3O6QB

The structure of spoiisa and spoiisb, a toxin - antitoxin system
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
43
structure length
43
Chain Sequence
CEPRAAKPFKILKKRSTTSVASYQVSPHTARIFKENERLIDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Toxin/antitoxin
molecule keywords Stage II sporulation protein SA
total genus 7
structure length 43
sequence length 43
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14185 SpoIISB_antitox Antitoxin SpoIISB, type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3o6qB01
1OZHA 2O01N 2RH0A 3O6QB 2AXCA
chains in the Genus database with same CATH superfamily
2PRRA 2WPSA 2B89A 2M5AB 1NVOA 2CPSA 2IBZG 2KI7B 2Z5IA 1JY2N 2FKWB 1NHLA 1VQKP 2JP3A 3Q3DA 4HKZH 5AW5B 1URQD 1G1IA 1YYCA 1IFNA 2IFNA 2ZYAA 2QM8A 2VRSA 1JCDA 3NXSA 5CMZA 3H1LE 3L72G 3WU2E 5B5EH 1NGMB 3MD0A 1U7JA 1SQQE 3GHGC 2I1JA 4JF7A 4U3FD 3A0HH 3WUUA 3F89A 5M1BA 1X22A 2W27A 4GT1A 2MKVA 3H1JG 2P58A 4IFFA 1GZLA 1VQPP 3MTUE 1Y8AA 3L4FA 3V2QA 1R8EA 1JTHA 3CWBJ 1CI6B 1L0LJ 1GU4A 4PD4E 2YKQA 1SQQJ 3BASA 1BE3J 2HFED 1VQ8P 2Q3IA 3H1HD 1T6AA 1LTTC 1NTME 2HG5D 3H1IJ 4M3LA 1S5LE 3CCVP 2OYIC 2Q5UA 1RY3A 2K9JB 2QVAA 4H13C 3RK2B 1EDIA 2KUBA 4HYTB 2W6BA 1A02F 1J1DC 1PP9D 2W83C 3B71A 5AVVB 1RF1A 3NMDA 4IL6H 1VQ4P 1H0TB 1BGYD 1L0ND 2BASA 2P67A 4L76A 4WVZA 1ZW0A 2FFDB 1BE3G 1JY3O 3HRNA 4KJMA 2ITAA 1T8ZA 3AEBC 3H1LG 1AQ5A 3B4SA 2PAJA 3MIWA 3CX5H 1HJBA 1J1EC 1XTGB 1KYOE 2V7QH 5KAFH 2NPSD 5AVWB 3TGUE 4D6TJ 1SP4A 3BRVB 3RK3E 3T97B 1SQVG 3V4QA 3L70G 4EYYQ 5CCHA 3P32A 1YJNP 2LXBA 4XFJA 1EDKA 2A06E 4W7ZA 1HVVA 2NPSB 3H1KE 1SQPD 1LWUC 2XKMA 1PGJA 2JR8A 1D7MA 1WRGA 2WSFJ 4L73A 3KXDA 1URQB 3L74G 1KORA 1PIXA 1TU3F 4LC1A 3MGNA 3VMYA 3LW5J 1L4AC 1DEBA 1S1CX 3M9QA 2B88A 1SQXE 2AXCA 1OXZA 2ZAEB 4BRYA 1NTZJ 3HD7C 4GKGA 2IFMA 3RK2D 3SFDC 1VQNP 2HODA 3SSUA 4UB6H 2A45I 1JM0A 2K88A 1FS0E 4PD4I 1NOHA 3HD7A 2M5AA 1OFCX 4H13B 2OQQA 2YKOA 3B5ND 2WT7A 1YJWP 4BRYB 1U57A 3CL3D 1NKZB 2KXPB 1NTZE 3L71D 1KQGB 1BCCE 2E76D 2XV5A 3MP7B 3TYYA 1RF1C 3TK1A 2JEEA 1M56D 3JSVC 3TF5A 3PH0A 1DEEG 2M8RA 