3O6KL

Crystal structure of anti-tat hiv fab'11h6h1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
217
structure length
217
Chain Sequence
DVVMTQTPLTLSVTIGQPASISCKSGQSLLYSDGKTYLNWLLQRPGQSPKRLIYLVSKLDSGVPDRFTGSGSGTDFTLKISRVEAEDLGIYYCWQGTHFPRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11H6H1 Fab' light chain
publication title Fab'-induced folding of antigenic N-terminal peptides from intrinsically disordered HIV-1 Tat revealed by X-ray crystallography.
pubmed doi rcsb
molecule tags Immune system
total genus 51
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2010-07-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o6kL01
2QQNL 1ZANL 5FA4A 4JJ5B 3VRJA 4G6KH 2HVJA 4PTUA 1DFBH 1YN7A 4ZUUA 3SKOB 4G9DB 3GKZA 4KKLD 1EH9A 5K9QI 1MCJA 5E8OA 2OYPA 2EDJA 3DXAE 2CJUH 2FO4A 1QLEH 2XZCH 4IOIB 4RFEB 4BQ9A 3O8XC 1FG2B 2XKUA 4I1NB 5I19H 5F8RC 4XPGL 1FZJB 1AC6A 3RP1A 3QQ4A 1NFDE 3HZMB 2R4SH 5L8JB 1H3XA 2RBLA 3QI9C 1CXHA 3UDWA 4XP5L 8FABB 4EN3A 1A9EA 3CPLB 2MMXA 5FUOL 2GSIA 3DHJA 5I1GL 3OKYA 3QWOB 1D5IH 3Q3GB 4RWYL 2YOCA 4LEOA 4H0HB 1AI1L 5D6DC 3W82A 1ZT4A 1R3KA 5JHLH 1CR9H 2A9NL 2H1PH 4JRYB 1BFVL 5IJKC 3UTSA 1NC2A 3IS0X 3KR3H 4PJIF 3A6BH 3N1PC 1G9NH 2IWGA 1KJMB 4NSKA 1NAMH 3PV7A 1YJDL 2W0LA 4ZFOB 4G42B 4ODXB 5F1IA 2CJUL 3JTTA 2XZCL 3FCTB 3UTTE 3ARPA 4ONGL 4P9HC 1AC0A 4MAYD 3DV6A 2AJXH 5ESQA 4PP2B 1IGTA 3IU3B 5I19L 3OG6B 3T2QA 4JFDD 5FKPA 1I4FA 3ESUF 2EDWA 3WFCL 4HIEA 2WINB 2R4SL 1A21A 3V5DA 4FXKA 4MQSB 4NZJA 1ES0B 4P2RD 4YC2C 3MNVB 3V5HB 4KTEH 2VDQH 5IBTH 3MXVL 2N7BA 2J88H 5D7IF 3CK0H 3L6FA 2VO5A 4YE4L 1D5IL 1D9KD 5DFTA 2IBBA 1EHLL 2DMBA 4K3JL 4O02H 1BD2D 3PWVA 2NCMA 2W60A 2GIYA 4Y5VB 4QO1A 3SKMB 5JHLL 4JVWA 4WUUD 1CR9L 2H1PL 5A3IC 4LVEA 4KY1H 3LKPA 4Y19E 2NW2A 1Z6JT 1K6QH 2QKIB 3F7VB 4JFYA 1P4IH 3DMMA 4U1KA 4FQJH 4H26B 2CIKA 1NJ9B 5FAAA 4OM1H 3A6BL 1G9NL 32C2A 1NGWA 4OSUH 2RFXA 3MGTB 1ZLSL 5DDHA 1NAML 4DOHE 3GI8H 5F7WC 3BO8B 4Z78B 1A0QL 3ZYIA 4QHLB 1A6WH 4D8PA 4HBQA 3MCKB 1XZ0B 1TETL 2DLTA 1DUZB 5JTWA 2Q8AH 3QXAB 5IW1A 3OGCA 4Y5YC 3B9KB 1MREH 3HUJF 3QRGH 4KJYB 4TPRH 3WFHA 2XQYG 1S78D 3T3MF 4POZD 4F9PA 1T5XB 1EEUA 1SQ2N 3D2UB 4BSVA 1HEZB 3K1KC 3KJ6H 1J0KA 2XN9E 3FFCA 3NA4A 4HG4K 2B4CH 4Y5XC 2F8VA 1AO7E 1CGUA 2VXVH 5F6IC 1MFBH 1X4XA 1QKZH 4KTEL 2VDQL 3FO1B 1A6AA 1HN1A 4H0GA 3CK0L 3H9YA 3VFSA 3UBXB 4DCQA 3KDMB 4O02L 3T8XA 5MEQA 1TTUA 3O4LA 3UTTB 4IIQA 2P46B 1I8MA 2Y72A 5J7CC 4YDLB 3TO4A 2D9QB 2GTZB 4M9OA 4N0YL 3UXFA 5FGSA 4KY1L 4NO2B 2HKFH 5I8OH 2XG5A 4JFFE 1K6QL 3OKMB 3T0DA 1IFHH 1P4IL 2F54D 4FQJL 2YBRA 4WFGD 3RTQA 4OM1L 2R2BA 1XGYH 1SYSB 2HMID 1A3LH 2QJDA 4GQ9H 4JCLA 4OSUL 1XGPB 1XF2A 3TIDA 2CKBB 4K7FB 5EZJA 3H6JA 4JJHA 3ROLB 4PREA 4Z7VE 1A6WL 3AU1A 1BFOA 4P2QA 4MGXA 3VXRA 2AK4A 1PZ5A 5D1XB 3OKLA 4K55A 1YPZF 2B0SH 3ISWA 3RU8H 1IM9A 3STLB 3OKOB 1MREL 4F57H 1SBSH 4TPRL 1RJLB 5JR1H 2VNCA 4Y19B 4WCYH 5CJ8A 4ELME 2BRRH 5F1NA 1B0RA 3LKOB 4LRNL 1IJ9A 2P5EA 3OAYH 3KJ6L 3MJ8B 4JM4H 1MEXH 5L7XH 3ARFB 4ZUVB 1NLDH 2B4CL 3KXFD 2IQ9H 4MQXD 2VXVL 5C2UB 4HS6A 4MX7B 4X9IA 4DOHB 2JJSA 1RZ8B 1WBYA 3JUZA 4L1DA 3P0YH 3QFJA 1H8SA 1FL3B 1X44A 2W0KA 4HWZB 2W0FB 4KJQC 4WTWA 5HHOD 9CGTA 3PWJA 3QDJA 2CGRH 3K1DA 3QUMA 4RX4D 5HYFA 3UYRL 1FC1A 1ZHLB 4EI5A 2HKFL 2DM3A 2OI9B 4JREC 2ITCB 3DO3A 1IFHL 4QT5A 2XN9B 1O7SA 2BMKB 1AO7B 1EO8H 1A3LL 2CK0L 3ULVH 2F8XC 4JG0L 4GQ9L 3U1SH 1OGAD 4XWOC 2P4AB 4LCCA 1ZGLM 5D7KD 1K4CA 2UUDH 2MJWA 4YJZL 3T2OA 1S5HB 4HGWA 3MRGA 4FS0A 4P3CH 3KPQB 1Q0YH 4PP1D 3DX8A 5MEND 3T77A 3LKRB 3RU8L 4PGCB 5JR1L 5GZOD 4G8GE 2CRMA 3V4VH 3IJHB 5ERWB 3EO9L 4EVNB 2BSSA 1HH9A 4QEGA 1JPTH 4JM4L 1MEXL 5L7XL 3EYUH 1NLDL 3BP7A 1UM5L 4F3FA 2IQ9L 1QRND 1XH3B 4UT6H 3W9EA 3NABH 3KNBB 3CH1A 4QXTA 1QSFD 3ULUC 2V2TB 2BY1A 5BRZD 1EO5A 3O8XB 1R5VB 4NT6A 2CIIA 2ICWA 1HK6A 3N1QC 4Q58C 1KB5A 1EHNA 3QNYB 2BP3A 1L0YA 2CGRL 4HK3J 1J86A 4NN7C 5D1ZA 1HHHB 2A77H 3S98A 1IGMH 3QI9B 4HV8A 4P5MA 1I1FA 5CGYD 5CEXA 3L3DA 2HYMA 1HSAB 2ED7A 3RPIB 2E7HA 1E4JA 1JGUH 3O9WB 4HHAA 5ACMA 1QUNA 5IROA 3U1SL 1P7QA 1NLBL 5FGCB 3OB8A 3A67H 4FFZH 1CFBA 1I1AA 4P3CL 4UNVA 5DHVB 3MBXH 2JTDA 4P57A 3GKWH 1F3RB 1N59B 5FUZL 2OLDA 3LRSA 2ZP0T 1FFRA 3CFDB 1EEQA 1T89A 1F6LL 5DO2C 3EOAA 2PXYC 1JN6B 3JV6A 2BY0A 3VGHA 2FCBA 1P4BL 3FB6B 1LNUA 1KN2H 5GGSA 4FZ8H 3NABL 2FH6A 1DQDH 4U1NB 4WHYG 1HCVA 3W5MA 1GGYA 4FFYH 5DT1L 5L6YH 1N7MH 1ZSDA 1TLKA 1CS6A 4QYOA 2X4RA 1A6UL 1C5DA 2FJGB 3N1MC 4BKLB 3RPKA 3LN4B 1ZLVK 4HKBB 1AD9B 4P4RA 2UY6A 4RSVA 5A1AA 3UPRB 2W1NA 1RZJL 1G7MB 1KULA 2UYLA 4PJ9C 4HPOH 4ZTPL 2YZ8A 2EDKA 5EO9B 4G8GB 3OWEA 2AJVL 1IGML 1KIQB 4MVBD 2DL9A 3V7AE 4YC2B 4KC3B 2AXFA 4NWTL 5CIPB 5I1KH 3P30H 2WM0A 5ANMB 3AS2A 3L7FA 4X6CE 1FV1B 1CVSC 2R9HD 4O5LH 5DSCB 3FQRB 2WUBH 5E2TH 3BMVA 1MRFH 4OIBA 3H9SA 3VFOB 2DLFH 1Q9OA 1ZHNA 3MA7B 5DD5H 5C07B 3WE6B 3A67L 2XZAH 5KSBA 2PUQT 3EKCA 2YPKA 1AHWC 3DVFA 3MBXL 4V2CB 5FYKH 1GZPB 3GKWL 4X6DE 2E7BA 2GK2A 3CFIC 1KENH 1P84J 2FEDD 1FGVH 4U1LB 2EECA 1MAMH 3VGAC 1K9TA 3MUY1 5IWLA 1ONQA 5FYLH 2VAAA 3L3GA 1A6PA 1VCAA 4CJ1A 1KN2L 4HUVB 1YNLH 2ZOLA 4AG4H 4FZ8L 4LSVL 3M1BB 1DQDL 3MV8B 