL 3S37H 1F4WL 4MJ5A 4XNXH 5L88L 3LIZH 1KLGB 2NPLX 5IW1B 3FQXB 2Z92A 4JRYE 4OZIB 1E4WH 1RZ7L 1IKNA 1RQ5A 1MVFA 3NTCL 4KI5D 4X80L 4LMQI 1WSST 2EXYD 3VG9C 3PQYB 4PY8I 4RZCB 1SYVA 4NZUH 2IADA 4OFDA 2H32H 4C83A 3MXWH 2WWMD 4GW5B 5MHSE 2ESVD 4FP8L 4ZFFB 1BECA 4PJFA 3X13B 5ALBH 2G5BB 2XI9A 2E6QA 3QAZB 4CJ0A 3LD8C 4EOWL 5A40E 2VERN 2MHAB 2B1HH 2Y9RT 5IJVB 4JO4L 5IHUH 3QIWC 1ADQH 4OCRH 1YQVL 2FO4B 3OGCA 2X1QA 2OTWB 4H26A 1X5JA 4MAYB 1GCFA 1N6UA 4Z7WB 3BQUC 3UMTA 4XNYH 3BP5A 2Y72A 3O4OC 2IBZY 1U3JA 1AKJB 3ZKMD 1T1YB 4AH2A 3PWLB 4JG0H 3V4UH 4BH7A 3H9SE 3EJJX 4XP6H 3RTQB 3ZYZA 4OLYL 1IFHL 5EA0L 4AG4L 5LGHL 2IGFH 5DTFA 4JHBA 5JOPD 4M7LL 2YD8A 1Q9KA 3GMNA 5I75B 2P8LB 5E4EB 1FFRA 4OF3A 3D85B 3MGOA 4NN7B 4R6UA 3RPIA 3TYFA 2H2SD 2WIIA 1VGKA 2WUBH 4QWWC 3IVKA 3SDDC 2BX5A 5F89A 2N56A 5F9DC 4LIQL 3MBEB 4JQXA 5TQ0L 4TRPH 1FHGA 3BHBA 3UX9B 4WUUE 4Y19D 4QHUB 4HMDA 5ACZB 5ICYA 3ZSTA 5D7SH 3LV3A 4NM4L 3RVVC 2PUQT 1A6ZA 3I3DA 1L0XA 3QEHA 4WJ5A 4JLRA 5SWZE 3M45A 3QIUC 1MAML 4C54A 5GGUB 1Q9OB 1HI6B 4HH8A 1GSMA 1LEGA 1KUMA 4HK3J 4FTVB 1UC6A 1KIPB 5EO1B 3LEYH 2VZ3A 3QPXH 2ZUYA 4LSRH 4N8PA 3O3DA 5FO7A 3QNXB 3BD5A 3TIEA 4ODHL 4QHMB 4WWKB 1IAIM 3IRZA 2GTWA 2WBJA 3MFFB 2D9QB 1WICA 4PJIB 4NO0A 3I9GL 1AFVL 4WTZG 1ZTXL 4S10A 4JPIB 2BJML 4HFWB 4J12A 4R3SB 4DAGL 1EK3A 3RFZC 5CBAB 4RFNC 1NBYB 1P84K 5FOBB 3IU3B 5DRNA 2A2QT 2I60H 2XFXB 1KN2L 1EBAA 5CMAA 4Z9KB 5IFAH 3QUXA 1YEEH 3KPOB 1J9CT 1R5VB 4MNGA 4PYGA 1GOHA 5DHYA 2VAAB 1TPXB 5HI4C 1ZA6B 3DYOA 4X4XA 4XP1L 3RWIA 5DMIH 1A6UH 1VEPA 1H5BB 2CRZA 2FGWL 3ARYA 4GRWH 4KK9C 4K3JH 4P9HC 3VI3E 5DHVB 3KGRA 3LB6C 3KHQA 2ITCB 1HHGB 3HI6L 4N0CD 4LF3A 4MQSB 15C8L 1NEZG 3O8XC 3ZDYF 1EFXB 3O3AA 3VRLF 3GJFA 3H9HA 2DQDL 3VXQB 2EDRA 5A2JH 3HAEB 5ERWA 3KPQB 4PS4H 2V6HA 1A1MB 3LKOB 25C8L 4HMCA 