3FGAD 3VMAA 1BE3E 2HR3A 1CZQA 2QSIA 3JCUE 4K35A 2G8YA 1KQFB 2OYIB 1PGPA 3HTKA 3AE6C 2HYNA 3RK2C 1HH0A 3IF4A 3HTKB 1T3JA 5KAIE 2QM7A 3L74D 3L73D 1FZFA 1Q81Q 1EZVI 1SQVK 1YQ4C 1QL1A 3E1RA 4OGQB 3CX5I 2FBWC 2J5UA 3C1LA 1S9KD 1QEXA 1YTZT 5CJ0A 3GHGB 1YIJP 1URQC 2IBZI 1OW7A 3S9OA 2YKPA 3VTPC 4ZKUA 4UB8E 2QJYB 2V7QJ 2ZVNB 2IBZE 1W2EA 2FYZA 1R5SA 3HUSC 1L0LG 3L75D 4N6JA 1MFZA 1VQ5P 3AE3C 1JEKA 2QJPC 2WPVB 1SQBJ 3CMAP 1M1KQ 2KP8A 3GG2A 4N3YB 2A06D 4GODA 4H44C 4C46A 5BVZA 1T2KD 5KLVG 1LGHB 3EFGA 1QX8A 4I7ZC 5B66E 1KQSO 4N78E 2D2CD 2WZ7A 3H1KG 3L75G 3QWOC 3TDKA 3A0HE 2LKMA 2Y0CA 2NPSC 4RESB 1VQMP 1U7MA 2QEXP 3BVHA 3JCUH 1K8AQ 2KLUA 1J1EB 1MV8A 4Y28J 1NTMK 4GDOA 2HODB 1NTKE 4DOJA 3HUSB 5B5EE 4W7YA 2QA4P 1EZVG 1FZBA 1J2JB 1SQXD 2E75D 2L91A 2N1TB 4MN4C 5TJHA 3N7NA 3RL0C 5AW8B 1FJKA 1NTMG 2AEJA 1AFOA 5KLIB 1HGVA 2NRGA 1R5LA 1LTIC 3AE4C 2L5GB 3L73G 1SQBD 3V6IA 1MKMA 3WUTA 1DD3A 3H32A 5APSA 2XNXA 1SFCB 3JC22 2BCCD 1KZUB 2BCCJ 5TISH 2D2CC 2HPCA 5E79E 1DH3A 1EXJA 3CCUP 1ZR4A 3P8MC 1NTMD 3SWKA 1EDLA 3G3ZA 1Q2NA 1KB9D 2QRXA 1KMIZ 4IOIH 5AVQB 5AVTB 2XZRA 3EWKA 1JY3N 1L0NG 1Q90D 3CX5E 3V2NA 4JBZA 3M9HA 4IFDK 4ZMDA 5AVSB 3F5HA 2ZT9D 1RQUA 1DD4A 2BCCG 2H88C 2JJLA 2K9JA 1L0NE 3CXHD 2Q1KA 3H1IG 1LTJB 3H32B 3L36A 4WY4B 5KLVK 1KYOD 1ZOYC 3CCEP 1BDCA 5APUA 1ZRTE 1H88A 1SQQK 4TLFA 1H0TA 1IFIA 5CJ4A 3RL0D 3ZDMA 1L0LD 4GIFA 1KN7A 1P84D 2WT7B 2WITA 1G2CB 1RHZB 2R5BA 1RF0C 2W6AA 3KDPB 4XA4A 3USSA 1SQPE 5AW4B 1X9VA 1PGOA 3CXHH 1M90Q 2MJZA 2QIWA 5AW1B 2WSSH 1GW3A 1JMMA 2QG4A 3H1HJ 3H1KD 4OVNF 4AQRD 2KZJA 3O6QA 3GW6A 3P7KA 1RE4C 2W90A 4IL6E 1OVVA 1BCCJ 1RH5B 1SQVJ 2YMKA 3VOPA 3H25A 1LTBC 2FXOA 3H1JJ 4Y99B 4WY4C 1X79B 1CW5A 4LGDE 3QH9A 2Q3EA 1LT9C 1SQQD 1LP1A 2KS1B 2FYUK 3WUVA 1UIIA 3L73J 2H8PD 3P8CD 1IK7A 1PZQA 3D6ZA 2P10A 3L71E 2M3EA 3E7KA 3PP5A 1SQPJ 3AE5C 2HPCB 1VF5D 1M1JC 3U1AA 4PD4D 1GL2B 2Y0DA 5APYA 4A7PA 4Z1MH 3AE9C 1NU1G 2ZYDA 3PHLA 2AEFA 4KHXA 3H1HE 2WPQA 3D6YA 4PV1D 1SQBG 1A02J 1LWUA 4K3AA 1CI6A 3NFQA 1K05A 1J1DB 1NU1E 1W2BO 1BGYE 1VDFA 2N1TC 1NJIQ 3LIEA 2OYHA 5CCHC 3IR9A 1RF0A 