3O6KH

Crystal structure of anti-tat hiv fab'11h6h1
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
217
structure length
217
Chain Sequence
EVKLVESGGGLVKPGGSLKLSCAASGFAFSSYDMSWFCQTPEKRLEWVASISSGGSYTYYPDSVKGRFTISRDNARNTLYLQMNSLRSEDTALYYCARDYDYGVDYWGQGTSVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11H6H1 Fab' light chain
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 44
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kH01
5SWSB 4XPFH 2VYRE 2FX9L 1T2XA 1G9MC 4DEPC 5J1AA 3I3EA 2FHBA 4U6TA 4M7JH 3MJ8A 1FFRA 1OW0C 4PLNC 2Q7YB 1BOYA 4KVCL 5J12C 4NJAL 1KEGL 3O3EB 4OAWA 3ETBF 1NLDH 2BSSA 4D9QD 2ADFL 4JJ5A 5D7LE 4PTTB 4YFLF 3RNKB 4PJFF 1BQHA 2X1WL 5IK3A 1P4BH 1MPAH 5C2UB 1U8KA 2JF1A 3DVNA 4JFPB 5TPWH 3V4PL 4PJAB 1GC1C 4ZXBB 3O9WB 4PJHE 5TE7H 2H32A 2CK0L 4J3TA 4NPYB 3SDAD 1BBDH 1IAIM 1YMME 1A6TA 3SJVA 2FIKA 3TT1H 4NM4H 5BS0D 5FA4B 1ZKAA 2QEJA 4CNIA 3M8OH 2V7NB 4FMKA 4PJHA 3ZHLA 1Z3GL 3CCHB 2DI7A 2Y5EA 3KYOA 5B3JF 4GOSA 5B8CB 1FL3A 5FK9A 4KJWD 1TNMA 4K7PX 4PGZA 2E7LA 3FN9A 4JKPH 3S34H 5HSFA 4H0HB 2A9ML 4LP5A 1Q38A 3WD5L 5I18H 1MCJA 3O3AA 4HIEB 5T1MB 4G8EA 3GGWB 1NC4B 2R0WL 1OAKH 2H3NB 1I9IL 3QZWA 3FFCB 4S0SD 5HDQH 3GJEB 1TVHA 2YMXL 1FVEB 1X6LA 4WFGD 3G5VB 3RVUD 4OBRA 4OV5B 2X42A 2D4DA 2XTLA 2NW2B 3I3BA 5IFJA 4OLVH 4JVWA 4KDTA 1BM3L 3BZEA 3MV9B 2EH7H 4JY4B 4YWGL 2CRZA 3CLFL 3QXTA 2VLJA 5T3XH 3ALXA 2R39A 1WWAX 1AQDA 4AEIL 1T5XB 5F72S 4UINL 1U41A 2AK4A 4S2SB 4Q9BA 1O7VA 1UZ8B 1C8PA 4TUJA 5I71C 4GBXA 3RWHB 3PL6B 1CFVL 3NCJH 3H42H 4P23C 4F9LA 5IMLA 2QSCH 1RI8A 3PWVA 1TNNA 4LCWA 4U6XB 2JTDA 4LRNL 1S7QB 4A2LA 2BMKA 1NFIA 4DQOL 1FRGL 1V8HA 1CL7I 1PD6A 3QXUA 4N8CL 1KPUA 3D18A 4G8FB 5IQ7L 4LCIL 4J7RA 2A0LC 3QSKB 5D7JB 2HFFA 1VKXB 1EVUA 1UM5H 1B9ZA 2VH5L 1OAQL 5TGBA 1NSNH 2VR9A 3G04B 2ICEA 1IGCL 2ADJA 3GSOB 3IS0X 1J7VR 3PIQA 3WKML 5C8JB 5GJSH 5CBAB 4WCYH 3DX9A 2YBRA 1NGPL 2YSSB 3JWOC 3WN5C 1MHPL 3MV7E 1MFEH 3FQUA 3THMH 1ZT7A 4HV8B 5EU3B 1XGPA 3CFBB 1D9KD 1TIUA 2KZWA 3BDXA 1C08B 3SDYH 4XCCL 4PJ9B 3MV7A 1ZVHA 3CPLB 5EBMA 1TJGL 1RAMA 1U36A 1DBKL 2W65B 1R5VA 3VW3H 2NY1D 3PG2A 2B20A 4P59L 2QHLA 3B8YA 4MA8H 1YY8B 1RZ7H 1Q94A 3QISA 2XN9D 5CJ8A 5JMRA 4JVUA 3N0PB 1LO5A 4XNMB 2D0FA 3O3DB 4OF7A 5CZKA 4NM8H 2FSEB 4KXZH 1P6AB 3IVKA 4NUJA 1KN2L 2VL5B 4BKLA 4A6YL 1IKFH 3GHBH 4M6OL 1F6FB 4JREC 1TENA 1I75A 2QSTA 2FGZA 5GRVL 4ELME 2BSRB 1JNNH 2Y6SC 4PLJD 3BP6B 3GBNL 1XIWC 5DK0A 3LQMA 4QRRA 3WFEL 5J7CC 3LS5H 2CPCA 4G6MH 5LBSH 5C0EA 5IMOA 1XGTA 2A9NH 3D0VB 2XNAA 2GK0A 5B38G 1HIMH 5DMKA 3I2CL 2PR4L 1VACA 5GIRB 3NFSL 1NDMA 3W81A 3KPOB 2GJ6B 4X6CE 4ZPVB 5EDXA 3DX7B 3PGDA 1FNFA 4OGAC 5I19H 4B5EA 3KJ4C 1HILB 3S3PA 3ME0A 4OM0L 4RAVB 5EOCJ 3OF6D 5F7UA 2EIEA 2W60B 3D3VD 3NIFE 3BUYA 2Z31B 4ODUB 3RUGB 4H1LG 4JCLA 1QOKA 4O4YH 3QDGE 5HYQA 5FO7B 3IGAB 2F58H 5ACZA 3NBNA 4LPVA 2ZJSH 3A6BH 4HS8L 1WCBA 3CSPA 3LQAL 1N5AB 1UM4H 2X41A 4PJGB 5D2NB 4Y1AB 2UWEB 2PO6C 3IB4A 7CGTA 4Z7VB 4GKNB 1JGVH 4NQXB 1HINH 1VFAA 1G7IB 5GS2D 3LIZH 1IC4H 4KKCD 3WDJA 4M6ML 4I18A 5BCAA 2JJSA 1E27A 5IEHA 3I75A 4UBDD 2AJ3A 3IDXH 5I74C 4YBLB 3CK0H 3QEUB 4N0CC 1U58A 3HPLA 5GS2H 1XF2B 4O2CB 3CFJB 2IF7A 2DF3A 1ZE3C 3JVGA 3QXDB 4FS0A 5MEOB 1PEZA 1DQJB 2MCPL 2AJYH 5KJRH 3EFFA 3P9MA 3ARQA 1V3LA 4P2OD 4G5ZL 4QHLA 2MQ0A 2NXZB 3MRCB 1ZVSB 2QADD 2RFXA 4X98B 3ISWA 1SEQH 5GHWH 3T2PA 3HAEG 2IMMA 1UENA 1IC5H 3G08B 4G7VL 4E42A 2HN7B 1JYVA 5F1KC 5K9OB 2W9DL 2OI9B 4NO3A 4NNYB 3DIFA 4JHAH 3QH3A 3FCTB 4RBPH 3GJFH 3EO9L 5DA0B 4IS6A 4YR6A 2CK2A 1IM3A 3PHQA 2VLRA 1SBSH 2MQ3A 5B3NA 4CMMA 4WGVB 5ESAA 1OGAB 4GRLD 3DHJA 5HI4D 4ZG1A 3IFNL 4WEMB 1AXTH 1D5IL 2LAAA 5EH1A 5EPMA 2X4RB 3MOQA 4KUZL 4QXTA 3SDXE 4HIIA 3BP4A 2YUXA 4HFWB 4JG0L 5AEAA 4M61B 1ZV5A 3T4YA 3B9DA 1VDGA 5FYLE 5E1AB 4Z7UF 3SDXA 3FB7B 4NN7B 4NO0A 4YUEL 5FGBA 4RISL 4PLOB 3O6ML 3UBXI 4YHYC 3T0AA 2NZ9D 3L5XL 4C58B 1HNGA 3ZE2F 4XNZB 4L9LA 1KB5H 5J3HC 4X83A 5DVMA 4NT6B 3NIGF 4BFEA 1Y18B 2N7BA 3HE6B 5EUKB 4YHIB 2BZDA 5EZIH 1ACZA 1H5BC 1Q1JH 5CEXB 4I77L 5T1LD 1ITBB 2ICWA 3VGGA 2D31A 1GOHA 2MKWA 2MWCA 3F58H 4YK4B 2BDNH 3G5YA 4AIZA 3E8UL 3MREA 1JWMB 4FQ2L 4JM2B 3GMPA 4K9EL 1MIML 4LHJB 4LLVB 3UYPA 1ORSB 4CAGA 2AW2A 1CZ8H 2R23B 4NBYB 4Y4KB 2GEEA 2VXTH 4KAQH 4J12A 2CO7B 4RWHA 3VFGH 4JHZA 4QRPE 1FO0B 2NY2B 1JPFA 1SYVA 3SE4A 2Y07L 5EOTB 2AKRA 5E99H 2AAVA 1FFOB 3UROR 4ODTL 1U93A 4U1SB 5TDPA 2H8PB 1KB9K 3LKQA 5E1HB 4W6XB 4PJCA 4QYOB 2O61A 4ZUVA 5EUOA 2RIKA 4RA3A 3P40A 4LCYA 1G7JA 4KXZI 3TZVA 1VFUA 4X9BA 3QIWC 2X4PA 4OSUL 3U6RB 2VE6A 1BX2A 5CCKL 3CVHB 5SX5K 2EC9T 4NRYA 2V6HA 1MCLA 3CMOL 5GGRB 4EI5D 3U4BL 4UDUA 1A6VH 4Z6AT 1J0ZA 5SWZE 5DQJA 4CUCA 3QUKA 2J4WH 5JZ7C 1A7QH 2R0ZL 1ZT1A 4NZUH 3BDYH 3WXVL 1G0XA 4OZGE 4D0DB 5C92A 5AWNH 4PG2C 5FB8A 3VDCA 3TA3C 3LD8B 3ULVD 1BAFL 4LMQE 5D9SB 1J05B 5E56A 3FT2A 4EI6A 3FB8A 3BN9D 4X6EB 4FFVD 3BISA 4ONFH 4UV7H 4XP4H 3ULVH 2BVOB 3QRGH 5H37H 2VR5A 4LLYA 1DL7H 4W68A 3C60A 2F53E 4ZS7L 4PRHB 3QRFM 4EUPG 4ZNEE 5IG7B 1P4LB 3V5KB 2MFNA 2P24B 2VXUH 3D25A 3H9HB 2WBWB 1LO3H 2FYYA 3VRLF 2NW3B 4XVSL 3ARDA 4WW2C 1G9NC 1DVFB 3QPXL 3RQ3A 