2BCKB 4PJCF 3E6HA 5ESAA 4CNIB 3OG6B 3TVMB 1IM9B 1AIFB 1DQDL 2YD6A 3TCLB 3OZ9L 4XCYA 1BD2E 1RJCA 1F8TH 3NIFE 4RA0C 1HH6B 1DBBH 1FBIH 2E7HA 3IAPA 5CGYD 3ZE1E 5C08A 3BJLA 3UPCA 4ZOCA 5ESQB 4JDTL 1NCAL 3RGVA 2SEBA 3O41A 4DQOH 3MV7E 1T0MB 1MWAH 4LBEB 1OAQH 3WXWL 4RGND 1OAKH 4PR5A 1NFKA 2HVKB 4O02L 4F7MB 3PWUB 3CH1B 4ZPTA 5CP7B 4LSTL 5I76B 3U9UA 4CVUA 2JTDA 3S34H 1J05A 4OF7A 5D4QA 1IGCL 3CUPA 4YHNB 4XRCB 3FN9A 3VGHA 2DOCA 1LGVA 4MQXD 1UZ6F 4LKXA 3SKUD 1N6QH 2HVJB 3KXFE 3QUKB 4ZSOE 4ONGH 5GGSA 3MRIA 2C1PB 4OZFB 5C0AD 4KQ3H 3BYYA 3FFCD 4JRYD 2W0KA 1ZHLA 3AREB 3BH9A 5C0RL 4UV4L 3GZKA 4B41A 2YPLD 5I1HL 1I8MA 3TZVD 2WLZA 4WHCA 1FLRL 4MA3A 3KPLA 3WHE1 4DW2L 5C0JA 2IJ0C 2NY7L 1HSBA 4KXZH 1JWUA 1QSVA 5IG7B 5TGBB 1NJ9A 4X9BA 4RMRA 4NP4L 5MHSD 1ND0B 3OHXA 1QFWM 3KPPA 4E42B 5CIPB 1J0JA 4MZ2A 1ZE3C 1RI8A 1N0XL 4W68A 2JCCA 5CSZA 4EXPX 3MACL 3RL1A 2MMXA 1HXMA 1P5VA 2OK0L 2BNQE 3SQOL 3HMXH 4G6JL 4F15B 2HT2C 4KJYB 1NBZB 4GKZA 4WEBL 2FHCA 5KN5B 1CICB 4G7YH 1I3RA 3GSXA 5JDSA 4FFYH 3BMVA 1XGTB 2QADB 1UJ3C 2GYSA 3L1OL 5IVOA 4PTUB 3WFBH 3RZCD 2PYFB 3M07A 1R0AL 3DX7A 5KVGH 5DJDA 4PJDA 3DRQB 3CZJA 3H9SD 5IQ7L 3P9LA 4BH8B 1RHHA 4XVTH 4QXGH 5C86A 1KPVA 3EYOA 1CXLA 5TDPA 5DEZA 3UAJD 1JPSL 2QTEA 3QWRA 3RQ3A 4HKXA 4NQVB 4I18C 3SDAB 4XPFH 1YY8B 5LCVH 4OLZL 3M17B 2E3VA 2X4PA 4OIIH 1CE1H 3T77B 4MQ7A 4K3GA 4OD1L 1MCHA 2DL9A 3LS5L 4WUUD 4BYHA 4N90E 1KELL 2MWCA 4LSSH 3O2WL 5D1ZD 3CK0H 4JDVA 5E2UH 2FZ3A 1RUML 2OI9C 4HK0A 5EORL 3CXHJ 5SWZD 4Y7MA 5I17A 4C57C 5EZIH 1JWMB 3UTSB 2IH3B 4M6NH 4S2SB 2MFNA 2BNRA 4JHWH 3ZE2E 3UBXA 3JZ7A 4HIJA 3MSPA 2IPUK 5SWSA 2LABA 1D9KA 3O6KL 5EZOL 3IAQA 3VDBA 3A6CL 1RUAH 4YAQB 4OZHF 5D7KE 3P73B 2YUZA 2Z35B 2G75B 3CFBB 4MCZB 3PABB 3N06B 4P2YA 1GC1H 2VZTA 4PV9B 4I0PA 4TSAL 4YXKL 3LH2H 3QI9C 3VFOB 