3O6KL

Crystal structure of anti-tat hiv fab'11h6h1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSGQSLLYSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
molecule keywords 11H6H1 Fab' light chain
total genus 51
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kL01
4QCIA 4YIQA 1BBJA 2DTMH 4LRNL 4NN5B 1G9MH 1D3CA 1GZPB 3P30H 4WW2C 4M61B 3R4DA 2EECA 1QO3B 2WZPD 1R0AH 3O45A 1MHPL 4Y5VA 1IBGH 1DCLA 2GSGB 2ILLA 2E6PA 1FVEA 3CJJA 2ITDB 1VDGA 5EORH 4UIMB 4IMLA 4Y2DA 4K2UH 4M8QB 1IQWH 5F1NA 2V17L 3QIWC 4ZQKB 2CR6A 1NMAL 1YJDH 4M1CC 4JN1L 4P3DA 2OXHA 3FT2A 4G43A 5FYLH 2P24B 4L9LB 4BZ1H 3D5OF 1A22B 3RUGB 1IM3A 3CH8A 3BW9A 4LOUD 1F4XL 4C55A 2F74A 3L5IA 3OAZH 5DVKA 4LPCA 3QEQB 3D1MC 5JR1L 4P4RB 1WC7A 4FFWD 1KIPB 1U8PA 4JFEB 1NGZA 3LZFL 3L3JA 5A2FA 5DRWB 4OLUH 3QCVH 3W82A 4OLVL 1QRNE 3U0TB 4WI7A 4Y88A 3BHBB 3LQAL 2IC2A 4NQEE 5EO1B 5IF0B 3QXAB 4NNXA 3NH7H 3BPLB 1IEHA 4KUZH 2FSEA 4EI6B 5CGTA 2WLZA 4LPTA 3C6LB 5FO8B 4GAGH 4X9GA 1I85A 4ZXBA 5JOFB 3TO2A 3TA3B 4JKLA 2HN7B 5KN5A 4RISH 2R56H 1H15B 3HG1A 3VXNB 1S9VA 3TFKD 5C08D 3MRNA 3QEGH 4K3HA 4LLAA 3S3SA 2RR3A 1MCEA 2A83B 4MD5A 4HUUB 5C0RH 4JHAH 3MUGA 1XF4A 3L3HA 4JPVH 4RNRA 3PGCA 1RV6X 1GCFA 4OFVA 5I66B 4P5MA 2R8SH 4X7SL 4OTXL 5ICXB 3ALPA 2AXGA 1K85A 1OF2A 4KVCH 4AT6A 4LFHD 1U8JA 2KDGA 4RBPK 3DTXA 1CDHA 1K6QH 4AM0A 5IHBA 2D9CA 1NUFA 3EHBD 4JVUA 5DYOA 2MKLC 3HI5L 5IJVB 2H41A 4Y19D 1SM3L 3QO1B 1J86A 5J56B 5I30H 3BZEB 3EYVB 4X5XA 2X4PB 3EYUL 4PJ8D 4UILH 4LBEA 5D5MF 5I1HL 1MCWM 2HVJB 1ZA3B 3P9WB 1A7PL 2FWOB 4JDVB 1C5DB 4G7YH 4KRPD 1IGMH 1RVFL 3CFEA 3HNTL 3PJSA 3MODH 3MMEA 5DFTA 4GG6F 3AS3A 3PJSB 2QKIA 1WJ3A 4LGSB 4HAFA 3SDCA 1D5XA 1EUTA 4PP2A 2DYPD 5IWLC 3SY0B 5GGTL 4AEHH 2J8HA 4JAMA 1NCWL 2XZQL 5D1ZB 3EZ8A 3U4BL 5BS0B 4OGYL 2C1PB 2UUDH 3CC5B 2P7TA 1A7NL 3BEWB 5KVEH 5IEHB 4YBQD 4TVPH 1LO3L 5GRWA 2XTJD 4QLRA 3HE7A 4PRHA 1ZGLM 5LAXB 3T08A 1U8KA 4BFGA 5BJTB 2Z91B 4PRBA 3MJ8B 4NRZA 2BRRL 2FSEB 4RMRA 3FRUA 1N64H 4HS3A 4N9OB 2G5BB 4GRWF 1G7HB 1U95A 1UA6H 1K8DA 5E2JA 1QYGH 3QH3B 1AGDA 4QRRB 1FO0H 1NKOA 4Z7UB 5HGDB 3EFFA 1JPFA 5EPMA 5IMLA 2GAZB 3DHMA 4JDZB 2FZ3A 3AU1A 2DD8H 4NN6B 1IFHL 1C7SA 2MTPA 1OAUH 5DA4A 3W9DB 2HJLB 3BPNB 5B8CB 5F93C 5IMKB 5F6IB 3GBML 1OQOA 3BIKA 3JWOC 4O2EB 2VUOA 1ZT1B 4OZGB 3DTXB 4U1NB 2RJMA 3T3MF 3B2VH 4TSCL 3LMJH 5C71A 3TBYB 2Y1VA 4S1RH 4F7TB 2HTLD 3RDTD 3RVXD 1JF1A 2Q7NA 4XBEH 4LSTL 4LRNH 1OWWA 1KGCD 1UM6L 4GH7B 1JNLH 1QR1A 4WTZG 4UTBH 5EUKA 3MJ9L 3MV9E 5KANG 3O0RL 4P9HL 4TNWK 4Y8DC 4H5SB 3T1FA 4PJ8B 4AG4L 5CSGA 1QBML 3TN0B 5DMGC 3IKKA 3GJFB 3QFJE 1DUYA 1LO4L 5E8DL 3KYAA 4H0HB 1YJDL 1PLGL 3MLWL 4Y5YC 3FQTB 3GUTA 1OARH 3CFEB 1U3HD 4HDIA 1KNOB 2LAAA 4IHOA 4WU7A 5D1QA 3UTSD 2H8PA 5FGBC 3T2PA 3N1MC 4D3CL 4PPTA 4UDUB 3DJ9A 2VB5A 4R6UA 5E08L 1R6VA 4CVXB 1I8LC 4WI8A 1MFAH 2NY0C 2XRAH 2H9GB 3LZFH 2VN4A 1PKQE 5SX5K 5AZ2L 4NO5A 4UQ2B 5CKGA 1KLFA 2X4QB 5L6YL 4HG4J 1FNFA 2VNCA 1I7RA 2AGJL 3S96B 1JP5A 3FB8B 4OZFH 3CVHH 1K4CA 2NY6C 4R3SB 1MEXH 3FB8A 2EH8H 5I18H 4YEFA 1X5KA 4I13B 2H3NB 4RISL 1MWAA 3H9SB 4LBEB 3P4MB 1BIIA 1FNSH 2DRUA 4BSWA 4H20L 5CP7B 1KIUA 2CXKA 1RZJC 1NANI 4L4VE 5FYKL 5DMJB 3QAZB 3SE3C 1ADQH 3QEGL 5DURB 3RKDD 4PJAE 3IFOB 2XQBH 5IBLD 1MIML 3HMXH 3JWOH 3QXVA 4FQPA 5DMYA 4JFPA 2AV1A 4AK1A 2VDRH 1AD9B 4TSBL 4ODSL 4OTXH 1S7RA 4KVCL 1EAPA 2DKSA 3KJ4C 5ID0B 2XTLA 4AQOA 3HZVA 5TDPB 4GRWB 4PP2B 4OZGA 5SX4H 1I3RA 4FTVB 1N59A 4BZ1L 2Z8RA 5GRXG 4XMPL 5D8JH 1TPXB 4ODVL 4X6DA 4BH7B 4PRIA 1S9KC 1RI8A 1ZHLA 4X5WB 2C1OB 1T3FA 2EDFA 3S37H 3D69A 3MCG1 5KTEH 3BJ91 5D2LA 3WXVH 1DVFA 3HR5B 1E27A 1D6EB 2JK5A 5F6HJ 2J8UA 5TQ0H 5KSBB 4QF1A 4WI5A 4K9EL 1E27B 3SQOH 2DM2A 3G9AB 4U3HA 3QCUH 4WW2F 1B4RA 5FUZH 3QZWG 2YRPA 1AFVH 1UJ3C 3I2CL 1RVFH 4GKNA 5EA0H 5CEZE 2PW1A 2GKIA 5LGJA 4V1DB 3FZUD 1HI6A 3VXRE 1A1NA 3MLZL 2X7LA 3QDGB 4JQVA 1JPGB 5JLZA 2GJ6E 4NGHH 3L3KB 2YD7A 5JHDE 3INUL 2XWBA 4R2GB 1Q38A 1AD0A 5EN2B 4LPYA 2OQJA 1YEKL 3IFLH 3B9KC 2Q76A 3QQ3B 1GOGA 1NCWH 4NCC1 2VZVA 4XP1H 3BQUC 4KV5F 5IFHH 1MCHA 2WP3O 4QXUL 4AIZA 4JVWA 4CW1A 3G6JA 1DVFB 3OKMA 5ALBH 1FE8H 5D72L 3H9SE 2YBRA 5HSFA 4D9LL 4NJ9L 2HT3C 4JO2H 4CJ0A 3P4NB 5HYEA 3ZDZE 1UEYA 1MFCH 4MVBC 4U6YA 2DLEA 5D7LB 3RAJL 3VXSB 4OCSL 5IMOB 5B8CC 2NY6B 1F6AB 4JRYA 5AAMA 3PHOB 3ARGC 1TTUA 1BQHG 1HIML 3RNQA 4C56B 3VFPA 2XY1A 3VXUB 1I8KA 4LCUA 3V4PH 5FO9B 5C0JA 1E4XI 3PWPE 5D1XA 3GMOB 2YUVA 3STZB 2VXSL 3CSBA 4PV8A 5F72S 4ZUVB 4GRLA 3GSQB 4MB5A 4DZBB 4Y4KA 4QOKA 4JANA 1YY8B 4YX2L 1AGFA 3OF6A 3PGFH 4POZD 2D2OA 1JV5B 3LEXA 3KJ6L 1MAKA 2X1PA 5SX4I 4Q58C 1I7UA 2J8UF 3F62A 4IRSA 4M6ML 3CXDH 4Z6AT 2JJUA 3G08A 3I3BA 2PO6A 5C0NC 2VQ1B 4RA0C 3D69B 4FG6C 3P2TA 3U4EB 5HPOA 2FLRT 3V9FA 2QR0B 4UTBL 5FYKU 1NCAL 1P7QD 3F12B 3HMXA 3O0RH 4P9HH 5ILTL 3WE6A 4PJ7F 4WTZA 3IDXH 1X5GA 3OXRB 3C9NA 5IQ7H 1P84K 3MXWL 3QNXA 2IALB 4IS6A 5DD3L 4OQ1A 3HHRB 1DBAH 1V7ML 4LU5L 3RNQB 1I85C 2ORBH 1OARL 3D0LA 4NUJA 2EIZA 5F1OB 4F7PB 3VFWB 4KTEH 1U6AL 4GW5A 5CJBA 2JB5L 1UA6L 3QIUB 3S6CA 2OZ4A 3MLYL 3VXQB 2H32B 3MNVB 5KS9B 5EO0A 2IQ9H 2PF6A 4LVNB 1RMFL 