1HHKA 4FFYL 5D7LE 1VFBB 4F2MA 4PJCE 4Y5YB 5L6YL 1N7ML 1E4WH 4MB5A 5TF1L 4NM8L 2P5WD 3VH8A 2W91A 3U9PH 2FWOB 5HSFA 5DRWA 2M26A 2QSTA 2VTFA 1FFOA 1X5JA 3NN8B 2V2XA 2ZWLT 15C8H 3BI9X 4Y5XB 3LPWA 1RJCA 5F6IB 1U92B 4LLYB 5I1KL 3P30L 3S4SB 5F9JA 3TBSA 4V1DE 1UA6H 4AENB 4KK8D 3HZKB 4O5LL 3I3BA 3MV7D 1KYOK 1LE9A 4AEIH 2WUBL 5E2TL 1NDMB 1KSRA 2DLFL 1QFWI 1BQUA 1YC8A 4GG8B 1XIWD 2ARJA 1JNHA 4YPGB 1NGQL 2XZAL 5EZIH 4BZYA 3MV9A 3BZEA 1MCCA 3GSUA 3AS3A 5J9PA 2XRAL 3ZE2E 3DRQB 3MLTB 1G7PB 4Q6IB 5J1TC 3G04A 5FYKL 4J4PD 2J12B 1HYSC 5BO1H 2Y25A 4LKXA 3MFGB 1KENL 3N1FC 3MJ9A 1FGVL 4M43H 1K2DA 1XR8A 3SDDC 3LMJH 5EORH 3LH2L 4AY0A 5LGHL 1MAML 5E9DA 3ILQC 5T5NG 3ULUE 5FYLL 1YECH 2VLMD 1CBVH 4NNYA 3S3JA 4R3SA 4AG4L 4MCYB 2BVUA 3IDJA 3B9EA 2NY3C 3S96A 1DBAH 1T7XA 1TCMA 1E4WL 4WFED 3HNVH 1KOAA 3LKNA 4UTBH 4E41A 2CO6B 3U9PL 3DBXA 4I4WA 2BXYA 2BNRA 1RIHL 1MNUH 4MA8H 4KROC 4LDLB 5DD3L 1WAAF 3QEQB 3HAEA 2X1PA 4OZGF 2AJZA 3EBAA 15C8L 4ZAKD 4XBPA 1RSFA 5J6HA 2ZG1A 1QQDA 2YEZB 4U1JA 1UA6L 3QO1A 1OP5K 4AEIL 1YYLH 2DQCL 3ME0A 1A47A 5I1DA 2GAZA 3LRGA 2BHUA 5DUPL 4PJCB 3QWQB 4U6YB 2XV6B 5EZIL 1V3MA 3C5SB 4J8RA 2ITDA 3SY0B 1CYGA 2OR9L 1A3QA 5IESH 3EO1A 2YPVH 5DMYA 2ZJSH 1PG7X 2GHWB 4KGJA 4RA0C 2DQHH 5BO1L 1UXSB 1Z2KA 3SDYH 1KTDA 4M43L 1Y0LA 2JB6A 2X10A 3LMJL 3ZDZE 3PHQA 5LWYH 1RIUL 4O58H 4E42B 2GT9A 3KPRD 1YECL 1X5ZA 3V0AC 5IFJA 1CBVL 4QRQA 5KG9B 3DIFA 1DEDA 1S7VA 2ZOKA 2DM4A 1YJDC 1Q9WB 5CEZD 3TZVC 3QIBA 5IF0A 2OS7A 1DBAL 4HFWB 1FAIH 5E1HB 1T0PB 3VI3E 3DGGB 1MY5A 1FIEA 2C4FU 3HNVL 5AYUH 2LVCA 2VLJE 5ID0A 5L2KE 4UTBL 3DX6B 5K59E 1MNUL 2BSED 4KKCC 1Q8MA 3ARGC 4IDJH 2PO6D 2ATPA 3EYSH 3NCYP 5BVPH 4QRTB 3D3VD 3TNNB 3CU7A 2D7NA 1PLGH 3QG7L 4YK4C 3V6FA 3RQ3A 1M71B 5SWSE 1J18A 1QP1A 3Q5OA 5HYSB 4F8QA 2IMMA 2R15A 4FG6D 3FQXB 2GJ6D 5C0RH 2X4OA 4YHIA 4D0DB 5IESL 4NN7B 4KTDH 1EEZA 2ZJSL 1DBJH 2ZKHH 5INCA 3SGKA 5I1HH 2OZ4H 3MMEA 5T1DH 1EV2E 2OJEB 3MGAA 1G7IB 1LHZA 1RZKC 3SDYL 1UXWB 1RMFH 2UWEA 2DWDA 1N2RB 4NO5B 4OKVB 3GHEH 2NY7H 4WHTA 4ODTL 3U46B 1EPFA 4E0RB 4EIZC 4IRSC 2Z0BA 4WDIB 4ZO9A 4JAMA 5DRZB 4U6XA 2Y5EA 3AROA 3ZE0E 1R3LB 3K3QA 4G5ZH 4L8CB 3CFJB 3WJLA 1XGTB 3U4AA 1FAIL 3WL9A 4LVOC 5IW6A 4POUB 1ES0A 5JORB 3TYFB 3O3AA 5AYUL 5IVZB 3RZCA 4L3EE 1HXMB 4M8VA 4XP6L 3IETA 3ZL4H 2WBJD 2D31B 3IDIB 3MUGB 5IFHH 5IJVB 4TYUA 5E2UH 3SO5A 2PXYB 3RWEB 2P49B 4L8DA 2LAGB 3EYSL 1MQKL 3GGWB 5J4MA 4Y4FC 5MP6H 5BVPL 2IQAA 3WCYA 3X12A 3OKKB 1KGCD 1TDQA 2H9GB 5IB3A 3E6HA 1F3DJ 3QNZB 4D0BB 3OKEB 5GSVB 4G8IA 3VE0B 3ZO0A 1R3IH 4G8FA 5BZDB 2VLJB 4HQQH 1X5HA 4M93C 4PJ9B 3GO1L 3QDME 4XNMA 2MSPA 1KYOJ 3TBYB 3G5ZB 3B2UD 5AZ2H 4GG6E 4J12A 1DBJL 3H7BA 2OZ4L 4P5KB 4HMEA 1OAQH 1UFUA 1G6RA 2KZWA 2EE9A 3KHOA 1RMFL 2AEWA 3L3OA 3VFRB 2NY7L 5F3BB 2PYEA 1MI5D 4O2EB 4JCMA 4EUPH 5DK3A 1K3ZA 3O6FA 4NZTH 1YNTA 3VD5A 2AV1A 1ADQH 1AHWB 3H9HB 3UTZA 3GSNB 1FO0A 3MZGB 4WGVB 3P11H 4YHPB 3L3IB 4YLQT 5EO0A 3TPKA 2AXGB 1QLRB 4OAWB 3S36H 2IGFL 3BIAX 2YUWA 1CIDA 4DVBA 3VH8G 4H5SA 1NGPH 2IFGA 3VGAB 1T2XA 2R1WB 1G7JA 4X6BA 3NIFF 5MP6L 1FZOA 3DXAD 3J7HA 1Y6NR 1X5GA 3F7RA 4I18C 3ECBB 3IFPA 4PPTA 3GMQA 1SY6H 3JV4A 2PTTB 4URTB 3OKMA 1CFSB 4UV4L 4ZXBA 4D0CB 2GTWB 2H3NB 4PLKC 1H15A 4X5WA 1R3IL 1C7SA 5F89A 1W0YT 2NXZC 4B0MM 1IRAY 5AZ2L 2JELH 1OAQL 5IGXH 2EH8L 5TH2B 5MEPB 4NRZB 5GS0L 4X9BA 3WIFA 4P46C 5JIHA 3SDAA 5KOMC 2J6EH 4WU5A 2NY1C 3KPSA 4ZNEA 4U6TA 3BZ4B 4DW2H 1PZUB 2YUVA 3OV6A 1OVZA 3KPNB 4RBPK 5H2BB 2X4NA 1ADQL 5D7JA 4ZFZB 1F4WH 1GIGH 2VZUA 4LOUD 4BFBD 4LAQL 2HRPH 3P11L 3CSYB 1LGVA 1EO7A 1A02N 3S36L 3QDMB 3GSQB 3D2UD 4N5UA 2B1HH 3IGAB 3SDDB 1TTGA 2ZPKL 3IVKA 5FV1L 5IB4B 5F70A 2EZ0D 4DN3H 4EI6B 2V5TA 3MLVL 3HAEG 3IDNB 2IPTH 4XNZC 3RVXD 1S9XB 4DKFH 5JW3H 2NY3B 1I7RB 1OLLA 3RL2B 2X09A 1U3HC 2HTKC 4WW2C 1EXUA 4JY6A 3UTTD 1SY6L 3QR2A 4JO2L 4OGZA 2N1KA 2NQCA 1FGNL 1EGJA 4KROB 4K2UH 4Y8AA 3NTCH 3RUGE 5ADOH 3O2WH 3UX9B 3PIQA 3S88H 3ZKQD 3MNWA 3SGEI 3GMRB 4UI2A 3DVNB 3LCYA 1NH6A 4PJ8C 1KELH 4N0UA 1WUNT 4J1UA 4OFKA 3WHE1 2Z31C 4Z8FH 3WNLA 4U6HB 5F7HA 3RKDC 2V5MA 3RX8A 2ICWI 4XMLH 1DLHB 1KLUB 1A1NA 1R3HB 3P0VL 4DW2L 4L4VA 3IFLH 3CXHJ 3MRLA 3A6CH 5GGVL 5CBEA 1F4WL 1WICA 1INEL 3FQTB 1GIGL 4Y19D 5F7NC 3HR6A 5BQ7B 2DTMH 3P9LB 1GXEA 1W0WB 5C0DB 6FABH 2X4SA 5BV7L 4BQBA 4GW5A 3PJSA 2B1HL 2FIKA 3N85H 3AY4C 4DN3L 1X5LA 2A0LC 2CLRB 2GJZA 1X7QA 2B2XL 4YR6A 2HT4D 1OOAA 1BOGA 1ED3B 3TZVB 1P53A 3EUUA 4XGZA 4DKFL 3QZWA 5JW3L 2XWBA 3GSVA 5L88H 3T3PF 1DQQB 4OGXL 4KHTH 5I76A 4RGOH 4HKXB 1RZIB 1IC7H 1WIPA 3VXNA 4NM4H 4HKJB 3O9WA 1CK0H 1C16A 3ARGB 1UM6H 3FRUB 3NTCL 2J4WL 4HH9A 4QGYA 1RZJC 3O2WL 1J0YA 3S88L 1DL7L 4KMLB 2VL5A 1S7SA 1AO7D 1NCNA 4PBXA 5ALCH 4OCSL 4UBDD 4PJIB 4YK4B 4LCIH 4Z8FL 2VQUA 5ESVA 3NZ8B 1DLFH 1YEDA 3ZDXE 3CD4A 2C1OB 4RFOH 3HG1E 5D5MA 3IFLL 2KH2B 1ZA3A 4PRAB 3NPZB 5LGKA 5FECA 5CJQL 4GBXD 4JFFD 4NBXB 4WHDA 2D3VA 5CJOH 1I7UA 3RIAF 1FYTA 3THMH 4ZOAA 5K9OA 3EJYC 1KIRA 3N85L 2DQJH 3PL6A 4IRSB 2Z35B 4XB7A 1KNOB 5EOTA 4FOMA 5F88A 5E6IA 1ULVA 4XHJC 1UQSA 3FOMA 2X70A 4GXUM 4JM2A 5HHNA 5JHDD 3PXJA 1GPOH 1ZS8B 1CGVA 5L88L 4LVOB 3BZFB 4EDXA 2G2RB 5CIPA 5D2NC 1S9VA 