3VFUB 3VH8A 1PY9A 3L7FA 4XB8A 3BKJL 4H20L 4RIRB 4U1NA 3T4AA 3V0WL 5ENWA 2I5YH 2WBJC 1WAAE 2Z9TA 3VMPA 1JHLL 3LCYA 2R0KL 3T0WA 4HJ0C 1BEYH 2AVGA 5HYEA 1XH3A 1SY6L 2DD8L 1T66D 3WO4B 1TTGA 1FJ1B 4TTGA 3WDIA 4P2QD 5FGRA 4OD1L 3L6FA 2AK4D 3L5WA 4IHOA 1UVQA 2VC2H 2F8OA 2GW5A 3UZQA 4ELKA 4GBXD 3BEVA 4WO4A 3VG0L 1B0WA 3D85A 4LCWD 5J0BA 2EDKA 3BKMH 1M71B 1NUGA 3L3JB 3JUYA 1CF8H 1BECA 4UUJB 4HWNA 2PYFB 4JANA 4P99A 5DUMH 3VFNA 1P2CA 3PWNB 1YDPB 5JUEL 4LPUA 3SPVA 3RWDB 5D5MB 1DR9A 3GHEH 2XQYK 2EEAA 4L8DA 4LVOC 1H9VA 4ENED 5TH2B 2A83B 1G7LA 3ARPA 4NBZB 1BD2B 4P4KB 4YHKH 4ZAKA 2N56A 1Q0XL 2ADGB 3K4ZA 5L2JA 3TT3L 3DXAB 2J3SA 5D1XC 2QL1A 3RIFK 4KY1L 2VDQL 4MXWH 2IH3B 2W91A 1MY7A 4EN3C 4OZIA 2Q3AA 2R1YB 4M3JA 3ARTA 2A38A 3QIUA 2NY4B 2XYCA 1T20B 5HGHA 2JK5B 4O51B 2X4NB 3B9KB 5D6DC 4XCFH 1FPTL 1DE4B 2VABB 1JFQH 1HHHA 5IBLC 5EZJA 4PY7B 3K8MA 3KWWB 7FABH 3A6CL 5DQDH 4MA3A 4UNUA 1JHKH 4X7CC 1LK3L 4N90E 5E6IB 2ZSWA 1ZTXL 3RTQA 3RIAF 3RWCB 3NVQA 4UTAL 1WFUA 4BH7A 4GRMA 3TN0B 3GKWH 2VSDA 3FOLB 1C16A 4KJPC 1JK8B 4NKDB 5GRYA 5T3ZE 3TPUA 5KS9A 2RBLA 1L0QA 5J11B 4Y2DC 2R0LH 4OF6A 5C0ND 5IVZB 1NGZB 3QI9C 3ES6B 1RK0B 1H3VA 3LN4A 1ZEAH 4QRRD 2GTZB 4DCQA 4JZOA 4LLWB 1QSFB 1RULH 4R0LB 3O8XB 1EA9C 4HH9B 2XQBH 1X5FA 3AB0C 3SY0B 4PGEA 5DD0L 3BH8A 1FZKB 1PG7X 2ERJB 4JN1H 3TIEB 4X6DE 3SEPA 2D03H 4JFXB 4PJEB 1BPVA 4YHZH 1AO7B 4WHCA 2W38A 3GMOA 4YNYB 2EDBA 2GI7A 3STLA 2HVKB 2N7AA 3T8XA 4WNQA 3NFNB 1GGTA 3OG6B 4TN9A 5JHDA 1UJ3C 3VWKD 1FGNH 1YEDA 3QCTH 3MZTA 4NGHH 3UDWA 4Z7NE 1MHHA 3LZFH 2AI0H 2ZKHH 1HNFA 1A9BB 4A6YA 5IT2H 2WUBH 4J3SA 1BREA 4Y16D 1T2QH 5F8QC 4ZSOB 5ADPL 5IKCA 4JO4L 4DKEL 3OKKA 5KZCB 3QNZB 3H6JA 5I1AB 4MB4A 5E8OB 2CLRA 1IRAY 1SVZA 1MH5B 2O5XH 3UAJD 4FXGB 5C0DB 4OLYL 5ICZB 4UT7L 1I1AC 5E7FA 5E8PB 2EYSA 1JNHA 1F4HA 1AXSB 4JRYE 5KANG 2PYEE 1EPFA 4JQIL 4PYHA 3GSRB 4AG4H 2P5WE 2UZXB 1FYTB 4JFZL 5J6HA 2R1XB 5E70A 1MCOL 2EECA 1G9MH 1JPSL 2RR3A 3EYVA 1MAKA 5B4MC 2R56L 3MRIB 4KZDH 5SV3A 2X1OA 3HE7C 1F42A 4G9DB 1WEJL 5L6YL 1GOFA 1Q9LB 3WIHH 2NY0D 1QACA 4NIKB 5IR1A 5BS0B 1QQDB 3QIBC 3B3IA 3BH9A 3ZSTA 4FTVB 5E9DA 5T1KA 4KVNL 4Y19E 3R0NA 5A3ID 3PE9A 2FEEL 4OCXH 5KSBA 5L7XH 2OP4L 1HXMB 1GC1H 1PBYA 2NXYC 3RX7A 3TBYA 4BELD 2E8YA 4QTIL 2IQ9L 5FYKL 5C86A 1N4XH 3WNLA 4D9QE 2VLRD 5BXFB 1FSKC 1WITA 1SQ2N 1NFKA 3QWQB 1LD9B 3BQUB 5IV2B 1IT9L 3MSPA 3F7VA 4GS7B 4R7DA 3GNMH 4YQXL 1NCWH 1FZJA 1KIQA 3HZMB 4LGPB 2QQNH 4EOWL 4NO0D 1BFSA 1T1ZB 1GGBH 3WSQH 2VLKA 1KPVB 4IM8A 2VKWA 2IBZX 4O00A 1KCRH 3SKOA 4TSAH 3NGBC 2ZCKH 3KDMB 5DJAB 1GOGA 4LNRB 1BVLA 4LAJH 4H26A 1PYWB 3B43A 4U1MB 2VQ1B 4HPYH 2APXA 1RZKC 2KPNA 2KH2B 3NZ8B 5CAYB 4YZFE 1UACL 1GJIA 2DYPD 2GT9A 4O9HH 3CNKA 4U6HB 3P4OB 5IM7B 5D1QC 3RGVA 5T3XE 4NZJA 2FJGB 1J8KA 4MJ2A 1IGIH 1MJUL 1Z9LA 4DN3L 5EORH 5EIVA 3ARGC 1A6ZA 2A0LD 4MGXA 4Z77A 4ZODA 2BJML 1ED3B 3UCRA 4ALAL 3EDKA 2F74B 2NLJA 3FQRB 3JV0A 4G9FD 5FEBA 2A1WH 4QWWC 4XBPB 1MCDA 1R3IH 4RGNB 2N4IA 2OYPA 2OJZL 1EHLL 2CGRH 4G6KL 2ATPB 1W72L 2NCMA 5DC9B 2P5EA 3AGVA 3PGCB 5ESQB 1WUNT 5E94B 3P4NA 5GRJL 2Y7QB 2H26B 1K4CB 1OB1A 4MMZC 4ODSH 3G5ZA 2GCYB 4IMLB 5CGYD 1LDPH 1NUFA 3JWOH 4FQIH 2GFBA 1PZ5B 2KQNA 4L3CA 4MAYA 3TZVD 1B0GB 1WBXA 2CUHA 3RZCB 1F2XK 4GRWB 1PGRB 2IADA 2XN9B 4NYLB 5INCB 5HI5C 1MHEA 3LV3A 1RUAL 5HYJD 1FC1A 4P2RA 2YD7A 2GJZA 3MGTA 4M5ZH 1S3KH 2V2XB 1QP1A 3TBTA 4X9FA 2YA2A 3S6CA 3MOBL 4JFOB 4N9OB 5L88H 4Y8DC 5I66B 4G6AC 1EAPB 3FO1A 4LFHG 2ARJB 3MMEB 3VXQA 4HKJB 2FWOB 3DROA 3UTPD 4L4TB 2CKNA 5DJ6A 4MXVE 3QEGH 1QUNA 4IRJB 1WZMA 1NGQH 2HLFD 4FG6C 3MRQB 4W70A 4ZYKA 4WI4A 5HY9B 4WJ5A 2BSED 3S7GA 1R3JA 4NN5C 1I7ZA 4WHYH 1UB6A 4LLUB 3P9LB 1NEUA 2E27L 2H9GA 4RBPK 3GJFK 3MLYH 3G6JF 2PXYC 1R5WA 3Q6FB 4U7SA 4NQDB 4AEEA 2GAZA 3T2NH 2X4SA 4YHPB 1BBJB 5JIIA 1DSFL 4CU7A 2I60H 1W8NA 1JZ2A 3PQYB 5ACLA 1J1XL 4ZUWB 4IOIA 4MLIA 5E0QA 2F5BL 2VDNH 3OAYH 2C3GA 1ZS8A 4PJ7A 4GUPA 4MAUL 2JELL 5DEZA 1IL1A 3DURB 4ODXB 4LQ1A 1DUZB 2Z8RA 1Q9WB 1WZ1H 3Q5TA 4MDJA 2VQUA 5E2VL 3HR5A 4U1KA 2PO6D 1RZJL 5F9JA 3T1FA 5IFHL 3GK8H 2XWBB 3V4PH 5FIEA 2ENYA 1L9NA 1MAJA 2PKDA 1BGXH 2VZVA 3D85D 4NCC1 4P3DB 4OLEA 4WV1B 2RCSL 4F9PA 4TVSa 3QJFA 3QPQC 1F4AA 3LH2L 5EIIB 4K7FB 5EOQH 4LAQH 4I13B 4NJ9L 2A9MH 4GMTH 3O0RH 4P57B 5C0CA 3HZKA 4ZAKD 4JFQA 4G8GB 4KV5E 1PX4A 4NHUA 3D69A 1FNEA 3VXRE 2YPVL 3O2WL 1ZLVK 1A1OA 2F54E 1SY6A 4KTYA 1IC7L 1NAKL 4LGRB 5TJWK 3U9PH 3RA7H 4MA1B 2JJWA 2D7PA 2HRPL 1UCBH 4CN1A 3DARA 1UWEL 2X1XR 1G6RB 5ISZB 2PNDA 4PJAF 3HUJF 2XZQL 1QEWA 3K0WA 3CZFB 2CUIA 3TVMB 2XIDA 4EQ2A 4AEIH 4L8SA 3U7YL 5I1EL 4QNPF 4GG6B 5KBNC 5HGGS 4WFEE 5FAAA 4LASH 3MJ7A 1BWMA 4RNRA 3S5LA 2PN5A 3RTQD 2DLIA 4MJIA 3J7HA 3DO7A 4LSVH 4I0PB 4F33A 5C1MB 1A1NB 1CFNA 1S78C 1DQQB 4FQHA 3IU4H 3NA9L 3CSYA 4LCIH 3SKNA 4Z7WE 1VADA 5ELIA 2IG2H 3EYOB 2ICWI 1CN4A 3QUZA 1K2DB 3FT4A 2J6EH 4PP1D 3BHBA 2Z35A 1RZGB 2NPLX 3GB7B 3PWJA 4L3AA 4ZFGL 4Z7WA 4NOFA 5BOPA 1VGEH 4O2FB 3VXPA 5BV7C 3SDCA 3WL9B 2C4FU 4JFYB 1WWWX 2WUCH 3VD9A 5LGHH 3Q5OA 4XMKL 5DQ9B 4M8QB 3RKDD 2L7UA 4CADB 5K9KA 3KYNA 2ICES 3BGMA 2ARJQ 1DBAL 1P4IL 3IFOA 4L4VE 4KFZC 4PGCB 