2EICA 4NQED 4OSUL 3MRMA 5DD5L 2VLRB 3S4SA 4OB5L 1UADC 4WI4A 5EU3A 2HYMA 3FO2B 1IGCL 3OAZK 4HKXB 2EXWD 1N2RA 4O4YH 5KVFH 4MNGA 2W59A 5IHZB 1OAKH 5DD1L 1H3XA 4GAYB 4D94A 5E4EC 4M62L 4P23C 4Y5YB 2E7LA 5BS0D 3DROA 4L9LC 3HNVH 4OCMC 4S0TD 3RTQA 4UIKH 1MCWW 1U3YA 2UWEB 5FKPB 1WSST 4L8SA 4M00A 1BAFH 5F9OL 5JW4M 2P1YA 1UXWB 3MLUL 3TH2T 4NNYB 4ELMA 3LPWA 2Q8BH 4N5EC 2Y5TA 4UB0H 4N8VG 4G6KL 2QR0A 5DSCA 4LSVH 4QWWD 2VDRL 3WIFA 4GXUM 3W5NA 5I1KL 4X99B 1KTLB 1NMCB 4L9DA 2XQYK 1CZ8H 4PS4L 1IT9L 3DECA 5DD0L 4M5ZH 1FYHB 1P2CA 3GSUB 2YD4A 5EU6B 3PF2A 4PRBB 4JEGB 3QULB 2LVEA 3T0EA 4ODVH 1W72A 4PRPD 1XGUB 2FJGB 1PBYA 4UUJA 4WWKB 5JORA 3ZTNH 1KCVH 4KMQA 3C8KB 2A74A 3WFHB 4ZXBB 4OFDA 5TQ0L 5DO2C 3O4OB 4JPWL 4X9FA 5DRNA 2X1XR 4BH8B 3RZCB 3GO1H 4ZS7L 4MX7B 4EN3A 3TBWB 1BFOA 4I8DA 5ITFB 1D5MA 2X4UA 2EEBA 5EA0L 1ZGLP 3W9DA 3EHBC 3IXTB 5FOJA 4LCWA 4KDVA 2OTPA 1VPOL 2A2QT 1CIDA 1DLHB 4NWTH 5MEND 3CSGA 5JO5B 3P0YL 4WO4B 3IJYB 3LKQA 4BFBD 2BERA 3MRRA 5IQ9A 2QSTA 2ATPA 3UTQB 3NCYS 1FO0B 4GKZA 4AL8L 1AXSA 4O9HL 3GMMA 4YAQA 5FECA 3OJMB 1QBLH 4G8EA 2CIKB 4GAJH 3AMKA 3ULVE 4XP1L 1RU9H 1JZ5A 2ZOLB 3HI1B 5SWZE 4Z78B 1N5YL 4D2NA 1T1YB 3MV8A 4NRZB 1KCUL 4KXZH 1YJDC 1CXEA 4MSWA 3L6FB 4ODSH 5GGSY 3UZQA 3TO4A 5IESL 3QWRA 2VDKL 4K3EH 5ESVB 1L7IH 4JY6A 5D72H 3BESR 5I1LB 1CDBA 3R06A 4D9LH 4DVBB 1F5WA 1ZSDB 1G0YR 3ISWA 4NO0D 2MQ0A 1A14L 3C6LA 5FO8A 4PLOB 1LE9B 4XP9H 2DIBA 3OGOE 4XMPH 1FVDB 3D2UD 5IB2B 2CLRB 4XPTH 4AENA 2OBGA 4HIEA 3MJ7B 2R69L 1I1YB 1O7VA 3WUWB 5F88B 3CK0H 5KSUB 4APQB 3F58L 3RVVD 2R4RL 2V7HB 3Q6GL 4K9EH 5GXBB 4LAJH 1BOGB 4XBPA 4TQEL 3VFNB 4E42A 4YBLB 1EZVY 4MZ3A 1JJUA 2HRPH 4NKOB 4FFZH 4S1QH 5IVXE 2EYTA 4XH2A 5CJ8A 3HG1E 4JKPL 1G6RA 3UTPD 4Z77A 4R90L 2IWGA 3BGMB 1A47A 4HC1A 5IKCA 4XI5D 1E4JA 1N3NB 3QO1A 4GUPA 4JY6B 1NFDE 3MFFB 2QL1A 2G9HB 4FQXC 2FRGP 3OGCB 2AQ1A 3S35H 1QNZH 4JREB 4QO1A 1LP9B 2BX5A 2HFTA 1D5ZA 4ZO9A 4NHUA 4S10A 3FFCB 4QXUH 4WW1B 4YNYB 5DD3H 1CYGA 1N4XH 1A9BB 3SGJC 5B39A 3LN9A 1Y0LB 4GRMA 1V7MH 4LU5H 5BW7C 5IEKA 3MFGB 4PB9L 3V5DA 3X14B 1GGBH 3PGDB 5EZIH 1NBYB 3RWIA 5I8EA 3FO1B 5DUBA 2GSGA 3OB0K 1ZVSA 5I76B 4KVNH 4P3CL 5F96L 1ZGLB 1W0VB 4KI5F 1HIMH 4YR6A 1MCSA 2IG2L 3B9AA 1MRCL 1J05A 4QRSA 4JM2F 1WZ1H 1MCNA 4O4YL 5KVFL 3QFDA 3RX5A 2HKFH 1MCCA 3ULVF 3RWJA 2IBBA 5E9DE 1OW0C 1OB1B 5FDYA 5B4MD 1OM3L 3GJEA 5GQBA 3JVGA 2EDXA 3WIHA 3G5YA 1HHIA 2F5AL 3NPSB 4G80A 5CGYC 4KI5C 5CBEA 1RK0B 5JHLH 1XZ0B 1I1RA 4ZYKA 2H1PH 1FPTH 1C5CH 2R0KH 4DKEL 2JJTC 5HHOB 3ULUF 3IB4A 1PZUB 1CDUA 1TZGH 3NPSC 1C5DA 2A0LD 4ZFGL 1PSKH 5L8KB 1MHPH 3TBSB 2QADB 2G2RB 2XY2A 4P2QE 4YHKL 1HHKA 1P4LA 4GBXC 2GK0A 3RFZC 1HWHB 2PXYA 4NKMB 5EORL 2NY6D 4U1LB 1TQBC 4HIIB 3ES6B 1EBPA 4OAWB 5KOVC 4OZGF 2P8MA 2ORBL 2HLAA 1KF9B 2EDQA 2ZJSL 4U1NA 4M5ZL 5FYLL 4U1MB 1NDMA 2AEWA 1AIFB 3IVKA 2XPGB 3FQXA 3K2MC 1FFPA 3PNWA 1I7ZA 2IMNA 1EVUA 1T1YA 3MV8B 4E41D 5C0AD 4H8WC 3ZTNL 1Q72H 1JNJA 2YK1H 3V2AR 1XMWA 4Y16B 4PJEA 4JRXA 4NJAL 4OLUL 3H0TB 3QHFH 2MHAA 2EKJA 1CDGA 2W0KA 1QQDA 2NY1B 3JTTA 2QSQA 4MNHB 4LLWB 1ZS8A 2E27H 2NLJA 3W2DL 4HGWB 1FQ9C 4AYFA 3B9KB 3L5WA 5I0DA 1FSKC 2VZUA 1E4KA 3HAEG 4PJIE 4QRPD 4QRRA 3QUYD 4XTRD 1SEQH 4XX1G 2PTTB 2CLVB 3L5WB 3BKCL 1W8NA 2V5MA 4O51A 4U7MA 5D1XD 2GITA 3EGSB 1JGUL 2P47B 2QQNH 3P0YH 4LCYB 1ONQB 3B8YA 4RMQA 3EFDL 5HGBA 3SDCD 5ID0A 1FNEA 1S8DA 3ME0A 1NLBH 4ALAL 2KL6A 4NZUL 4W81A 1BAFL 4XVJH 1ND0B 5F9OH 1QSFA 2MJWA 2BZDA 4M48L 2AI0H 1OTUD 1ZHNA 5GS1A 5I1IL 4G8GD 3BDXA 4JG1L 1I1AD 2NX5B 4H26A 4QHUB 2IPTL 4Y2OA 4X7SH 4QHLB 3MRJB 1WBZB 4E5XB 4WNQA 3FZUC 4TYUA 2ESVD 4Z8FL 4ZSOA 5IW6B 1AP2B 4HWUA 2GUOB 1G6RL 1GC1C 2M8XA 5KSBA 3QRFM 2ADJB 2FATH 2DS4A 1CTNA 3ARPA 43CAB 4N8PA 2LABA 1F3JB 3D3VE 3HI5H 5FKAB 3C5ZA 2X4OA 4XWOC 1CR9L 3FFCA 1RIVH 3VFRA 4YGAB 4ZOBA 4HFUH 4Q9RH 2OMBA 5J6GB 2F53E 3GSQA 1B0RA 2VZ3A 4UQ3A 1QOKA 4Z7VB 5HI3D 1JYNA 3T0WA 3IS0X 3WEXB 1KJ3H 4HEPG 1Q9OA 3TCXA 3QNZA 3MUZ1 1BJ1H 1JGEA 2DQTL 3DGGB 1A7PH 4PRAA 2NCMA 5EBLB 1X6LA 4MA3B 3Q6FB 4UV7L 3QWOB 3OXSB 3RU8H 4JFDB 4JKPH 1QA9B 5I0ZA 5DI8A 4CUCA 3OKDA 5JIPA 4R90H 4NQVB 3L95B 1CT8B 5TF1L 2VE6B 1TVDA 3DX8B 4JFHD 4WUUB 5CJ5A 1EXUA 2SEBB 3T0EC 1MELA 1O0VA 1A2YB 5J4MA 4RIRA 1BQHA 4JQXA 1QNZL 4F7CB 1S78C 4MAUH 1RU9L 3OJ2C 4NZTH 3R1GL 1A7NH 2YXMA 1T21A 3BPCA 4HGKC 1R3IH 5KVEL 3K74B 1U8QA 1AGBA 1Y6NR 4Y16C 4ELMB 2NY1D 4XB8A 1NGPL 1MHHB 4GW5B 4XNZB 5E5MB 1RD6A 4UOW1 3SE4A 1YYLL 4U6HA 4I77H 4B7IA 1WBZA 2M1KA 3RPIB 2NW3A 2ICES 5D2LE 1SBSL 5ANMB 4XCEB 1DFBH 3QXTA 1FYTA 2XFXB 1JWMA 3GHEL 5KVGL 4KJQC 1JZ2A 4LCWE 3QULA 1I7TB 3BHBA 5GZOC 2C4XA 5I19H 5HHPB 3BYTA 1MFEL 5EG6C 1YNLH 3CDCA 3U6RB 4ZPVA 3JWDL 4NBYB 4CVUA 2BNRA 3G08B 5I9QB 4GS7C 5E6ID 5F9JB 4E5XA 5C0AB 3ZDZF 3EBAA 3CH1B 4OV5B 4FMKA 1EMTL 4KKBD 5ALCL 4OF8A 4J3VA 4QHMB 4ZD3H 1S9VB 4HXAH 3BFOA 1AO7E 4JFQB 4WTXA 4TRPH 1HE7A 3VG9C 4NUGL 4YXHH 1N6QL 2C3XA 5FFLA 2DJSA 4ZFGH 1KN4H 3S35L 5INDB 2KKQA 4ODHL 1TVBB 4ODXA 5ITBL 1ZANH 3FFDA 1R5VA 3AS1A 5LWYH 3SDDA 3ARXA 3QG7H 1LO4H 5C7XH 3BN9C 2HH0H 1JNNL 3FO2A 3WD5L 5L0QC 3QB7C 4WV1C 4M7LT 3VGHA 