1P69B 4RGOL 1IC7L 4HK0B 4NM4L 5JDSA 1UM6L 5CJXA 1YEHL 5D6CA 3RVUC 4AIZA 1JPGB 3VFPB 1AQKH 4Y4FB 1MCSA 2DTSA 1CTOA 1EFXD 2HT3C 2A73B 4LVNC 5ALCL 2OSLA 4LDOB 4LSSL 4R96B 3MXWL 4JN1H 2V7HB 4LCIL 4HWEH 2W92A 3HC3L 1CFNA 1DLFL 1EJOH 5TE4H 4YDJB 2D0GA 2YD7A 1W0VA 2FYYA 2UZIH 4F7CA 2BSTB 3F12A 4X6FA 1CXIA 5JLZA 4M93B 3W9DA 1FIGH 5IW3A 1MHPL 3HUJB 3B6SB 4NGHH 3VFNA 4MXVE 2ILLA 1RUAL 4PJDA 3TIEB 1UZ6E 3THML 4Z7QF 2NTSP 5LGJA 1VSCA 5IEHA 5LBSH 1F4YL 3X3FL 2OTUA 2DQJL 3QRFM 4AIXA 5DJ8B 2K9UA 4NZDA 4JFHE 3OJMB 4P4KA 3FT3B 1IC5H 3T1FB 3M8OH 4HUWB 3QUZD 1GPOL 1PSKH 3RWHB 3GIZL 4HZLB 3DV4B 4LFHD 4S2SB 5HGDA 4G8GD 4OZ4A 4QOKA 3VFVB 4J3SA 3MCLH 1U58B 1JNNH 3O3EA 4ONHB 4MAYA 3RWGA 4RAVB 5JW5A 1OWRM 2XTLA 2HN7B 1G7LA 3U79A 5I17B 3HNSL 3BN9C 3SN6N 1DR9A 4JFDA 2LAAA 1X5IA 3RWFB 4G6AC 4JN1L 3L3KB 4I18B 4PGBA 4HWEL 4UT7H 3VGFA 3WMSA 3L9RB 1MCPL 4HLJA 2EYTB 2RAMA 5TE4L 1EHAA 1PYWB 1T7VA 5E7BA 2JJTC 1D5MA 5A3ID 2UZIL 5EOCJ 1WBZA 5C9JA 4PJGE 3ARBD 3S5LA 3WD5L 5EO1A 1AQDB 4LEXH 4OI8A 5C8JA 1FIGL 2NXZB 1LO3H 1YPZB 1MCWW 1D9KA 3NVQA 5MHSE 1BD2A 3MRJA 4KVCH 2X4QB 3T0EC 4NGHL 1FFPB 3WJJA 5JQHC 4L8SA 4WUUA 3H9ZA 2E6QA 4P46B 5JPNB 2J8OA 2NY1B 5JOPE 1BVKA 3HR5B 1V3KA 4L4JA 1J12A 3GMNB 5BJTA 5CCKH 3QIUD 3OKDB 1MRCL 3MGOA 2NY4D 3F7QA 4R4BB 3M8OL 2X7LB 4W70A 2G9HA 4D9LH 4G7YL 2APVA 1PSKL 3SEPA 3U0TB 4QCIA 2WANA 2DDQH 3B2VL 4PIRF 2YD9A 3RVVC 4BFIB 2YN3A 4EQ2A 1RK0B 3MCLL 4ELKA 1JNNL 3JV0A 3TGXA 3JWOH 4ZSOA 4YZFE 2VKXA 4XNZB 4ZFGH 4ZUSB 1GC1L 3RI5F 3CAFA 3LQAL 4OD2B 1VACA 3HE7C 4UT7L 1U3HB 1UH3A 4I0PD 4WW2B 2XTJC 4IM8A 3WN5C 3E0GA 5C08E 3RZWA 1NFKA 3JWDH 2EH7H 4R0LA 1ZT1A 4Z7WA 1J8HD 1UZ8B 1IGYA 2IAMD 4LEXL 4CBPA 3HN3A 1LO3L 1OF2A 1ORQA 1HI6B 3A0OA 4JY5H 1KJ2H 4JO3H 4DEPC 3D0LA 4JANB 1WWBX 4KVCL 3PGDA 3MRQB 3PUCA 4PJ8B 2F74A 3VJ6A 3KG5A 3B83A 1F6FB 2Z31B 3LEXA 4ZO7A 1U8KB 5EC1A 3GB7A 4F7MB 5GRVK 1H3PH 4BFEA 1T0NB 4RIRB 4Z77A 3UYOD 5BMFL 3BEWB 3BDYH 5JZ7C 2OK0H 1CG9A 1T04B 1IARB 1UKTA 4HAFA 4D9LL 3QZWG 1A9BB 2VXTH 4GLRI 4OFDA 1XGRA 2Z92B 3IF1B 2IH1A 2DDQL 1U8PA 5EN2A 4LLWA 5FHBH 4Z7UA 1T5WA 3FFDA 1D3CA 1FLRH 5C3TA 3UZEA 3GBNH 5HI5D 4JZOB 1WT5C 4NQSB 1OSPL 3JWOL 4QHNA 1A1OB 4MJ6B 1JFQL 1QEWA 2VITB 1C12B 1YMHB 3SJVA 5D7LD 4KZDH 1J0IA 2VH5L 1MPAH 5CGMA 1CFTA 4KJQD 1NCCH 1VHPA 3KXFA 3JWDL 2EH7L 1OAYH 1X9QA 2YA2A 3CSPA 2AKRA 4OUUA 4AEHH 5FYKE 5B3JE 5JW4Q 1K4DB 2F53A 4JPVH 4OB5L 4JY5L 1KJ2L 4Z7NF 1TCRB 1OB1B 1QFWL 2XIDA 5HPOA 3DURA 5HHOA 3DROB 4V1DD 4HLZH 4JHWH 4RX4A 5FYLE 4WEMB 4P3DB 1H3PL 4JEGB 5DFWH 3FRPA 4CNIA 4JQXC 3BDYL 1QR1B 2L7JA 2OK0L 2I26N 1UH2A 1S7UA 2WWMC 1KPRB 1OGAA 1ZLUH 4XNYH 5FHAH 4C54A 2VXTL 5ITBL 1C5CH 4O2CA 5EIQA 1FLRL 4GXUN 3PGCB 3U9UA 4RCAA 3LHPL 1MCRA 1F11A 1BBJB 3V7MA 4WJ5A 2MHAB 3ULUD 1VFAB 2X4TB 3VDAA 3GSXB 5F7EL 2O26U 4HGMA 5FGBC 4HX1A 1TVBA 1HILA 1T1YB 3DOSA 2JIXB 3BIKB 2FIRT 3AXLB 4KZDL 1MPAL 4Y16C 5D2NB 4LCWA 1NCCL 5J06A 3UMTA 1QRNA 1CFVH 1IEAA 4PG2A 1INQA 4OF5A 4MAUL 5ESAA 1KCSH 1QSFA 3EYFA 3U7WH 1DN0A 5BRZA 3SOBL 3T0EE 5CSBA 4TVSa 1IKNA 4HF5H 3VRIA 4JPVL 2OL3H 1KT2A 1CT8B 2HTLC 2EICA 2X1OA 2FD6H 1N3NB 4LVNB 2A6DB 2PW1A 3G9VA 4ZDHA 1HQRA 5D2LE 5GS0C 2NPLX 4LSTH 4JHWL 5BXFB 3LN9A 3K8MA 4YHYC 4PRIE 3QQNA 3O0RH 3T2NH 3C8KB 1N5AA 5JOFB 4L8BA 2V2WB 1N6UA 4KV5E 1JZ6A 1SHMA 4LLMA 5IHZB 2HH0H 4XNYL 3HRPA 2AXHA 5FHAL 4C56B 3AUVA 1BQHB 4JDVA 5DO2D 1HXYA 1XF3B 1BZ7A 3DUSA 1FH5H 1I8KA 4XNQB 4M3KB 2J3SA 3ULSA 1MFDH 2XWJB 1RUKH 3NCCB 2C7UB 1P1ZB 4L29A 5HGHA 3O6MH 4MNGA 3BUYA 4NQXB 1KPUA 1IM3A 3SDXA 3CZJA 1FVEB 3HI1B 1AGBB 3T1WA 3W39B 3ZKMC 1J7VR 1JUFA 4JPIB 3P9MA 1AE6H 1FVCA 2OMNA 2VLJD 5L2KD 3MJ7B 1EVUA 4PJ9D 1CFVL 1MAJA 4P48A 4RFNB 4XXCA 1KCSL 3U7WL 1ZA6B 3QFDA 2CH8A 3HMXH 5GIRB 1S7RA 3ULVF 5DK2A 3S5LG 3QQ9D 4HF5L 5IVXA 1VFUA 2OL3L 5EC2B 4PGDB 4PRHE 1TZIB 2FD6L 2J8HA 1MUJA 1NUGA 2XKNA 4PLOB 4C4KO 2Q86B 3O41A 4LSTL 4KUCF 5CMAB 5SWSD 3Q2CA 3O0RL 4AM0B 1MY7A 3T2NL 3C87A 1JHTA 3VGDA 4XI5D 3GSWA 1A4KB 3WLBA 5MI0C 4MJID 1L0QA 4XPHH 4K9EH 5I1IH 3STZA 5IFAH 2HH0L 1YY8A 1AY1L 1DE4B 3T0EB 3MREB 1UGNA 5F9DC 5DQ9A 5BV7C 1RUKL 3R8QA 4YXHH 2Q76B 1A7RH 4OKDA 4PGJA 4OZGB 3O6ML 5D2LB 4I2XE 2R0KH 1UG9A 1NEZB 1DBKH 4CVXA 2VXUL 3WO3B 3I9GH 3KJ4C 3TP4A 3TBTB 4M5YL 5LVEA 1QSEE 4JRWA 1AE6L 2R23A 2FHCA 5F8QC 5E5MA 3D0VB 1FZMB 1ZLWK 1FBIH 3RIAK 1G7QA 1TVDA 3KPLA 3MACH 4LMQI 4L3ED 4N9GA 5BW7C 5JIPA 3PP3H 5EA0L 4LSQH 4LNRA 3HMXL 4PS4L 1GGUA 1ORSA 3MRRB 1XF4B 2P5WA 3X13B 4ETQA 5DMIH 3SGDH 2VZ1A 4HXAH 4NPYB 5HJ3A 3TJEH 3HE7B 4M1DL 1U8MA 1HHJB 4QRPE 4YFLI 2XTJB 1VPOH 4PJBE 5SX4I 4NBZB 3WN5B 4CKVX 1UB5A 3TWCH 4X9HA 3QDGD 1R5IA 3NMEA 2LVEA 2EYSB 4XCCH 1F97A 1OHQA 4OCWH 1U8JB 2R0WH 3U4BH 1IGFL 4XPHL 3QDMD 4NQCE 5IFAL 4DEPB 2PN5A 5CGTA 1DQJA 3VXSA 3SDDD 1MVUB 3FAXA 2E8YA 4WTXA 3HC0B 5ISZE 3MRFA 2ICES 3PWNB 2Y6SC 3LS4H 3SPVA 4PY7A 4PRHB 4HBCH 1GRWA 3IXTB 4J4PA 3ARDC 4B5EA 3D5OF 4TSAL 1FCCA 1P4LA 2NY3D 4QHUA 5T5NF 1MELA 1DBKL 4JVPA 4UIKH 5E1AA 5ILTH 1C8PA 1M7IB 3FOLB 1I9EA 3I9GL 3TV3H 4PGEA 3CMOH 3DGCR 4LARL 2HJFB 2LE9A 4XVUC 1BJ1H 3TT3H 4WI9A 2FSEA 4KPHL 5DYOA 3U83A 1TVHB 3GJFH 1KXQE 3EGSA 4KROD 4EBQH 