3O6QB

The structure of spoiisa and spoiisb, a toxin - antitoxin system
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
43
structure length
43
Chain Sequence
b'CEPRAAKPFKILKKRSTTSVASYQVSPHTARIFKENERLIDEY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stage II sporulation protein SA
publication title The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Toxin/antitoxin
total genus 7
structure length 43
sequence length 43
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14185 SpoIISB_antitox Antitoxin SpoIISB, type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3o6qB01
2O01N 2AXCA 3O6QB 1OZHA 2RH0A
chains in the Genus database with same CATH superfamily
2ZT9B 4H44B 3I55P 1LTGC 3CWBG 1OW6A 4LLHA 1KORA 1BGYE 3M0AA 4K3AA 3WMM0 1D7MA 3RK3E 1EDLA 4ZKUA 3B5NA 1IFIA 4B86A 3MHVA 4RESB 1ZP0C 5CCGC 3A7OA 2WZ7A 5AW3B 2J58A 2G3AA 3HUSC 3NMDA 1VQPP 4YXDC 4C7NA 1HH0A 1Q7YQ 1Y47A 3D71A 4NPDA 2E75C 3ABVC 1LGHB 3L74D 1IK7A 3H1KD 2RN0A 2ZFCA 1YHQP 2MJZA 1NOHA 1PZQA 3BRVB 1DX7A 3WUUA 3OW2O 1NHLA 1SQBK 4IFDK 4JQ0D 2YXQB 1OFCX 2JJLA 1VQNP 1N7SD 4EOTA 2H8PD 3RK3C 4C46A 2B88A 3CCSP 1HJBA 1JTHB 4WBAA 3FGAD 4CPGA 4I1LA 5APQA 2NPSD 1NTMK 4NPFX 3A0HH 3V2NA 5KLVE 1CW5A 3MP7B 1N2DC 3L35A 1NH4A 2ZYDA 1MZ9A 3AEGC 1NKNA 1FOSE 1VF5C 2ZT9D 3L73G 4H44D 3HE4A 1OX3A 1K9MQ 5AW1B 4HB1A 1BCCJ 1G1IA 4YTPC 2K88A 4EI2A 3V4QA 2ZXXA 5GTHE 1VQ6P 5KKZC 2WSCH 3RK2C 1LP1A 2L5GB 3H1LD 1W2BO 1VQ8P 3MUDC 1GMJA 4L75A 3KYQA 1LT1A 1AQ5A 5AVVB 1BDDA 3CCUP 1NTMJ 1FZAA 1EZVG 4DT0A 1T3JA 4U3FJ 3M91A 2ZVNB 1FZGA 3CX5D 1RF1C 1K04A 3SFEC 3GF7A 2FYZA 1KQFB 3D6ZA 1S3JA 1NTZE 1DIPA 2WMMA 1X9VA 1VPCA 2YKOA 2K9JB 1GK6A 2FXMA 2IZ0A 1YQ4C 4OGQB 2O3JA 1BGYJ 1VQ9P 3AE9C 3L71E 4ZKPA 2A45G 2FYUK 3H1HE 2I1KA 2M3EA 5AW9B 2N1TB 1QEXA 1NTKD 2K1AA 3IR9A 1HGZA 3VN0A 5AVWB 3H1JE 1X22A 2HPCA 1CZQA 2A06G 1OXZA 2YO3A 1S9KD 1YITP 3H1IG 1SQQE 1PP9D 1VDFA 2QG4A 3L70E 1EQ7A 2BCCE 4M3LA 1J1EC 3UIAA 1SFCC 3B8EB 2ZAEB 2YIUB 4KT0J 3R4YA 1KILB 3SSUA 2YKPA 4Y28J 2HODA 1FZBA 1T2KC 1OW7A 1WMKA 2H7HA 3EWKA 4AUWA 1VQOP 2YMYA 2ZXEB 3HTKA 3BCCG 4QMAA 1UIIA 4H0LC 4K35A 3O6QA 5M1BA 2KB7P 3VP8A 3E1IA 1NJIQ 2YKQA 5AW5B 2PGDA 3WU2E 1VQLP 5KLVJ 2IX7C 2N9BA 2WSEH 1AA0A 2Y0CA 3CMAP 3RL0C 1H8AA 1LTJA 2GA1A 1W5CE 4LC1A 1NTZK 1CI6B 2QJPB 4OGQD 2KSEA 2OYHC 1ZLLA 2KNCA 1A02J 1KB9E 3D70A 1KB9I 2QSIA 1URQA 4N78E 1PL5A 2M3BA 1JMBA 1KZUB 1MV8A 2N1TD 2RKLA 2QJYC 1CSBA 1ZXGA 3B71A 4ZMDA 2I1JA 3B4SA 1L0LG 1S9KE 2C9LY 3OAKA 2ZYGA 1J2JB 1X8YA 3HUSB 2IBZD 3F5HA 1WRGA 2Q9IA 1MKMA 1HJ0A 4UB6H 2HR3A 4L74A 1P84D 2E75B 5KTBA 3FXEA 2JWAA 4PJ0E 2V7QH 1WT6A 2KS1A 2W90A 2KOGA 1OIPA 3L71J 5KJ7A 3HE5A 3H1HJ 3CCQP 1S5LE 1YJ9P 3G3ZA 2RMZA 1RE3A 5TJHA 1IFJA 3C8VA 