2NY0B 1MHHA 5CJQL 5F9JA 1SJHB 1B6UA 3QUXC 1Q72L 3ARFA 2VQ1A 3RPKA 5T1LA 4P4KA 4NQSA 4QWWC 1YNTA 3BP6A 1WZ1L 1MIEL 3I6KB 2FX7L 3W2DH 2WMPA 3KAAA 3QNXB 1TJGL 4OZIB 4JR9H 2DDQL 2UWEA 3MNWA 1AGCA 3BVNB 3AFLA 4C56E 1ES0B 2ED8A 5L2KB 4RFOL 4YJZL 2ZCHH 3RL2A 3QEUB 3S3JA 3TVMC 2F5AH 4FQIL 4WI9A 1JGUH 4NKDB 3MBEA 5E1HB 2C4FT 3ULVD 2BRQA 4G5ZH 4QTHB 2K7QA 5DO2D 1WIUA 2A6DB 4QHNB 1HDMA 1NQBA 1ZKAA 1VHPA 4C57C 2B1AL 4PBVC 4GG6B 4YDKL 4YH6A 1J9CT 3FAWA 4K55A 4CU7A 3WIHL 5DQJB 4WRLA 1WCBB 3QIBA 4HIXH 2KQNA 4XPBL 5DA0B 2VXQH 1S7VA 2BSTB 3FN9A 3ARBB 2V2TB 1XIWC 5DF0A 1KOAA 1A9BA 4JG0L 2CKBH 4P5TD 4OFYD 1R5WB 1RZ8B 3VXPA 4B50A 5JUEL 3WLWC 4LL9A 2Y6SD 4JFQA 3TCLA 2R0ZL 1F13A 1QEWA 4FP8L 1QLFA 2QLVB 1DBBH 4GXVH 5C1MB 4PLKC 3ARDB 2B8OT 5DC4B 3I75B 2D7OA 2HJLA 4YQXL 3QHFL 2YD9A 4LP5A 5L2JB 1U8JB 5D7JA 5IHLB 4RAVB 3QO0A 1IKFL 1NBVL 1P4IH 2R9HD 2L0DA 1Q9WA 4QTIL 3FCTA 5ISZD 3GGWA 1KIRA 3L5HA 1SYVB 3O3AB 3WXWH 3QIWD 3QRGL 2A6KB 4HS8L 3HNSH 3BP4A 5L9DH 3V5HB 1WTGT 1OAZH 3K46A 3OGCA 4PJCF 2GJ6D 4ODTL 5B21A 4N0UE 5HYJE 4RBPH 2DL9A 3UJIH 4DZ8A 4TNVF 2EDJA 1K8IA 2OLDA 4M48H 1CWVA 1R3IL 5C9KA 5C08A 3TV3L 3KYNB 5DK2B 3SKMA 1K8IB 1IAII 1J0HA 2J88L 4FN0A 4LMQI 3UROR 4ZFFB 3QXAA 1R24B 2P5WA 2VLJD 3AREB 5DQJA 1I8LA 3VGAB 3OR6A 2L7UA 1ZA6B 3MBXH 4GMSH 1E0OB 1PJ9A 4HJGA 2VO5A 4XCNA 3TYGL 4IIQA 5EU4B 5FEBA 3VI3E 5SWQB 3FO0L 1OAQH 3QUML 4P4RA 5JXEA 3ALWA 3O9WD 1GVIA 3C60D 5C0FB 2YEZB 5E24E 4NC1C 3MUJA 5FF6A 3VCLA 1AXSB 5I19L 1B2WH 5GGRY 2D7TL 1SBBA 4KZDL 1OB1A 4JGMA 1EAJA 3SHSA 2X70A 4GSDL 5BOZG 1BD2B 3RWHA 4BQ8A 3O4LD 5C09A 3TO4B 1H5BB 3LEVL 1MJUH 4FQ2L 1N7ML 4U1KA 3VGDA 1QUNA 4LKCB 2KZ1B 4AQ1B 5EIIA 1KXQE 1D5IH 3MR9B 4UDTB 4MCZA 3MLVL 4ENED 1NFKA 4O5LL 5DMKB 5FUCC 4NQTA 2WQ8A 4PBWD 1M7DA 3B8SA 3FQTA 4H1LA 5F7UA 1N6QH 3QPXH 4UAOC 2XNAA 4K8RD 4UNUA 5IVXA 4ZDHB 1P7HL 1H8NA 2W9LA 1TPXC 2YD3A 2OX5A 5DUBB 2V7NA 4IOFC 2BSSA 3L3IB 4QRPE 4JFZL 5LWYL 5CGYD 3TWCH 3U7WL 5J9PA 4CMMA 1DBAL 4JM2C 3VD5A 3MCKA 3MLRL 3MRGA 5F71A 3WD5H 1BFVH 1OP5H 1ZLSH 3RJDA 4YC2B 1QHOA 5AZEH 2IADB 3ARZA 1F02I 5DRXA 4Q7DA 2X89D 2J7LA 1P7KA 3WN5A 5IKCB 3ARGA 3BGMA 3KPSE 4MB4A 4Y16A 1FG2B 1HKLL 4HS6A 4JGJA 1JF1B 4OSUH 3VRLE 4IDJL 4LKCA 4JM4L 1VCAA 2DWEB 3C09C 1CK0H 1PZ5B 4APQC 4NP4L 4HMCA 3NAAH 4PD4K 32C2B 4YHMH 3BMWA 4ELKB 4NO2B 2FX7H 3ZL4H 4YDJB 3DXAB 1HCVA 1BM3H 1ZOXA 3S3PA 3MV7A 4PJBA 1T0PB 3ZKSD 4FQIH 1K4DA 2YN3A 3N50A 3SPVA 3B5TA 4PYGA 2DBLH 3RVTD 5K33A 4I5BA 3LPGA 4PJCB 3IJSB 5J12B 5BZDA 1UB5A 4TRPL 4YHLH 4ZTPL 3RVUC 3BZ4B 1NL0L 4Q9CA 4KJWD 1JWSA 3HI6L 4P57B 1MLCB 2ZZUT 3IXAA 4H26B 2NX5A 4QHUA 2SEBA 4UQ2A 2AEQL 1QKZH 4LCWB 3KPRB 1QFOA 4EVNB 5LBSL 2B39A 3PIQA 2DM3A 3MC0A 1FDLL 5ANME 1GL4B 3L3OB 4F15C 1JHTA 4TUJA 4DCQB 2HH0L 4U6YB 4I0PA 4NQXA 2BJMH 2QADD 1T0NB 1KPVA 3CLFH 4DEPC 4RDQG 3MRGB 1AC0A 1BOYA 1LWRA 1JGLH 2EC8A 5FDWA 5JUEH 3B5GA 5CINH 2XQYG 1RHHA 1AHWB 4PRPE 2VJXA 3CFCL 1NLDH 2NY3B 2XN9B 5A16A 1I1FA 3C2SA 3RZCC 2KZWA 2A6JA 3S34H 1A6TA 1QVOA 2UVFA 5CEZH 3HMWL 1IARB 1I1AC 2WWMC 4ELME 2AXHA 3J7HA 3TESA 3O6LH 2BY1A 2UZXB 1ULVA 5J7CC 3I6GA 2NNAB 1NC2B 4R4FL 1GSMA 4AMKH 4FRWA 5ADPH 4Q2ZB 3PDOB 1JHLL 2PW2B 4XVSH 4JQIL 5DMGD 3AM8C 2RFXA 5DZLA 1EGJL 3VXSE 1FFPB 4LPWA 4HS8H 3TN0C 4F57H 1F3RB 3TZVC 3QDMA 2UY6A 1BZ7B 1VB9A 4FABL 3IDJA 2BVPA 2A9NH 2FIRT 1MWAB 1KV3A 5BZDB 2NY0D 1EBAA 5BRZD 5LQBH 3QJHA 3TV3H 4XH2B 2AKRB 1XR9B 4YHOH 4HV8B 5JDJA 4Z76A 2FGWH 5C92A 3H6JA 2Y23A 1EEZA 2A9MH 3LKNA 4GMSL 3DO7A 3G5VB 4S11A 2Q87A 5EO0B 1YPZA 2VLKD 2DICA 2NZIA 3C2AH 4PJGB 3RWGB 4P5TA 2W38A 3V6OA 4XPTL 3DURA 1G1YA 1FNEB 1OSZB 5HGBB 3BUTA 1PG7W 1FRGL 2DKMA 1T7YA 3SKOB 3SGEI 2HRLA 1T03L 2HKHL 1CXKA 4LNRA 1I8MA 3MQIA 1KC5L 2YPLD 5KSBE 4X4ME 4MNQE 3IDYC 5HHVH 2EDNA 1YEJL 3VU2A 5JW5B 2Z4QA 3U9UB 2VC2H 3GBNH 5ESQA 2FHCA 2AJYL 3BO8A 4QHMA 3O8XD 1D9KA 4UAOB 1TJIH 1CD8A 4FFZL 4S1QL 5CEYB 3Q1SH 1RUML 2DQHL 4LSPH 43CAA 5DQDL 1C16B 3C87A 2QJDA 2OMNA 4OFYA 3NCCB 3MRLA 4JRXD 3QPXL 1IGYA 4YUEL 4QOKB 3GHBL 2R23B 4U1JB 1R5VB 5IFJA 4HHAA 3SCMA 3PDGA 4YHZH 2BVEA 4MJ4A 2AJXH 3FT3B 4WWKC 3UYRH 3X3GH 1N4XL 5CZKA 1NC2D 4PJ7A 2JE8A 1UCBL 2ZP0T 4URTB 1GJIA 4RGND 4DGVH 5HYQB 4O58L 1IZKA 3H9ZA 2PYEB 5C0CA 1I7UB 5CD5C 4O02L 4A6YB 1NMBH 1Q94A 2EZ0C 4OV5A 5MEQB 4KJPC 4P4KD 3IJHB 5F1KC 3ZE1E 2DI7A 1MFDH 5IVOA 1NCCH 1U41A 2X41A 3GIVA 4IMKA 4YDVB 5TFSL 1BIIB 1LO5A 4DAGH 5F88A 5IR1B 4GSDH 3TBTA 3VG0H 3ZDXE 4O2FB 4YHYB 5FYKE 3P77B 3ARBC 4HBCL 1MJUL 3IDGB 3VD3A 3VFWA 5DSCB 1M05B 3K2UH 1F8TH 4P99A 4OJFH 5SWSE 3H8NA 1N5AB 4O5LH 4X6EB 2Q3AA 1CD0A 4ZTPH 4YHLL 2GQHA 1FV1B 3U83A 3MGOB 5DUPL 3MZTA 3QIUC 2IGFH 4W6YB 5F7DA 3ZYOA 1NBZB 2FBOJ 4LVNC 5FB8B 1MAJA 3C09B 2B5IC 1T0MB 4YHKH 3MRLB 2VITB 4HWZB 4PGCA 1INQA 4Y5YA 1B0WA 4PGJA 3UTZA 1FDLH 1BIHA 3HPLA 1CF8L 3ARFB 3BRGC 3TVMD 3NFPA 4AJ0A 4MA7H 1HQRA 5EH1A 4TUOB 3O41B 3MX0A 4R8WL 1KJVB 2WBWB 3MLRH 4FXKB 1VFBA 1ZLSL 3WFDL 2JCCF 3LEXB 4XP4L 1A21A 3E8UL 3SKJL 3KLAB 4UTAH 4POZC 2R0WH 3V95A 5CD3B 1N0XL 2I60L 3OB8A 5E2TH 2C3GA 1QFWI 4LLYB 4LLDA 3ARVA 5CEZL 4JM4H 5C0AE 3MNVA 2GCYB 4F33A 