1FN4B 1BVLA 3GSOB 5EU4A 3MACL 1PW3A 3AS0A 3RJDA 2DWEA 4YHNB 2QR0B 3ZHDA 1JGEB 5J1AA 4JZJA 4M61B 5E8NA 2YD6A 3G6JF 1JCKA 3Q6GH 2OX5A 4HT1H 5HVHC 1JF1A 1HE7A 4YDKH 1ERNA 2FZ3A 2FJHB 4LKCA 4Y0GA 1QYGH 5DJDB 4PRAA 2H26A 2HVKA 3TJEL 1FFQA 1BJMA 5HHQB 1CDCA 4TUJB 2I9LB 1VPOL 1HNFA 1KTLA 3QUXC 4I9WE 3PWLA 4ZAKA 2I9TA 2BHYA 3RNQA 1YMMD 1S7XA 1HWGB 1WFTA 4O51A 1QSEB 3FRPG 4PJHE 5IUSA 1Y6KR 2DMKA 2XY1A 1PFCA 4Y4HC 3K8KA 3MLRH 3R06B 3GZKA 2X89D 4Z0XB 4TUOB 4P5TA 5D7IA 3CFCH 3LS4L 5GS1A 5DJ0A 3MLWL 5KN5A 4F9LA 4HBCL 1BQLH 4PBVC 5H35B 4G9FE 3TZVD 3CDYA 4Z76A 5DUMH 4KK5C 2ZCLH 4PJBB 2XZQH 4RA3A 1YEKH 3TV3L 5LQBL 1ZGLP 5DR5L 1A4JA 1NL0H 3TT3L 2VJXA 3UJTL 3Q6FA 2X1WL 4EBQL 1EMTH 4MWFB 2ADIB 4M6OL 4NQCB 1ZHBA 4CDHA 3WHE0 2JE8A 1JRHH 5IMLA 1J10A 2D0FA 1HIML 4LCYB 1P9MA 4MJ4A 5F3HB 5DRXB 3NH7L 3Q6GL 2BSTA 4HT1L 1PEZA 3CVHH 2Y36H 1FNHA 1UEYA 3RWDB 1L7IH 1QYGL 4OGYH 4LQ1A 2AS5M 3S36X 1XF5A 1KIUA 2LABA 2PO6A 4GT7A 3E2HC 3QULB 3WHXA 4Y16B 4X4XA 4NQEE 4NO0A 3UJIH 1GZQB 2IPKA 5TDNB 5F1OB 5F7UA 2GJJA 4CJ0A 1FQ9C 1LK3L 1DSFH 1CGTA 5E56A 4DKAA 5E03A 5C0ND 4LQFH 2WIIA 3I85A 4BK5A 1FNLA 1L0XA 1XGUA 2Q6WB 4X5LA 1KCUH 1TXKA 3RI5K 5T1MB 3RDTA 4JFOA 1QVOB 4QTIH 4OZFH 3LPFA 4IRSD 1BQLL 1ND0A 1RZFL 3CDGA 4YHYB 1BIIB 2FJFB 2V5SA 4QWWC 5DUML 5F7MC 3L1OH 2DYPB 2ZCLL 5TGBA 3C5JB 2XZQL 3S6CA 2YPLE 1NMBL 5D71H 1NGZB 4XCYB 4Y88A 1NL0L 3C5ZD 5BS0A 2ZNWA 2KL6A 1JK8A 5IHUL 3V6OA 1S5IH 4CADA 3GK8H 1EMTL 1PQZA 1PY9A 1MQ8A 4FTVB 2FR4B 5E2VH 1JRHL 2BVQB 3T09A 1LD9A 4RMRA 4HZAA 2XPGB 1FDLH 5DLMH 3CVHL 2Y36L 2OJZH 5IMMA 2WBJA 3OZ9H 4IRJD 4YDVB 5JW4N 3ZKNC 4FXLA 1GC1C 2XYCA 4JY4B 1BECA 3LQAC 5DRNA 1TJIH 5JUEH 3E3QE 4PJFA 5IHLB 1X5XA 5J56B 2GQHA 3GEWB 3UJIL 5E94A 1IILE 2H6PB 1DSFL 4Q9BA 3AAZB 4AH2A 3G6AA 3I2CH 4LQFL 4OD1H 5B38A 3CNKA 4X83A 3BPOC 1RURL 5KSBF 1KCUL 1JIBA 3IS1X 3OL2A 2BY2A 4BM7A 1Q9KA 4L1HA 3WEXB 4X7SL 5EU6B 5TDOA 1PX3A 1ZVSA 3CUPA 3C08H 5C7XL 4UNTA 2EDYA 1VFMA 3HG1D 4ODUB 1E4KC 3PABB 4NQEB 2Y7QA 5MI0B 3TH4T 1OAUH 4M9PA 3H2WA 4JN2A 1CGSH 1R24B 1MI5A 1S5IL 3K46A 1UT9A 3GK8L 4G80B 1BFTA 4DZ8B 5BV7B 3EZ8A 5E2VL 5DK0A 3RY6A 4F7EB 4QKXB 4GOSA 3MYZA 3DNKA 3CVIH 4R4ND 3MRIB 1J0ZA 3IT8D 4NUJA 5DLML 1FDLL 4D9RE 2NR6D 3BD5A 3VWKC 2OJZL 4X98A 3KJ4B 2O5XH 3T0AA 4K3HA 5JUEL 5GS2H 4QNPF 3R8BB 2YPLB 5CEZH 1CE6B 4MD4A 3CX5K 2NXZD 3DRTB 5T1KD 1AR2A 3DXAA 3SDCC 3BVNB 1R0AH 4OZIE 3NFNB 3AS1A 3I2CL 4OD1L 4Y1AA 4EEEA 3HHRB 4P46D 4NNPL 5DJCA 3QCUL 4M1CC 3JBG7 2AEPH 3UPCA 1CGXA 5F1KC 2NY1D 4JDZA 1F13A 2JCCE 1NFDA 4LF3A 5HHPB 2ZUTA 1T83A 3C08L 3ARZA 4LLVA 5I18H 3QNXB 3I6GB 3V4PL 3QPQD 3TT1L 1WC7B 5FDWA 3U4EA 1OAUL 1Q1JH 1IMHC 3GMLA 1CGSL 1YEFL 3GI9H 1CDUA 4JKPL 1KLGB 4X4MA 4ZOCA 2NW3B 5EUOE 1Y18B 2EXWC 4IMLB 1E27B 3CVIL 4JFEB 2AVGA 4OI7A 2IANA 1JBJA 4UDUB 3WXWH 5GSRA 1RU9H 4ORZC 2DKMA 3LOWA 3IJSB 4RGNC 4JFHD 3MYJB 1UCTA 2DRUA 4L5FH 3I75B 7FABH 2JJVA 3W0WE 2D4DA 2NY5L 2ATKB 3MJ9L 2NTFB 4NQVB 3O3DA 3F7YA 5I8EA 3VFWA 3ZDYF 4MQTB 3GMPA 4P59L 5LCVL 3PNWB 2X2YA 3OKNA 5BOPA 4HEPG 2BOCA 1R0AL 4KJWD 4XAWL 4JFXA 4R97C 5HDBF 2BHZA 4U1HA 1NDGA 4JZNA 4K8RC 3H0TA 4OZHE 5HVHB 1RJYB 4O9HH 4XNUH 2CXKA 1DEEA 4I8DA 3RKDD 4MCZB 3MRBB 4OCRH 3VXTA 4CN1A 5DMKB 1T2QH 4XNXL 4RQQA 3QUXB 1KJ3H 3OR7A 3ZE1F 1OLZA 4MD0B 5KTEH 5I18L 3NFPA 1I75A 5T1LA 3O2DA 5DJXB 4XXDB 4Y4HB 5AEAA 1Q1JL 3UDWC 5KVGH 3ZTJG 4LPYA 5MHSD 1B0GA 1EZVX 4EN3C 3GI9L 1IQDB 4X4ZA 2Z8WC 4YFEA 3RY4A 1JGDA 2ESVA 1SVZA 5SWZA 1AD0A 1C08A 2XOTA 1RQ5A 1VADA 5JOPD 2ZUUA 5DJYB 3WXWL 1IZKA 1RU9L 2C9AA 4JRXA 5I74C 1Q94B 4ZPVA 1FZKB 3GMMA 5IB1A 4JKKA 5C09E 3DX9A 1I8IA 2B1AH 3RWCB 1PEWA 2G5BA 1WISA 4NKMB 4PV9B 5C0BB 3VXOB 2W38A 5DWUL 3RY5A 5SWQB 5EUOB 4MLIA 1E28B 3VXUE 1KG0A 4O9HL 1D5XA 4LCUB 3I50H 3UJJL 1UJTA 3ZHKA 3QIWD 3MLZH 2A74B 3JVGA 4G6FB 1FC2D 4HJJH 4KDTA 4MDIB 4NRXA 4OCRL 3BEVB 2GCYA 1OQXA 3E2HB 3DJ9A 1KJ3L 3BGMB 5DI8B 3VFTA 5C08D 1B2WH 5IB2A 5KTEL 2VDML 4X7CC 2UWEF 2AEIT 3V0VA 1NUDA 4TN9A 2PYFB 2B7DT 4ZQKA 1DBBH 1KB9K 4H0IA 3FT2B 5MEOB 2ICEB 3LN5A 2R56L 3EJYD 4UDTB 3ARWA 1SMAA 3MRHB 3BSZL 1MCHA 4OZHB 3SCMA 4XVSH 1G0XA 3QEUB 4Z7OF 2NY6D 4GBXA 4XHJD 1T1WB 5C70A 4JFFA 1BQSA 1QFUH 2JIXD 3T4AA 1HINH 1T3FA 4ZFOL 3DETD 1MLCB 1AIFA 2BDNH 2QHLA 4GMTL 3DMMC 2F15A 2V17H 1QZ1A 2ZSWA 1NBQA 2BVOB 2IALA 3WS3A 4GFTB 3BQUA 3TJHC 1YN6B 1Z5LB 1IEBA 4Z7VA 3D25A 1QO3A 4FNLH 5JHDA 1P7KB 1P2CA 1P7HL 5IOPB 1CICD 2HT3D 3OAZH 1I7TA 4BZ1L 5E8PA 3QQ3B 3U2SA 3VMOA 5J6GB 5B38G 3I50L 3CX5J 1A4KA 4ELMA 5FYJH 2KBGA 5EBWB 3HRZA 4H8WH 1VEPA 1MHCA 3CDFA 1B2WL 4OCYL 3TBVB 3VFUB 4XZUA 4F9PC 4W6XB 1EFXA 4GKOA 4GRLD 2X40A 5IR1A 1WAAA 5C09B 2IH3A 5FYKD 5IM7A 1DBBL 3TBWB 3QA3B 4F33A 5EIIB 3BPOB 3EDKA 3WLWD 5C0AE 2QADC 1F45A 4X8XA 1HKLH 1RZGB 4XVSL 2BVPA 4HCRH 2NX5B 1WWWX 5FOBB 5FYLD 4IIQC 4RGNE 4NC2B 3G5YB 3TO4C 3W2DH 4X4YB 5H37G 1ZWIB 3G08B 3ZHLA 4R7NA 2CKBH 1QFUL 4RZCB 1HINL 4HDIA 4GUPA 3L5WB 1UWXK 1G6RL 4PJAE 3WIIH 2V7NA 3FO9A 4H1LA 4N9OB 3DO7B 5CLWA 2VKWA 3RTQC 4BSWB 5ENWA 1OP3K 1QBAA 1W72A 3R0MA 2K3TA 3RBGA 3QUZA 1PY4A 2EIZA 3BN9D 3G6DH 4FFVD 2APFA 4XT1C 3VWKB 1SVCP 4X7TA 1UACH 1LQSR 4H25B 1Z9LA 4P9MH 