3CD6P 1PFIA 1GZLA 3H1JJ 4I6MC 1RE4C 2Y0EA 3CPWO 3C1LA 2YNYA 1SQQJ 2BCCJ 5H2FE 1KD1Q 1H88A 4UB8E 1VF5B 1K73Q 3TGUE 1M1JC 2BEZF 1BCCD 5AVRB 1KYOH 1SQXE 1SQBD 3HD7C 1YQ3C 4H13C 2E74C 3RK2B 1FBMA 2PRRA 5CCGD 4OVNF 1K05A 4BRYB 1HGVA 3MTUE 1NTMD 3U59A 1OW8A 5AVTB 4U3FD 3GW6A 2IZ1A 2D2CC 3GF3A 1P84E 1M90Q 1KQSO 1P84I 2E75D 1BSHA 1PPJG 1U57A 1H0TB 2YO2A 5CCHC 1FJKA 5BU8B 2FXPA 1JCCA 1KQLA 1L4AA 1R8EA 4R4MA 1L0NG 3IAOA 2WQYC 1GL2A 2E5TA 1JY3N 2KI7B 4HJGH 4IL6X 3CXHH 3MD0A 4WY4A 2C0XA 1U7MA 3CWBE 1IZNB 1BGYD 1L0NK 3RK3D 3P32A 2VRSA 3JC22 1ZMEC 1QLED 2O01J 1N86A 5DJUB 1X0TA 2JKVA 2O1JA 3L75G 3RBXA 1N73A 1KFNA 1VF5D 5DJTB 2XU6A 5GTIH 2E5YA 3QWOC 2FFDB 1J1EB 3B5NC 3A2AA 3I5CA 3GMAA 1SQXK 3RK2D 2K9JA 1ZW0A 2WSFJ 2FYUD 1GD2E 1PGQA 1IK9A 3OJAB 3H32A 5KLVD 1E79H 5AW0B 4DJGA 5KAFH 1Y9BA 5APXA 2KLVA 3II6A 4JYCA 3CCJP 3FX0A 2P10A 1S72P 1JUNA 3L73E 5KLIC 2W8ZA 3TGUJ 5BVZA 1IFNA 1HF9A 2OYHB 1KILA 1SQVG 1PGOA 5B5EH 4BWNA 4L76A 3KXDA 2KLUA 1VQ4P 1XTCC 1YTZI 3OA7A 3U1CA 1JMMA 2QJYB 4MN4C 4YXWH 1BE3G 4TT3H 2QA4P 1NU1G 2L91A 1USDA 2P7JA 3GLMA 1QL2A 3M9QA 2WT7B 1EZVE 4WWIA 2E43A 1R5SA 1S4XA 1SFCD 1JY2P 1NTZD 1M7LA 1BCCG 3TNUA 3TF5A 1VL2A 1CI6A 3L72G 3RGUA 1T2KD 3R2PA 2FYUE 3Q5RA 3CWBJ 5AVYB 1JY2O 3L71D 1GDTA 4WB4A 2M5AA 3H1HD 1PIXA 4H0LD 2CK3H 1Q90D 1NKZB 3V2QA 1PGPA 2YMKA 2H89C 1FZFA 3H1JD 2LKMA 4HKZH 2WSSH 4PD4H 3VMXA 4W7YA 1FDOA 3RL0D 1SQQD 3L70D 2BCCD 4OWFA 1Q86Q 3H1IE 2AXTH 1VQ5P 3BATA 2B87A 2FY8A 3N7NA 4GT1A 1EC5A 1SQBJ 5AVXB 1JCDA 2AEFA 2OYIA 2Q5UA 3VTPC 4HYTB 1M1JB 3CI9A 5AVQB 2P67A 3EFGA 1JB0J 2WSCJ 3BCCE 3HD7B 3V2PA 1G2CA 5EFWB 1S1CX 2E74B 1FAVA 1HUCA 2LXBA 2R3CA 4GKGA 3G71P 3KPEA 3GHGA 3PJSK 1YIJP 2Z4EA 3AEBC 3FWNA 3KDPB 3L73J 2XNDH 1FZCC 1KB9D 2C9NY 2JO1A 1BSNA 4UB6E 3H6PA 4N78D 1X79B 1KN7A 1LT9A 1SQPG 2JWDA 2SPZA 3PHLA 1SQPK 3JCUH 1LTJC 1L0LE 3P8CE 2W6JH 4A7PA 1QX8A 2IFMA 3Q1MA 3BRTB 5AW2B 1KQGB 1URQC 4GOEA 1FDMA 1NVOA 1AV1A 2BASA 3W68A 2W6BA 1H0TA 1Q81Q 2A45H 1RF0C 1NWQA 1AQTA 3LW5H 1T3UA 1FZCA 2GM4A 2FYUJ 2PFXA 3B5NB 3AEAC 3GG2A 3HD7D 5AW7B 4EDFA 4H13D 2E74D 1GW3A 1KYOE 3CLQA 2WWWA 1EXJA 3L74G 3H1KG 1LWUA 3PP5A 1YTZT 2D2CD 2ZYAA 3BASA 1T8ZA 5AVUB 1EDIA 5CCHD 4IL6H 5C39A 3H1IJ 3KZIH 5KJ7C 3KHUA 1SP4A 5K5GB 1UIXA 1RE3C 4ASVA 3TGUD 2Q3EA 4U7JA 1IO4A 1BDCA 3L71G 2KZIA 1RF0A 1SQXD 3K5BA 4Y99C 1IFPA 3PLNA 3CXHE 4AQRD 3CXHI 1Q2NA 1N7SA 1JEKA 2HYNA 3BCCJ 1NAYA 1L0LK 1NGMB 3T97A 4BXLA 1M56D 3Q5PA 4RJTA 3AE1C 3IF4A 4HH2A 4D6TD 2NPSA 4Z1MH 2ITAA 1ZN5A 3HE4B 4JF7A 1NTZJ 1VQKP 3RBZA 1PPJE 3H1LG 3WUVA 3B5ND 2KP8A 1LP1B 1L0NE 2V7QJ 3CWBD 1ZRTE 3RK3B 3TDKA 2IPPA 3AE6C 2IDBA 3AE2C 4ZNCA 1JOCA 1RHZB 1L0LJ 1AFOA 2KIKA 3PH0A 3NTNA 3L70J 1DD4A 1L4AC 4GODA 1GU4A 1GL2C 1OZHA 2H88C 