1NUGA 1RK1B 4XPAH 4FG6D 2FB4H 4RGMC 1F4HA 5EOCH 3ZL4L 1W72L 5E8OA 1MOEA 5J13C 5E8EB 2R29H 3S36X 1BM3L 1WFOA 3HS0B 1RUQL 2I5YL 3VFRB 4HUKB 2ZSWB 3BP4B 2J2ZA 5DQ9A 1YEGH 3ORJA 3UAJD 3RY6A 3Q48A 4HWNA 4PLJC 1TZIA 3RGVB 3K8KA 4KRLB 2YRZA 4Q97A 4QEGA 5FGRA 4J3XA 3HUJF 4PLKD 1XT5A 3V7AE 2H32A 2VYRE 1X44A 1QG3A 1X5YA 2VLME 4AIOA 4CVWA 1F58H 1XH3A 5KN5B 2Y5EA 4XVJL 1BD2E 4LSUH 4K8RL 4KROB 5GRUL 4RMVA 2DYPA 4HUMB 3WIIL 4F2MA 2R0LL 3GSRA 4Q6IB 1UXWA 1XGTA 4ZOEA 1AE6H 2EH7L 3H7BB 4ODBD 3KHQA 2AV7A 3RL2B 4KK9D 3AGVA 1R3LA 1TZHB 2VKXA 3OJDA 4TUKH 3C5ZD 3OAYK 4OT1H 5D6DC 3HPJA 3AY4A 1GIGL 4Q6IC 3LKOA 4P23D 4JFDE 1KIPA 5IW3A 1BREA 1PW3A 4FXKA 3F5WA 2YPLB 2OP4L 5KW9H 3O6KL 5DD6B 3DLQR 4Q0XL 1FRGH 1IAKB 5C0BA 3TNMA 2YHGA 5MERA 3S5LA 1L9MA 1A6VL 2K3TA 4JY5L 5IK3B 3PWNA 3TPUA 5EZJB 1Q9KB 3VRIB 4TTDD 1T0MA 4G8FB 3PWLA 2AJZB 5HHVL 5DS8A 3ROOB 1KJ3L 3LB6C 3EUUA 3MOBL 3TBVA 3DUHA 1L9NA 4DGIH 4EUPH 3PWJB 1YYML 4OD2B 5JPMB 4MX7A 2BY3A 5HPMB 2HFGL 4JQIH 4KPHL 1ZT4A 3OWEA 3Q1SL 4GRWH 1EPFA 1KELH 2DQHH 3D87B 2A77H 1U42A 3ARSA 2NTFA 5GGTA 1LE9A 4KGLA 1UWGH 3QA3B 3MRHA 2MCPL 4UUJB 4LHUG 2ZOKA 4K7PL 3LQZA 4F8QA 2FX9H 4JHWH 1F90H 3RWIB 3QIWB 5DJ6A 2VAJA 2Y4SA 2W1NA 3TZVA 4GG8A 1I9JH 3CZJA 2E7CA 2DLGA 1E6JL 4Z77B 4JFEA 1TQBB 2ADGA 2EO1A 4MS8D 3WDIA 3VXOA 3TPUB 5I17B 3QJFB 3CFKA 5JIHA 1JN6A 3N1GC 3DX6A 1HINL 4M7JL 3I6LE 1FL3B 2P45B 1RJZB 2NXZC 2ERJC 4JO1L 3SKUD 1JYVA 3QH3A 2X4SB 1G7MA 3ETBF 1EFXB 3VFOA 5C07E 3TBWA 3V6FB 1NCCL 2X1WL 3EYQD 4IHOB 1SVZA 3BH9A 3UTSE 5A2JH 4P2RD 1L6ZA 2C7UA 4I0PD 4U2YA 1EAPB 1H0DA 5I6XC 2NNAA 3BPLC 5LKNA 1EH9A 1H3UA 2H45A 1FCCA 4OZHA 2JTDA 3DXAE 4J8RA 25C8H 2J5LC 2DM4A 1DUZA 3CFJB 5D9SA 4I0CC 5I8EB 5J9PB 4P46D 4EZMA 3F65A 3VXRA 2JB6B 5BXFA 2NX5D 3W9EB 1UVQB 1VKXA 3BDYL 1RZIA 2Y25A 4YFDB 4ZODA 2J5LB 3VRLF 2F58H 5E6YA 5I1GL 3W39A 2AW2A 4BZ2H 3EYVA 1T1XB 4Y4FA 5IJKA 5LCVL 4KKNA 1YMME 2XZAL 3F7VA 1JNNH 1QD0A 4XP4H 4UU9B 1TQCC 4P5KA 1OP3H 1RURH 2EXYC 2VLKE 1JRHH 4KJWC 3LKNB 4NC2B 5EU7C 4O02H 5M94B 4KXZI 1P4BH 5EC2A 3BOVA 3P40A 5DHVB 2Z8SA 4L8DB 4WY7L 5GRVK 3WUWG 2AJVL 4JRYE 3IJYA 4I2XB 1DBJH 1DLFH 1MFDL 4OM1H 3CNKA 1KCRH 3ZMRA 3P9LB 2X89A 4OCLC 5FM5O 1DQQB 5IB1A 3JV4A 2MWCA 5FHAH 3MMEB 2C1OA 3KYKL 4N90E 4IJ3B 2VE6A 3EJZC 1YEGL 3P30L 4N8VA 4K9EC 3DSFH 3V52H 4C4KO 1BQLH 4JHAL 1JHTB 4OZHB 4EDWL 2R1YA 3VXSA 2WWMD 2YD8A 4X8XA 3R06B 1Z9SA 3LSOA 1QZ1A 5DK0B 5GRUH 3VFOB 2V17H 3HZMB 1IAIL 3MCLL 3F8UB 1KB5B 1UM4H 2ADIB 5JA8B 3UPRA 1ZLUK 5E8NA 4OGXH 4FQJH 2W9DH 4LCYA 4HIXL 1ORSB 5CZXC 3G5VA 4O00A 3H42H 4KMTH 5GGQH 4HHAB 3BAEH 4P59H 4KJYB 1RIHH 4OBSA 3TN0D 3TZVD 2VKWA 1U93A 4OZ4A 3OKYA 3MRDA 4HK3N 4JG0H 5I30L 1F6FB 2HVJA 5C9JA 3JTTB 5IVXB 5F7NC 3F7QA 2R0WL 3O2VH 5KAQF 4R97B 5HYQA 1ACYL 3DSNA 2D0HA 3TH3T 1G6VK 3DX9A 3WHXA 1XCTB 1OSPH 4QHLA 2CKNA 2OSLA 3VJ6A 4JPKH 1CGUA 5I1JL 5DTFA 5AUMB 2Q86B 2WINB 2V9QA 4XNQB 3MODL 4MXVF 1AKJD 1JZ4A 3W39B 1MQKH 4LGPB 3SGKA 4KKCD 3VFUB 4Y5XB 2OJZL 2O61B 1VEPA 5T33H 5DEGB 1CLOL 2DQGH 5GGTH 3ILPA 4PREA 1AGBB 3DRTB 3T4YA 2NX5E 5T3ZH 4NDMA 5EZOH 1U92B 4Y2DC 3IFOA 1HSBA 4N8VB 1V3LA 2VDMH 3JTSA 3PHQA 4LHUB 1WAAF 3SCMC 3ZO0A 2R8SL 4K94L 1JFQL 3AB0C 2Q7YB 5DRWA 4PJ8A 1T89C 4LSUL 4YPGB 3PHQB 4JFXB 2P4AB 5D7JD 2A6DA 1INDH 4QHNA 1Q0YL 4UINH 3PP3H 1QBAA 2C3VB 5DK0A 4ZXBD 4Z5RB 4NQVA 1QSFD 2Q20A 3D25B 3SGKC 3O81A 3PQYA 4ZFOL 1A64A 2UY7A 4TOYL 3QWOA 5DJ0A 1FVCA 2FGZA 4H1LB 4JFDD 2BVQA 4Q9BA 1GIGH 4EQ2A 4NO3B 5T1MA 1T7ZA 3UJJH 5JXAL 1AHWC 1Z3GH 5D1XC 5SV4A 1BZ7A 1IVLA 1FSKB 5F7WC 1J5OH 2WIIB 3G04B 3I02A 3FT4A 1MPAH 4HIHB 3STLA 2JF1A 3OL2A 4L4TB 4BK5A 3SDCC 1B9ZA 2PNDA 4FNLH 1AR2A 1RJLB 3RHWF 3CCHB 4EN3D 3UX9B 3PABA 2P5WE 2YUZA 4OLWH 1LQSR 1OGTB 4AT6B 2CO7B 4RIRB 1JTPA 4U1IB 1GAFL 1FFQA 4XBEL 5DWUL 2CRIA 2VLRA 2EZ0D 1AGFB 2PR4L 2XOTA 4LQFL 1DR9A 4QHKJ 2ZUTA 5DJZB 1A02N 1L7TL 3LH2L 2BY2A 1G7JB 3RA7H 4LVOC 3WYRA 3R0MA 4KZEH 4N0FA 3DRTA 5EOTB 1NCNA 1LEGB 1G7IA 5BV7L 4U33A 1XIWB 4K7PH 5DXWA 5D1QB 2ESVB 2AQ2A 1F11A 1JI1A 2BCKA 2X42A 4JFXA 3IU3A 4YC2C 3JSSA 5LCVH 4QRQB 1KG0B 5CMAB 2F8VA 3IJHA 3MRBB 3BYYA 2DQEL 5GZND 1NSNH 4UOJA 5FUOL 4MXQD 4PTTB 3DVIA 4M9PA 1OCWH 2EDDA 2NY7H 5CLWA 1NGYB 1HKLH 4TNWF 3QNYA 1IEBA 4MNQA 2JK5B 5T3XH 7CGTA 3IDMB 1KPRA 2Z93B 1JYWA 4NSKB 4YHML 1I7TA 3FT4B 3MYZA 4OM1L 3PWUA 1KCRL 2QTEA 3A67L 3D9AL 3SCMB 1SYSB 4G3YH 5FM5M 5ESAB 3GMNB 1KTKE 2WP3T 3BPOB 5I71C 5KG9B 1WFNA 3UJTH 4Y16D 3BP7B 1A6UL 2NY1C 1EEQA 1UH4A 5H37G 1U8HB 1UGNA 4XNXH 3FQUB 2GSIB 2VDOH 1MAML 1YNTB 2BVOA 3IETB 3UBXI 3GSXB 3L5JA 2V2TA 3KDMB 3JBG7 4NYLA 3REVA 2LU3A 4EI5A 4EUPA 3ZDYF 1IAMA 2VZ1A 4XRCB 1BQSA 1TXKA 4Z7UE 3SDYL 3WKNA 4L4TD 2F58L 3WNMA 4CW1B 3K7UA 4EI5B 4EUPB 5GZOD 5LBSH 5I1GH 4RWHA 4N5UA 4NHCH 1JPTL 1ZA6A 5GGQL 5J13B 4RRPG 4Y5VB 3S37L 1ZXQA 2VABB 5EC1A 2W65B 2X4RA 4Y4KD 5A3ID 2EDRA 4NKDA 4S1SH 5DD6A 1WITA 1EFXD 4DW2H 1NGWA 3O2VL 4JDTH 1KFAL 4LIQL 1AXTL 5ESAA 5DUML 2HMID 4BZYA 4MD0B 1NEZB 4P0DA 2O26U 4WWKA 5I1JH 5FCUH 1TVHA 4HUWA 2Z31B 3V5HA 1H8SA 1MEXL 6CGTA 2J6EA 3U4EA 4R4FH 5ADPL 5JIIA 3VG9B 5IOPA 1JHLH 