1S7WB 4G80B 3NABL 1T04B 4CDHA 2CKBB 3K80A 5IBUB 1S9YB 2F8VA 5JHDD 3MQIA 3DV6A 4L4VA 4PJIE 3IDNB 5TFSL 3FONB 2Q76B 2YXMA 4PUBH 3W11D 5J6GB 1KIRA 3ZMRA 5J56B 1QFUH 1T22B 5F3HB 2IFFH 4PJIA 4XP1H 3X14A 1U6AH 5F88B 3OX8A 2FR4A 1XCTA 1W2KT 1RJLA 2K1MA 1DBML 5DURD 2AXJA 4JQXA 1ES0A 4A6YH 1OM3H 3QIWD 4R2GD 3GFUA 4L3EE 5J1AB 4XCEA 4ZS6C 3CFKB 1EO8L 3MJ8B 3MLVL 4RRPG 3BE1L 5SV4A 1I8KB 4MQ7A 1J0JA 5CP7B 5EB9A 2ZOKA 4OD2B 4RGMB 1QTYT 3ZYZA 1XGQB 2BSSB 2JJTC 1AGEB 5L2KA 4X6FA 3OAUL 3PP4H 4QCIA 2BY0A 4XVJH 1U8KB 3DVNB 1MUJB 3NZHH 5CIPB 5FHBL 1NANH 2H32B 3U0TA 1MFAL 1CLZL 4RA0C 4Z78A 3DUHA 3SJVB 2FIKB 1C5CH 2AJZA 1BFVL 1ZLUK 3TJEL 5E9DD 5T1KD 4CNIB 1ONQA 4PJHB 5JORA 2X10A 4R26L 5KVEH 2WK2A 3MRRA 1EXUB 3DGGB 3I6LD 2WMPA 3E6HA 1B88A 1FL3B 4U1JA 5FK9B 1PG7L 5FKPA 1QZ1A 12E8L 5DJ8B 1EGJH 1KENL 2AJVH 1KXQE 1J8HA 1NFDF 1OSZB 1A9EA 1AC6A 1ROWA 3GSNL 3NIDE 5I1IL 3TBVB 3C5ZB 1IGYA 3KXFE 3QDJA 4HXBL 4BYHA 1QBML 4IRSC 1FLRL 3QZWB 4HKXA 4S1QL 4HFUL 1NMCB 1TVHB 3KXFA 2NMSA 4NO2B 3WE6A 3IJSB 5IBTL 1JUFA 3MBEA 5FFLA 4WI8A 3VXUA 3TNNB 5C09A 1F3RB 3BZEB 3VXSA 2OXGA 3B2VH 3STZA 3BO8B 2VLJB 4XP6H 3QXAA 2VLKD 4HJ0D 4MD0B 1G9NH 1AQDB 5C08A 3OKDA 5FCSH 1N0XH 3L9RA 2Y5TA 1EEZB 4TUJB 2EYTA 5TQ0L 1RU9H 4HC1L 2EXWC 3PWVB 4LCWB 4G5ZH 3RPIB 1N5YH 3VXOB 2BMKB 1NFIB 3O6LH 4FQLH 5ID0A 4PBVC 2P47B 4Y5VC 4U2YA 4ZTOH 2VSCA 1KPUB 3V6OA 5KSAC 3D18B 4NFBA 3MA7A 3RGVD 1QBBA 3JWDL 2HFFB 4S1RL 1ZAGA 1OTUC 4DTGL 4Z8FL 1IZJA 2UWEF 5TGBB 3ARFC 2ICEB 2ADIA 2NYYD 1TPXC 4P2QE 4Z7VF 2E9WA 1F45A 3KLAB 3SKMB 3OGOE 1IJ9A 2DQEH 2YBRB 3DX9B 1D5IH 4M7ZB 1G7PA 3FQUB 1GL4B 3VFMA 4BA8A 4AT6A 5D1XD 4DWHA 1C12A 3PHOA 1X5LA 1KCSL 1FGVH 3MV7B 3WUZA 5EULV 3OTTA 5CEZD 4RISH 3O6MH 2B39A 1R5VB 3L5XH 4FQXC 1MAMH 4MAYD 5GGUA 3CFIC 5IBLD 5IB1A 2AK1L 2X4TA 2Z91A 5CEZH 2H2SC 4OTXL 1Q94B 5D7SH 5BRZA 5BVPH 1KEMH 2O5ZL 3IJHA 4PRIE 3BYYA 1LO5B 4HG4K 4XAKE 2P42B 3IVKB 4NUJB 2GHWB 1JHTB 4BKLB 1R24A 1AHWB 3TBWA 1PEWA 1O7SA 3M07A 4POYA 1WV7T 4RMVA 4OZFA 3N06B 4YO0A 6FABL 1NMAL 4Y2DD 4IJ3C 5HGDA 1U3HA 5FA3A 5F96L 1N59B 1J12A 3WV0A 1W72A 3IKCA 5DK0B 1CGSL 4HMCA 3NTCH 1CI5A 4ELMB 1OHQA 2XTJD 5DHVA 3O4OB 3CMGA 5C0EB 5IMOB 1FAIL 2YD6A 2GK0B 4XXDA 4AENA 3NAAL 5DMKB 1YYLL 1JPGA 3AUVA 3QAZB 1VACB 4HKZB 2WP3T 4ODTH 1NDMB 5DMIH 4WWID 5MEND 2Q7NA 1JTPA 5CEYB 5MP6L 1N7ML 1X9QA 3N1PC 3Q1SH 3AY4C 5IB2B 4JZJC 5D6CA 1WFTA 4PS4H 3MLSH 3P73A 5GGSY 4CKVX 1RMFH 4X6CB 4JRXD 15C8L 1I7TA 4RAUA 3NH7L 3QEHA 3S36L 1A2YA 4DGVH 1T2JA 3O41A 4JM2F 3ILPA 3CMOH 1QHPA 4JGMA 3U4BH 4LPTA 3RBGA 1YPZE 4LRIC 5A16A 1T0MA 3MOAH 1JZ5A 1WCBB 3F5WA 5CILL 4QRQA 1Q9OA 2R0ZH 5D96B 1BQUA 1NCDH 3S37X 2MQCA 1BJ1H 1VGKA 1XF5A 2JE8A 1VFAB 1CIUA 1LO4L 5HHOE 1QG3A 4I18B 1BAFH 1E27B 3VWJC 1FP5A 5FV2A 1E4KA 3P30L 3I84A 1JWUA 3HPLB 5E4EB 3VFWB 5JQHC 4HGWB 2Z4QB 3DETD 3OPZH 3EFFB 3P9MB 1FHGA 1Y0LA 4JDTH 4RDQG 5DLML 2V2TA 1ADQH 4L5FL 3QDME 1U95A 3QIBD 3BGFB 5DWUL 5K59E 4JLRA 3DRTA 3X3GH 3V95A 1NBVH 4HIHB 3QWRD 2DQFA 3T3MF 1LEKB 3PDGA 5F1IA 4E42B 4B50A 4NFDA 3ULUL 2Q1EA 4HJJL 3DIFB 1BIHA 4NBXB 5K33A 2OTWB 2NXYD 4IS6B 1G1YA 4FXLA 4YR6B 4H20H 3PHQB 5CHNB 2PCPA 3GSQA 3HMXH 3D39E 4CMMB 4FP8L 5HHXL 5ESAB 1OW0A 1AXIB 2FLRT 4JEGB 1GGCL 1X4XA 3DO3A 2MJWA 4DUWA 3V6ZB 3EJZD 1DUYB 2OTUA 1JPTL 4OCYH 2VAJA 5I1CL 5C2BH 3CSGA 2R8SH 5GGQH 3HI1B 4HIIB 4QHUB 3BP4B 1BZ7A 4WY7H 5FGCB 3V2AR 4OD1H 3RI5F 5DYOA 3VD7A 4GW1A 5ACMA 5DD5L 3SDXB 1AFVL 4MJID 5HJ3A 3RL1A 3HR6A 1S5IL 3VD5A 1CFQA 2VQTA 3EOTH 1A1MA 1IKNC 3BWUC 2VZTA 3E2HB 4C59B 2CR3A 4L9LB 4HWZA 4K55A 4JQVC 5IGXH 4CJ1A 1S9WA 3B6SA 5D2LF 1KJMA 2R4RH 4PRDB 2XKUA 3MX0A 4P5MA 2W0FB 4CN4A 3RU8L 4ORZC 3QUZD 3HC4L 3OKEA 4DN4H 1FVDA 1JRHL 2D31B 4XH2A 1KCVH 4ZNCD 5E8DL 4AIZB 4KGJA 3MREB 3V5DA 5D1QD 3GMPB 2DWDA 1Z6JT 3EGSA 2XA8L 1G0YR 3WYRA 5LGKA 1RZKH 3V9FA 3PWPD 5JLZA 1DFBH 4QXWA 1DBJL 4R97C 1KCUL 1CDGA 2J8UE 3W0WE 4FFZH 1JPFB 3O4LD 1F3JB 4HLZH 2AKRB 1I7RB 1KTRL 1U93B 2NY3B 5TDPB 3W0WA 1FC2D 3HB3D 4MVBD 3LKQB 4I3SH 4PJCB 4IRZL 4ZUVB 4F7EA 2YK1L 3OAYK 4NQCD 5D5MF 1NCAH 4LCYB 1G7JB 4KKBC 4WI5A 2X4PB 5DTFA 2APWA 1LVEA 4JFFD 4X7DC 5HHMB 1HCFX 4ZFZB 3RDTC 1BX2B 1F8TL 1MHCA 4NRYB 4MQTB 4G9FE 5HI5D 3EDDA 1M05A 4TOYH 3KPRA 3RJDA 5CD5C 1RIVH 3ZKXB 3QUKB 4P46C 4KTDH 5JXEA 5L2KD 3SO3B 2OTPA 1U2CA 1I1YB 3GMNA 5SWZB 2J5LC 3FTGA 2LTQC 4G6AD 3EUUA 3GIVB 3WN5A 1N64L 2DBJA 4YFLI 5FB8B 2NY7H 5HD8D 1Q9KB 2IANA 2JCCA 1C1EL 1MF2L 3WCYA 4NZTH 2X9XA 3SBWA 1RURL 1KLUA 3IF1A 1IFHH 2IPTH 1INEH 3HG1D 3L95A 4PJBA 5GRXG 3FFDA 4PB9H 4FQCL 3LKRB 3OZ9H 3C60B 1TQBC 3QHZH 2W9LA 2PXYD 4HKBB 4X80H 3SKJL 3QDJD 1JZ8A 4TSCH 3D25B 3OQ3B 3P11H 4GG8A 3U4AA 3R4DA 2FYYB 1E4WH 3BJ91 3RBSA 3UTPE 5HGBA 3ARDB 3L7FB 4UT7H 4U1NB 3T4AB 3ARUA 1QKZL 4K94L 5B22A 5TF1L 5H8DA 5C09D 4YHML 3WFBL 3O6FA 5IMMA 4JFZH 3RIFF 3ZTNL 3MJGX 3VXSD 5E2UL 5I73B 2WAHA 2R56H 1GRWA 4OD3L 3L6FB 3L5WB 4IHOB 1UVQB 3MUGA 4LKXB 5IVXA 4HLJA 3UTTE 4ELKB 5L6YH 3BEVB 5I1HH 4WO4B 2VLMD 5BMFH 3CGTA 4KHXL 4PJ8C 2BSTB 1AR2A 4X5LA 5HHVH 3GSNA 3L7EA 3OKOA 2ED7A 3TPKA 3S37H 4F57H 3VFNB 1MCPH 2AV1A 3SPVB 3I6KA 1IGFL 4L8DB 