4WY4C 5KAFE 3L75E 3NFQA 1M1KQ 4O9BA 3E1RA 1JY3O 2Y9ZA 1SLQA 3SWFA 4GDOA 1JM0A 3SFDC 1NTKG 2YXRB 1M8OB 5KKZB 3G6EP 1H89A 3CX5H 2R5DA 2R32A 1LTIC 2P58A 1JTHA 1NTKK 2FBWC 4D6TE 3SWKA 5B5EE 1QGKB 3VMAA 1N73C 1LTTC 1PP9G 2HPCB 2RH0A 3V2RA 1RF1B 1LTBC 2QE7H 2P1JA 1OWAA 3M9HA 5APTA 4IOIH 1KILE 1IC2A 3SWYA 3L73D 2HODB 2QM7A 1FC2C 2FXOA 2P2UA 2KZJA 1IJDB 3HTKB 3JSVC 3O6QB 2POHA 1SQVE 3I56P 5TISH 2AEJA 2AXCA 4W7ZA 4KHXA 1DEEG 2WTYA 2XV5A 3TSIA 2QIWA 3A0HE 3M0DA 5B66H 1BE3E 3V4WA 3N4XA 2FYNC 1NU1E 1EZVD 3D6YA 1LTSC 2E76C 2YIUC 2KNCB 5CBOA 1KILC 3Q5SA 2AEMA 1SFCB 3AE7C 4PD4E 4PD4I 1W2EA 1URQB 2Y9YA 5AVSB 1KV4A 2B89A 3F89A 2AXTE 4EIJA 1L0NJ 3A0BH 3L72E 1IFDA 2XZRA 3AE3C 3VOPA 2K3RA 1SVFA 4H0LB 2N1TA 3CC2P 3IFMA 2NRGA 2IBZG 1KC8Q 4TLFA 1DD3A 2J5UA 2IFNA 3RL0B 1K8AQ 3L4FA 3AEFC 3L75J 3V5BA 3H1ID 1SQXJ 1Y8AA 2KS1B 1DEBA 2M0BA 2Q7CA 1FS0E 3HE5B 3FXDA 3QH9A 1SQVK 3NXSA 3CCVP 1HTLC 4XE5B 3MZWB 4D6TJ 4IFFA 3BCCD 5KAIH 4Y99B 1E5WA 1MFTA 1OVVA 1EZVI 1P84H 1NU1K 3ZDMA 3JCUE 4PV1C 1URQD 2H43A 5APVA 2OYIC 2Q6QA 1AJYA 1FJPA 3H25A 1SQBG 3P8MC 1NYHA 2KK7A 2R44A 2Q3IA 3S9OA 2ZVOB 1OMIA 2A45I 1R5LA 4DZOA 2HFED 1N8RQ 1SQVJ 1NTMG 4U3FG 1SQPE 3GHGC 4OH8B 3U1AA 1FDIA 1L0LD 2OTJP 1QL1A 3P8CD 4L73A 5CCGA 1GK4A 1BE3J 3CC4P 1NU1J 1N7LA 2A06E 3HUSA 3AE4C 1ZR4A 1L4AB 5CBNA 3FWLA 1LT9C 1BGYG 3IN6A 1GL2B 5KJ7D 5E79H 2O01N 1T6AA 4WY4B 2N9YB 1YJWP 2BEQD 1Q82Q 4IL6E 5APSA 3KZIE 3ITKA 1J1DC 1S5LX 3L72J 3Q2YA 2O1KA 2B9BA 4H13B 2Y0DA 1KTMA 1JY2N 1KYOD 3RL0g 1EDKA 3O8ZA 3M06A 2WPRA 3VYIA 1N73B 3L74E 3H1KE 2W6AA 2QJKC 2D2CB 4W80A 2NZ2A 1G1JA 3CCMP 2OTLP 4I7ZC 2Q1KA 4DOJA 2FKWB 2JP3A 2XNXA 1QVGO 2FYUG 4ASWA 1YI2P 1QVFO 2M8RA 2XDJA 3CMEP 5KLVG 1LWUC 3CXHD 1JNMA 2CPSA 3H32B 2ZJSE 3MUDA 2WPSA 3AE5C 4BRYA 5KLVK 5BU5A 2G8YA 3TK1A 2KUBA 1L4AD 4JPZB 4JYBA 1YBKA 2FFDC 1GL2D 2FYNB 4WY4D 1RF1A 2C0WA 4AYCA 1PPJD 2E76B 3L36A 5AW4B 3H1LE 1N7SC 4RKUJ 1AVYA 1L0ND 2K37A 2IYPA 1AVOA 1KYOI 1YYCA 1ZRTD 3EQ2A 3USSA 4XFJA 1OVRA 2XKMA 3LW5J 2NPSC 2HLOA 4C7NB 1SQPJ 3E7KA 4DCKA 2QM8A 3V6IA 1USEA 3LIDA 1LTAC 2R5BA 1LNQA 3CX5E 3CX5I 4N6JA 4NPEA 3G4SP 2WSEJ 2ZT9C 4H44C 1NTZG 1U7JA 1ZV8A 5GTHH 3M9BA 3TYYA 3TNUB 1ZR2A 3L75D 3G9RA 2FFDA 2OGUA 2V4HA 1RY3A 5KLIB 3PTZA 1Z56A 3CL3D 3H1HG 1SFCA 5CJ4A 2J59M 2CPBA 5AVZB 3EFFK 1MUUA 2M5AB 2E42A 3CC7P 5CJ0A 1NTKE 2UWJE 3H1JG 1L2PA 1MFZA 1GTWA 1FOSF 1SQQG 2PAJA 5TISE 2QVAA 3L70G 3MIWA 3PRJA 2BCCG 3VMZA 2R3SA 3A3YB 1PP9E 3L74J 1JO5A 3H1KJ 1A02F 1TU3F 1SQQK 2E76D 2B87B 5B66E 4C7RA 5GTIE 1KILD 2W27A 2KYVA 4PV1B 2OYIB 4IFMA 2OYHA 2DW3A 2GUVA 3HRNA 5CMZA 4LGDE 1PGJA 1G2CB 1SQVD 3VP9A 3A0BE 5L8RJ 1EXIA 2WITA 5APYA 1JY3P 3GHGB 1S2EA 3LIEA 3KQGA 1BE3D 5AW8B 1NU1D 2WT7A 4YPCA 2I8DA 1FE6A 3W67A 3AE8C 