5FYJL 3WIHH 5DHYB 1U8HB 5HYEA 4RISH 1EK3A 3HS0A 2D03H 4HUUA 5EOQH 1YDPB 4QRRB 5FA3A 3IJYB 4XP9H 5EBMB 4RDQF 3SDCB 1HSBA 1FNGB 3VFMA 4KRMB 3T0ED 3IYLW 1CD1B 2BNQB 1T4KB 2FX8H 3B4NA 1WWAX 43C9B 4KAQL 5HYQB 1NCDH 3CLEH 4W81A 3G5VB 5IIEB 3ARBA 2JJSC 3QEGL 1QD0A 1DTUA 3WXVH 1WCBA 4R9HA 5L2JB 2GK0A 5SV3A 2YRLA 1JHLL 1MVFA 4PRID 2CKBL 2GSGA 3QO0B 3L3HA 4WFHE 4LLQA 4EI5C 3C8DA 4WU7B 4KI5F 4ZUTA 5JA8B 1UADC 2CKNA 3KPMB 1UWGH 4UQ3A 1OCWL 3QIUA 5DQJA 1AGCB 1ETZA 5D7SL 4F7TB 4LCCC 1UJ3B 3AREC 2HFEA 4M6NL 2DBLH 4O00A 2ERJC 4XTRC 5C0AB 3P4OA 1IAKA 5IVNA 3P4NA 4PJXF 4UQ2B 4F15C 3TEUA 3P73A 4P9ML 1UB6A 2Q7YB 1N26A 4ZO8A 1QBMH 4RISL 1IQWH 5J3HD 4TTDC 4FQCH 5K93A 2YN5A 1H0DA 2IBZX 1OY3B 1SEBA 5EOQL 5FA4B 3VRJB 4XP9L 2R0LH 2HVJB 4OFIA 3BPLC 4MZ2A 4PTUB 1CDJA 1YN7B 4ZUUB 4I0PA 4R97B 5HGBA 5E8OB 4I48A 5CZVH 5SX4H 2FX8L 2JK5A 5DQDH 2FO4B 1MJUL 3ZTNL 3QCTH 1NCDL 3CLEL 4AJ0A 1J8HA 4PRHD 1Q9LA 5CJ5A 5FB8A 1U2CA 3L7EA 2IAMA 4WW1A 3WXVL 2IPUG 2X1QA 3NZHH 1BIHA 3RX5A 4O2FA 2I07A 3KLDA 4LHJB 5J12C 3TNMA 1J1PL 1Z3GL 2C1PA 4Z5RA 3QQ4B 5D1ZC 4X6CA 4L9DA 4HC1H 4BH7A 2RIKA 1M7DA 2BY3A 3U6RA 5DHVH 4EN3B 2X05A 1A9EB 4FQQA 4J3TA 4NZRL 2GSIB 2BSRA 1QPXA 5IROC 2ZCHH 5HD8C 4U7KA 5DD6A 2WWKT 4U7MA 2DBLL 4LEOB 2DKSA 1KF9B 1ZT4B 2HJLA 3F6IA 1R3KB 1UKQA 3OF6D 4X6DA 1I1AC 4LPTA 3IU4L 3FQNA 3P0GB 5I74B 4OTXH 2H45A 1NC2B 3UTSB 3PDOA 2Y5TA 1QSED 3BD3A 4FQCL 4P9HH 5E00A 1T89C 2VLKA 4WFFE 4ONOA 3VCLA 2R0LL 1INDH 3E8UL 5C3LD 4NSKB 4PJEE 5D7LA 5KW9H 5D5MF 5F1IB 3NCBB 5CZVL 2ADJA 3B5HA 4G6MH 3JTTB 5DQDL 3QCTL 3O4LE 3D18A 5CIPH 2VOTA 4FA8A 3DV6B 1PJ9A 5ESQB 3NZHL 4E5XA 3ELAT 4QRPD 1IGTB 4PRPD 2VN7A 3IKCA 4LL9A 3LY6A 5KVEL 5FKPB 2YKLL 1I4FB 3L3JA 4HIEB 1RHHA 4BQ8A 1J0JA 4V1DA 3V5DB 4FXKB 1MH5A 4HC1L 4NKOA 1JMZA 5GGRY 5KSAD 4DAGH 2VZSA 4NQCD 1SJEA 4XC3H 3OSKA 3C09B 4HUNB 3M07A 1T7ZA 1WBXA 3L6FB 5ISZD 5D93C 2EDLA 4P2QE 3VXRE 3OX8A 4KKNA 1OWWA 3PWVB 1LEKA 4X0KA 3WSQH 1U6AH 3DTXA 5KVDH 3SE4A 3U82B 3GRWH 3LKPB 4YEEA 2NW2B 5HVFB 1WCQA 4Y16D 1A1MA 4YHKL 4OTXL 3EOTH 4LLUA 4JFYB 3DMMB 2P5EE 3DSFH 4U1KB 4MD5A 4P9HL 3T65A 3DUHA 2CIKB 3KYOA 1HH6A 32C2B 4H20H 3HB3D 3U7YH 1F8TH 1NGWB 5IWLC 2RFXB 2HTLD 4TNVF 5ALBH 3O2VH 4DQOH 3X11A 1JNLH 5DDHB 3UTPE 3IAGC 5JMRA 4D8PB 2MPAH 1H3TA 5I0DA 2W9DH 4G6ML 5GS0D 3QAZC 3QJFA 3MLUH 5IW1B 3OGCB 2NZ9D 3KHQA 3DECA 4GAYA 3WFHB 3LB6C 2DYPD 4PLJD 1V3JA 4JHZA 4I9WD 4PJDF 5J8OA 2E27H 3WNKA 4JFZH 3PQYD 4BSVB 3RVWD 5IQ9A 3FFCB 3FB7A 1GYAA 4GRMA 4DAGL 3MFFA 1W8OA 4Y4KA 1I9RL 4H1LG 1A6AB 2QADB 3TPUA 3VFSB 3GHBH 1DN2A 1SBBA 4F80A 4DCQB 3T8XB 3MPCA 5MEQB 3O4LB 4IIQB 3B8SA 1I8MB 1RV6X 3IFNH 3TO4B 4G9FD 3WUZA 5KVDL 3ZKMD 1YUHA 3GRWL 1NFIA 3VGBA 4LFHG 2WUCH 1OD9A 3EOTL 2YRPA 3DSFL 3BWAA 3QDHA 5TPWH 1EUTA 4KJPD 2YBRB 2NY5C 4ZUWA 3RTQB 4WIQA 2XNAA 2R2BB 1NCBH 3U7YL 1F8TL 3BDBA 4P0DA 4DQOL 5ALBL 1XF2B 3O2VL 3RIFF 5JMOC 1JNLL 3TIDB 5EZJB 3UEZA 1PDKA 2A1WH 4PREB 3AU1B 3P2TA 1BFOB 2MPAL 4P2QB 2FBOJ 3VXRB 5L2KA 2AK4B 4K07A 4MS8C 2R8SH 1PZ5B 3OKLB 4HKZA 1G1CA 2EIBA 3Q1SL 1IM9B 3K8LA 4XPTL 3K2UH 4I3RH 2QSVA 1KIPA 2CXGA 5F1NB 2DM2A 4WI5A 4NQED 1B0RB 1CE1H 1F3JA 2ENYA 4JFZL 3VFGH 4S0SD 2P5EB 5KZCD 3O3UN 4WO4D 2F58L 4J3VA 5KVMC 4IS6A 5SWSA 1A7BA 2X1XR 3LEVL 1JL8A 2P48B 2VLRA 4HS6B 4FQHA 1LEGA 3CFEA 4BELD 1WBYB 1S8DA 3GHBL 3PGFH 4MJIA 3QFJB 1AR1C 3IFNL 1KC5L 5FO7A 3PWJB 1BVZA 3QDJB 3QUMB 1GGIL 4EI5B 1D5ZA 2YPLD 3RA7L 5C2BL 2WUCL 5ICZA 4LSUH 2RR3A 4QT5B 3KLAA 1H9VA 4OIIH 5GHWH 1L7TH 1NCBL 5EDXA 2Q20A 3MRDA 1CDYA 3TA3D 4LCCB 4I0CC 1K4CB 1KUMA 2FL5A 2ERJB 3ZZ1A 4Z7WF 4UIMA 2PR4H 4HGWB 3MRGB 3QIBC 4F15B 4L3EA 4TNWF 4X99A 3DX8B 3TESA 3T77B 3QXDA 3ULUH 4I3RL 2DQTL 5CZXC 1DANT 1PG7H 4NHUA 4X7DC 3REVA 2VAJA 1CE1L 3VFGL 2BSSB 1HH9B 4I13B 3V7AG 3BPLB 1QLFA 4UILH 3BP7B 4R26H 4F3FB 5ICYA 12E8L 1S7WA 2D9CA 3W9EB 3H9SE 3QDGA 4KK6C 1KCVL 3CH1B 4QXTB 2VZ3A 4PFEA 3KLSA 3ARDD 4NT6B 2CIIB 2A83A 2AEQH 5K9JH 1KB5B 3NOIA 4GG6A 1K8DA 3MRMA 1BAFL 5GXBB 1OAZH 2MTPA 5J12B 3BE1H 2Q3ZA 4PRBA 5D1ZB 1A5FH 3L5JA 4HV8B 4KXZI 1GVIA 4OLXH 1AXSA 1I1FB 5CEXB 2E7LA 3MODH 4OIIL 3D39E 3L3DB 4HUKB 1K3IA 5GHWL 3V4UH 4BQ6A 1MWAA 4HHAB 4YHLH 1N6QH 1P7QB 1BF2A 1X5KA 3NIGF 4OQ1A 5GJTH 4XPBH 2PCPA 1I1AB 2BNUA 3O11A 4D9RD 1H8NA 3WJLC 1ZKAA 3QUXD 4P57B 2PYFA 1TNNA 3ABZA 3QXTA 3QUKA 4IRZH 2VIRA 1A6ZA 5GRUL 3RZCC 3LRSB 4PG9A 2ENSA 1E4XH 1M4KA 1D6VH 4CMHC 2I5YL 4Y4HD 3EOAB 3CFKA 3JV6B 3V5KA 4UILL 1LNUB 3KS0H 1J1XH 4R7DA 3K2MC 5GGSB 1PG7W 3BAEH 1F4HA 1YMMA 1KTKE 2WQRA 2Q87A 3C60A 1ZSDB 4QYOB 2X4RB 1C5DB 3MO1A 3MV9E 4KK5D 5F21B 5K9JL 4P4RB 1OAZL 1AKJD 2CRYA 3CFBA 3CMGA 4JGUA 2UYLB 1TMCB 5C0GA 3O6LH 4PB0L 1U91A 1A5FL 2IJ0C 1MIEH 4PJ7E 3F65A 1KN4L 2MOVA 2AXFB 5E9DE 3VXQA 3GSNH 3L7FB 4ZMAT 1EDQA 4R2GC 4LK4A 5AYQA 1F58L 1WF5A 2FX9H 5DVNA 5FK9A 5D93B 3H9SB 1Q9OB 2AW2A 3C2AL 2EE6A 4QXWA 3WS6A 4CU6A 1ZHNB 5GJTL 5HYSG 5T3XE 5KSBB 3O6FC 4FQ1L 4G6FD 4BJLA 4P2OD 2GITA 2YPKB 2BNRE 4WNQA 5GJSH 2DOCA 4IRZL 3W0WD 3X14A 4D9QE 3TFKC 4M3JA 3BXNA 4GW1A 2OXGA 3HCVA 1ONQB 3TO2A 4UU9A 1IC4H 2VAAB 3L3GB 4MA3A 2DQEL 1J1XL 2ZOLB 4PJ5A 5DMGC 3BAEL 3O3BA 1FL5A 4QTHA 1HHKB 3QAZB 