2ITCB 1G7HB 4UQ3A 4HK0B 1MCRA 5EG6C 3MUJA 3U48A 1G7LB 3Q3GA 3QNYA 1RFDH 4Z9KB 1FNSH 5I2IA 3MYZA 4MNQD 4OLWH 5DT1L 1VPOL 3LN9A 2BOCA 1FE8H 4U6VL 4JKLA 1IT9H 3CU1A 4OZIB 5C0AA 3U1SL 4FN0A 2NR6C 3PL6C 3QIUB 4LCCC 5EBWB 3K2MC 4H88H 5HGHB 4R96A 4HC1A 5DK3A 3LEXA 1OSPH 1V3KA 2IMNA 4RDQF 5JR1H 1AD0A 1S5HB 1MWAB 4GMSL 1T5WA 5AYUH 2A6JA 2KZ1B 4MA3B 1DQLL 5D7JC 2ZSWB 4AL8L 3FN3A 5BRZD 5L0QB 1WICA 1P7HL 3W39A 1LNUA 4BH7B 3IRPX 3WEXA 1C16B 1IBGH 3Q5YA 1MCWW 4EJ1C 4WI3A 4F7PA 4LPYA 3QUYC 2GTWA 5GGTA 1HH6A 5KS9B 3ARBB 5AD0A 1A14H 3D2UA 5C0JA 1WLHA 4L8CB 2C7UB 1I8MA 4MD5B 3LN4B 4YAQB 3ZE1F 5IUSA 1Z0MA 5KW9L 1GZQA 5GS0C 4JZOB 4ALAH 5TE4H 4HZLA 3MRMA 5D71H 1NPUA 5I9QB 2R9HD 3WO3B 2DL2A 4KWUA 4G6FB 3KLSA 2VERN 4MB5A 2V5MA 1JMXA 1U92B 2ORBL 5HYFA 1A0QH 4CU6A 4KKAC 2EYRB 1FZOA 3GMOB 3JUZA 2RAMA 1F11A 2J8OA 1FO0L 3WIFA 4XNUH 3SHSA 4HQQL 3STLB 4N1CA 5IBUG 3T8XB 5BV7H 4WNQB 5DVOA 4KJQD 3V79C 1HHKA 2D7QA 3RWEB 3VI3F 5T1DH 2BX5A 4F7MA 5C0GB 1A7NL 5F21B 4GO6B 3R1GH 32C2A 4DZBA 1WT5C 1EZVX 3PWLB 1AGFA 5IKCB 1S7UA 4PB0H 4POZD 4FABH 1CBVH 2XWJA 3OKKB 4EDWH 2CLRB 1YN7B 1QFWH 4KRPD 3LAFA 1FORH 3CVHL 5IMKA 3F65A 5C07E 1SJVA 3SDDA 4WFHD 1GIGH 2EYSB 4S1SL 4OF5A 3KYMA 3LB6D 3KLHC 1F6LL 3C6SA 1HSAA 1YEEH 1J87A 5D7IA 3MRKB 5FYJL 2WLYA 2HFTA 4MD4B 1UCTA 5J6HB 4U3XA 4YXKH 5F44A 1YY9C 2AXGA 3H7BA 5F3BB 4LLQA 1BQHG 4Z7QE 1CLOL 3O3BA 4CVXA 1I85C 1YEKH 3SE9H 2OM5A 4TSBH 4JHWL 3VMOA 3VXMD 3IDYC 4LEOA 4XNYL 4V1DE 2E27H 2Z31C 5H37G 1SYSA 4APQA 2AEIT 2ESVA 1P9MA 2DTML 3VFOA 4IOFC 3C5SA 3N9GL 5KSBB 2A77L 3ARVA 3OKLA 2AXFB 4B53A 2HTKC 4R6UA 5K9QG 3TBYB 4HUVA 5E2JA 3NCMA 2UUDH 1HKLH 4H1LH 1G1CA 3OR6A 4UDTB 2DQTL 1DLHA 1N3NA 2P46B 3HNSL 3QZWG 3O3EA 1T7XA 2BOBA 1T03L 1HCVA 2FD6H 4YBLC 5DJDB 3RAJL 1DN0B 4MS8C 3F7VB 4R7DB 2F19L 2WLZA 4XPGH 1KIQB 4JFPA 1DEEA 1A3LL 1JGLL 2YN3A 3F7PC 4ONGL 3O9WA 4ZXBA 3ESUF 2ZCHL 3EJJX 3DRQB 2PTVA 5I30H 5KN5A 5FA4A 4PG2A 1W0WA 4M62H 5L8JB 3TA3A 5D93B 3UJIL 4CMHC 4ORGA 1TJHL 2FEEI 3BT2H 2XACC 2OI9C 1ZGLA 2QHRH 5B8CA 1BVLB 1OTSD 5E00A 4FZEH 2EE9A 4MZ2A 5KVGL 3VGDA 2PETA 3C2AL 3CDYA 1N6QH 2OJEA 2GT9B 2Y9RT 1NC4A 5I6XB 5D70L 1NUDA 2YRPA 1ZA6B 3UO1L 3FFCA 5IW6A 4Y5YB 1FVEA 1Q0YH 4Z77B 1NCCL 1WC7B 4M1CC 4WW2A 4XXCC 2HRPH 4OT1H 1GGYA 2YPLA 3MV9A 3RZWA 2WBJA 1MLCA 2QQLH 4JY4A 5AZEL 4Z18A 4XPAL 1CICA 1X5GA 5CJQL 4U1HA 1AY1H 4NQEE 2P5EB 4XTRC 1T5XA 4DW2L 3STBA 1U91A 1OQOA 4S2SA 1WFOA 5I1EH 3P4NB 1CD1A 1UZ8A 1CQKA 1OB1B 4AM0A 5JDJA 3I02A 2APVA 3V52H 2BNQE 1MFDL 1A3RL 1B4JH 3B9EA 2IAMB 1LP9E 1FDLL 3SGKA 4RAHA 1S7RA 3BD5A 4FMFA 1S7QA 5JPMB 4YDLB 2FATH 4L3CB 1U8NB 3O2VL 3MRHA 1WBXB 5EU6D 5JOEA 4JM2C 4ZO8A 1LP9A 4F15B 4HD9A 2CDEA 2IADB 4G8FA 2ZUWA 4IOSD 2H2SD 1MHEB 3LV3B 2H2PD 4XP9L 4TUKL 1UWGH 4XVUD 2EE3A 3IDJA 4XCNA 5E4IA 4P2RB 4JCMA 1KELL 2GJZB 3MGTB 3GSOA 1GYAA 1CDYA 4K3JH 5C8JA 1GXEA 3BKCL 4XX1G 1JZ6A 2DMKA 3HS0A 1MCFA 3FO1B 3TC9A 1IAMA 3VXQB 3ARED 4GW4B 3DROB 5EU3A 1EFXD 3LHPL 1C08A 4U7KA 5DJ6B 1BIIA 5MI0C 4PJ9A 3WMSA 5E8NB 1DBAH 3GSUA 1E4XL 3BUTA 4EBQH 4S0TD 4WJ5B 3NCCB 1MNUL 1X5YA 1R3JB 1AQKH 1I7ZB 1BOGB 1UB6B 4O02H 1YY8A 4PD4J 3QUXC 1R5WB 3QFJD 3BSZL 2M2DA 1YNLL 2D2OA 2GAZB 4WU7A 3O3DA 1D3CA 1QD0A 2FSEA 1RUKL 4N9GA 4NP4L 2BERA 1QFWI 4LNVA 3GBML 4D3CL 4UAOB 4WUKL 4OQTL 4WWKB 1D5MA 1OARH 5LWYL 4PJFE 3N1QC 3UTZA 1ZS8B 4PJ7B 3LD8C 4WVRA 4JY5H 1X4ZA 3WS6C 3O6FD 3C6LC 3D0VA 1H3PH 2BRRL 4YXHL 5DXWA 4MQXD 3HR5B 4U1KB 5F9JB 3T1FB 4P3CL 1OAUL 1MFAH 1DLFL 1FBIL 2EDNA 5B3JE 3RWGA 4ZPVA 4JRXE 2HAZA 2XXMB 1MCCA 4JPKH 2FHFA 4R26H 2BNUB 4YDKH 1WF5A 4DAGL 3QJFB 3UZVB 1RJYA 3KR3L 4RFNB 4QXGL 3K74B 4RAVA 2V5RA 1MIEH 2X89A 1DCLA 1UJ3A 5BW7C 4OI9A 1F97A 4MA7L 3EDFA 2A73A 2CDFA 4KI1A 4X0KA 3UTSE 1F00I 1WVZA 3GSNH 3HC3L 4ODUA 3QJHA 3RUGA 4EUPH 5I1IH 5C0CB 4HXBH 4BM7A 3HZKB 3OJDA 2HT3C 3IGAA 5FO7A 3U0PA 4JPVH 3OJ2C 1A7OL 1QBMH 4U4BA 3WFDH 4NHUB 5FF6B 4OFPA 4HFUH 2VDMH 4PJGA 5D2NA 5H2BA 2J12B 2APBA 4O2EA 4JE4B 4Q0XL 4X9HA 3IYLW 2BNRE 4Y4HB 4UNVA 3VXRB 2A6KB 4GKNA 1ZLSL 4U33A 1RZFL 2F54B 4TULL 4OCSL 4PFEA 3ULVF 4UQ2A 2FO1A 3QEUA 3RWIB 4U1LA 4L8SB 5LKNA 3GMMA 3H3PL 3MCG1 4PGJA 4PJHF 2G60L 3QXDA 3FB6B 3MJ7B 1S8DB 3GRWL 4RNRB 1QHOA 3KS0H 3B9VA 5JOPD 1YMHA 3DO7B 1K8IA 3CXDL 1YJDL 3EYSL 3MRCA 1ZVSA 3V6BR 1CD8A 4HUXB 4P4KC 4X98A 2Z93A 2DQCL 1AGCB 3UX9B 3TCLA 1CFNB 4FQHB 3VE0B 4F33B 5DJ2A 1TJIL 1I3RA 1HZHH 1VADB 4GAJL 3D2UD 4OFVA 3QUZB 4KPHL 4DTGH 4Q58C 2Z35B 5C7XL 5GGTH 1IQWH 2NY4C 1WQVT 4Z7WB 2F8XC 3U7WL 4NHCL 5JW5A 5ESVA 5GXBB 5KG9A 4NQSA 3VXPB 1YNKH 3SDCB 2X6MA 4HFWA 4M61A 2CR6A 2J88H 2E7HA 4WUUE 5K9KB 3KYNB 2XPGA 3H9SA 1MRFH 1SBBA 3BGMB 1PY4A 1KG0A 2PW2B 2XWTB 1CXIA 43C9A 3ZKNC 2QSVA 1CE1H 4GT7A 4L4VB 3DV6B 2UZYB 1TZGL 3OKNA 1P84K 5I1GH 5JHLH 5GISH 4NT6A 1KIRB 5AYQA 3T2QA 2DDQL 1K8DB 3HE6A 1TMCB 3S3JA 5E24E 4EXKA 4YHIA 4OM1L 4PJIB 3X14B 3OX8B 1S7VA 4JO2H 3RVTC 1RJLB 2KUTA 3PGFH 2LAGB 4HHAB 1MLBA 2OCFD 3OB8A 4D9RE 4KKBD 1X6NA 4CW1B 3DI2B 4ONHA 4XCEB 1MFNA 5I8OL 4LLVA 2MKLC 2V9TA 1NMAH 4FHBD 3X3FL 1ORSA 4OFYA 3QHTC 3UC0L 4L3EB 1MJ7L 5AG8A 3FMGH 4XT1C 2ZOKB 3ARGA 4Y4KA 4YE4H 