1SS1A 3C9IA 1PV3A 4PD4D 1HVVA 2LXCB 2HG5D 1YJNP 3MGNA 1LT9B 3H1LJ 3WU2H 4R4LA 2JR8A 1GU5A 3L72D 2OYOA 2MKVA 3VMYA 3M0DC 1J1DB 1LJ2A 2JEEA 3A5TA 2OTKE 1NO4A 4I2LC 3CCLP 1GW4A 2IBZE 2IBZI 4XA4A 2W83C 3P7KA 2KXPB 1KB9H 5KAIE 2WVRA 1KFMA 2PP6A 4PV1D 4OGQC 4N3YB 1RE4A 2QJKB 2JDIH 3S1KA 5APWA 1FZCB 2WPVB 4I7ZB 2N1TC 4GOFA 1EDJA 2OQQA 4RO0A 1HWTC 4WVZA 1M1JA 1NTKJ 1RH5B 4KJMA 2GUSA 2O01H 1DH3A 1HBWA 2OARA 3HD7A 5CHXA 1LWUB 1LTJB 2IYOA 2QEXP 3BVHA 1IFMA 1PP9J 4PJ0H 2WPQA 4JBZA 3TGUG 3AEDC 4EYYQ 2K9YA 1OVUA 1BCCE 1SQXG 1FZEA 1S5LH 5CCHA 2KSJA 2WSFH 3AECC 1SQBE 1FU1A 1ZOYC 1NAFA 5E79E 1N7SB 1RQVA 4D6TG 2Z5HA 1SQPD 3T97B 3S4RA 1RQUA 3WUTA 1NTME 3AEEC 4U3FE 2QRXA 3CCEP 2NPSB 1VQ7P 5H2FH 5AW6B 3Q3DA 5APUA 4UB8H 2QJPC 1KMIZ 1VQMP 1M57D 2A06D 1XTGB 3L37A 2Z5IA 2LR2A 3CCRP 4GIFA
chains in the Genus database with same CATH topology
2O01N 2AXCA 3O6QB 1OZHA 2RH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O01 N;  2AXC A;  3O6Q B;  1OZH A;  2RH0 A; 
#chains in the Genus database with same CATH topology
 2ZT9 B;  4H44 B;  3I55 P;  1LTG C;  3CWB G;  1OW6 A;  4LLH A;  1KOR A;  1BGY E;  3M0A A;  4K3A A;  3WMM 0;  1D7M A;  3RK3 E;  1EDL A;  4ZKU A;  3B5N A;  1IFI A;  4B86 A;  3MHV A;  4RES B;  1ZP0 C;  5CCG C;  3A7O A;  2WZ7 A;  5AW3 B;  2J58 A;  2G3A A;  3HUS C;  3NMD A;  1VQP P;  4YXD C;  4C7N A;  1HH0 A;  1Q7Y Q;  1Y47 A;  3D71 A;  4NPD A;  2E75 C;  3ABV C;  1LGH B;  3L74 D;  1IK7 A;  3H1K D;  2RN0 A;  2ZFC A;  1YHQ P;  2MJZ A;  1NOH A;  1PZQ A;  3BRV B;  1DX7 A;  3WUU A;  3OW2 O;  1NHL A;  1SQB K;  4IFD K;  4JQ0 D;  2YXQ B;  1OFC X;  2JJL A;  1VQN P;  1N7S D;  4EOT A;  2H8P D;  3RK3 C;  4C46 A;  2B88 A;  3CCS P;  1HJB A;  1JTH B;  4WBA A;  3FGA D;  4CPG A;  4I1L A;  5APQ A;  2NPS D;  1NTM K;  4NPF X;  3A0H H;  3V2N A;  5KLV E;  1CW5 A;  3MP7 B;  1N2D C;  3L35 A;  1NH4 A;  2ZYD A;  1MZ9 A;  3AEG C;  1NKN A;  1FOS E;  1VF5 C;  2ZT9 D;  3L73 G;  4H44 D;  3HE4 A;  1OX3 A;  1K9M Q;  5AW1 B;  4HB1 A;  1BCC J;  1G1I A;  4YTP C;  2K88 A;  4EI2 A;  3V4Q A;  2ZXX A;  5GTH E;  1VQ6 P;  5KKZ C;  2WSC H;  3RK2 C;  1LP1 A;  2L5G B;  3H1L D;  1W2B O;  1VQ8 P;  3MUD C;  1GMJ A;  4L75 A;  3KYQ A;  1LT1 A;  1AQ5 A;  5AVV B;  1BDD A;  3CCU P;  1NTM J;  1FZA A;  1EZV G;  4DT0 A;  1T3J A;  4U3F J;  3M91 A;  2ZVN B;  1FZG A;  3CX5 D;  1RF1 C;  1K04 A;  3SFE C;  3GF7 A;  2FYZ A;  1KQF B;  3D6Z A;  1S3J A;  1NTZ E;  1DIP A;  2WMM A;  1X9V A;  1VPC A;  2YKO A;  2K9J B;  1GK6 A;  2FXM A;  2IZ0 A;  1YQ4 C;  4OGQ B;  2O3J A;  1BGY J;  1VQ9 P;  3AE9 C;  3L71 E;  4ZKP A;  2A45 G;  2FYU K;  3H1H E;  2I1K A;  2M3E A;  5AW9 B;  2N1T B;  1QEX A;  1NTK D;  2K1A A;  3IR9 A;  1HGZ A;  3VN0 A;  5AVW