4J1UA 4LLVB 5GISL 1MCBA 4XVSL 1ZA3A 1XGRA 3BUYA 3ULUL 2WW8A 1KPUA 4L4VA 4G42B 2P24A 4LMQE 3PGCB 2PTUA 2PKDA 5DR5L 3IS1X 3IXTA 4FS0A 4ZUUA 2Z4QB 5DJ6B 1Z2KA 2HWZH 5EOQL 3U2SA 5CEXB 3QHZL 4TTDC 4N0UB 1BECA 5HYJB 3D2UB 3B2UC 3DX7B 2UZIL 12E8L 3ZKXB 1RULL 5EFIA 3MUHL 4J7RA 3MCLH 3VXPB 3HFML 4UI2A 3DUUB 4J6RH 3P4LA 3TA3C 3TJHD 4YPJA 1BFSA 1F6AA 5KJRH 5C07D 1P5UA 4U2ZA 3P11L 2A9ML 3QHTC 1NCBL 1XGUA 2FJGA 3LV3A 4MAYC 3WXVL 4HCRH 2AERT 1MRFH 2FEDC 4OFIA 1YEDA 3U0WL 3BH8B 4P2OD 3UDWA 5EU5B 3PL6D 5EU3B 4XZUB 1H15A 5EU6D 3KPPA 1J0YA 3DVGB 2XKSA 3KDMA 1VACB 1DQDH 5B39B 2P48B 3WNLA 4HJJH 4PY8J 3MJ7A 3WSQH 3I2CH 4HIEB 4MJIE 3BH9B 4M6OL 4P2CG 3WJLC 4WDIA 3KR3L 2FYYB 5BRZE 3BRFA 3KPNB 4L29B 1AO7A 3MV7B 1U95B 2GW5A 4L8SB 2ARJB 2VDQH 4HG4K 4YE4H 4KFZC 5FGCE 4LLYA 3ARED 1MRDH 2HLAB 1V7NH 2GJZB 5JHDA 4ORGB 1UB5B 3OXRA 2XTJB 5DQDH 1BFTA 4MQXD 2FZ3B 2AXJA 4KK8C 5ILTH 1IKNA 1XIWD 3MGAA 4DKAA 4L8SC 1G6RB 5GSRA 4P5TC 2EYTB 3V4VL 3G9VA 3GIZH 4I1NB 5F7EL 2ZOLA 3HI1A 3MXWH 4Z78A 4D0BA 5BV7H 4GKOA 4K94H 4DTGL 2IANB 3GMLB 1E6OL 3BZDA 3WHE1 3SDCB 1JNHB 1CFSB 5CHNA 3NZ8B 1Q0YH 5FOBA 3O11B 1TZIB 3PUCA 3H3PH 3TBVB 5CIPA 4YLQT 1VERA 4XCYA 4HFWB 3MRQA 4OCSH 1UEMA 1LNUB 3RTQD 5JQ6L 4HT1H 4PJXF 4GQPH 3QAZC 4XP6H 2NY7L 2FR4B 1OPGH 4I3SH 2VXSH 3RWGA 1H3PL 2FR4A 5CJXA 3WNOA 1FLRH 2EYSB 4LSDA 5HHOE 4M43L 5TFSH 5IB1B 3KJ6H 3FB6B 1BQUA 3VFTB 4RCAA 3QZWA 1BP3B 5E5UB 4I3RH 1XFPA 5GRJL 3ZKXC 4X7DC 3IXAB 1KLUB 4OLWL 1I9RL 5J11C 2F5BL 2DL2A 3TNMB 3UJTL 3RDTA 4WEBH 2FCBA 4G9FE 1CFSA 1PD6A 3T2NL 4MJ5A 3CX5J 2PXYD 3QUKB 1K4CB 1PFCA 5HVFB 1VGKB 1K8DB 5FO7A 1LE5A 1KBGH 4I48B 4YDJA 2EDEA 5BVJA 4OF6A 3O3DA 4Y5VC 3TIEA 4LSQH 2ADIA 3H3KA 3QXDB 2OL3A 1NMAH 2BHZA 4F58H 5E1AB 4S1DC 5FYJE 3CZFB 4PRHB 1JRHI 1B6DA 2EC9T 3MYJB 4GLRH 2P5WB 2X70B 3HB3C 4ERSL 1OP5K 4XCCH 4Y1AB 3ROLB 3FL7A 2IAMC 3RWEA 1D5BA 2PO6D 2YC1A 5J6HA 3KPSD 4NKMA 3B6SB 3CU1A 4ZG1A 5ECJE 2EDTA 1X5AA 4F9LC 3T3PE 4OLVH 3KLDA 4XAWL 3E6HB 5J3HD 1NANH 1GZQB 1S9WB 2VH5L 3GI9H 3W9EA 3GSVB 3RBGA 2C5DC 3G6JB 1LP9E 4MD4A 3Q0HA 1T5XB 3UXFA 3AMLA 5FCUL 4DCQA 1WWBX 4I9WD 1Q8MA 1W72H 3T8XA 5T3XE 4JJ5B 1QQDB 5DLML 2R29L 5I8KH 5JXED 2FECL 4YBHA 4NRYA 3RGVC 1HN1A 3CPLB 4UIKL 2XICA 1G7MB 1KXVC 3CSPA 1CFVL 3L3GA 5E4IA 2A1WH 1F42A 2V5RA 3OKKA 2B1HH 1DJSA 1B0RB 4UB0L 1FIGH 4X9IA 5GRVL 1EEZB 1DBKL 4LSVL 2XKUA 4I4WA 4QRPB 2NY4D 5CP7A 3IF1A 2YUWA 4OGAD 3WIIH 4U1LA 4KWUA 5HY9B 1ZT4B 1CZ8L 2PCPB 1U8OB 3GMPB 1IT9H 4EEEA 3ZKQD 3I6GB 1BJ1J 2JCCB 5CILL 4XP9L 3S97C 3MCKB 4NHCL 4PJGE 2HP4A 1AE6L 1RZ7L 2PCPA 1RZKC 3FN0H 3VXRB 4ZUTA 1Z9OA 5B3JF 1NCBH 3BP5A 3WHE0 2QHRL 3EO1A 1C5BL 3HZKA 5JR1H 1KCVL 2EDWA 4HAGA 3FO9B 1KYOK 4HWBH 4R26L 1QSEA 1UC6A 3SE3A 1S7QA 2WIIA 4DW2L 3Q6GH 3D39B 3LRGA 4XXCA 5A40E 2OP4H 1MJJB 4Z0XA 3U36B 1OGAD 3N85H 1ETZB 2ATKB 4MDIB 1DEDA 1M7XA 3MLTA 2NR6C 3C6SB 1EUUA 3U36A 1KLGA 1IGML 4N1HB 5BOPA 4X7FC 4KROD 4LLDB 5GGSA 2OR9H 4U3CA 3JWDC 4NWTL 2HVKB 4WU7B 4KKLC 1UWXH 5KZCB 3HC3H 5MEOB 1TQCB 4FQCL 4YPGA 5A2LH 1IGIH 3DV6B 3H9SA 4R96A 2JJTA 1X5HA 2HJFA 1QBLL 1B88A 2I25N 2X1OA 1SY6L 2BNQB 5BV7C 1AQKL 2QADC 5HDQH 5F7EH 3QIBD 3D18B 5D96C 5EOQH 3JVGC 5LG1A 3EOAB 5EUOF 5D4QA 1X4ZA 3QDMD 4Y4KB 1E6OH 3DI2B 4JFYB 2I9TA 5IESH 1Y18A 2YA1A 5H94B 2CRYA 3IDJB 1D9KB 2XN9E 2DB8A 2VDNL 4IMLB 3AM8A 4LK4A 4BYHA 1EHXA 3MA9H 2YS4A 1PZ5A 4WFEE 4G6JL 1M7IB 3UBXB 3O3DB 1XGQB 1U91B 4OCRL 5HVWA 1T2XA 1IFHH 2R4RH 1MVUA 4JN2A 2HFEA 5EBMA 1D6EA 1OTSC 3OHXA 2QSCL 3WUZA 4BQCA 4RAUA 3MOAL 4ZNCD 2OK0H 4KDTA 1F2XK 3C8HA 4ZOCA 5IK3A 3WDHA 5K9QI 5I2IA 1PKQA 3LAFA 1C5CL 1FN4A 4DKEH 1RY7B 3O3BA 3GZKA 4L8BB 2BNRB 1BVKA 2L7JA 1F11B 1ZT7B 1KCLA 3QI9B 1B4JL 2OS7A 1EJ6A 3QFJB 2XG4A 3A0OA 3MV7D 3PIQB 2N7BA 2IFGA 2RIKA 4M6NH 1CI5A 3VMPA 1QBMH 5JW3L 1UJ3A 3NFNA 4HKBB 5HYSG 2Z92A 3OKOB 1A3QA 3H9HA 2F15A 5DJAB 3VMOA 3SOBL 1HH6B 1ES0A 2XKNA 3WL9B 4BSJA 4F3FA 5BZWA 5GGRA 4HV8A 1PVHA 4IRJD 2OTWA 3KPTA 4JFFE 5E5MA 2H6PA 3QNYB 2HFEB 4JFYA 4M1DL 5C3TA 4ZO7A 4XGZA 3QEQA 4JFOB 3MRRB 1CE6B 2DQCL 5L7XH 1E4WL 1I9IH 5C6TL 5F96H 1KTDA 1SY6A 2IFFL 3QUXB 1N8ZA 2Z0BA 5FV2A 5D6CB 3Q5TA 1CXHA 1OPGL 4I3SL 1P4BL 1FORH 4EDXA 1TIUA 4YHPB 3M1BB 4H0GA 1BVLA 2JLLA 3VWJB 4J12A 3CVHL 4M43H 3O2DH 5DJYB 3AXLA 3GJFK 3BGFC 3B2VL 3KYNA 5DK2A 1HHJB 2A6IA 4FFWC 3NCMA 5A3IC 3RVWD 1JTOA 1WFTA 2HLFD 4Z0XB 4OZIA 4GRLD 4WU5A 4RSVA 4NZUH 5ACMA 3OR7A 1UM6H 1YMMB 3DSFL 1KN2H 4HJGB 4EIZC 1PSKL 1XF3B 4LEOA 1OHQA 3JWOL 1IGYB 4X99A 5GS0H 1SQ2N 1DUZB 1ZAGA 4OFKA 5EUOB 1DSFL 1BFOB 4NPYA 3NCEB 1ZHKB 5E94A 4P23B 4XNZC 2KH2B 4MLSA 4JKMA 4YBLC 1WCQA 3ZLQC 2WV3A 4P4KC 1DP0A 4K7PY 4PRIE 1MH5A 1UG9A 1YQ2A 1OGAE 1T20B 1WT5A 2UWEF 3LRSA 4F8TA 5D7IE 3O4LA 3BAEL 3RQ3A 1RIVL 3WS6A 1NJ9A 2VDLL 3L6FA 4LCIL 3UTOA 4ZNEA 4ODWB 4LSSH 1FYTB 2ADFH 3NCYP 2G75B 2VZTA 1HCFX 1JK8A 4XAWH 1YY9C 5E2VH 2DYPB 4DUVA 2YKLL 2V2WB 3WJLA 2E27L 4MA8H 5D7SH 2AK1L 1NAMA 2V2XA 4HKXA 5F9AC 4ZPVB 1T04A 4M93C 4PJ5A 2GJ6B 3TA3D 3TJHC 4JFFD 5E6ZA 3MUGB 1RUAL 3RI5K 1FL5B 1DE4A 5TE4L 2V7NB 3WJJC 4NN7C 4MJIA 5I8KL 4NGHL 6FABH 3VXQA 2GJZA 1BQHB 