3GI9H 3O4LE 1X5AA 2J7LA 3KPPA 3LEYH 5L2KB 3MODH 4HWBH 4X6FB 4I3RL 5TE6L 4QCIB 1FO0A 2FZ3A 3NAAH 3TFKC 5HDLA 5F7HA 5GZOD 3MGOB 4WHYG 5AAWA 4U1SA 4TVPL 2MMXA 4OZHA 1CT8B 2DN7A 4QYOA 1N7MH 4JFFE 4XWGL 2BVQB 3SE3A 3S3SA 4WFFD 3MRRB 4F80A 4OZ4A 3E6HB 3ZYOA 2D3VA 5SWSD 4U1JB 5FKPB 5E5MA 1XZ0A 5C70A 3VMNA 1J8HB 3MLWL 1QNZH 3CVHA 1F58L 5CJBA 5GGRA 1IGYB 3OV6A 2DMCA 1EEYB 4HKXB 3G6AA 3U30C 2DAVA 3KXFB 3VH8G 3WE6B 4NRZB 3UPAA 4OCWL 4D0DA 1FIGL 3ARZA 1JUFB 5KVDH 3MBEB 3BPOB 3VXUB 4HMEA 3I50L 4KH2A 4ZXBD 3O9WD 2B2XL 1ZGLP 3STZB 5FO8B 1KULA 3QXAB 4UU9B 2EO9A 3OKMA 5C08B 3OKDB 5JIKA 3P30H 4RFOL 4X6EA 3L9RB 4NZRH 1NC2B 2Y5TB 4KJWC 2B0SL 4AMKH 2EYTB 3AXLA 3BMVA 4MJ6A 4DK3A 2APFA 1F4YL 3MLUH 1KF9B 2C26A 5CGTA 3ULUD 3A0OA 1JGEA 1G0DA 1U8OA 3BD3A 1MFCL 1BMGA 3V5KA 5TQ2L 3REVA 1UH3A 2P24A 1NC4D 4KHTH 3MA7B 2NW3A 3L5JA 3RVUC 3NIFF 3FFCD 4B41A 4A2MA 5K9JL 2R4SL 1X7QB 4GS7C 1GHFL 2ZCLL 3VFUA 1LGVA 1X5HA 2DL9A 5FM4A 4HAFA 2V17L 2ADIB 3V4VL 3UTQB 4DZ8B 3B5TA 4FP8H 1KYOK 3N1MC 4EEEA 2YPLD 3MV9D 4LVNC 1CK0L 4MJ5B 4BFIB 5KOVC 4Z7UE 1MCSA 4XP5L 4D0CB 3HA0A 1G7PB 3QP3A 2I9TA 3VFMB 4D8PB 5I8CB 4Z7UA 2IGFL 3PHOB 3ZE2E 1PX3A 2R2BA 3NIGE 4TNWK 4RWYL 1M71A 4J4PA 1EVTC 2PW1A 5IB1B 2X4TB 4YXLL 2PYFA 2YA1A 2FO4A 3L1OH 3F62A 1K3IA 3IJHB 5D7JD 5ADOH 2ITDA 1NCBL 1BHGA 4MNQE 2A83A 4HUWA 2FX7H 4KQ3L 1BD2A 5DS8A 1R24B 4RMSA 3TBWB 5GRZA 4PRIB 4RGNC 1NJ9A 1OLLA 5D72L 4LSPH 4OZFB 1M4KA 5F7FA 4YO0B 2Y25A 4AK1A 2HTLD 1S7TA 1YECL 1U3HB 1D9KC 5FA3B 2IH3A 4YX2L 3T0EA 1W72B 1WWBX 5EWIL 4L9DA 1U9KA 4XAWL 5DHVB 4PJ9D 1T20A 5GS0D 3CLEH 4O51A 3B9KA 3WFCL 2NY1C 3MXVH 5F7NC 4XXDB 3O6KH 4M3KB 4PY7A 4LU5H 1EAJA 3KWWA 4K3EL 1T3FB 5T33H 5GS0H 4MLSA 5DVNA 3VFRA 2UUDK 5E2WL 5E6IA 1FVCA 2FGWH 2YK1H 4XBGA 3FOLA 1UEYA 4JDZB 4Z7OF 1A3QA 1MELA 1JK8A 2AQ3A 3P73B 5E03A 3IS1X 1TTFA 4NKDA 4OUOA 1G84A 4RAUB 1JGUL 3QEHB 1A2YB 1QFOA 3MLXL 1ZA3B 3O41B 4NNPL 8CGTA 2NX5E 3ILPB 2VDPH 4LSQL 4PLJC 1BF8A 3OL2A 1EH9A 1RUPL 2QV2A 4LFHD 2E6QA 3LSOA 1RIUH 3VU2A 1RVFL 5A16B 2QKIA 1QSFA 1T0MB 4IRJC 4HH9A 1P53A 1Q9OB 3SY0A 1VGKB 3ZL4H 4PG9A 3KLHD 5KVMC 4JFXA 2YD8A 3U83A 2DQGH 2GJ6D 1CTOA 4HIJB 1QRNA 4YNYA 5EU7C 1HH9B 5DD3L 4PJCF 2EDOA 1RURH 1JWUB 5HHOB 5EUOF 3NFNA 1X5ZA 4J8RA 5CP3A 5HPMB 4XC3H 3NOIA 3OR7B 5IESH 2HMID 2X89D 2M1KA 3VRLE 3KYKH 2I07A 2Z31D 4AH2A 1EMTH 4ZSOA 2AEWA 4JLRB 1YEGH 1KOAA 2Q8BL 1RV6X 5D8JL 2AABL 5F1IB 3G6DH 5I1AA 4EKXA 5E8OA 3QDMB 1MH5A 4HXAH 5F9WB 2X7LB 4FXGA 3DMMA 3MUZ1 5KANI 5ALBL 4L1HA 4RFEA 5E8PA 2UYLA 1NBZA 4Y1AD 1AXSA 4DEPB 2HJLB 2PCPB 3GSQB 4DGYH 3GSRA 1V3JA 4UBDC 2Q6WA 3FT3B 2YUVA 5J12B 1KC5L 4F37F 3D39B 1FQ9C 2WWKT 2IEPA 1BZ7B 3MNWB 2Y4SA 2OMBA 4LQFL 3QEQA 4G9DA 5DYOB 1LWRA 3AM8C 3F7YA 4GW1B 4P2OC 3ABZA 4LSUH 2QADC 4PP2B 1QQDA 5HJ3B 3RL1B 3N1FC 2NXZD 3VFPA 1SJXA 5HYSA 3LS4H 1L7TL 4HWZB 3DWTA 1HXMA 1S9WB 3B6SB 2AGJH 1KJMB 4PJXF 3VRIB 4I1NB 4ZDHB 1CVRA 1ZK9A 4QT5B 4Y0GA 3ECBA 4M6NL 1A7BA 4JN2A 1FVDB 2ED8A 4GRLC 4KK5D 5BXFA 4LCUB 5HI4C 4Z76A 4JY6B 3QUML 3I3DA 1OGAD 4GSDL 4ERSL 2EDJA 1QFHA 2DWDB 1MY5A 3TVMC 3EGSB 5DRXA 5JLZB 3MV11 4PRPA 3HZMA 1M7IB 1WWCA 1ACYL 2WM0A 3S35L 2XRAL 4Z0BL 3GRWA 4LVHB 4K8RD 1UKSA 1QRKA 1KPVA 4UOW1 5ABDE 2YKLL 1TETL 4LIQH 1TVBA 2AJXL 3CFEB 3KPSA 2OR8A 2J8UB 1N8ZA 5DJAA 1UC6A 3W0WB 4K8RH 1SMOA 1DQLH 1J1PH 4KRNA 4OF0A 3HE6D 4DVRL 5I71B 4U1MA 1YEFL 1S9KC 1D7FA 2HH0L 3BX7C 2FBJL 2E8ZA 4NDMB 1AJ7L 3ARYA 3BAEL 4U6HA 4ZOEA 3P4OA 5IM7A 3TNMB 2FJGA 2I24N 1YZZA 5BO1H 4OCNC 2CIIA 4JM2D 1LMKA 4IDJH 5IVOA 3GI8L 2P45B 4JO3L 1IEHA 2JJVA 1M05B 3KPRB 2EXYD 3UPRB 5C0BE 4OZIF 4Y4KD 1QBLL 2F74A 3FHAA 5F93C 4OIIL 4XBPA 1R0AH 3V0VB 4MMXC 4OJFL 3B4NA 5DI8B 4HUNB 5C0BA 4FQ1H 3GMNB 2NY2D 3FTGB 5DZNA 5E94A 2ORBH 3WN5B 5CSZB 2Y7QA 5J9PB 3RY6C 2Z0BA 2IANB 2JCCB 4XC1L 5EU6E 2GCYA 1GSMA 1FO0H 3MACH 3D48R 4FQQA 1AIFA 3H0TA 1PZ5A 4XVTH 3ZT5A 4ZTPH 1B0GA 3L95B 4BQCA 3KS0J 1LE9B 3MA9L 2X70B 3RZCA 5F6IC 3FFDB 4NYLA 5AZ2H 4EI5C 5KS9F 1IAKA 1J10A 1AKJB 2QSQA 4HCRH 4KQ4H 1KT2B 3O2DL 2FB4H 5GSVA 3MCLL 5FYJD 4BQ9A 3CVHH 5HGBB 5CZVH 4B0MM 2OZ4L 1XGYL 2VXQL 4JFOA 5EA0L 1AD9B 4S1SH 1PSKH 3CFDB 4JREB 4N0YH 2VUYA 2FWOA 3ORJA 3ULVC 1T7YA 4L4TA 3TYGL 3CX5K 3NMEA 4G3YH 1XIWB 2CMRL 1INDL 1E6JH 3BN9C 3WJJA 5DRZB 1D6VL 4FFVC 3MUGB 3QFJE 4YH6A 3WNOA 4LLUA 2K9UA 3ARSA 2E7LC 4XNYH 5C9KA 2LFGA 2QR0A 5DO2C 4W4OA 43CAA 3C2SA 5E08H 1VA9A 2Q8AH 3UTTB 2VISA 4PRHD 5D7KD 2JLLA 3OKOB 4QEGA 4JFDE 2WQ8A 3RRQA 2AV1B 2XZCL 1BBJA 3I6KB 5T5FL 3P77A 3WFZA 1OP3K 3PQYA 3KJ4B 3K8KA 2CQVA 4UQ3B 1KJ2B 5LJYH 1DVFD 2DBLL 3KG5A 4LPCA 4KDTC 1D5XB 3Q3GB 3HFML 1DQDL 4OGZA 5I2IB 2NZIA 3RHWK 3HNSH 1A6UH 1T66C 2W59A 5ITBL 1KPRA 3RAJH 2E3VA 1MFBH 4ODHL 5CJOL 3Q6GH 5C0AB 4Y5XC 4GBXC 3W2DL 4M5YL 3ZTJG 2QQQA 2BVEA 4D9LH 2C4XA 2XWBA 4F9LC 4FRWA 1CGVA 5E2TH 5FUZH 4R96B 2O5YH 5DSCA 4WV1A 3LEXB 5IROA 5JNYA 3L3KB 2VLLA 3JTSA 1AD0B 1Z2KA 5I74B 1T5WB 1AE6H 3CFCH 5KSBF 3S5LG 3JV6B 4R4BA 4K7FA 3QQ3B 4ENEC 4F58H 1VFBB 3BP7B 3W39B 1KTLA 1LNUB 5DA4A 3QCUL 4XRCB 1A7RH 4P57A 1CU4H 1SVCP 4P4KD 1BD2D 1HH6B 4TPRH 5D70H 4YDIH 4JFEE 5AD0B 1CXFA 1GGIL 3D2UB 