B;  3H1J E;  1X22 A;  2HPC A;  1CZQ A;  2A06 G;  1OXZ A;  2YO3 A;  1S9K D;  1YIT P;  3H1I G;  1SQQ E;  1PP9 D;  1VDF A;  2QG4 A;  3L70 E;  1EQ7 A;  2BCC E;  4M3L A;  1J1E C;  3UIA A;  1SFC C;  3B8E B;  2ZAE B;  2YIU B;  4KT0 J;  3R4Y A;  1KIL B;  3SSU A;  2YKP A;  4Y28 J;  2HOD A;  1FZB A;  1T2K C;  1OW7 A;  1WMK A;  2H7H A;  3EWK A;  4AUW A;  1VQO P;  2YMY A;  2ZXE B;  3HTK A;  3BCC G;  4QMA A;  1UII A;  4H0L C;  4K35 A;  3O6Q A;  5M1B A;  2KB7 P;  3VP8 A;  3E1I A;  1NJI Q;  2YKQ A;  5AW5 B;  2PGD A;  3WU2 E;  1VQL P;  5KLV J;  2IX7 C;  2N9B A;  2WSE H;  1AA0 A;  2Y0C A;  3CMA P;  3RL0 C;  1H8A A;  1LTJ A;  2GA1 A;  1W5C E;  4LC1 A;  1NTZ K;  1CI6 B;  2QJP B;  4OGQ D;  2KSE A;  2OYH C;  1ZLL A;  2KNC A;  1A02 J;  1KB9 E;  3D70 A;  1KB9 I;  2QSI A;  1URQ A;  4N78 E;  1PL5 A;  2M3B A;  1JMB A;  1KZU B;  1MV8 A;  2N1T D;  2RKL A;  2QJY C;  1CSB A;  1ZXG A;  3B71 A;  4ZMD A;  2I1J A;  3B4S A;  1L0L G;  1S9K E;  2C9L Y;  3OAK A;  2ZYG A;  1J2J B;  1X8Y A;  3HUS B;  2IBZ D;  3F5H A;  1WRG A;  2Q9I A;  1MKM A;  1HJ0 A;  4UB6 H;  2HR3 A;  4L74 A;  1P84 D;  2E75 B;  5KTB A;  3FXE A;  2JWA A;  4PJ0 E;  2V7Q H;  1WT6 A;  2KS1 A;  2W90 A;  2KOG A;  1OIP A;  3L71 J;  5KJ7 A;  3HE5 A;  3H1H J;  3CCQ P;  1S5L E;  1YJ9 P;  3G3Z A;  2RMZ A;  1RE3 A;  5TJH A;  1IFJ A;  3C8V A;  3CD6 P;  1PFI A;  1GZL A;  3H1J J;  4I6M C;  1RE4 C;  2Y0E A;  3CPW O;  3C1L A;  2YNY A;  1SQQ J;  2BCC J;  5H2F E;  1KD1 Q;  1H88 A;  4UB8 E;  1VF5 B;  1K73 Q;  3TGU E;  1M1J C;  2BEZ F;  1BCC D;  5AVR B;  1KYO H;  1SQX E;  1SQB D;  3HD7 C;  1YQ3 C;  4H13 C;  2E74 C;  3RK2 B;  1FBM A;  2PRR A;  5CCG D;  4OVN F;  1K05 A;  4BRY B;  1HGV A;  3MTU E;  1NTM D;  3U59 A;  1OW8 A;  5AVT B;  4U3F D;  3GW6 A;  2IZ1 A;  2D2C C;  3GF3 A;  1P84 E;  1M90 Q;  1KQS O;  1P84 I;  2E75 D;  1BSH A;  1PPJ G;  1U57 A;  1H0T B;  2YO2 A;  5CCH C;  1FJK A;  5BU8 B;  2FXP A;  1JCC A;  1KQL A;  1L4A A;  1R8E A;  4R4M A;  1L0N G;  3IAO A;  2WQY C;  1GL2 A;  2E5T A;  1JY3 N;  2KI7 B;  4HJG H;  4IL6 X;  3CXH H;  3MD0 A;  4WY4 A;  2C0X A;  1U7M A;  3CWB E;  1IZN B;  1BGY D;  1L0N K;  3RK3 D;  3P32 A;  2VRS A;  3JC2 2;  1ZME C;  1QLE D;  2O01 J;  1N86 A;  5DJU B;  1X0T A;  2JKV A;  2O1J A;  3L75 G;  3RBX A;  1N73 A;  1KFN A;  1VF5 D;  5DJT B;  2XU6 A;  5GTI H;  2E5Y A;  3QWO C;  2FFD B;  1J1E B;  3B5N C;  3A2A A;  3I5C A;  3GMA A;  1SQX K;  3RK2 D;  2K9J A;  1ZW0 A;  2WSF J;  2FYU D;  1GD2 E;  1PGQ A;  1IK9 A;  3OJA B;  3H32 A;  5KLV D;  1E79 H;  5AW0 B;  4DJG A;  5KAF H;  1Y9B A;  5APX A;  2KLV A;  3II6 A;  4JYC A;  3CCJ P;  3FX0 A;  2P10 A;  1S72 P;  1JUN A;  3L73 E;  5KLI C;  2W8Z A;  3TGU J;  5BVZ A;  1IFN A;  1HF9 