5BRZA 3QIWA 4WFHE 2QQQA 1KACB 2FEDD 4Z7VF 1HHJA 5ITFA 4V1DE 3S4SG 1S9YB 2XZCH 2B1HL 4JLRB 3TC9A 2JJVA 3KXFD 4EXKA 5I8CA 4TSBH 2W9EL 5T3XD 3L5XH 1NGPH 4GLRI 4I9WE 4H25B 3BKYL 2BOCA 4TN9A 3V5KA 2WBJC 2CLZA 1LO0L 3OAYH 3AREC 4PG2A 5ISZA 3NMEA 2JKXA 1GYAA 5J1SC 1RZ7H 4CADA 1XGRB 3PG2A 1G9MC 2FIKB 1KPUB 5IB2A 2AJ3B 4GRMB 1J8HB 1LO2H 2AAVA 4YBQC 3V4PL 4KQ3H 2XTJC 5A2KH 4WFED 2ZKHH 3EOYG 1S7TB 1BPVA 3QEUA 1UYWL 3N85L 4IIQB 5EU4A 4HWEH 1FL6A 2GY5A 5FUZL 5J57B 3QZWB 4D0DB 2GEEA 5IB5B 3ZE1F 2R2EB 2RCSL 4UV7H 4AY0A 2VWEC 2F53B 4PRPB 2P7TB 2OR9L 3VGGA 4HQQL 4HUXB 1XGTB 4M6MH 1MHEB 5TF1H 1C08B 3INUH 3LS5H 4MJ5B 5FGBA 1FC1A 4FQCH 4GKSB 5D5ME 3FONB 5HYJD 2QKIB 4U49A 4WFHD 1KN4L 2PR4H 3C5ZC 2ZNWA 3KPMA 5IFHL 3ULUE 2P5EB 2UZYB 3BH8A 3S35X 2GT9B 4PFEA 1ZANL 5MENE 3QUYB 2OTUB 5J12C 3JV6B 1BVZA 3I3EA 1BMGA 1MCQA 1FE8L 5I8CB 2X10A 5CUSL 5E9DD 2JB5H 3BD4A 3RVXC 3GI8L 3RWEB 2X2YA 1U8LA 5CJQH 3HPJB 1ZSDA 3Q6FA 1ZLVK 1W0VA 1RIUH 3PE9A 1QPXA 2YZ1A 3FTGB 5E9DB 4F33B 1JWSB 2NXZB 3KLHC 2F53D 2RFXB 2NY2C 4PJ9A 4Y1AD 3MGTA 3B5HA 4OQTA 5B3NA 5CCKH 4V2BA 1AIFA 3IVKB 3BWAA 4U3XA 2NY3D 1FORL 2XN9D 1A6WH 5KZCD 1LK2B 1U3HC 4RFOH 1GGIH 4JE4B 5E2UH 1H8OA 3QUKA 5BW7A 4X4XB 2IANA 2QSCH 3EYFB 4M62H 4UMGA 3GDBA 4XPGL 2OK0L 4JRXB 4XVUD 1EMTH 2RHEA 1LMKA 3LY6A 1NAKL 2PO6C 3QDJE 3QUZA 4ZD3L 3HNVL 4NO2A 2X44D 1RHHB 4PJXE 4X8JA 5GJTH 1I7ZB 4XZUA 1NKRA 3TP4A 4HGWA 4MS8C 2X7LB 1U0QA 2H26A 2ZUUA 4OD3H 3GSNA 4WTWA 1IBGL 3BSZL 4KV5E 2OYPA 3LKRB 1S7RB 5I75B 4HIIA 4ZTOH 1JPSL 3MLXH 4IOIA 5J6HB 2BNRD 1DSFH 2DQUH 2GFBA 5TDPA 3BD3A 1SJEB 3LKRA 2DTSA 1Y6MR 2D7PA 4PJEE 3TYFB 3KS0J 4PS4H 4CN6A 1X9QA 5DFVD 4RFNB 2P8MB 1JPTH 3EO1B 4KGJA 5FUCE 2FHBA 3QEHA 1YEEH 1S7QB 3DVNA 1NBYA 5DC0A 1I9IL 4OCYH 3M17A 4ZS6D 1JUFB 4BFIB 4QRQA 4S1SL 4WW2A 2DQDH 3DIFB 4GO6B 3LQAH 1MIEH 2HT4D 4NN5C 5AD0B 5FYJU 3S36L 2C9AA 3RWFB 4DFHA 1QFPA 2ESVE 3BQUA 3U82B 2JELL 1Y0LA 3QFDB 4PB0L 5HD8C 4NCDA 1G7QA 5F9WC 1P7QB 5K59E 5JLZB 1AGEB 1VA9A 4K07A 4W4OC 3HAEH 2PXYB 4U1KB 3KXFE 5L9DL 3GMRA 1AGEA 2W0FB 5DURD 5K9KB 1XGYH 5GISH 3IFNH 5DJXB 4R0LB 2VXUL 3HR6A 4JCMA 4G5ZL 5FKAA 5B8CA 4D0CB 1H5BC 4AL8H 1CD9B 5TE7L 4MCYA 4IRSB 2JCCA 4FZEL 5D70L 1A6AB 2XZCL 3CFBB 1A7RL 4JPVL 3QEHB 2H26B 4G6KH 3PWPA 4LVEA 3WIHH 2AEPH 4Z7VE 3HRPA 3M17B 3KS0H 2VDKH 4K3EL 2DN7A 2COQA 4QOKE 3CH1A 3E1F1 5HYSA 1KG0A 1JMXA 5DD0H 1XZ0A 3BPNC 5F7KC 5I15L 3U9PH 4FXLA 4MDIA 3B9KD 2EIZB 2N4IA 4F7PA 5ICYA 1EHLH 4P2YA 2OZ4L 4PJFE 5BQ7A 4LCWD 3HC0A 4CJ1A 3VXTB 1AI1H 1QACA 3U0WH 3L3KA 1YN7A 4M1GH 4QXGH 1W0WA 4KHXH 4PJGA 5ANMA 5AWNL 4Z7OF 2AABH 1NBVH 3U0TA 3ZE0E 5D6CA 4PRID 5DJCB 5GS0C 3GMQB 4FQ2H 4LLMA 3A6OA 4M4RA 5AD0A 4MNHA 3TT1H 1K5NA 4I5BB 3DETD 5HY9A 2JJWA 1JPFB 3VJ6B 5DT1H 3VRJB 4A2LA 3MACH 3D18A 5IB3A 1RZGB 3FHAA 3VRJA 2CUIA 1KGCE 4CU8A 1UJTA 3EOBA 5CZXD 35C8H 3K1KC 3RIAK 1V7NL 2P5ED 4NQEB 4QRTA 3U46B 4RX4A 1OGAA 4JFHE 4G8IA 3O6FA 1J8KA 1FYTE 5IVZA 3NA9H 4ZNEE 1ZE3C 4U6HB 1KCSH 5HHOD 3T0DA 4DTGH 3L5XL 2OSLB 4DUXA 2AQ3A 3HAEA 5D7IB 3CPLA 1L7IL 3V6BR 3ARGB 1X7QA 3F7PC 2APFA 1LO0H 3H3PL 2Z35A 3V0VA 2UVEA 1QYGL 1XR8A 5DHXB 3QUMH 4JFPB 5IIEA 3MRDB 2CO6B 5C0IB 5JQ6H 1IGTB 4KRMB 3O3AA 4XCFL 1FAIH 4XAKE 3NAAL 1A4KA 5CCKL 4F37K 5L8JB 3GRWH 3WS3B 1HH9B 5GSVA 5D6DA 1M6OB 1T66C 2PO6B 4OF0A 5KSVA 43C9A 2D7QA 5IM7B 4IRJC 5DJYA 4Y2DD 1PEWA 1ZWIA 1CICD 1D5BB 1N7MH 2FEEL 3FQRB 2CDFA 4NRXB 5T1KB 1JMZA 3VWKB 5JHLL 2H1PL 4PGZA 4HZAA 5H35A 1QFWH 2F5BH 3C5SA 1PQZB 4LSTH 1A3LH 2HTKD 3L9RB 4EI5D 4P4KB 1XEDA 3THMH 2J6EH 4PJHE 1F4AA 1EVTC 2AEQH 5IG7B 5JOPD 4A6YH 5JZ7D 3UYOD 1FZOA 1AH1A 2AXGB 3L7FA 4QF1B 3BISA 3U30B 3VXMB 1I8IB 1TCRB 4Z9KB 4PTTA 3QQ9D 3T0EB 3VWJC 1KJ2H 4P5MB 1TFHA 3RVWC 4MJ6A 2E8YA 4PB9H 3FQNB 1M71A 3GSWB 4PV8B 5EZIL 4JFFB 4PJCE 4XCCL 4GRLC 2IAND 4OIAA 1DANU 4N68A 5E08H 5MEPA 3SGDI 1HYSD 2BCKB 1NLDL 1R3JB 4P3CH 4NJAH 4E41E 5FM4A 2Q76B 3QT2A 1QO3A 4PJ9D 2GYSA 1G7JA 4H88L 3NZHH 2DOCA 1A6WL 2PYED 4U1JA 5C0DA 2E7LC 1ZEAH 1JZ8A 4PB0H 3BZFB 1S7TA 2EYRB 2VIRA 2ARJA 1F3DJ 1EGJH 3QI9D 4U1HB 4DOHB 4NWUH 3VGAC 1YNKL 2BSSB 3OF6D 1HHHA 1T7WA 4WWID 1DVFC 1FPTL 1CE6A 3N0PB 3EFDH 3QG6B 3VH8G 5FYKH 4G8EB 3ZHLA 3VE0B 1G7LA 3TNNB 3FCTB 1YY9D 4GS7B 4JFED 1CFVH 3SE9L 2A1WL 3HMXL 4MB3A 5HHPA 5AAWA 3O9WA 4CDHA 3O4LB 5F3BB 1DBKH 4WUUE 5J0BA 4M7ZC 1WAAE 1LP9A 4ODWA 5F7YC 3I50H 5BS0E 4M93B 2ICWB 4Y2DB 5GJSH 2YWZA 2CDFB 4NRXA 5K9JH 1Q1JH 4QXTA 1QRND 5D5MB 3C2AL 4FQQA 5SWSA 3RWCA 5T1KD 3VWKD 5EPMB 1KNOA 2ZUSA 3QUZC 5C0EA 3BUYB 3CDGA 1WGOA 2QHRH 5EBGA 4R0LC 3NIDE 2OZ4H 1BBJB 1LO5B 3D0VA 1YMMA 3DV4A 4WO4A 5JORB 3EJJX 3KYOB 2FX8L 2FD6L 2DQDL 2YZ8A 4M1GL 4X0KA 1EV2E 3D3VB 1RZFH 4NT6B 5AWNH 3DMMA 3E3QC 3QCUL 5JIKA 4Y4HA 4HMEA 2WBJD 4AMKL 3MRNB 4PG9A 1J8HE 1VESA 1AFVL 2YPLA 2MPAH 3IDIB 3ZT6A 1YC8A 3QR2A 4HK0B 1CIUA 3DRQA 3BN3B 2D7NA 1C08A 5DT1L 1XGQA 1X5IA 2DF3A 2CRMA 3MLZH 1V5JA 4D0BB 2Z31A 1EDQA 4TVPE 2VISA 2CUMA 3IAGC 1IEAA 2VXUH 3FQUA 7FABH 35C8L 5ACZA 1IGIL 4UZGA 5F21B 4U1SB 4OIIH 1QBBA 1ZLWH 3TEUA 5CJOL 5EU6A 4MAUL 4Y4KC 1NGWB 3BP6B 5CEZD 3ARWA 2VOTA 4YWGH 1YUHA 