1K8IA 3D9AL 5CEYA 4F2MB 4U49A 4ZXBC 4OLEA 4QY8A 3RUGA 1A7QH 4EXKA 1GSMA 3VH8B 3MRCA 5DRWB 3FTGA 5GGQH 4P3WA 2Q7NA 1FFOB 4P23D 2V2XB 5DUBA 1MIEL 3BZDA 2DQGH 2NMSA 1NAMA 4HMDA 3SDXF 3GSNL 3TBSB 5F9JB 4AMKH 2BVYA 4NKDA 3LSOA 5I0ZA 3WNNA 1LE9B 3SDAC 5FCUH 4NP4L 4OLVL 5FYKU 2BVEA 3T0VA 1JPST 3C5ZA 4DKEL 2ARJB 1JNHB 1YYMH 3MV9B 2EIEA 4IDLA 4NBYB 4W6YB 5EBMA 3BZEB 3GSUB 3FONA 5J9PB 5D7JC 5IVXF 2P8LA 2XT1B 2EDFA 2F9BT 3G04B 4YIQA 5GJSL 1VENA 5E2WH 3VI4E 2A6KA 1T66D 2G5RA 2OTPA 3BYYA 4LKXB 1I85A 4YO0A 3SQOH 1K2DB 1XR8B 3ZYOA 2D2OA 4IRJA 5E9DB 2BK8A 4XP1H 5HTSA 3EYQC 4NNYB 4XPGH 3Q0HA 4R3SB 4GAFB 3IDJB 3VXUD 3OJDA 4NN5C 3S96B 2Y23A 1NGXA 1JZ2A 4UB0H 5I1AA 3EYVA 3LKNB 1TZHA 4E41B 3DBXB 1LDPH 4I4WB 5FUOH 2BNRB 3SKUD 5I1GH 5GGQL 5CSZB 2R1YA 4RWYH 3HAEB 5B39A 2AJZB 4LNVA 1QPPA 3TLRA 4N1HB 4XBPB 1AI1H 2DQGL 4UUJA 3UO1H 2FX7H 3VXPA 5J6HB 2BCKA 1QQDB 3OHXA 4U1JB 5EIVA 4AMKL 4CMMA 4CUCA 3HG1A 2E7MA 4YHZH 3IDGA 3QO1B 1A7OL 1PBYA 1CLYH 5LAXA 5IKCA 3O45A 5I1DB 2GAZB 3PE9A 3F6LA 4KRPC 3SE3A 1YYML 4J8RB 1U8LA 2ITDB 1JWMA 4WI3A 1L4IA 3RL1A 3EO1B 2ZNXA 4MNQA 3HE6D 5SX5K 2IBZY 1YJDH 1ITBB 5E2WL 4ENEC 5E0QA 1IAIM 4PRNA 1KTDB 3SQOL 4ONGH 4M6AA 1Y0LB 2JB6B 3PHQB 4ALAH 5I1EH 5C0CA 2CDGA 5AD0A 3BOVA 2HFGH 2GT9B 3S37H 4Q9RL 4XP1L 5IFJB 5IMOA 4QRQB 4M1CD 3DIFB 2ZOKB 1S7VB 4UOJA 2Z8RA 3WFCH 3N1GC 3QIBB 5IF0B 5T1KA 4UB0L 4YXKL 2C3GA 4EKXA 5E7FA 3NPSC 5ID0B 4TOYL 1WZKA 4KKBC 1LDPL 3MXVH 2O5ZL 3O6KL 1NKRA 1A7PH 3QWRD 4U2ZA 3DWTA 3O9WC 4YE4H 4TNVK 1EHLH 4HJGA 4K3JH 2ATPB 1G9ML 1TJGL 5DA4A 3UZVB 2O93L 2DJUA 3UO1L 1WFOA 2FX7L 2J8UF 4OI9A 2Y9RT 3V6FB 4YHZL 1OP5H 4X8JA 1AH1A 5C0AD 1CLYL 5TE6H 1RZKH 4DUVA 3FAWA 1J8KA 1QNZL 2EDQA 2M2DA 1CU4H 2X4OB 4NKIH 4RGND 4YHIB 1AGFA 5FYJE 1CTNA 1FNAA 4RGMC 1ZLSH 1EEZB 3MA9H 43CAA 5INCB 1A0QH 3MMEB 3DX7A 1E6OH 1TETH 5AUMA 1KV3A 2UWEB 2DWDB 3EZJB 5I1EL 4ALAL 1AXTL 4PV8A 4WHTB 3BESR 1LP9F 3PL6C 3U36A 2HWZL 1CLCA 2HFGL 4FQIL 3S37L 2W0PA 4JAMB 4DJMA 2FGWH 4U6XB 5E6IC 1R3JA 1ZE3C 5L0QC 2VE6A 4JM2C 3WL9B 5IW6B 1F5WA 3REWA 3O3AB 4KKLC 3RZCB 4OUOA 3UAJD 3IETB 1A7PL 5CP7A 4M62H 4CMHB 5KS9F 4WI4A 3RIFK 2R1XA 1ZMYA 3HMWL 5CJXC 4KDVA 4ODWA 4L8DB 1T0MA 2GKIA 5BOZG 2IQAB 4N0YH 3X12B 5FUCC 4N8VA 3KPSE 1GCFA 5EBLA 5IB3B 1JV5A 1MFAL 4ZNEE 3IFOA 4I77L 3E6HB 5A2KH 4RAHA 4PJGA 4PTTA 5TE6L 1ZLUK 1RZKL 5IBLD 1QFWM 2E8ZA 4G8IB 2HFFA 5F7LB 4S11A 4G8FB 4OBRA 3PHOA 1CU4L 4NKIL 1WZMA 4RRPG 5C0JA 5D1QD 4W68A 3UTQA 4XNMB 4QRSA 4Y7MA 4J2XA 3MA9L 2EEDA 4WFHD 4NDMA 1U3JA 3H7BB 4MDJA 1E6OL 4HS8H 1I1CA 1G6RB 3WKNA 4LHUD 1T22A 4R2GB 3L3OB 1BX2A 1MCEA 1NSNH 3QH3A 4CVUA 2PYEB 3SKNA 4JFPA 1IVLA 3IDUA 5I8KL 4LRNH 4CVWA 2FGWL 3O6FB 4P4KC 1XT5A 1YNTB 5CAYB 2AV1B 2Q8BH 3UTZB 1FO0B 2HA1A 5EO0B 2HT2D 3KLHD 4XRCA 1FLTX 4DVBB 4AT6A 4H5SB 4M62L 3I02A 3LRHA 3QIWA 2VQTA 4YBLC 4MAYC 4N0UE 1G7JB 4X6BB 2G75A 1FZOB 2QSQA 3I6LE 1S9KC 3UYRH 1WZLA 1II4E 3NFSH 2HRLA 1FP5A 4Q6IC 3WV0A 3IFPB 5EBGA 3GMQB 3JV4B 4L4VE 5F93C 4ZXBB 3J8F7 2VXQH 3OBAA 2CLZA 4OCLC 3TN0A 4NNXA 1H15B 4X5WB 4AZ8A 1T1XA 2CK0H 2HKHL 2VC2L 4JG0H 1GL4B 5F89B 4LMQE 1ZHKA 1D9KC 3DMMD 5LG1A 1FJ1A 1P84K 3WJJC 3TJHD 4HS8L 2V9RA 4L8SC 4C59B 1TQCC 3C6LD 3RAJH 4RMUA 3KYNA 3JWNC 3WIFB 1NSNL 3P4MA 3SDAB 3B3IA 4NQDA 4MJ5A 4UINH 4WU5B 3I6KA 4PJFF 3KPSB 5HDLA 2ID5A 2XZZA 2WBWB 4WI8A 3PV6A 2VDNL 3EO9H 4WWKA 5BCAA 5FF6A 1R6VA 4APQD 2X4NB 1P6FA 3LV3A 5D7JB 5KVFH 2Q8BL 3IRPX 1UM5H 1LO0H 8CGTA 1CICA 1AJ7L 2GI7A 2VLLA 4HWBH 5FGCE 1HQ4A 3QPXH 3LAFA 5DTFB 4WFFD 5GZNC 1SMOA 3IVKB 1U41A 3A6OA 4HIIA 4UNUA 4NRYA 3G6JA 3N06B 1KPVA 5B39G 4Q6YA 2DD8H 3OXRA 1S78C 4U1SA 4NN5B 4GRLA 3NFSL 3O4LD 1EXUB 4JY6B 4MQ7A 3ARRA 2NNAA 2VXQL 4S10A 4B53A 3TO4D 1QA9A 4R0LC 3L5HA 4ODVH 2BVTA 3NIDF 4GO6B 2M8XA 4OM0H 3N9GL 2DQFA 3PIQB 1NLBH 1XR9A 3MNWB 3JTSA 2YUXA 3RTQD 4LASH 4IOSD 2CUIA 3MOQA 1O0VA 5DA0B 4ESKA 4N0UB 4J1UB 3RAJL 1A2YA 5FUZH 1IZJA 4UINL 4YWGH 2D7TH 3VXRD 4KRPB 1A1NB 4ONFL 4L4VB 4RBPH 5ANME 3MRLB 2ADGA 5KVFL 5CBEB 1FORH 1P4BH 4M4PA 1LO0L 3BKML 4F7PA 2X4SB 4S1QH 4ZD3H 2VDLH 4C83A 4GW5B 2P5ED 4HWBL 4YGVA 3KYKL 3D69A 3PJSB 1C5BL 4MA1C 5DT1H 5C07E 3QPXL 2GFBA 2WSKA 1NFDF 2FIKB 4PD4J 1A6UH 3G5XA 3VXMD 2GJZB 3RGVD 5GRYA 3T0WA 1HHGA 1X7QB 1SEQH 1RZJH 1MFEH 4YR6B 4OGAC 1BOGB 2DD8L 5CILL 2OTWA 4FXGA 4XGZB 4ZTPH 5TE7H 3QZWB 2XWBB 2AJVH 3GSVB 3P77A 5GGSY 1BLNA 1FSKC 4NWTH 5HVWA 4YNYA 3NPSB 5I76B 4MQXC 3QUYD 4ODVL 3R0NA 3VXNB 2W65A 4FQXD 3SGJA 3HTLX 4EI5D 4KTYA 1BZ9A 1C16B 2ORBL 4HH9B 4OM0L 5CBAA 3MV8E 2X42A 3DHMA 2V5RA 2VL5B 4YAQA 4LASL 1S7QA 1FAKT 1S7SB 2H32A 4JFQA 4PRIA 4YHOH 5EUKA 3ARED 5ESVB 2MKWA 4XTRD 3JXAA 1DUYA 1YEDB 3PDDA 5EU7C 2X41A 3GJFK 4YWGL 2D7TL 1IAII 4LGPB 5D5MB 1JYNA 1CL7I 1ZA3B 3FB8A 4LBEA 4RGMB 4DGIL 3GDBA 5FECB 3BYTA 1FORL 3KYMA 4QOKE 4ZD3L 4S1QL 4LSVH 2VDLL 1RY7B 1I7UB 1FYTB 5K9OB 3PWPA 5DJAA 1U9KA 1KIRB 1V8HA 5TF1H 3INUH 4NM8H 4XWGH 3PL6B 2X4UA 5D96C 1TJHL 2IF7A 4OLUH 1SEQL 5EOTB 5F88B 1MFEL 3DUUA 3GIVA 5E6IB 2VDKL 5GZOC 5L0QB 1UQSB 3FOMB 5TE7L 1M1SA 2X70B 5HHNB 4JM2B 2AJSL 4N8VG 4M5ZL 4EDXB 5B22A 1S9VB 1JVKA 1VDGA 2ZUSA 4HULB 1I9JL 4K71C 4PG2C 3SE9L 1VGEH 