1KUMA 3DXAD 5C0JB 1I8MB 1B2WL 3ARRA 3SGEH 3UYOD 4JFEA 4EXPX 1GZQB 1ZHKA 2DM2A 1GZPA 3V4UH 1YEIL 5C6TH 2NY4D 2RGSA 4NUGL 3B9KD 3CZFA 3LEVL 4P2YA 4JO1H 5CJQH 1PKQE 2FCBA 3OG4B 5JW4R 4HLZG 4GG6A 5J1SC 3P0YL 1EX0A 1RIHH 1IEBB 1PKQA 4JZNA 5E6ID 5EOCL 5MHSE 3GUTB 4P5TA 5I1JH 1IC1A 4M7KH 2VOTA 3RY4A 5C3TA 1T89A 2ID5A 3TN0D 3ZKND 3IDIA 3O2VH 2R29L 5C0NC 1O5DT 5EU5A 4F7MB 1IKNA 32C2B 3SKUD 2CO6B 2CRMA 4TUKH 3UYRH 1CGXA 2OQJA 1XR8B 2ZPKH 1K2DA 1S7UB 4LHUB 4M9OA 4P9ML 1F6AA 3FO9A 4GXVL 1OCWH 3GB7A 1H3XA 3O4OC 4S11A 1QSFD 5IMKB 4O2FA 3MJ6A 3O8XD 3SDDB 4X7SL 5SWQB 3EDEA 5F7YC 1L4IA 4PRBA 3QAZC 3C6SB 1HSAB 3GIZH 3DSFL 5C07B 4M8QA 1DBBL 1DQML 1YA5A 4QHMA 1DN2A 1JWSA 2AXGB 1ZHNA 1AO7D 3H7BB 4LLQB 1QRND 4OF8A 4PGCA 3FHQA 1NAMB 2EIZA 4G80A 4CVXB 3G6JE 4FFWD 2LQRA 2ICCA 5C0RH 4QOKA 1QSEA 2UZIL 1CDCA 3HNVH 1QA9A 3IDNA 4LEOB 2DLFL 1UA6H 2Q76A 4YC2B 5J6GA 3TV3L 4Y16C 4APQB 2ESVB 4WIQA 4OV6F 3VD3A 1T22A 3BSZH 3C5SB 4V1DB 4R90H 3HI5L 3UAJC 5JOFB 4AQOA 4X99B 3C08L 5KZCD 5D96C 4HUVB 3CFKA 3A67H 2R2HA 3TWCH 3CUPB 1IAIL 5I8EA 1I8KA 4GQ9L 3OR6B 2Y72A 3LKOB 1IEAB 1LK2A 1DLHB 1N3NB 5CP7A 4GXUM 5CINL 2JJSC 1FYTD 2BOBB 4OD2A 1XGQA 4KTEL 1AGEA 5GZND 3X13A 2VRAA 3OHXB 1JN6B 1IM9B 1OGTA 3JVGC 3MRLB 3SE8L 5I75C 3CVIH 1ZXQA 1DEEB 1MUJA 5CIPA 3SCMA 1CD9B 1G7MA 2NY0C 4BQBA 5D7LA 4P3CH 4QXUH 1OAUH 3C09B 4WFFE 4X7TB 4PR5B 2LU4A 3BGFC 3IFPA 5KN5B 1W0WB 5A3IC 3TA3B 4OCRL 4FTVD 3MXWH 4L29B 2XZAL 5L9DL 3KJ6H 4JPWH 3Q2CA 4LSSH 4ORGB 1EXUA 3DGGA 1YMMA 4XZUB 4E41E 1ZGLB 1J18A 5E00B 1L7IL 4N0FA 5DJ8A 35C8H 4AQ1B 3NPZB 1OSZA 3TBVA 4E41A 2GITB 3RVXD 3L3IA 3C5ZA 3MV8E 2OJEB 3AVEA 4FQJH 1NCTA 3CXHK 3OXSA 4KUCD 3ILQD 4Q9RH 3D5OF 3MNZB 4PJ7F 2Y06H 1WZLA 4G8IA 4TRPL 5IW6B 1TLKA 1J1OH 2UVEA 4NO2A 5EN2A 3BQUD 4PJAE 3HUJE 3IJSA 3EO0B 2AEPL 4WW2B 4OLUH 1LEGA 1IGML 5IP4A 1ZLSH 1VESA 3TNNA 5FGBC 1BQLH 4QNPE 2YPLB 5JQ6H 2WBJB 1MLCB 5JW4Q 3MFGB 1FN4A 2MPAL 4OCSH 3BO8A 1CICB 4LSTL 4U1HB 4MD0A 5FHAL 3MCKA 1U91B 3MBXH 2YD4A 3H3PH 1CD1B 3TO4A 3LKPB 1EEZA 1A4JA 3BP5A 4UT9L 4AM0B 1XT5A 3I02B 1H8NA 3GRWH 4NQEB 4YFEA 1YEHL 1S7RB 3QG7L 4I2XE 3RPIA 3CXDH 1YJDH 3VXOA 2CRYA 1MWAL 2NTFB 1MCHA 3MRHB 1OAZL 2BNQB 1CL7L 5ALCL 4PJ8A 1LP9B 4H8WH 4K71C 2CDEB 4MX7A 4HWEH 1FFQA 3QUMA 3WHXA 3MR9A 3DYPA 4HBCH 2HWZH 1P7KB 1QLEL 4NRXA 4CL7A 4PREB 3N85L 3T0BA 1SHMA 1GPOH 3IDJB 4XCNB 3F12A 4LVOB 3OAZK 4YDJA 3SGEI 4ODVL 1D5ZA 1UM6H 3FOMB 4HPOL 1U8HB 3BD4A 3QCVH 4NHCH 2GKIA 1FL5A 4OZFG 3KLAA 3SKMA 4RGND 5T3ZL 3D9AH 3HS0B 1OPGH 2HYMA 1NL0L 4EIGB 3HMWH 4UV4H 1OAYL 1U8PB 1BIIB 2DQUL 5CGYC 1FIEA 4DKFL 5DHXB 3QO1B 3GSUB 1SJHB 4HIXL 1CYGA 1NEZA 3TZVC 3OSKA 1EK3A 1XCQA 1MCBA 3OKYA 2E5EA 1JNLH 1U8LA 3WS3B 3RZCD 1D5BB 2N1KA 2HKHH 4OM1H 4X4YB 3QWOA 4WU7B 5CUSL 2DQHH 4N9GB 4UILL 3SN6N 4OIBA 1JHTA 5KVFL 2OR9L 4GRWH 5TDNB 5LXGL 1AHWA 3MLRL 3RPKA 4TNVF 4Z7WF 4R4FL 5AUMB 2HFGH 2ZUQC 1L0XA 1CDIA 1PLGL 2WWMD 1D5MB 2C3XA 1N59A 3FRUB 1RPQA 2HKFH 1AI1H 3UTZB 1F90L 3ZDYF 4MNGE 3SQBA 5ILTH 4L4TD 5CMAB 1U42A 4ELMA 2HLFC 1PJ9A 4BZ2H 4TVPD 4FNLL 1E4XI 4IRJD 3EYQD 3QHFL 4I3RH 4MNGA 4AEHL 4HBQA 1PW3A 1C5BL 2BVPB 4HKZA 4TVPH 1CS6A 2LE9A 4OGXH 3RWGB 2OL3L 1OF2A 5CEYA 2AEQH 1LHZA 5HDOA 1NFDE 1U3JA 1HN1A 5IB2A 2VDKL 3FN0L 4NQDD 5HBBA 3IETB 4P9HL 1BF2A 3SGJA 2XG5A 3QNXA 2CLZB 1KXVC 4OGYL 4WHDA 1RJYB 2YC1A 4X6CA 5EZOH 3ARDC 4M7LH 2Q20A 1AGDB 1WISA 3O2DA 1UJ3B 4NSKA 3IXTA 3PQYD 1I4FB 2A73B 2CDFB 4X0KB 2F15A 4R8WL 1MRDH 4M7JL 4I48A 3S88L 4ONOA 3FAXA 3QJHB 3IAQA 2OZ4A 4PY8J 1WT5A 5F9DC 3OJDB 2R69L 3U0PB 4D2NA 3KPNB 5I73C 2VXVH 4J3VA 4KI5D 3OGCA 3UTSB 1NLDL 3QB7C 1E28B 3QDGA 5H2BB 2DQIH 3RFZC 1M1SA 4O2EB 2UY7A 1P4BL 1MPAL 4OCWH 2GJ6E 3TIDA 3B2UD 4ZUUB 5TPWL 1CXLA 2GIYA 4WO4C 5CLTA 5TE7L 4DGIH 1UH2A 1URLA 3ARXA 3FZUC 1BBDL 2BNRB 4ZO7A 3TT1L 4NM4L 3EBAA 1F3DH 4UQ2B 4U1LB 3M8OL 3GMMB 4E0RA 4QHKJ 4RFOH 2FEDC 1KBGH 3VFWA 2B0SH 4HGWA 2Z4QA 5KTEH 3BOVA 3HE7B 3ZE0F 1MJ8H 3EKCA 4MZ3A 1YMHB 1K8IB 3DVGB 2VWEC 3S34L 4JB9H 5I18L 4DUXA 4ZAKC 2Z93B 4HIHA 3TCLB 1LEKA 1OAKL 5DJ2B 2V5SA 1A6AA 3BGAA 4G8GD 4XBEH 1I3RB 3KGRA 5K9JH 2OTWA 4PJ5E 4JR9L 4M93B 5CHNA 5A1AA 4MHHI 4G6JH 3AS2A 1XGUA 1WBZA 4OLVL 2VN4A 1I1RA 5JW5B 3KNBB 5DFWH 5DVLA 5ESVB 3U2SA 2EH7L 1FSKB 4GW5A 3MLTA 1DUYA 3V6ZA 4NQSB 4EDXB 5ISZD 1TDQA 5T3XL 3HI1A 4UT6H 4QHUA 1NBYA 3RJQB 3TVMD 2EH8H 4AYFA 2H1PH 3OJVC 5IW1B 1G6RH 2XPGB 1T7ZA 3RTQC 3H9SB 1JBJA 5L0QC 1KG0B 4RMTA 4O58L 3VD4A 3NCJL 3K4AA 3H42L 43C9B 3P0GB 4XPHH 5GGRY 4WUUB 1JF5A 4I0PD 1HE7A 3OKNB 3NGBB 4PRDA 1TFHA 4KMTL 4PP1C 2W0FA 5GSRB 4QGYA 3QG6A 2X1PA 3RKPA 1MI5E 1UM5L 1S7VB 1NSNL 4IMKA 1MLBB 3QA3A 3LMJH 5TF0A 1Z9SA 1KB9J 4ONHB 5HPOA 2P8PA 4NWTH 1N6VA 5GJSL 3VGAC 4WCYL 2ENSA 4Y2OA 3RKDC 2YS4A 3THML 3WNKA 2C1PB 3ARGB 5EWIH 3RI5K 2B5IB 1RUQH 3KPPB 3SDYL 4XXCA 1HKFA 3ALWA 3LY6A 4B7IA 4GLRH 3PV7A 3MRPA 1ZLVH 3WXWH 2FZ3B 3VW3L 1N6UA 1IGTB 1F3JA 3W11C 3UDWC 2C3HA 4QOKD 1I7RA 3RNQA 3HNTL 4NKIL 4OZHB 2ED9A 4MA8L 4NC0B 4BZ1H 4QRPA 1MQKH 1RZ7L 5E2WH 4DUVA 2CKBH 5FYJU 5HHNA 3MFFB 4NM8L 4HGKC 4OB5H 4OZ4B 2I9LA 4R2GC 1ZLWH 4M00A 5E5MB 1XZ0B 5CZXD 2HRLA 1IKFL 