A;  2OYH B;  1KIL A;  1SQV G;  1PGO A;  5B5E H;  4BWN A;  4L76 A;  3KXD A;  2KLU A;  1VQ4 P;  1XTC C;  1YTZ I;  3OA7 A;  3U1C A;  1JMM A;  2QJY B;  4MN4 C;  4YXW H;  1BE3 G;  4TT3 H;  2QA4 P;  1NU1 G;  2L91 A;  1USD A;  2P7J A;  3GLM A;  1QL2 A;  3M9Q A;  2WT7 B;  1EZV E;  4WWI A;  2E43 A;  1R5S A;  1S4X A;  1SFC D;  1JY2 P;  1NTZ D;  1M7L A;  1BCC G;  3TNU A;  3TF5 A;  1VL2 A;  1CI6 A;  3L72 G;  3RGU A;  1T2K D;  3R2P A;  2FYU E;  3Q5R A;  3CWB J;  5AVY B;  1JY2 O;  3L71 D;  1GDT A;  4WB4 A;  2M5A A;  3H1H D;  1PIX A;  4H0L D;  2CK3 H;  1Q90 D;  1NKZ B;  3V2Q A;  1PGP A;  2YMK A;  2H89 C;  1FZF A;  3H1J D;  2LKM A;  4HKZ H;  2WSS H;  4PD4 H;  3VMX A;  4W7Y A;  1FDO A;  3RL0 D;  1SQQ D;  3L70 D;  2BCC D;  4OWF A;  1Q86 Q;  3H1I E;  2AXT H;  1VQ5 P;  3BAT A;  2B87 A;  2FY8 A;  3N7N A;  4GT1 A;  1EC5 A;  1SQB J;  5AVX B;  1JCD A;  2AEF A;  2OYI A;  2Q5U A;  3VTP C;  4HYT B;  1M1J B;  3CI9 A;  5AVQ B;  2P67 A;  3EFG A;  1JB0 J;  2WSC J;  3BCC E;  3HD7 B;  3V2P A;  1G2C A;  5EFW B;  1S1C X;  2E74 B;  1FAV A;  1HUC A;  2LXB A;  2R3C A;  4GKG A;  3G71 P;  3KPE A;  3GHG A;  3PJS K;  1YIJ P;  2Z4E A;  3AEB C;  3FWN A;  3KDP B;  3L73 J;  2XND H;  1FZC C;  1KB9 D;  2C9N Y;  2JO1 A;  1BSN A;  4UB6 E;  3H6P A;  4N78 D;  1X79 B;  1KN7 A;  1LT9 A;  1SQP G;  2JWD A;  2SPZ A;  3PHL A;  1SQP K;  3JCU H;  1LTJ C;  1L0L E;  3P8C E;  2W6J H;  4A7P A;  1QX8 A;  2IFM A;  3Q1M A;  3BRT B;  5AW2 B;  1KQG B;  1URQ C;  4GOE A;  1FDM A;  1NVO A;  1AV1 A;  2BAS A;  3W68 A;  2W6B A;  1H0T A;  1Q81 Q;  2A45 H;  1RF0 C;  1NWQ A;  1AQT A;  3LW5 H;  1T3U A;  1FZC A;  2GM4 A;  2FYU J;  2PFX A;  3B5N B;  3AEA C;  3GG2 A;  3HD7 D;  5AW7 B;  4EDF A;  4H13 D;  2E74 D;  1GW3 A;  1KYO E;  3CLQ A;  2WWW A;  1EXJ A;  3L74 G;  3H1K G;  1LWU A;  3PP5 A;  1YTZ T;  2D2C D;  2ZYA A;  3BAS A;  1T8Z A;  5AVU B;  1EDI A;  5CCH D;  4IL6 H;  5C39 A;  3H1I J;  3KZI H;  5KJ7 C;  3KHU A;  1SP4 A;  5K5G B;  1UIX A;  1RE3 C;  4ASV A;  3TGU D;  2Q3E A;  4U7J A;  1IO4 A;  1BDC A;  3L71 G;  2KZI A;  1RF0 A;  1SQX D;  3K5B A;  4Y99 C;  1IFP A;  3PLN A;  3CXH E;  4AQR D;  3CXH I;  1Q2N A;  1N7S A;  1JEK A;  2HYN A;  3BCC J;  1NAY A;  1L0L K;  1NGM B;  3T97 A;  4BXL A;  1M56 D;  3Q5P A;  4RJT A;  3AE1 C;  3IF4 A;  4HH2 A;  4D6T D;  2NPS A;  4Z1M H;  2ITA A;  1ZN5 A;  3HE4 B;  4JF7 A;  1NTZ J;  1VQK P;  3RBZ A;  1PPJ E;  3H1L G;  3WUV A;  3B5N D;  2KP8 A;  1LP1 B;  1L0N E;  2V7Q J;  3CWB D;  1ZRT E;  3RK3 B;  3TDK A;  2IPP A;  3AE6 C;  2IDB A;  3AE2 C;  4ZNC A;  1JOC A;  1RHZ B;  1L0L J;  1AFO A;  2KIK A;  3PH0 A;  3NTN A;  3L70 J;  1DD4 A;  1L4A C;  4GOD A;  1GU4 A;  1GL2 C;  1OZH A;  2H88 C;  4WY4 C;  5KAF E;  