3HC4H 2AEPL 5HHNB 3REWB 4MJID 2AJ3A 2XIDA 4PJFB 4KMLB 4I77L 2E3VA 2W0PA 4HUWB 4V2CB 1XGPA 4O58H 3NBNA 3LRHA 5GRZA 1AGDB 2WIMA 3SJVD 2WWKT 1DUYB 3MA9L 1ERNA 3LIZH 3QO0B 5I15H 1FP5A 1G9NC 1S7WB 3WFBL 1ADQA 4GG8B 3X17A 2JB6A 1N59B 5I73B 1FBIL 1WUNT 1QRNA 3DMMD 4KK5C 4YK4C 3V6OE 4WHTB 4R2GD 2O5YH 1NH6A 4OCRH 4X5WA 1X5ZA 2I9LB 3T0BA 2HKHH 1ORQA 3T3PF 1MFEH 4FTVD 3KG5A 4XNYL 4RGMB 4EVNA 4Y89A 1PG7X 4MDJB 3Q5YA 2O5ZH 4PJ5D 2WANA 3BP7A 9CGTA 1KCKA 5CBAB 1F00I 2FO4B 5KANI 3DHJA 5FYJD 5I1LA 1J0JA 4XBPB 3UPCA 4PR5A 3RU8L 1TJIL 1RUMH 3LN5A 1EFXA 4HXAL 3ZYIA 3MACL 3NCJH 5F1IA 3PV7A 5EO1A 2EE9A 1A3LL 1FGVL 1I9EA 4DKDC 4U7KA 1JNHA 5CHNB 3LS4L 5EUOE 1T04B 2ZCLH 1NCAH 2GAZA 4HPYL 4L5FL 2XA3A 1UH2A 4NO0B 4Z7QF 5I71B 2OJEA 1P84J 3IDXL 2P46B 5JW3H 2RQ8A 5IQ7L 1T5WA 1U8IA 4XB7A 3LKQB 5FK9B 2AJXL 3T2QA 5LGKA 4DWHA 4KI5D 3HE6B 2P49B 4LVHB 1IAIM 5FKPA 4HLZG 1YYLH 3QDJB 1JVKA 4AEIL 2A73A 1S7SB 4HCRA 4F80A 1QLRB 3X12A 1U6AH 4LIQE 3JXAA 3SQBA 4ZAKA 1NFDF 1UZ8B 1NEZA 3EOTL 3MRPA 4WHCA 4TPRL 4PIRF 1VGKA 5E00A 1UM5H 5DGQA 5IB4A 4HSQA 1MSPA 1I3GH 5F8RC 4H1LH 4LEXH 4GBXD 4P9MH 1ZGLA 2PN5A 3DVGA 2R39A 1XF1A 1TMCB 4OLXL 3S96A 4CKVX 2Q6WA 3HR5A 3GSOA 5HTSA 2DDQH 1KEMH 4KK8D 3ARTA 1OAKL 4QY8B 4RGOH 5DD1H 3BWUC 5DFVC 2JJSA 4RAHA 3QDGD 3SN6N 4LLUB 1CTOA 4MMXC 4PGDB 4EXPX 5IEKB 1KB5H 1JF5A 3LQAC 5BV7B 2BK8A 1H0DB 4M7KH 3O3EA 4PJEF 3CDYA 5ALCH 3G5YB 3MJGX 4DQOL 4QXWA 4U6XA 5B38A 4ZS6C 3KPRD 3ZZ1A 4YZFF 1SJEA 5TE6L 4W6XB 1F58L 3FJTA 1NDMB 3RRQA 4K94C 3CUPA 1KN2L 1XF5A 2J6EL 1J05B 4R7NA 2OI9B 1MJ7H 2EDHA 3VXRD 1MLCA 2R0LH 4N90D 3HE7D 4IJ3C 4YK4B 4NKIL 4OI8A 3GEWB 1NCUA 1ZVSB 3OKNA 2BXYA 3IDYB 3DX6B 2P8LA 4ZAKC 3BX7C 3MRIB 4GKZB 3T8XB 4UNVA 3WFDH 1ZLUH 1HK6A 5E4EB 2DIAA 4N0CD 5F3HA 5GGVY 3PV6A 3RWDA 4ONHA 4JKWA 1HKFA 4ZAKB 1MY5A 4H25A 3S5LG 2HT2D 5E2VL 3K8LA 2FB4L 4X6CF 3GO1L 4ZS7H 1RZFL 1I3RB 4DGIL 1Z5LB 4QTIH 1R5IA 3MRCB 3LEYH 4PJHA 3EDDA 2IH1B 5SV3A 3MRCA 4QT5B 5IMLB 5C3LD 1ZLVH 1S5IL 4KHTH 4CVZA 1GGCH 1X5JA 2N1KA 3B83A 3ZE0F 3EZJB 2WINA 2Q1EA 1BOGA 3RIFF 3V6ZA 1G1CA 2IJ0C 1HOCA 5FOBB 5FO7B 5TGBA 5DFWH 3SE9H 3DXAD 2YXFA 5F3HB 4Y5XA 4BFEA 3HZMA 3T4YB 1KCUH 3MV8D 4PREB 1TTFA 2W9EH 3UP1A 4XPBH 3O2DA 4PJ5E 3RI5F 1AKJA 4G9DA 4FTVE 3PQYD 3FFCD 3TYGH 1Q1JL 5EB9A 3QNZB 1HINH 5I1DA 2Z31D 5CGMA 1M71B 4P5KB 5E7BA 3VFPB 5JXEC 4GXUN 3UMTA 1CGWA 1CL7L 1LEKB 1P1ZA 3F58H 4YQXH 5DJ0B 4D8PB 2E9IA 1MCPL 4XMKL 3TBSA 4MA1B 3RKPA 3WV0A 1T5XA 1OTTC 4HWEL 4PJDB 4NQDA 3DVNB 1FZJA 1WFUA 1AP2A 3I02B 4RFNC 4KPHH 3GJFH 1MI5B 4NQDB 5ESQB 1BJ8A 3C5SB 4HQQH 1KPVB 2V5TA 3BZFA 4KJQD 4RWYH 2H2PC 1MF2L 4RZCB 2YD1A 4BK4A 3W81A 5C2BH 1OAZL 4Y4HC 3MJ9A 3T77A 4LDOB 5SWSD 2MCPH 3VXSD 5CAYB 4CVZB 1TVBA 3HC0B 5D1ZC 1X7QB 4HX1A 4PJBE 1EFQA 1YEHH 3IAQA 1B0GB 5FYKD 1I3VA 4NNPH 5DJZA 5GGVH 5DEFA 1X5FA 4OLEA 3OTTA 4AEIH 2NR6D 1GGBL 4X6BA 2ICEB 5AZEL 5GGUB 2E6QA 3DX9B 3WHXB 3NPZB 5EC2B 1OAXH 4PLNC 5IOPB 5FV1L 1RIUL 1MJ8H 4PV9A 2C3WA 3SDXF 2XZZA 4KVNL 2VLJB 4LF3A 5D5MA 2D9QB 1AD0B 5HDOA 5ISZB 3OKNB 1UWEH 3CVIL 3RNKA 1WISA 4RGNE 3WL9A 1NBZA 2LU7A 1ZVHA 2A83A 3LHPL 4DK6A 4LOUC 1A7OL 1HSAB 4NN7B 3BN9D 4GG6E 5AUMA 4RGOL 3TLRA 1OM3H 4LSRL 3NN8B 5INDA 3QIBC 1CFTA 3UTSA 1DBMH 1GC1L 2O93L 2X9XA 3VXTA 2MFNA 2C26A 3QUXD 1HYSC 4AM0B 25C8L 2R15A 5GS2D 3FMGH 3MREB 2R0KL 1ZHKA 2FJHB 5E94B 3O2WH 4MVBD 1F4WL 3KNBA 3SJVB 1FL3A 4G7VH 3ARGD 4R4NC 3CSYA 4YDLC 5JW5A 4A6YA 5EBMB 3TO2B 2DQUL 1DQJA 4TUOA 5KSBF 1K2DA 3TFKC 1HXYB 2FECI 4JFZH 1QLEL 5AYUH 2BVOB 3HG1B 3HPLB 5E95B 1OTSD 1P6AB 2ZJSH 3ULVC 3E0GA 4KK6C 5HHNA 2BJML 1X4XA 2LQRA 2NTFB 1U3ZA 1UQSA 4B0MM 3U48A 1RURL 2VL5B 3C5JA 3EOTH 1JRHL 1ACYH 3K1DA 3M1BA 1WBYB 2O5XL 4ZUUB 3CFCH 5DK3A 1DANT 3KLAA 2ITDA 2ZOKB 2XT1B 4FQLL 1INEL 1I3GL 3CFIC 4N0UA 1KJ2B 5HYJA 1WBYA 3T65B 4WUKL 2XXMB 3X3FH 3DUSA 2R23A 2DAVA 4NP4H 3O6LL 3RX7A 1IJ9A 1KTDB 5TQ2L 1TETH 4Q6IA 4EKXA 5KSAC 1IM3B 4KTDL 2ADGB 1SYVA 3LEYL 2E7MA 4HK0A 1KIRB 2VZOA 1SEQL 1C7TA 3EAKA 3TBTB 3ECBB 1CLOH 4X6BB 2OTWB 5JOPE 3X13A 3RUGA 1EO7A 1MUJB 4M7KL 4RQQA 3P0VL 1OAYH 5ACZB 1RK0A 4PRHD 3CGTA 3EJYC 4LRIA 1HQ4B 4EDWH 4KRPC 1NLBL 4ALAH 2A6IB 5E70A 1IAKA 2Q3ZA 3IETA 1WWAX 2FJHA 3HS0A 3QWQB 4P2RE 4FZ8L 4IRJB 1WWCA 2ZUQB 3M07A 2WNGA 4YHNB 3OKLB 1BX2B 3KJ4B 1I3UA 2FGWL 2XWJA 4KH2A 2EXWC 4Z8FH 4IOIB 3ESUF 4MXWL 2L4OA 2GCYA 1LVEA 5HPMA 1S7WA 3TO4D 2QV2A 3FO1A 5GS1C 2D0GA 1A1MA 4JHBA 3CFJA 3O41A 1Z3GL 3N9GH 4JQVC 1AY1H 3GM0A 5C0BD 3VXNA 3R8BB 4PGEB 1Q9KA 5KSUA 3VRIA 3NIFE 1NEZG 3CX5K 1TTGA 3FB7B 1C1EH 3U30C 5HHXL 1RFDL 3MXVL 2ICEA 2APWA 3KHOA 4QXGL 4X4XA 5F89A 2B5IB 3T65A 2AABL 4U1SA 4MAYB 3U7YH 4KDTC 1SVCP 1FJ1A 5C70A 5H37H 5C86A 2I27N 4UT9H 2APXA 3OKLA 3HE7B 1S5IH 4X6DE 3IFPA 1L7TH 3LH2H 5T3ZL 5HVHB 3ARYA 4U6VH 4FOMA 4PJFA 3BPOC 4MWFB 1JFQH 4ODUB 1A1OB 1A1MB 4HIJA 4NZDA 3UTQA 4L4VD 4NOBA 4NZTL 3LCYA 4OD1H 1INDL 1NFDA 4UINL 2EEAA 5C0FA 2VXTH 2NXYC 4ZO8A 1GZQA 4OF3A 4MD5B 1ZK9A 5FA3A 2ZCKH 3DPBA 5D7IF 1NMCC 1ZLWK 4RMSA 1UCBH 4OLYH 3NIDF 2DQEH 1WWWX 3DI3B 4GMTH 3GNML 3U1SL 1KTRL 5KS9F 2X4TA 1CLYL 1HEZB 2NY5H 3FRPG 