3GHBL 1JGUH 4ZFZA 1BWWA 1K6QH 1JNNL 1M7DA 2X2YA 2FX8H 4U0RB 1RVFH 3G6AB 3LS5L 5F7WC 4EZMA 4M4PA 3UXFA 4Y7MA 4GXUN 5LBSL 1I1YA 1A6WL 2A9NL 3P3YA 5SWZA 4JPIB 2R15A 1HIML 4HS3A 4OUUB 4IEFB 3GIVA 3BN3B 4K23H 4WEBH 3TCXA 4G42A 2D7TH 3SOBH 1Q9KA 4OZGA 1QLFA 3SJVD 4Z0XB 3U0WH 1LO2H 3OKMB 5I19L 5CIPH 5HGAA 1KJ3L 1LO0H 5JTWA 2H32H 1YMMD 3AXLB 2FJHB 4R4ND 4MJ6B 3EJYC 1J0KA 1S9VB 1DEDA 3T3ME 4TNWF 4NN5B 3LQAC 3QQ9C 1JGEB 3LKRA 1CGWA 1U8OB 1OL0A 3BMWA 5DO2D 2YEZA 3C5ZD 3QUXA 4HKBA 4O4YL 1EIBA 3REVB 3X12B 5D8JH 2F58L 1KJVA 3FB5A 1JP5A 2F53A 1OD9A 5F89A 2ZJSL 2GJJA 3A6BL 3VGHA 4ZNEA 1UM4L 5GS1A 3GKZA 2BXZA 3TBSA 1JGVL 3VCLA 3LIZL 2ZUUA 1IC4L 5DGRA 5D93C 3D1MC 5ITFB 2VLJD 1WAAA 2I9TB 3MGAA 3CK0L 3WJLA 3HRPA 4LKXA 4Z7UB 3TO4D 4PRHE 5KJRL 2AJYL 1EJOH 2R2BB 1WTGT 5D2LE 5EC2B 4QGTA 2BSTA 5DFVD 5GGVL 3TM6A 5I6XC 1SEQL 3RGVC 5GHWL 1L7TH 1YYMH 2PW1B 3BZ4A 3VA2C 1IC5L 4Y4FA 1QVOB 2FO4B 1H3UA 1HK6A 2ITCA 1G7HA 4JHAL 4HK0A 2ITDB 2J8HA 2NYYC 1ZLUH 1SBSL 4HUWB 2C3VA 1MVFA 5DS8B 1CR9H 1TZIB 1NJ9B 5I8KH 4YHLH 1KTKE 1UYWH 3T1WA 1IARB 1S7TB 4K7PL 4S10A 3T0EB 3VJ6A 5D1ZA 1A64A 4HJGA 1CLYH 5DMGC 2GUOA 1UZ6F 5EBWA 3V6FA 3MV7D 3FO0H 2DKUA 4YDLC 3GMRA 4G43A 3BVNB 4MAYC 2CDGB 4V2BA 1JIBA 1S5HA 4F15C 3JV4A 1MWAA 1MREH 4N5UA 5IIEB 2XG4A 4C56E 3VFRB 2OMNA 2BK8A 2Y36H 3VGEA 1FVCB 4J1UA 4YIQA 2P44B 1YEFH 3BJLA 1UG9A 3MRFB 5EZIL 3D6GA 4XBGB 2YZ1A 4K2UH 3DXAE 3M17B 3BAEH 2BDNL 4RMQA 3ARBA 1XGRA 2VNCA 2NTSP 2J1KA 4L8CA 2DICA 2C7UA 1UADC 3L3OB 3GI8H 4MD5A 4YAQA 4PGDA 2PF6A 4OI8A 3LSOB 1FL6A 2XTJC 1X5IA 2QKIB 3L3GB 2VXTL 2NNAA 4KAQL 3OMZA 4RGOH 3B83A 3EOYG 1QYGH 4PIRF 2DMBA 4GLRI 3VFGL 3PABA 5GJTH 1ZHBB 3I9GH 1RUMH 4PLKC 5IJVA 1U92A 4PG9B 5E99L 2EYRA 4U49A 2DKSA 1QRNB 5CS7A 5EO0A 3GO1H 2AJUH 4X6DA 1SEBB 2D7NA 2AP2A 2WW8A 4J8RB 3RWEA 5I1KH 4J2XA 4XI5C 4W6YB 3BPLC 4NC1C 4Z5RA 5C0GA 3EHBD 2GYSA 3HKFA 3JXAA 2I07B 5HYIA 4AH2B 2DJUA 3PWLA 3T0DA 3REWB 2D4FA 3IXAB 1A6VL 2AERT 1ND0A 4H0IA 1YN7A 4RZCB 3MRDA 5F1OB 4GAGH 3DMMB 1V7ML 4RFEB 2J4WL 1A7QL 2UYLB 1NBZB 4NZUL 3MNVB 1AO7E 3QDAA 4BSVA 1QR4A 3MRKA 5AWNL 5B38B 4MD4A 3TYGH 4JRYA 2Q6WB 2PYEA 2B4CH 5F3BA 1GAFH 1MEXH 5DJ0B 2JCCF 4KMLB 2P5WA 2OL3A 1OT2A 4CRPA 1I9RH 3DETC 5F6HI 3QEQB 4WTXA 3F7YB 3SQOH 4UV7L 5F97E 1I9JL 4XP4L 2OK0H 1F13A 1UXWB 5FCUL 3QRGL 3IFLH 2DI9A 2QLVB 3MRBA 4PJBF 1AGBA 3OJMB 3VFPB 4YHOH 4HK3J 5HYSB 5LG1A 3WIIH 2AXFA 2VXUL 4HT1H 4F3FA 2XZCH 5K9QI 1LO3L 4Y19A 2VXSH 4GKSB 3CC5A 1JVKA 5LQBH 1J0IA 2DQJH 3ECBB 1FYTE 4JN2B 4Z76B 4UDTA 2I5YL 3HFMH 2IPUK 3EJZC 4YGAB 4MYWB 4UB0H 4WI2A 1BEYL 1FFPA 1F4XH 4IRSB 1DTUA 5DJDA 4L8SC 5DRXB 1DN0A 2DWEB 4LOUD 2G5BA 4XWOD 1OP9A 2E9IA 5BS0E 1EDQA 4PRPB 1Q8MA 3DUUA 2VC2L 3W2DH 4FTVE 4OBSA 4L8BA 5IVXF 2NY5H 3SDAA 3DRQA 3TLRA 1W0VB 3BKML 5FYLD 1TVBB 3KPSB 3J8F7 4XNQB 1NDGA 5JIPA 1N8ZB 1CF8L 1QR1A 4JFHD 3HAEB 5DUML 1BFTA 3O81A 2CJUH 1JCKA 1U3YA 2CXKA 3QUZC 4LKCA 3GHEL 5FYLH 1MQ8A 3K2UH 4KDWA 4WFGE 4CVUA 3ZE1E 4DFIA 4Y5VB 4FFYH 1ZA6A 1KIUA 2CIIB 3UJTH 4Y5YA 2XA3A 3NPSB 2V2WA 4MXWL 1WC7A 3KPQB 3DLQR 4YEEA 5DUPL 1SM3H 2XOTA 4YPGA 2VAAB 3ARFB 1YEJH 1MVUA 3SO5A 4U0QB 4BZYA 1X5JA 5CKGA 4XCFL 5C0BB 1Y6KR 4XPTL 4X5WA 3UBXA 3MTRA 3HC0A 3HB3C 4MVBC 2NY3D 1LDSA 1MSPA 5DQDL 3VI3E 1F3DJ 4QRPD 1QLRA 1RZ8A 1QO3B 4M8VA 2IAMA 2JIXB 3ALPA 4FQQB 1AIFB 5JPMA 3H0TB 1EUTA 2X40A 1U8NA 2X44D 3GKWL 4JQXC 1BP3B 3CU7A 3NCBB 3FO2A 4FQXB 2O93L 2XI9A 3TP4A 3MRNA 1E6OH 2R0LL 5HHMD 1J0HA 1B0RB 1IAKB 1EBPA 3KPLB 3GBLA 4UIKL 1ZWIA 4F7CB 2KKQA 4RGNE 1ZEAL 5GSVB 4HK3N 1RULL 1EERB 4N8VA 2V5YA 2XQBL 2GSGA 2ZNWA 5HDBF 1P1ZA 1T6WA 2EZ0D 2EDLA 3RHWF 1UH4A 5SWZD 4LARH 2EC8A 1NLBH 4GW4A 5HD8C 3DSFH 5GPRA 4IJ3B 2E7CA 4JN1L 1D9KA 2D03L 4ZMAT 4W81A 5DGQA 4JVPA 4YHZL 5E8NA 2AJSH 4GJTB 1F4WH 2XN9E 2LVEA 4F2MA 1BOGA 1XF3B 3QCTL 4NGHL 3UPCA 2QR0B 3LZFL 3TV3H 2AI0L 2ZKHL 25C8H 4FXKA 5IT2L 43CAB 2WUBL 3CH1A 3C60D 2VISB 1IAOA 1VENA 4M43H 2EDQA 3WHE1 3HI5H 2XZZA 4JZJB 3C08H 4ISVB 2FX9H 2F53D 3P77B 2O5XL 4BFGA 5HHPB 1VEPA 3ARDD 4JFDB 4NCDA 2BRQA 4QHNA 4WWKA 3MBEC 3QBTB 2HG5A 1IAIH 1AH1A 1I8LC 1EV2E 5CSGA 2UVFA 4GQ9H 4KVCH 4HS6A 1KEGH 4NJAH 5D7IF 3TJHC 3BI9X 5IHUL 1KPRB 1G9ML 4N0UE 2IQAA 2ADFH 4I9WD 3AC0A 1QSVA 4KZDL 2YR3A 4I4WA 4R3SA 1PKOA 4X9IA 3R8BB 2IC2A 4NQDE 5EU7E 4X4ME 2CK0H 1N2RA 4X4XA 4WO4D 3WIHL 4Z7QF 5DSCB 1T80A 5JNYB 3FZUD 5DC4B 1AR1D 1UJTA 2VLLB 2XZAH 3JTSB 4YDVB 3VWJB 3D3VE 4WGWB 2BNUA 1Z3GH 4OCXL 5L7XL 3VXNA 4R4BB 1GC1L 1R3KA 2FEDD 5IHZA 5BJTB 4TQEL 1HOCA 2VDLL 4Y8AA 5DEGA 1KTLB 3WD5H 1VB9A 3VGFA 2G9HA 1T7VA 1OLZA 2R0WH 3MO1A 5FF6A 1I9IH 4CDGC 1UWXK 3KHOA 3CDFA 2YMXH 5IOPA 4S1DD 5CBEA 4Y4HA 2X4UB 3GNML 3MLZL 4JFEB 3VXRA 1NCWL 1ZHKB 2A6KA 4Q6IC 1GZPB 3MZGB 4NKQB 3M45A 1BM3H 5J06A 3QIUD 2QQNL 2F54A 4DK6A 4YWGH 3VDAA 3CLFH 1GGBL 3WSQL 4LSTH 5CGMA 2E9BA 1ZLWK 3RWIA 3KPMB 3V8CA 4UINH 4TSAL 3V5HB 2ZCKL 3OWEA 4XB7A 5LCVL 3FB6A 1S8DA 5I0ZA 1PKQB 3AM8A 1CFVH 4JZNB 4AY0A 1ZANL 3LQZA 3FRPA 4P2OA 4P5TB 1YEHH 4HPYL 3ULUF 4G8GE 3BXNB 3AAZA 4LRNH 4K3GA 3WHE0 4HUXA 4DQOH 1FRGH 3GJFA 3IDIB 2XKNA 4O9HL 2B1AL 1AGCA 4N8CH 5EU5B 3VE0A 3ARBD 