3L75 E;  3NFQ A;  1M1K Q;  4O9B A;  3E1R A;  1JY3 O;  2Y9Z A;  1SLQ A;  3SWF A;  4GDO A;  1JM0 A;  3SFD C;  1NTK G;  2YXR B;  1M8O B;  5KKZ B;  3G6E P;  1H89 A;  3CX5 H;  2R5D A;  2R32 A;  1LTI C;  2P58 A;  1JTH A;  1NTK K;  2FBW C;  4D6T E;  3SWK A;  5B5E E;  1QGK B;  3VMA A;  1N73 C;  1LTT C;  1PP9 G;  2HPC B;  2RH0 A;  3V2R A;  1RF1 B;  1LTB C;  2QE7 H;  2P1J A;  1OWA A;  3M9H A;  5APT A;  4IOI H;  1KIL E;  1IC2 A;  3SWY A;  3L73 D;  2HOD B;  2QM7 A;  1FC2 C;  2FXO A;  2P2U A;  2KZJ A;  1IJD B;  3HTK B;  3JSV C;  3O6Q B;  2POH A;  1SQV E;  3I56 P;  5TIS H;  2AEJ A;  2AXC A;  4W7Z A;  4KHX A;  1DEE G;  2WTY A;  2XV5 A;  3TSI A;  2QIW A;  3A0H E;  3M0D A;  5B66 H;  1BE3 E;  3V4W A;  3N4X A;  2FYN C;  1NU1 E;  1EZV D;  3D6Y A;  1LTS C;  2E76 C;  2YIU C;  2KNC B;  5CBO A;  1KIL C;  3Q5S A;  2AEM A;  1SFC B;  3AE7 C;  4PD4 E;  4PD4 I;  1W2E A;  1URQ B;  2Y9Y A;  5AVS B;  1KV4 A;  2B89 A;  3F89 A;  2AXT E;  4EIJ A;  1L0N J;  3A0B H;  3L72 E;  1IFD A;  2XZR A;  3AE3 C;  3VOP A;  2K3R A;  1SVF A;  4H0L B;  2N1T A;  3CC2 P;  3IFM A;  2NRG A;  2IBZ G;  1KC8 Q;  4TLF A;  1DD3 A;  2J5U A;  2IFN A;  3RL0 B;  1K8A Q;  3L4F A;  3AEF C;  3L75 J;  3V5B A;  3H1I D;  1SQX J;  1Y8A A;  2KS1 B;  1DEB A;  2M0B A;  2Q7C A;  1FS0 E;  3HE5 B;  3FXD A;  3QH9 A;  1SQV K;  3NXS A;  3CCV P;  1HTL C;  4XE5 B;  3MZW B;  4D6T J;  4IFF A;  3BCC D;  5KAI H;  4Y99 B;  1E5W A;  1MFT A;  1OVV A;  1EZV I;  1P84 H;  1NU1 K;  3ZDM A;  3JCU E;  4PV1 C;  1URQ D;  2H43 A;  5APV A;  2OYI C;  2Q6Q A;  1AJY A;  1FJP A;  3H25 A;  1SQB G;  3P8M C;  1NYH A;  2KK7 A;  2R44 A;  2Q3I A;  3S9O A;  2ZVO B;  1OMI A;  2A45 I;  1R5L A;  4DZO A;  2HFE D;  1N8R Q;  1SQV J;  1NTM G;  4U3F G;  1SQP E;  3GHG C;  4OH8 B;  3U1A A;  1FDI A;  1L0L D;  2OTJ P;  1QL1 A;  3P8C D;  4L73 A;  5CCG A;  1GK4 A;  1BE3 J;  3CC4 P;  1NU1 J;  1N7L A;  2A06 E;  3HUS A;  3AE4 C;  1ZR4 A;  1L4A B;  5CBN A;  3FWL A;  1LT9 C;  1BGY G;  3IN6 A;  1GL2 B;  5KJ7 D;  5E79 H;  2O01 N;  1T6A A;  4WY4 B;  2N9Y B;  1YJW P;  2BEQ D;  1Q82 Q;  4IL6 E;  5APS A;  3KZI E;  3ITK A;  1J1D C;  1S5L X;  3L72 J;  3Q2Y A;  2O1K A;  2B9B A;  4H13 B;  2Y0D A;  1KTM A;  1JY2 N;  1KYO D;  3RL0 g;  1EDK A;  3O8Z A;  3M06 A;  2WPR A;  3VYI A;  1N73 B;  3L74 E;  3H1K E;  2W6A A;  2QJK C;  2D2C B;  4W80 A;  2NZ2 A;  1G1J A;  3CCM P;  2OTL P;  4I7Z C;  2Q1K A;  4DOJ A;  2FKW B;  2JP3 A;  2XNX A;  1QVG O;  2FYU G;  4ASW A;  1YI2 P;  1QVF O;  2M8R A;  2XDJ A;  3CME P;  5KLV G;  1LWU C;  3CXH D;  1JNM A;  2CPS A;  3H32 B;  2ZJS E;  3MUD A;  2WPS A;  3AE5 C;  4BRY A;  5KLV K;  5BU5 A;  2G8Y A;  3TK1 A;  2KUB A;  1L4A D;  4JPZ B;  4JYB A;  1YBK A;  2FFD C;  1GL2 