3ZTNL 1UEYA 4H0HB 4ODWB 4DGIH 4M6OL 5IW1A 4JM2A 1I7RB 1OW0A 3FQXA 4YFDB 4X83A 5EU6B 3VGFA 4OZIA 5KVDH 5K9QI 3IDYC 5GS1C 3TH4T 3IGAB 3BN9C 3GK8L 3NAAH 4WTWA 3Q0HA 1EAPA 3GBNL 3MTRA 4OKVA 1GC1C 2D7OA 4ZS7L 3LKRA 3UTOA 2V2XB 3PV6B 4M3JA 1S7XA 2VXQL 5HJ3B 4IRZH 4H88H 4JHAL 3J7HA 5E1AB 4NC2B 1NAKL 4JRXA 3LN5B 4LCWE 5SX4I 5CEXA 4ONFL 4L3EA 3X13A 2P5EB 3BFOA 3MR9B 2DQEL 4Z7VB 2R1XB 4Y16C 2MHAA 4UNVA 4NN6B 5IJVA 3QIBD 1KC5H 4JQVC 3H7LA 3JV4A 3C60D 1FZMB 1T04B 4KRPD 1D5XB 3TJHD 4MAYA 4Z7WA 2CGRH 1QTYT 2RJMA 4YDVA 3DRTB 12E8L 3O6ML 3FOMA 4YNYA 1JRHI 2FJGA 1B2WH 5DK2B 5ABDE 4N5ED 4KV5E 3GSUB 5IIEA 3O0RL 1T1YA 3U0WL 3PWLA 4P2CG 5I19L 3DMMB 4Y4KD 3RTQA 3CFIC 5JNYA 4HJJH 1N5YH 3IT8D 5E24E 3UZQA 3EO1B 4NZJA 3X3GL 2ZOKB 2P8LA 4G3YH 2R8SL 3D85A 2ZUQB 4YEEA 1MCPH 1DSFL 1OARL 2VXTH 3SDCB 1W2KT 1S9YA 4M7JH 4ZXBB 4LIQE 3MBEA 3T0BA 4PGJA 1UKTA 4HC1H 4QHUA 3G6JB 4EI5C 4XH2A 5ACZA 1FZJB 4M7ZC 5E7BA 1AXIB 2BVEA 2D7MA 1MY7A 3QHZL 3BWAB 3F58L 4GRWF 1QQDB 4AQOA 2CK0L 1URLA 1Q9OA 5GGUA 2A1WL 1HI6A 3ZKND 1VENA 5J3HD 2P5WA 1U3HC 3KXFD 4IRSA 1T6VN 4WHYG 5ALCH 5DQDH 2R1WB 4JO2H 2VLKB 3HR5B 4FTVA 1JRHL 3X11A 1KIPA 5EO1A 5E8OB 1IC7L 4PJ8D 3WFDH 4S1SL 5HY9B 1EZVX 2MTPA 3D2UB 5ITFB 1JZ3A 4ELKB 4ZYKA 3NIDF 1A9BA 1TZHB 3QNXA 5EBGA 1HHHB 5I71C 1WZLA 4QHMA 3PV7A 3P4OB 1EMTL 4PJHB 4P0DA 4NFDA 4PJIA 5HHOD 2XYCA 2J4WL 3JWOH 1HEZB 2MNUA 2YK1L 1C5BH 4IEFB 1MREL 5E9DD 4F33B 4L4VD 4Z77B 3BXNB 5CBAA 3MRMA 3Q1SH 1NBYA 3AC0A 3V6OC 4PG9B 2Z93B 1Z0MA 2B4CH 2WUCL 2NY4B 3JVGC 5GJTH 2VH5L 2P7TB 1CR9H 2BNQD 5KSBF 1R5VA 3FT4B 2VAAA 3RP1A 4F7EB 2PTTB 4LNRB 1FNFA 1A7QH 3NA9H 3CVHL 4QRUB 1TETL 1KN4H 2OR9H 2R0WL 4M1GH 4FABL 2O61B 5C0BA 5L2KB 2B4CC 3ECBB 1KBGH 4PJ9C 2HN7A 2EXWC 4O58L 1PSKH 1ZSDB 2Y06H 4GLRH 1J8HA 5DYOA 5FUOL 1KJ3H 2NW2B 4LGPB 