5D1ZD 5JDSB 1AXIB 5L8LB 2NXYC 2Y06L 5D6CB 4AIZB 4FFWD 3O4OC 3KPTA 5AZEH 1NGQH 1RK1A 2M1KA 2RGSA 2OSLB 2XRAH 3BKYH 5HXMA 4YHOL 4KDWA 2QV2A 1CFNB 1MCBA 2XWTA 3QEQE 1I1AD 1W0VB 4TVPL 2FYYB 5TFSL 4F7CB 3F12B 1NCAH 4X6FB 3HFMH 1MCDA 5FM4A 3LH2H 5LGHH 3SBWA 5JLZB 1WT5A 2WNGA 3W9DB 2YSSA 4U2YA 3VFNB 1G0DA 4HD9A 4PJDB 4I2XA 1X5AA 5LGJB 4ZSOE 5IEHB 1R5WA 2OTUB 3MBED 4K3GA 3INUL 4RAUA 4XWGL 4M02A 2CDFA 2E6JA 3PWUA 1RIHH 4OLUL 5DD3H 2P43B 4P4KB 4U0RB 5HPMA 3GNML 2IADA 5BVJA 1HWHB 4UOW1 5IP4A 2X9YA 4YBQC 2OZ4A 5HGDB 1VGEL 2DLGA 4OZ4B 4XXCC 1XGQA 1UWEH 4QOKB 4ODBD 2CMRH 2DQCH 3O3EB 4YBLB 4MAYB 3RWGB 5DUPH 4YX2L 5JW5B 3HZYA 4QRPA 4PRPA 5AZEL 1G7LB 1WFNA 2OR9H 4JFDB 1MOEA 3H9SD 3BKYL 4PGBB 5HYJA 1XMWA 4WFGE 4TQEL 1D5MB 5KSAA 4FP8L 1WBZB 2HFTA 1NCAL 4QHMA 3HFML 5C9JB 4Z7VF 3S5LB 5EO1B 1RIUH 5C8JB 2P7TA 5ISZA 1D9KB 4M8QA 4Z7UE 2APBA 5B4MD 3QISA 5ETUA 3EO0A 5IMKA 1BD2B 3MRJB 2CR3A 4L8SB 1MHEA 1TQCB 4ELMF 1MFNA 4WUUB 3D39D 2QSCL 3EHBC 3EJJX 4ZNCD 1BVKB 1ZVYA 5BJTB 4XPAH 3SJVE 2YXMA 5CSZA 5DEFA 2A6IA 3MGOB 5HHVL 2G9HB 2ARJQ 5I1LA 4QHKJ 1BWMA 4LU5H 2APTA 4QCIB 1B0WA 5DEGA 2QQKH 5JO5A 5C0EA 2F53E 3QG7H 1CIUA 1UWEL 3F62A 2CMRL 2F5BL 4ELKB 3BJLA 4LP4A 3L95A 3S7GA 1G9MC 4ZSOB 5GGUA 5GGTH 3I84A 5AAMA 4EUPA 4ISVA 2YR3A 5BZWA 1WV7T 1VACB 3PQYA 1WIOA 2X9WA 3OPZL 3OMZA 1ADQA 4NCC1 3ORJA 4S1DD 5EWIL 4PJHA 4LDEB 4JGMA 4Z18A 3TH2T 3MV9D 4R0LB 1ZT1B 2PW2A 4Y2DD 4Z7WB 3AFLA 1OGAE 3BMWA 3V8CA 1IGYB 4GRWE 3JUYA 3CJJA 4ODTH 5K33A 1OF2B 1ORQB 1BJ1J 4BFGA 4YBHA 5I16A 3D0LB 5GS2D 1VERA 3PGDB 3VJ6B 2F74B 5E9DD 4RMTA 4G9FA 3BP6A 2AXJA 3LEXB 4PBWD 4WV1A 2D7PA 2ZZUT 5EC1B 3RBSA 3GB7B 3DARA 4J4PC 3QG6A 1SY6A 4XP6H 1T1ZA 4Z77B 4MS8D 4XPAL 5D70H 1XCTA 4LCWE 1CG9B 5DJZA 1WSST 2X4PA 3VGGA 2EO9A 1MQKH 1QRNE 2KQNA 4LU5L 4M7KH 2BNRD 5DD1H 1XGRB 4XCFH 2IH1B 1U8PB 2QQKL 5EN2B 4LLWB 1W72L 4HIXH 4Z7UB 1T5WB 3FFDB 4D9QD 4MA1B 3H3BC 1AFVH 2H2PD 3MROA 1J88A 3FQWA 1S7TA 3TVMD 4JZJC 5CHNA 2RB8A 5HGAA 4HXBH 2J6EA 4QHNB 5M95B 4L4TA 4M7JH 5GGRA 1B6UA 5GGTL 1ZT7A 5JNYA 2RQ8A 3OAUH 5J57B 1I7ZA 1QEWB 1SJXA 3GO1H 2ICWJ 4KK9C 2EXYC 2P42B 5HI3D 3SJVB 4WO4A 1FSKB 1NGYA 3H8NA 4XP4L 1CFTB 4ZAKC 3KXFB 1GOFA 3CXHK 4KU1A 2AKRB 4OUUB 1HOCA 3ROOA 3SQBA 2F53B 1T20A 5EULV 3MOBL 3RWJA 4KFZC 3WDJA 4P5TC 3V6ZA 3DURB 2OR8A 4L3CA 5GS1C 6CGTA 5HHOB 4I3SH 4F9LC 3WFDL 4J3OC 2IGFH 3QIBD 4LPVA 1I1RA 1OW0A 3IXAA 4CNIB 5D70L 4JVUA 4BYHA 1NMAL 1OTUD 1S7UB 5CZXD 4M7KL 1OGAB 3TA3A 2QQLL 4JKMA 5CLTA 4GRWB 5DD1L 4XCFL 5LKNA 3CXDL 4PLNC 1KXVC 4HIXL 4WEUD 4IOFD 4O2CB 2CD0A 1JI1A 1AFVL 3U9UB 4UV4H 4HIJA 1P9MC 1F11B 4J3UA 2EYRA 1CFQA 5D96B 4WJ5B 4HXBL 1VGKA 5DC0A 3H3PH 4U3CA 4M7JL 3QEHA 5J13C 4JRYD 1TTFA 3OAUL 1EBPA 4X6CF 3BGFC 4HX1B 4WUKH 1TVBB 1HILB 4N0FA 4U1MA 3U0WL 1M05A 2PO6C 4LCWB 4FABL 1YY9D 2EH8H 2OQJA 5GS0H 3D85A 1QRNB 4K71B 1IEAB 4N5ED 1INQB 5ESAB 1QSFB 3EYFB 2E3VA 1DN0B 5BRZB 4XCEA 4BUGA 1MFCL 1JPFA 2NYYD 2EDHA 3VRIB 2NXYB 3ARDA 1KT2B 3VRLE 3O4OB 4X6DF 1GH7A 3V6BR 4HIHA 4GKNA 2P1YA 1M6OA 3RDTC 3WFEH 4KHXH 2PW1B 4ZDHB 1HQRB 5EPMA 1F42A 4I3SL 4LAQH 1FRGH 5GRVL 1MHHA 2LQRA 3K4AA 4GKZA 4QXGH 1JWUA 2UZXB 2ZPKH 2BX5A 2YMXH 1N5AB 4L8BB 4H88H 3MLVH 1ZV5A 3RZCD 4LLMB 2BOBA 2MFNA 1PKQA 2X9XA 4XX1G 4PJCF 4KRNA 1UH4A 3V6OC 4JDVB 1HXYB 1BZ7B 3DUSB 1I8KB 3ULSB 1NBZA 2D0HA 1F02I 4IMKA 2AJYH 5DVKA 2GUOA 1MJJA 2C26A 4Y89A 4L29B 4JO2H 1RJZA 5HGHB 4MNGB 3BUYB 1FGNH 3H3PL 1KPUB 1IM3B 1LEIA 1G7HA 4XBEH 2WBJC 4ZS6C 1RUQH 3SDXB 1MLBA 3BKCL 4WUKL 1JUFB 1BEYH 1MRDH 4ZS7H 3P9MB 3QHTC 1FVCB 4AL8L 4AEEA 4OZIA 1JI2A 3QFDB 3VXSE 5E8EA 1S7RB 5DK2B 3ZE2F 2EKSA 3BH8A 5IVXB 3BKJL 3EFFA 1YNKL 3P0VH 2JCCA 2NLJA 2ZUWA 2J5LC 3B9KD 1MUJB 2Z91A 3BW9A 3G9AB 3WFEL 1AKJA 4KHXL 4WI6A 5GGVH 2XKNB 5I1JL 1INEH 3O41B 1FRGL 2QL1A 3B2UC 5BV7H 3ULUF 4QXGL 4NJAH 5F9AC 3VWJA 5DTFA 1JHTB 2YMXL 4KVNH 4U1IA 4H88L 3GSWB 4NHCH 3WLBB 5FYJD 5I30L 1H3GA 4PJIE 1P6AB 3STZB 3OAZK 5DZLA 2B2XH 1YY8B 3TFKD 3S34L 2I27N 1UKSA 3CH8A 5EZLA 1S3KH 4WFEE 5DQ9B 3RY6C 2AJYL 4OGXH 4P2OA 5DURB 3BISA 5EU3A 3K81A 1CVRA 1KJVA 3B9AA 1FL6A 3W0WA 4XBEL 4PJXA 2E9IA 5IK3A 4CVXB 5I2IA 1RUQL 2J4WH 5JQ6H 4OD3L 1RD6A 5CP3H 4DZBA 3FN0H 4CDGC 4EUPG 1U93A 1BEYL 1DL7H 1MRDL 4ZS7L 2CDEA 2H8PA 3LZFL 4O4YL 2R23B 2GYSA 5E5MB 2GEEA 2KPNA 3GMOA 1V7MH 1G7QB 4OCSH 3KPLB 4G8EA 4N9GB 3S37X 5KOVC 1HKFA 4XH2A 4LNRB 5D4QA 1S9WA 1ORSB 4ZOBA 5D7IE 5D1XD 2P5WB 1X3DA 4ACPA 4ETQB 2CK2A 1Z9SA 3SDAD 1VFOA 5HJ3B 3KPSD 1U8MB 4P23A 2Z93A 3ZDZF 5CJQH 4N0RA 1EEYA 1T83C 1UB5B 2IPUK 3C6SA 5JXED 1NANI 4GW4A 4NJAL 1R5IB 4S1SL 4L3AA 3ARFD 1U8OA 1CN4A 2DLHA 4P49A 4KVNL 4U4BA 4NHCL 1BGXH 1DQTA 5C86A 2ADFH 3VI3F 3K74B 3U0PA 1DQJB 3VXSB 4E9LA 3KAAA 2XA3A 5K59F 1JTTA 3MRFB 4PY8J 1S3KL 3SPVB 2AGJH 4PY7B 4XC1H 1AGEA 4LOUC 1DVFA 1DCLA 1PAMA 1F6AA 1NC4A 1P4LB 1UVQA 4QHUB 5E1AB 4ZFFA 3HUJE 3KPPA 5JQ6L 3BDXA 4PGEB 5FKAA 4Z9KB 1YEHH 3FN0L 2EZ0C 1DQMH 1LMKA 2XN9D 4WY7H 1GOGA 3T3ME 4F58H 1U95A 2FSEB 5DYOB 3EGSB 1BVLB 4JDTL 1ZLWH 1V7ML 4LSSH 5EU4B 3MXWH 5CD5D 3RVXC 1AP2A 2DWEB 3VXUA 4KWUA 3HC3H 3V0WH 3T4YA 4X5XA 5ELIA 4MB4A 4G3YL 5J1AB 4JZJB 5E8NB 3QJHA 1JF1B 4HPYH 