1XF2A 1PG7H 2J3SA 5JXAH 5KVGH 5ENWA 3TM6A 3ULUC 1X4YA 1QTYT 4O2EA 3ZHDA 3QCTH 4QRSB 1DDHB 1MPAL 2OL3B 4HH9B 4OZHE 1BBDH 3QXDA 3WO4C 4J3SA 3G6AA 3C08H 3S88L 1CDIA 3TGXA 4JM2D 4X80L 5IW1B 4PTUB 2BDNH 1EO8H 4G42A 2F8XC 1FL5A 2XNAB 2ID5A 1GC1H 2OJEB 2ZUQC 5DHVA 4XNXL 3T04D 2VDOL 5I66A 3LKOB 2DIJA 5GIRA 1FG9C 4YDLB 4WW1A 5C2BL 3TJEH 2FDBP 1WEJH 3EO9L 5SX5H 4HEME 4ZQKA 5JOEA 4YXHL 4YUEH 3ARDA 1F4WH 1JE6A 1A9EB 4C56D 1EHNA 2GY7B 4HS6B 4MNQD 4YHZL 1MCOH 2CQVA 3O4LE 1SMAA 2H9GA 1T7XA 2BOBB 3RVVC 3FOLA 5AYUL 5CBAA 4NFBA 4P2QA 2NY5C 3BGAA 4FQ1L 4R8WH 2VQTA 1RUKL 1G7LB 5IBLC 4Z7NF 1UVQA 3JV5A 4K7FA 1NC4B 1NSNL 5FUOH 3MRQB 1XCQA 2XN9A 3RVUD 5A1AA 5IF0A 2BVYA 1U92A 1MJ8L 2Z8VC 2VSDA 2V5YA 3X3FL 2E8ZA 4LNVA 4RA3A 3KVQA 1XGPB 3G5XA 4FQXD 1CBVL 3EFFB 1A7OH 4PJHB 1TETL 1ZTXH 3CXHK 4D0CA 3RL1A 1ZT1A 1ZEAL 2YSSB 4G3YL 5FYLD 3M45A 3LN4B 1CICA 4HBCH 4WHDA 2WBKA 1PGRB 4DKFH 3TBYA 4Y4FC 4V1DD 4U1MA 4PJIA 4IRZH 4NWUL 4QRRE 5F97E 3LKSB 2LTQC 1NGXB 4XBGA 2N56A 3HZYA 3LSOB 2ENSA 4TVPD 1BD2A 2P5EE 3RWHB 2VDPH 4NQUA 5F89B 3ZYZA 1RPQA 3P3YA 5E2WH 1XCTA 1LE5B 1KT2A 4K8RH 1U8QB 2NW2A 4LPXA 4WW2B 3V0AC 3DRQB 5D2NA 2Y72A 5ISZE 3UEZA 2NY2D 1CFQA 5A16B 4Z7UA 5HGDA 2VXQL 1YEFL 5TH2B 2GUOA 3EO0B 3UPRB 4H5SA 1F4XH 3T1FB 3CIQA 2K7PA 4PJAF 2NY3C 4G9FA 2MQ3A 2QSVA 4KQ4L 2XFXA 5GS3A 4JRYD 5DEFB 4P49A 1O5DT 5I6XB 4N8CH 1MRFL 1MVFA 2APTA 1RJCA 3J8F7 3LVEA 4E0RA 4MA3A 3O6KH 3O4OC 4M02A 5DUMH 1LEKA 4NOFA 3SKNB 4QCIB 4YIQB 1PYWA 3L3DA 1DQDL 1XIWA 3PWVB 4HJJL 3WEXA 1FNGB 4RDQF 4HUXA 4KUZL 1RFDH 5HYSB 3FFCE 1JBJA 5IMKA 3WE6B 5E0QA 1FZJB 3KWWA 3BZ4A 1D5XB 2VDQL 5ID1B 1T1XA 5J06A 5EU7E 2E6JA 8FABB 4F7MB 1EK3A 3MTRA 2CGRH 3B9KA 3JV4B 4LDLB 1GGYA 3OX8B 4UBDC 1UXSA 5DR5H 5C07A 1MVUB 5JPNA 3CMGA 4TUJB 1QSED 3D39E 4PTUA 5JDSB 2R4SH 1YDPA 2E7HA 4X6CB 4Y8AA 4CMHB 4BQBA 3FT3A 5F7FA 5FDWB 3OZ9H 1RZKL 5T1DH 5C8JB 1MNUL 1JWMB 2VXTL 3HC4L 3QISA 1T2QH 3DXAA 3IDNA 5C0ND 1A1NB 3IYLW 4R7DA 4X7EC 2YPLE 3W0WD 2EH7H 1FFRA 2HT4C 3LN4A 1UZ6F 4GKNB 4AH2A 4UDUA 2I9TB 3F6LA 4RRPA 3QUYC 4XTRC 3LIZL 2NY5L 2G2RA 1R3JA 1YA5A 2IH3B 3O6FB 1K3IA 4JO1H 3JV0A 1K5NB 5CD3A 1V3MA 1BHGA 4W4NA 1HOCB 1BBDL 4PRDA 1QP1A 2FBJH 4WWKD 4I0PB 4XNYH 3WSQL 1A6AA 1IL1A 3C08L 3S88H 4NDMB 3DX8A 3NCFB 4QGYA 3NIGF 5FCSH 2B20A 1NDGA 5DRZB 1IM9B 4RGNC 3IU3B 4XXDB 1YYMH 3MBEB 5IB4B 4JN2B 1FG2A 1T1WA 1U8NA 3RX8A 4WEUD 2EKSA 1FZOB 3GMRB 4DVRL 4PJEB 1KELL 2CK2A 4PRAB 4UT9L 1HHGA 5IT2H 3MBED 2VAAB 3B3IB 3G6JE 2XZQH 3U4BH 3D85A 3MGOA 4KJPD 1A3RL 2BC4B 2QQKL 1ZHBB 4OKDA 1NGQL 5FYJH 3HUJB 3GIZL 4GRWE 4JREC 1C12A 1J1XH 1T1ZA 1IEAB 1RZGA 5BQ7B 2ICWI 3OPZH 5C0AA 5KSAA 2QEJA 2Y7QB 3UC0L 4PRNB 1L0QA 5FA4B 3TWCL 3F7YB 3U7WH 2YD2A 5DJCA 3GMPA 1FO0L 4F7MA 3QIBB 5I75C 3GIVB 4M8QA 3L9RA 1MWAL 4HT1L 3ZE2F 3VDCA 4F3FB 4QNPE 2XKNB 3OR6B 3TH4T 4Y1AE 1OOAA 5GPRA 3O45B 1JZ7A 1UM5L 2F9BT 4XCNB 3RPIA 1EXUB 2VR9A 5E7FA 1GGTA 1XR8B 4CGTA 4ZOAA 4HX1B 4GQ9H 1DBJL 1DLFL 4B53A 4JRYB 1LDPL 1F97A 2YPKB 2I9LA 3VA2C 4GOSA 3C9NB 1KEML 5BO1L 2AJZA 4KI5E 3KYKH 1PKQB 2DWDB 1J1PH 2G5RA 2X5PA 4CN1A 2R1XB 2UWEE 1HZHH 4MJ6B 5F3BA 3LQMA 3CLEH 1JTTA 4JRXE 4DQOH 4QTHA 3BEVA 4XNMB 3NFPB 1FIGL 4NYLB 3REVB 2VLMD 3QXWA 3RY4A 1KBGL 3FB5A 1NL0H 2V2XB 3IF1B 4GBXA 4P3DB 1YUHB 4NBXB 2AS5M 2CD0A 3WLBA 1IAIH 1QKZL 4X98A 5E8DH 1UM4L 3H7BA 5T3ZD 2W9DL 5B39G 2AVGA 2E5EA 5GGRB 5KSAB 2Z8WC 4HBQA 1NUDA 3BXNB 3QDMB 3WFCL 1DEEB 4XP5L 5HHMD 1QSEB 5D7KE 2DM7A 1MFAL 4KQ4H 2EC9U 5E6IC 2DQJH 4HWBL 3LKPB 5IMOA 5EWIL 5EC1B 1A6ZA 2YPVL 2HJKA 1AC6A 1G9EA 5KAQG 1NAMH 1UACH 1P7KB 3GI9L 2PTVA 1N2RB 3BKML 2WUBL 2DLFH 3SJVA 2CLZB 4EI5C 4QOKD 3MUY1 4RFEA 1M4KA 4KAQL 1RJYA 2AK4A 4KK9C 4F7EA 3AC0A 1U2CA 4W4OA 1MQKL 4YXKH 4PBXA 1YECH 1NCTA 3JZ7A 4XWGL 4AENB 4H20H 2CMRL 4OGZA 4DKFL 2P8PB 2E9JA 1D5MB 5T33L 1NAMB 3IFPB 3WUWA 1AQDA 4PGCB 1BX2A 3VWJD 4F57L 4NZRH 2EDLA 2XQBL 3W0WA 5DRNB 4MQTB 5MEPB 3OJDB 4FFYH 1TITA 4FABH 4HF5L 2RAMA 4ACPA 5DRZA 4ONGH 3K8MA 3LB6D 1YMHB 5FK9A 3L3IA 5B3JE 4NSKA 2OL3H 2R2EA 2YOCA 3QDJD 1MI5A 2CJUL 4HXBH 4P48A 1L4IA 4OGXL 1JYXA 5B38G 4J4PD 5CILH 3MLSH 3FN0L 1LK2A 5JW4N 3LPFA 4NFDA 5KTEL 3OAUL 5DJ2A 4YAQB 1Y6KR 4A2MA 1ROWA 4U1HA 4ELMF 1URLA 3N1FC 5HGAB 2VITA 1F4YL 4L3EB 3V5KB 3GKWH 4HS3B 1KEGH 1N5AA 5GSRB 5CWSB 1SMOA 4J4PA 3N06B 3RIFK 5DEZA 1CE1L 3AB0B 4ELKA 1OSPL 4I18A 2IPUK 4PJIF 5T1KA 5LAXA 3VWKA 2NXYD 4EN3B 4EUPG 2F54A 2X4UB 4FNLL 2VISB 5CLTA 2AV1B 1HHKB 5K9QG 3RUGE 3KPNA 4L29A 5AYQA 5L2KE 3O3EB 4YO0B 4MQSB 4KY1L 3SDXA 4K3DH 5DMIL 1YEKH 3V4UL 3GUTB 2ZSVB 3HCVA 1FL6B 4YR6B 5I16B 4G9FD 3ULUD 4OLZL 5SWQA 1MF2H 3HCVB 1Q9LB 5B4MC 4KZEL 1TCRA 5HDQL 5E99L 5C0EB 5IV2B 4HUUA 1LGVA 2VDML 3VWKC 2ICWJ 4DN4H 5ETUA 3DV4B 3H0TA 2D31A 4PGBA 1GRWA 4I0PC 2R2CA 3F5WB 4JO2L 4K3JL 4LCCC 4M1DH 4XC1H 4XT1C 1ETZA 2ATKA 1K9TA 2NW2B 2CIIB 1HXMA 2A74B 3WFHA 4I18B 3DYMA 1G84A 4XMLH 2MNUA 4UU9A 2R9HC 2I07A 4P46C 5C6TH 3SO3C 4G6JH 3CU7A 4V1DA 4YHIB 4YXLH 1OCWL 5T5NG 1AKJB 4G9DB 4EBQL 5IFAH 5HHQB 2EE3A 4XNUL 1J0KA 3GSRB 1WV7T 4ZFOB 3QXUA 1N3NA 1WIOA 1HXYA 5DHYB 1DL7H 4CU6A 2D03H 3DMMB 4J3WA