4P2QA 1ITBB 4JKMA 3SGEI 5HGDB 3SJVB 1EFXA 2IPKB 5E6YA 1LEIB 3L3DB 2D9CA 5DFTA 4AT6B 5EOCH 4JPKL 3WHXB 2ICCA 4UNUA 1QFUH 1A1MA 3LKOA 4FQXC 1OGTB 2VDOH 2ARJQ 4P4KC 4ZQKB 3JXAA 1F4HA 4CNIA 3TVMA 1OTUD 1AIFA 2X7LB 3BVNB 4PY7B 4N90D 1FC2D 4Y4FB 2AJUH 1QZ1A 4AIZA 3UTZA 1RZKL 1MF2L 5JXED 3CDGA 3RNKB 4P5MA 1I3UA 3OTTA 3E1F1 4XPGL 3O4LB 3RVTC 1JHLH 1S7UB 4XC3L 4NQCA 4KHTL 4YDLC 5DVNA 5L6YH 1BAFH 1TCRA 1KG0B 1YEDB 1MCRA 4WI3A 2H1PL 3S96B 5IMOB 2HVKA 1PLGL 4F7MA 3W0WE 3PWUA 5H2BB 3P4LA 4PUBH 2Q7YB 1NCBL 4GRLB 5I8OL 3B2VH 5I76A 4H0IA 3T0EE 3ZKXC 2QL1A 2EH7H 1C8PA 4Q58C 4MVBC 3GM0A 1CU4L 1KT2B 2DTML 3BIKA 4Z7NE 4MJIA 2KUTA 2HVJA 3GHBH 3QUKA 1N59B 2DM2A 4Z7OE 1A9EB 1XGYL 5DZLA 3AU1B 4QLRA 1UM6L 4KHXL 3EW3B 4PJBF 5D8JL 1MOEA 3C5ZB 1F13A 5JO5B 1E4XI 2HWZH 3MQIA 4KKLD 3QJHB 4LLAA 4PJGE 4EDWL 5HYSB 3U2SB 4OLVL 1KCUL 4X7TB 5IEHA 3RA7L 2W59A 5HVWA 3ZO0A 3BZ4B 2J6EH 1ND0A 4PRHE 4E42A 3SE8L 5CIPA 4OZ4B 1QR1B 3WSQL 5DWUH 4OGAD 3C6SB 4N1EA 5D5MF 4ZD3H 1FFNB 4M02A 5F7FA 1MI5A 4MX7B 4PRDB 1FFOB 4KJYA 5A16A 1NBZA 4XBGB 1IGYB 3RHWK 5KN5A 2FX9L 1CICA 2GJ6E 2YS4A 5I74C 4E0RB 4W4OA 1XGTA 3IDXL 3QDME 1KPRB 4PTUA 4G9DB 4Z0XB 5IESH 2PYFA 3FQUA 3NACH 3FOLB 1E4XL 5ID0B 3DRQA 5GGTH 4BH8A 2CLRB 2VXUL 2YOCA 1YC7A 4X6EA 5CUSH 1WEJL 2ERJC 4MWFA 5F1IB 4HQQL 4LEXH 4BSWB 4CMHC 4C4KT 3V95A 3SDAA 1YY8A 2WAHA 3E3QC 4HCRH 3M17A 3HZMB 1RJZB 2UWEB 4GRMB 4YGAB 3T77A 4NFCA 5HHXH 1D5MA 4UT9H 1Z9LA 3MNZB 1QOKA 5TDNB 3WS6A 2PO6D 3PWNB 3TWCH 1U8NB 4KRLB 3BKCH 3SO5A 2Z4QA 3LKQA 2AK1L 1JWMA 3UTSA 2EIZB 4S2SA 3BRFA 2I25N 1XCQB 4QTHA 2IEPA 2PF6A 3VG0H 3ARGC 1U42A 4M6MH 2XWJB 4WVRA 3HC4L 2VABB 5FM5O 5T1LA 5FB8B 3IS0X 2HFFB 3NVQA 4YAQA 3BKMH 2OJZH 5ITBL 1T83A 2G75A 3V4PH 2FJFB 3JV0A 4JO3L 1JYXA 1BQHA 1PX3A 3CFBA 4MLSA 1S9XB 4MCZA 3ZYOA 3PABA 