3BH9B 2FZ3B 3GSRA 4LKCB 2H26B 2HVKB 1DDHA 1I1YA 3I6LD 1MHPH 4Y8DC 1KTLB 1LP9B 1OM3H 4L4VD 1YQ2A 3PWLB 4ZAKB 2I9TB 1B4RA 1RUAH 1I3RA 3RNQB 1S7XB 4O51B 4BH8A 5BS0E 5ICXA 3ZE0F 4JQVA 4UMGA 1F4YH 3V6OE 3X3FH 3MTRA 4CVZA 1BGXL 2ADFL 1K5NA 2JLLA 2J1KA 3O8XD 1FCGA 2AQ1A 4P5TB 1F2XK 5D7IB 2UY7A 4BZ2H 5GS1B 2AGJL 1CQKA 5DJ0B 4NCDA 3GIZH 3HE6A 5KN5B 4XC1L 1U3YA 4KUZH 3QP3A 1J9CT 1YPZE 4Z76B 5DJ2A 2ZG3A 1OSZA 3QI9D 5B8CA 1AGDA 5IG7A 1A4JB 4WY7L 1DQML 1RULH 4F58L 5EH1A 3Q6FB 1KJ2A 3HNSH 3O9WD 1NCWL 4U33A 2HLAA 1ZHBB 3V0WL 5IMLB 1MCPH 5I8CA 3QHFH 4Q2ZA 4GG6F 4HPYL 5J13B 3WD5H 2O61A 4JLRA 2B8OT 1DZBA 3BGFB 5IB5A 5CFHA 3JVGC 4KDTC 1XF5B 2O5YL 3CSBA 3IRZA 2PO6B 3LDBC 3JV5A 3WHXB 1OM3L 3PP4H 4X4XB 4OFVA 4NO0B 4OT1H 3UC0H 2IPKB 3IDYC 1Z0NA 1MCWM 2BC4A 4J3XA 1EAPA 4UBDC 4NKQB 1MI5E 1JGVH 3V8OA 2WIIB 4JHBA 1XGUB 1Q72H 4HFUL 1H8OA 4NYLA 1MRCH 3RDTB 4JFOB 1IAIH 5EFIA 4UAOC 3SCMC 4G7YH 4WI2A 4BZ2L 1WEJH 5MERA 1H3WM 1HZHL 1ND0B 2CLVA 3CDGB 4GBXC 4G43A 4KUZL 2WV3A 3B2VH 4JM2D 4PJAA 1A14H 2W59A 3KWWA 4RFNC 5TGBB 4RWHA 1TQBC 3OXSA 3F8UB 1YEJH 5BS0B 1RULL 3FO0H 1JK8B 3AMLA 4CN4A 4FQLH 4OBSA 4CADB 1GC1H 1MWAL 4M03A 1IC1A 4Y1AE 1CGYA 2P44B 3LQAH 3H42H 1PQZB 3BQUC 3P40A 3ZSTA 2AJ3A 1ZTXL 2HJKA 5C07D 1LD9B 3WFZA 3QHFL 4P2RA 1X4YA 2PF6A 4OIAA 4RDQG 3WNMA 1JMXA 5IMMB 2Z8VC 3SHSA 2WBJB 3E6FA 2AV7A 5DRNB 2P24A 3PP4L 1I8LA 3GM8A 4PJFB 4W4NA 1IAOB 4OT1L 3UC0L 2VERN 3CCHA 5E94B 4OF0A 5GRZA 1IAMA 3U30C 4AH2B 4OV5A 3ZKXC 1JGVL 3G6AB 1A6TA 4MXQC 4ODHH 3RNKA 1A64A 4X4ME 5B38B 3MV8D 3DVGA 1Q72L 5D72H 2CSPA 5BMFH 3W81A 1UC6A 2J5LB 5AG8A 1Q9KB 3BP5A 1IAIL 2IANE 5D1QA 1D5BA 1CL7L 3MRKA 4XAKE 3EW3B 1WEJL 5TDOB 1A7NL 1ZVSB 2P8MA 3CUPB 3IDXL 2JJWA 3CC5A 4P4KD 1HHIA 3HKFA 1A14L 5D9SA 3MUZ1 4G6KL 4LHUA 4FQPA 3WUWA 1DFBL 2Y7QB 4MNHA 1OSPH 4WHCA 5C1MB 1H5BA 1YEJL 4JN2B 3FO0L 4OQTA 4FQLL 2OL3A 1MI5B 4RNRA 2AJUH 1JFQH 1QLEL 4QOKD 2ICCA 3H42L 4W6WB 5DMJB 3BP4A 1KFAH 5DK0B 2VH5H 3RUGF 1BOYA 1TPXB 3QUZC 2BERA 4NUJB 1T7YA 1VKXA 1ZGLA 2FHFA 1G1YA 4X98B 5EU5A 3ARXA 4OB5H 1BP3B 4TVPE 5L9DH 1S9YA 1QFWH 4MD4B 5IBUG 1JWSA 2K7QA 4XCNA 3DXAB 5ITFA 5H94A 1MJ8H 2EEAA 4ODHL 4Y1AB 2P8PA 2ESVE 5C71A 2F54A 5D72L 5A2LH 5SWZE 1OT2A 2IC2A 5DJCB 5D2NE 3ARBC 4P2CG 5KSUA 3D1MC 4JDZB 1MCNA 4LF3B 1NFDB 3RHWF 3KR3L 4UOW0 5ITBH 4KH2A 4LLVB 4JRXE 3QEQD 3JZ7A 1J05A 5FDWB 1DBMH 3C6LA 5HVGB 3LHPH 4WEBH 2AQ2A 3U4EB 2XICA 1FFNA 3HMXA 3QCVH 3RJQB 3GMLB 3OR6A 5JA9A 2AJUL 5F7EH 1EX0A 5GZND 1U8QA 3QIUC 3S97C 1JTOA 1HCFX 1KFAL 2AJXL 2NY4C 4APQA 1QBBA 2B5IC 4GMSH 5FO8A 3VW3H 2IANB 3FT4A 3BHBA 4HAGA 4MAUH 5GSRB 4C56E 5ID1A 3SOBH 4K8RH 1OTTC 2G60H 5EB9A 5L9DL 3VFWB 4OFYD 3O3DB 3F7YB 5I8EB 3ZDXF 3MR9A 3F5WA 4PJEA 5IBTL 2J88L 3GMPB 4XWOD 5C0FA 1RUPH 4L9LA 3OKNB 2BOCB 2XFXA 2V6HA 1MJ8L 4JFXB 4I0PC 2COQA 4U1HB 3QB7C 1HYRC 1NDGB 2C3VA 4JZNB 3H0TB 5ABDE 2Z4QA 3Q5TA 3AGVA 4JGJA 4N0CC 1DEEB 5DJ6A 2IAMC 3VXTB 4OJFH 4RQQB 3OR7B 3EJZC 4B7IA 4LLDA 1BM3H 1N8ZA 3NFPB 1JP5A 5FGRA 5T1LB 3B5GA 4AQOA 1DBML 1L9NA 5MENA 3MJ6A 2CUMA 4WEBL 3GI8L 4C57C 2OCFD 3ILPA 1FNEA 3QCVL 4HMCA 1B0GB 4MYWB 4A2MA 2HG5A 5JHDE 4LRIA 5C0IA 1JGDB 3B43A 4HUXA 2Q8AL 2ESVB 2VDRH 1NMCC 3QRGL 5SWZB 1AD0B 2KQMA 3IAPA 1C08B 4GMSL 3GUTA 3T0BA 3RWIA 3VW3L 1VADB 4OGAD 3SJVD 3CZFA 4I5BA 5KSVA 5CWSA 5DC4B 5T33H 1U8NA 4JRXB 4K8RL 5HI5C 4U0QB 5F7DA 5F6HJ 2G60L 2YWZA 3V9FA 2A6JA 4X6EA 4ZPVB 4WENB 3GMMB 1MFBL 3VXMA 5IB1B 1WAAE 3LPGA 3RGVA 1QKZL 3VU2A 4OZGE 3DX9B 1I8IB 2K1MA 2G5BB 1RUPL 2F53D 2YC1A 4LHQB 4S0TD 3UZQA 2FH8A 2KKQA 5IV2A 4DN4H 3GJEA 5JPMA 1KG0B 1D5XB 3QUYA 4MXVF 4FQXA 4WHYH 5I8OL 4YXLH 1UZ6F 4NRXB 2DQDH 3S3PA 2R29H 2GCYB 4OJFL 1AY1H 3LDBB 3VFTB 2RJMA 5IB2B 1NBYA 3GJFA 1M7XA 1BM3L 2PXYD 3IDYB 1XGYL 2DIBA 4WW2F 3V0VB 4LPCA 2YD5A 3AREA 4PR5A 4ZQKB 5K9KA 1A6VH 2XTJE 2VXUH 3LN5B 4B41A 4NUGH 1OPGH 2B0SL 1XCQA 4UAOB 3SCMB 2VDRL 4M5YH 3W11C 2EDDA 4PRDA 4F57L 1SBSL 4NWUH 2WZPD 4WCYL 2VABA 4GBXB 5CD3A 2BRRL 4JFFB 2DIJA 3HNTH 4HLZG 5JW4M 5EA0H 3SE4C 3T4AB 1T3FB 1TQBB 4PS4H 5T33L 4LCWD 1AIFB 1N4XH 1FVDA 3OB0K 3GBLA 2ZSWB 2IALB 3WS3B 3BQUB 1X5FA 4M1DH 2NXYD 4C4KT 1IEBB 4PJGF 4Z7VB 3D25B 1QO3B 5JHDB 1P2CB 3P0YL 1OGTA 1EUUA 1I7TB 3FB5A 3T08A 1IGJA 3LIZH 2LV4A 3H7LA 5E8PB 4DN4L 3U2SB 1SJHA 4QRUA 4LP5A 4QF1A 4ELMB 1IGFH 2R4RH 4YXLL 5CZKA 2A9MH 1WJ3A 2DQDL 2R29L 3HRZB 5HDQH 1MHCB 1PD6A 2EKJA 3UP1A 3LKSA 4XZUB 1EFXB 1EO8L 1LO5A 1UYWH 1DP0A 3EOBA 4ZYKA 3ULVL 3U30B 3IDMB 5IR1B 2CRIA 2IH3B 3ZKXB 4LHUG 5HHME 5IM7B 4F33B 2P47B 1A6VL 3WUWG 5B3NA 4TSAH 4Y4KC 1Q0YL 5ECJE 4NUGL 1OPGL 3CVHA 4LARH 5KAQG 2YD3A 2BVPB 4KPHH 4BUHA 4NWUL 1FPTH 2F8OA 4EQ3A 2F19H 3V4VL 1T21A 3HNTL 3EDJA 4YZFF 4R7NB 1DQLH 1JPTL 4HDIB 4XBGA 1GOHA 5E95B 3EYUL 4GUPB 4YBQD 3FQUA 3MBEA 1N4XL 1D6EA 2V7NB 3FO9B 4H1LB 4UT6L 1TFHA 1E0OB 5ENWB 2MNUA 4AK1A 1W72B 3MRPA 4OZFA 3WDIA 5FYJU 3QUZB 4HG4J 3MNZA 5I15H 1J8HE 2EIZB 4HS3A 3LIZL 4X7TB 4M00A 2A77L 3MV7A 2R4RL 1HYSD 2A9ML 3TH3T 3QQ9C 5HDQL 2CO7B 2R2HA 3HZVA 1XIWA 5HDOA 3HS0B 4QXUH 3ILQD 4HUUB 1UYWL 1JGUL 5FA3B 3MLWH 1HSBB 3VFMB 2VMFA 3STBA 3RFZC 2NY2C 3QUMH 4FFZL 5IEKB 4ZTOH 3EHBD 1WITA 2J8UA