2DQDL 5IQ7H 1IGIL 4AJ0A 1U3HC 3WUWA 1A22B 3BWAB 4LEXL 2OQJB 5EORL 3N85H 2VH5H 1OAQH 5ISZE 1F6AB 3FO9B 4BFBD 4ESKA 4ODVH 1C7TA 1IGCH 4NFCA 4YBHA 4WW2F 2R9HC 4HPOH 3WKMH 3QXWA 5DHYA 2A1WL 4U1GB 1R3IL 1NGPH 2CGRL 4PRBB 1MHPH 5DJXA 4G6FD 5B39A 1NL0H 3DVFA 5FDWB 1WK0A 4QHMB 4ODSL 1B90A 1JWSB 4WDIB 4XCCH 1ZHNB 3BPNB 5ERWB 1HEZB 2PW2A 2XWTA 4KJQC 4HIXH 4R97B 1TJGH 2EIZB 1LDPL 4DOHE 1DBKH 3JWOL 5CWSB 2Z8SA 4ZFFB 4FQIL 4QOKB 4I0KA 1QSEB 1QA9B 4P59H 4RSVA 1KXTB 1T6VN 2P1YA 3G6JB 5F70A 1K8DA 2V5TA 4P49A 3NFPB 4POZC 5IWLA 2W1NA 3ZDXF 5T1LA 4NKMA 4UILH 4KRPC 4ACPA 1CGTA 2NQCA 1KN2H 4HHAA 1V5JA 4M5ZL 1S3KL 5MEPA 4CW1A 5LXGH 1II4E 4M6OH 4ZPTB 3GSVA 2HT4D 3LB6C 2R2HB 2EIBA 5L88L 5I8EB 3RDTB 3JZ7A 1BQSA 1LK2B 4L3EA 4CGTA 3GBNH 1TQCB 3WFEH 1CVSC 2NY6D 1E4KC 1KFAL 3QEGL 3X13B 3DUSA 4QRTA 4YJZL 2YD1A 1NGQL 4PRNA 4P46B 3HLAB 3QHFH 1OGTB 3SCMB 3I2CH 2PR4H 1G7MB 3EZ8A 3MGOA 5D7LB 3NFSH 2J5LB 1HHGA 5LAXB 4KK8C 3MUY1 3HZYB 1R3HA 3MLYL 1CT8A 1N26A 2A6DA 2ARWA 2EDHA 3IFPB 2FJFA 5C9JB 2BVQA 4XGZB 5ECJE 3T2NL 5DD1L 1YMMB 5I1DB 3TGXA 4OM0H 4N0FB 2I60L 3B5HA 3DTXA 3FQNA 4Y19D 3EJYD 2JJUA 4R8WH 2IH1B 3MROA 1S9XA 3S88H 4E41B 1IAII 3L3IB 3ZT7A 3QQ9D 4EI5A 1KGCD 2VDNL 1RZJC 2R69H 1TQBB 1EEYA 1UB5A 3OXSB 4DFHA 2DTSA 3R06A 4ZFOL 4G8IB 1KJ2L 3AMLA 4HS8H 3MV8B 2C9AA 3LQAH 5EN2B 4NRZA 2JB5L 1WZ1L 3ULVE 2YWYA 1LEGB 3SJVE 3OXRB 3PP3H 3LKSA 1HXYA 1S7XA 3GK8L 5J89A 3HUJB 4KKNA 2MHAA 1FN4B 3PJSB 5JMOC 4M6MH 4F8TA 5FO8A 1BGXL 1ERNA 4UU9A 4FOMA 3MCKB 4IIQC 5HHQB 1K9TA 1OTSC 5HVHC 5IB5B 3PNWB 1NC2A 3TO4B 1A4JB 3BP5B 1HDMB 2MCPH 1P7QB 5EOQL 5FUOL 4LAQL 5F1NB 2Z92B 4GMTL 3O0RL 3RUGF 2BY1A 4PJ8B 4MX7B 4G7VH 4I2XB 3C9NA 5IF0A 3QUMB 3WHXB 2W9DH 3MR9B 1SJEB 4NRXB 2YHGA 4ZD3L 1WCQA 1R5IB 4BJLA 1X7QA 3EO9H 4AZ8A 4PJGF 3F12B 4JR9H 5IB4A 4HDIA 3FAWA 4YDJB 3QQNA 5T3XD 4GKOA 2VLJE 3U9PL 3RA7L 1D5ZB 3UTQA 4DZ8A 8FABB 1UCBL 5HTSA 4LVHC 5BOZG 2AK4E 3U46B 1FL5B 3IFNH 4MJ5A 4BFIA 1JZ7A 2FHCA 3R8QA 4D0CA 4KUZH 1DDHB 4HG4J 1JTOA 1YUHB 2P5ED 4JG0H 4NQUA 4P2QA 4D8PA 2GSIB 1JYXA 5I8CA 4LCWE 1PQZA 4LASL 3T2OA 5DMGD 4Y5XA 2QQKL 4O58H 4YUEH 1NEZB 2IAMD 4LCCB 1XCQB 4LSVL 4X4ZA 4KKLD 1CXEA 1U8LB 5DEFA 1IE5A 2H2PC 3UJJL 3AS3A 4F7TB 4XVUC 3U36B 3IU4L 4KMTH 1R3LB 5EFIA 3DBXB 5JPNB 2IG2L 3QWOB 4I77H 2J6EL 5F7DA 4P2RD 1XF4A 3CDCA 5JXEC 4PRIA 1VGEL 3E8UH 3QUYB 3QQ4A 4FQ2H 1JGDB 4K9EH 1MIMH 3AREC 1ZVYA 3VFTB 4AEFA 2VMFA 1BVKA 5LGJA 2WUCL 1V3MA 5LGHL 1H3TA 2ZUYA 1J11A 2CXGA 2EEDA 3SBWC 1MCNA 3B5GA 3T77B 4MNGB 1FH5L 1L6ZA 3DPBA 1WTLA 3I85A 2Y07H 1T3FA 4PLKD 3MUHL 3HNTH 3K7UA 4NKIH 4PUBL 4XMPL 1NAML 1OF2B 1QFUL 2G75B 5I17B 2IFFL 4XP1L 4I5BA 1U6AL 3VI4F 3QNXB 4JDZA 5DRWA 2YC1B 4OSUH 4XX1E 5DK2A 4NSKB 1NFDB 4XI5D 1OM3L 1HYSC 2AV7A 3IXTB 1U0QA 5CCKH 4QRRE 1ZA3A 4I48B 1A6PA 4WWKD 3O6FC 1T4KB 3DI3B 4ETQA 3OGCB 1PG7W 4PJDE 2ICWJ 2IFGA 3C8HA 3QDGB 4MQXC 1T1XB 3PP4L 3QFDA 1YPZA 3WXVH 2BC4A 3TIDB 1A6WH 4XVJL 4PJDA 1NUNB 3NZHL 3V7AG 1REIA 1IZKA 4HIJA 4U1IB 4OZHF 1T0NB 1C5CL 4LF3A 4N5ED 1HH9A 1KV3A 1OP5K 5HHOA 4E0RB 1KJ3H 5KVEL 5HPMA 3VWKA 4KJYB 3OR7A 4PRAB 1EGJL 2SEBB 2AJVL 3IDYB 3ZDZF 4ZS7H 5HYSG 4Y16A 3FL7A 5C0CD 2VDOL 2WIMA 1EEUA 1A6AB 3C87A 3QDMA 2X7LA 1WBYA 4XVSH 4H5SA 4IBLT 1RHHA 3QPXH 3BW9B 3BKJH 3V0WH 2HJLA 4Y4HD 3VXRD 1XGUB 4MHHG 1WBZB 1JHLH 1H0DA 1FG9C 4PPTA 3VG9B 2R0KH 3U2SB 4GW5B 4PJ5B 3MLTB 2F54D 3FT3A 2CSPA 3B2VL 5I76B 1O0VA 1SY6H 2DD8H 3D39A 4XP6L 3WIHA 1NBYB 1G9NL 4MXQC 3MNWA 5C0FA 2CRIA 1CXKA 1N0XL 3ZTJH 1BFOB 3RWJB 1RU9L 3JWDC 1KSRA 4KU1A 4PP2A 3VG0H 3BZFA 1N5YL 4NZDA 3O6LL 4FQLL 4WFED 5GGVH 4ZTOL 1KNOB 1KTDB 3U79A 5DUBB 5JUEH 4CMHB 2UV3A 2VLRE 3VRIA 4ZDHA 4AIXA 3L3HA 3QG6B 4QT5A 3HHRB 4XHQA 1NKRA 4XNXL 2B8OT 4LCUA 1NBQA 1JMZA 3QA3B 4JY6A 5GGSA 1MI5B 1Q0XH 2P8PB 5FGCE 5DDHA 3TT3H 2DQEL 4NN6B 2Q86A 4KY1H 2VDQH 3SDCD 5BZDA 4F37K 1U8JA 4K7PH 2H45A 1JYWA 1CDBA 4ZUTA 1XMWA 4HUUA 1M7IA 2M8XA 1FGVL 2IPUG 1IGJA 4NC2B 1MCEA 4JFHE 3HN3A 1I7UA 1FPTH 3LRGA 3Q0HA 3MRPB 4NQTA 3P2TA 4KK6D 3CFEA 1CG9A 5CJ5A 5DMJB 1MAML 3EW3B 3RNQB 2J8UA 4L4VD 3A6CH 2RHEA 5IVNA 4Z7OE 5CEZL 4QRPB 2P8MA 1XF1A 3LVEA 1LK3H 3MYJB 1XAUA 5D7SL 1ZTXH 5DRNA 5BVPL 1KEML 5HHNB 4UTAH 4WTZA 4P23A 4NDMA 2JB6A 4X6BA 2I9LB 1I8IB 2DYPA 3RWFA 2EDWA 5CFHA 1YC8A 3SDDC 3TNMA 1Z0NA 4OFDA 4YBQD 1M7DB 1H15A 1EHXA 3UPRA 2EDXA 2YXFA 3FJTA 4L3ED 2YN5A 3NTCL 1JTTA 4G9FA 3V0VA 5DI8A 2W92A 5DD0H 4PGBB 5GZOC 2VN7A 4PJCE 4HS3B 4MQSB 4YC2C 5EUOE 5CSZA 5INDA 3M1BB 4APQC 5J9PA 1P9MC 4G42B 5DMIL 4OZGB 3W82A 1QLFB 2EE2A 2WANA 5MI0B 3Q1SL 3S8WA 2VUOA 5HGAB 5HHME 4PS4L 3MLSL 4XHJD 5HYJE 1RMFL 1LE9A 4KROB 2X70A 5J1TC 2C1OB 5BZWA 1J8HD 4DGVL 1AKJA 3H7LA 5HYJA 2YEZB 5ADPH 3QUXB 5K93A 4JO4H 1KT2A 4DKEH 1KJVB 3MV01 3FB5B 3GMQB 2F53B 5F89B 1OWRM 5DD6A 4E5XA 3MOAL 1V7MH 3KXFD 4OLYH 5GS1B 1AD9A 4U7MA 3CFDA 1NCDL 3FQWB 4JQIH 3TBSB 4ZXBC 3O9WC 3MBED 3C09C 3VXUD 3VCLB 3D0LA 1INQB 4MCYB 4PJEF 1XIWA 1MCOH 1JPSH 3MRJA 3TJHD 1X3DA 5DRZA 5JXAL 5C08D 3C6LB 1JI1A 3RP1A 5B8CC 3GSWB 2UY6A 1NC2D 1XEDA 3ULUC 1I9JH 1WEJH 2OLDA 3OPZL 4Y88A 5FCUH 1DZBA 1GGUA 4JDTL 4PJXE 5DZLA 1F02I 4D94A