1ZWIA 2QQLL 5E6ZA 2G2RB 1MIEL 3VFOA 5BS0E 3FMGH 4PRNA 5CAYB 4ODWA 3MA9H 1F4YL 2O5XH 2R29L 3VH8B 4LVHC 5H94A 1T03H 4NZTH 3VXOB 3AGVA 4KAQL 4N0RA 4YDJB 3FO2B 4M8VA 3IGAA 3QYCA 1NGZB 3LN4B 1LWRA 2DTSA 1G7IA 3R0MA 4H5SA 3MFGB 1YYML 1EJ6A 2V2XA 3QO0B 3IJHB 2H45A 1BF8A 5HJ3A 3DETD 2Y5TB 5E1AA 2DQUH 2WM0A 4J3VA 5AYQA 5BV7L 4M1CD 3ET9F 3P4NB 3ARBD 4X99B 4MD5B 1ZLWK 3VXUB 4Q2ZB 1EA9C 3MR9A 1QFHA 4XZUB 2APFA 4Q9RH 1QBMH 2NLJA 3HCVA 4Z7VA 1OAXH 2R1XA 3RPKA 4LHJB 1A7OL 2ICWJ 3O3EA 2R0LL 1FZMA 1U92A 1T04A 2R23B 7FABH 2IQ9H 4OIAA 5CZVH 1E28B 3ELAT 3H0TB 4JPVH 4JZNB 3S8WA 4H8WH 4PB9L 2DQHL 1CK0H 3BSZL 1FNHA 3DRTA 4HWBH 3VWKB 1CVSC 1WC7A 3WJLC 3DV4A 4KUCD 3GRWA 4X6BB 4MA1B 3WUWB 4HS6B 5ADOH 3DMMA 1NUDA 5DRWB 1INEL 4WCYH 4YBLB 5BZWB 1PZUB 4U7MA 2ENSA 4H8WC 5JR1L 3EO1A 3HUJE 2ZOKA 5CSGA 2MCG1 1DVFC 3B9VA 1UWEL 4U1NB 1NL0L 4DGVL 1RK1B 4LASH 1LO0H 2NY5L 3SDCA 4ZXBA 4OZGE 4PYHA 1MCBA 5C07B 3G6JA 1MCWW 3O2DH 1FZJA 3AAZA 3GGWB 1P1ZB 4XNZC 5BMFL 1JTPA 4P5TA 1W72B 2HTLD 1LE9A 2IH1B 3OAUL 4LL9A 3BWAA 2F53B 3T0ED 3GBML 2HLAA 3M8OL 4JFFB 2MPAH 1WCBB 5BVPH 3RKPA 3H3PL 5CILH 4K55A 4UB0H 1XF5B 4GKSB 1GIGH 2F54E 2R1WA 1CFSB 4TNVK 3AS3A 2VLKA 3QEGH 2JELL 1S7SB 1QR4A 2CRYA 3QEQB 2Y6SD 3K80A 4LVEA 4QRPB 5E8OA 4K7FB 2E9WA 1P53A 5E6IC 5HY9A 5GS0H 5TQ2H 1IAIH 3D2UA 2XZQL 4ELKA 4OT1L 5IROC 4D0CB 2UV3A 1TZHA 4NPYB 3N85H 4YXHH 5CD3B 1UB6B 3FQTA 4MNHB 1HHHA 4KZDH 4M93C 3ZTJH 1C1EH 1U3YA 1JGDB 3NCBB 3P11L 3STZB 1ODAA 5C7XH 3P4OA 4F37K 5SV3A 3NCCB 4Z7UA 3QUYB 4QOKA 2BDNH 1GGCH 2VWEC 5IFJB 1YNKL 4V1DE 1DQTA 5GS0C 2VDML 4NBZB 4F33A 4Z77A 4MNQB 1X5HA 3LKNB 5JPMB 1ACYL 5BW7A 5IEKA 1U58B 4YHLH 3FT3B 3IDMA 1JIBA 4L1HA 3UC0L 4PG9A 4NZDA 5D1XB 1F2XK 4D9QE 4OQ1A 2P7TA 5HI5D 4IDJL 4UINH 1RZJL 3CLFH 3MRNA 5KOVC 4K9EH 4F7EA 1M4KA 5F44A 4R97C 