D;  2FYN B;  4WY4 D;  1RF1 A;  2C0W A;  4AYC A;  1PPJ D;  2E76 B;  3L36 A;  5AW4 B;  3H1L E;  1N7S C;  4RKU J;  1AVY A;  1L0N D;  2K37 A;  2IYP A;  1AVO A;  1KYO I;  1YYC A;  1ZRT D;  3EQ2 A;  3USS A;  4XFJ A;  1OVR A;  2XKM A;  3LW5 J;  2NPS C;  2HLO A;  4C7N B;  1SQP J;  3E7K A;  4DCK A;  2QM8 A;  3V6I A;  1USE A;  3LID A;  1LTA C;  2R5B A;  1LNQ A;  3CX5 E;  3CX5 I;  4N6J A;  4NPE A;  3G4S P;  2WSE J;  2ZT9 C;  4H44 C;  1NTZ G;  1U7J A;  1ZV8 A;  5GTH H;  3M9B A;  3TYY A;  3TNU B;  1ZR2 A;  3L75 D;  3G9R A;  2FFD A;  2OGU A;  2V4H A;  1RY3 A;  5KLI B;  3PTZ A;  1Z56 A;  3CL3 D;  3H1H G;  1SFC A;  5CJ4 A;  2J59 M;  2CPB A;  5AVZ B;  3EFF K;  1MUU A;  2M5A B;  2E42 A;  3CC7 P;  5CJ0 A;  1NTK E;  2UWJ E;  3H1J G;  1L2P A;  1MFZ A;  1GTW A;  1FOS F;  1SQQ G;  2PAJ A;  5TIS E;  2QVA A;  3L70 G;  3MIW A;  3PRJ A;  2BCC G;  3VMZ A;  2R3S A;  3A3Y B;  1PP9 E;  3L74 J;  1JO5 A;  3H1K J;  1A02 F;  1TU3 F;  1SQQ K;  2E76 D;  2B87 B;  5B66 E;  4C7R A;  5GTI E;  1KIL D;  2W27 A;  2KYV A;  4PV1 B;  2OYI B;  4IFM A;  2OYH A;  2DW3 A;  2GUV A;  3HRN A;  5CMZ A;  4LGD E;  1PGJ A;  1G2C B;  1SQV D;  3VP9 A;  3A0B E;  5L8R J;  1EXI A;  2WIT A;  5APY A;  1JY3 P;  3GHG B;  1S2E A;  3LIE A;  3KQG A;  1BE3 D;  5AW8 B;  1NU1 D;  2WT7 A;  4YPC A;  2I8D A;  1FE6 A;  3W67 A;  3AE8 C;  1SS1 A;  3C9I A;  1PV3 A;  4PD4 D;  1HVV A;  2LXC B;  2HG5 D;  1YJN P;  3MGN A;  1LT9 B;  3H1L J;  3WU2 H;  4R4L A;  2JR8 A;  1GU5 A;  3L72 D;  2OYO A;  2MKV A;  3VMY A;  3M0D C;  1J1D B;  1LJ2 A;  2JEE A;  3A5T A;  2OTK E;  1NO4 A;  4I2L C;  3CCL P;  1GW4 A;  2IBZ E;  2IBZ I;  4XA4 A;  2W83 C;  3P7K A;  2KXP B;  1KB9 H;  5KAI E;  2WVR A;  1KFM A;  2PP6 A;  4PV1 D;  4OGQ C;  4N3Y B;  1RE4 A;  2QJK B;  2JDI H;  3S1K A;  5APW A;  1FZC B;  2WPV B;  4I7Z B;  2N1T C;  4GOF A;  1EDJ A;  2OQQ A;  4RO0 A;  1HWT C;  4WVZ A;  1M1J A;  1NTK J;  1RH5 B;  4KJM A;  2GUS A;  2O01 H;  1DH3 A;  1HBW A;  2OAR A;  3HD7 A;  5CHX A;  1LWU B;  1LTJ B;  2IYO A;  2QEX P;  3BVH A;  1IFM A;  1PP9 J;  4PJ0 H;  2WPQ A;  4JBZ A;  3TGU G;  3AED C;  4EYY Q;  2K9Y A;  1OVU A;  1BCC E;  1SQX G;  1FZE A;  1S5L H;  5CCH A;  2KSJ A;  2WSF H;  3AEC C;  1SQB E;  1FU1 A;  1ZOY C;  1NAF A;  5E79 E;  1N7S B;  1RQV A;  4D6T G;  2Z5H A;  1SQP D;  3T97 B;  3S4R A;  1RQU A;  3WUT A;  1NTM E;  3AEE C;  4U3F E;  2QRX A;  3CCE P;  2NPS B;  1VQ7 P;  5H2F H;  5AW6 B;  3Q3D A;  5APU A;  4UB8 H;  2QJP C;  1KMI Z;  1VQM P;  1M57 D;  2A06 D;  1XTG B;  3L37 A;  2Z5I A;  2LR2 A;  3CCR P;  4GIF A; 
#chains in the Genus database with same CATH homology
 2O01 N;  2AXC A;  3O6Q B;  1OZH A;  2RH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...