4LHUB 3QH3B 5IVXB 3DXAE 2GJ6D 3ULUL 4S11A 4XCCH 4UT7L 2O61A 4I1NB 1LO2L 3EO0B 5AWNH 1QSFB 1EZVY 4XXCC 2K3TA 3U83A 1K6QH 1ZSDA 2GTZB 2V9QA 4K9EC 2R0KL 3PG2A 2NW2A 1VEMA 3Q6GL 5H37H 3QFDB 4OD3L 5HGDA 3SJVA 1SJHB 2JJSC 1I1FB 1X5ZA 2Y07H 3W9DB 5I0DA 5D7IF 2IPKA 1LEIA 3L3DA 4HLJA 1A1NA 4FHBD 3WHXA 1KULA 2DQCH 1OGTA 4RBPH 2FLBT 1AE6L 4HT1H 5I1IH 4ZQKA 2JIXB 3KS0J 3VFGL 3ESVF 5HHMB 2GHWB 3S5LB 3EGSA 3TJEL 2X7LA 1H8NA 4Y4FA 3IFLL 2WBWB 4X6CA 1JGLL 1U6AL 2JB5L 3MOBL 3RNKA 4XVJL 1YEJL 5IBUB 1NKRA 3O4LA 2A73A 3WNPA 5SWQA 1HXYA 4LSPH 4Z7QF 3SCMD 1GGBL 1S7UA 5DMYA 1IGFH 1J0IA 2VJXA 4RFOL 5E8PA 4MJ6B 2AW2A 2B1AH 1JUFB 1KG0A 1YEDA 2X41A 5HHVH 4MXWL 5IMOA 3S96A 1MH5B 2CO7B 5H2BA 4HW6A 4IMKA 3LRGA 4GRLA 2PW2A 3WLWC 2CIIA 4HGWB 2VAJA 2JJTA 1XAUA 1KT2A 5E2WH 2NY3C 3NABL 3TBTB 4ETYA 4JVUA 3HLAB 2OR7A 2NY1D 1A9EA 2I5YL 3AU1A 4JVWA 5BS0D 5T3XH 3WDJA 1E27A 4ZDHB 3C5ZA 1REIA 4QRSA 4X98A 1QSEB 1EHAA 3QJHA 5JUEH 4N0YL 2H3NB 1JZ5A 1U8HB 3U2SA 4X7TA 4IHOB 3VCLA 2NX5B 1V3JA 5EC2A 2YXFA 4FZ8H 3BZ4A 2W9EH 3HFMH 2C4XA 3QIWB 4X0KB 3MLRL 4FQ1H 4PJFE 5FYJH 3C5SB 2H32B 3VXRD 4U6TA 1OF2B 5D2LB 1FFNA 1UCTA 2X9YA 3ZSSA 3MV9A 2AXGA 1FPTH 4OJFH 5JTWA 3THML 2VLMD 4G7VH 4MDJA 4PRDA 4E41B 3O4OB 3ARFD 4EQ2A 1OQOA 3IRPX 1VFOA 3KNBA 3QZWA 1IGYA 2MQ0A 4ZS6D 4E0RA 1LO4H 1NCWH 1Q1JL 5D72H 2ORBL 4KJWC 4G9DA 4Z0XA 3SKNB 5GS2D 4EVNA 4ENEC 5D7JC 3P3YA 4Z95L 2ESVB 1AR1C 3QG7L 5B22A 3HC0B 3MV8A 1LK3H 2ED7A 1AD9B 2GSIA 2CLRA 2BNUB 2E27H 4GKNB 4P9ML 5F1IA 1IQWH 4BSWA 3O9WD 1D6VL 1OAUL 4LEOB 4M4RA 5LAXA 2CJUL 1ORSB 3HZMA 1RJZA 2FEEI 3TBWB 1P6AB 3DROB 1NC2B 1ZV5A 4Y4HC 5C6WH 1RHFA 1R3KB 3MODH 1QRNA 1NGWB 1CGYA 1FNSL 3DVGB 3RWJB 3MNZA 4XCEA 3VE0B 4OM1L 3AUVA 1HOCB 5TDNA 2GJJA 2UYLB 4Z8FL 2LE9A 1OTTC 4RFEA 5LKNA 3NZHH 1U8NA 5CGMA 1F42A 4HFUL