1YI2P 1LTGC 5KLIC 1IC2A 1K9MQ 1HBWA 2FY8A 2W8ZA 3E1IA 2WTYA 1IK9A 3CC7P 1KILD 1KFNA 1PPJD 1S9KE 1VL2A 3IAOA 3HD7B 3LIDA 3MZWB 3A5TA 1JTHB 1NU1J 2JDIH 4JYBA 3G4SP 3OA7A 3Q5SA 1EC5A 2PFXA 5KAFE 4H0LD 2R32A 2FYUE 1N7SB 2A06G 2IDBA 2IX7C 1KB9I 2JO1A 2ZXEB 1L0LE 3BCCD 3PJSK 4IL6X 1SVFA 2NZ2A 2QJKB 2CK3H 1PV3A 3M0DC 1QLED 4U3FJ 4RJTA 1YHQP 2E43A 1LTSC 5AW7B 3TGUG 1QVFO 1NH4A 5GTIH 2JKVA 1YQ3C 2YMYA 1FZCC 1IFJA 3KZIE 5KAIH 1VQLP 3CCQP 2GM4A 1IFMA 2B87A 2QJYC 4DZOA 2YO3A 1M57D 1KYOI 3KHUA 1YITP 1SQVE 3CC2P 1S2EA 2C0XA 3FWNA 1JOCA 4QMAA 2OYHB 1FOSE 1OW8A 2LXCB 3GHGA 1NYHA 3U1CA 1GW4A 1ZV8A 3OAKA 1P84I 4U7JA 3S1KA 4EI2A 1NTKD 2GUVA 2QE7H 2BEZF 2HLOA 2E74D 1P84H 4H44D 3TNUB 2C9LY 1AJYA 1SS1A 1OZHA 2BCCE 5APQA 3CD6P 1NAFA 2R3SA 1L0LK 3HE4A 3KPEA 5KKZC 1LT1A 1EQ7A 1KYOH 3L74J 4H0LC 5GTHH 1BGYG 3RBXA 4ASVA 4UB6E 3CPWO 1HF9A 3L71G 1GK6A 4JPZB 1M1JB 2GA1A 2N9BA 3L72D 4GOEA 1BE3D 2WWWA 1LNQA 1HJ0A 2K3RA 1JY2O 3AEDC 1OIPA 2IZ0A 1FZCA 1DIPA 1L2PA 1L4AD 3CCLP 3H1HG 4LLHA 1PFIA 1FE6A 1WMKA 2SPZA 5AW0B 2B9BA 1MFTA 3MUDA 3RK3B 3CX5D 1LT9B 2P2UA 3PLNA 1NTZG 3A3YB 3R4YA 5KJ7A 2E75C 2WPRA 1L0NJ 1BGYJ 2WSEH 3HUSA 3L35A 2YXQB 4R4LA 1ZR2A 1NAYA 1VF5C 3GMAA 4WWIA 4O9BA 1G2CA 1URQA 2AXTE 1VQOP 1Q82Q 2R44A 3CXHE 3VN0A 2B87B 1OVUA 3HD7D 4OWFA 4YTPC 4C7NB 1N73A 3RGUA 1FZEA 1LTAC 1NTKG 1ZRTD 2CPBA 2P7JA 4JYCA 2KYVA 3TSIA 4ASWA 3IFMA 5C39A 1S72P 1GD2E 3BATA 3W68A 1DX7A 2FYNB 1YBKA 5AW9B 1P84E 3FXEA 4WY4A 5AW3B 2OYHC 3GLMA 3U59A 2ZXXA 2WSCJ 3WU2H 2K9YA 4YXDC 3CWBE 1ZN5A 3KYQA 3MHVA 3N4XA 4H44B 4OH8B 4PJ0H 4XE5B 1AVOA 1NU1K 5APXA 2JWAA 2OYOA 2KNCB 3AE7C 1NTZK 1M8OB 3HE4B 1JNMA 1N8RQ 2O01H 1X8YA 2PGDA 2XDJA 3ITKA 3L70D 5AVXB 2WSEJ 3CCMP 2YIUB 3G6EP 1FZCB 5AW6B 2M3BA 2W6JH 1S4XA 3IN6A 1VF5B 1M1JA 2P1JA 3PRJA 1HUCA 3CC4P 4L75A 3BCCG 2FYUG 1G1JA 3FXDA 1KILA 1VPCA 2FYNC 1T3UA 3CLQA 3A2AA 4ZNCA 2O3JA 1N7SC 2WQYC 2QJPB 5CCGC 5CCGA 2C0WA 2KLVA 5KLVE 1SQBE 3I5CA 4ZKPA 2FFDA 5EFWB 1KILC 3H1IE 1PPJG 3AEAC 2RMZA 2AXTH 3AECC 4W80A 2Q6QA 1ZP0C 2N1TA 4TT3H 2Q7CA 3ABVC 1Y47A 2WMMA 4AUWA 4C7NA 1FJPA 3CCJP 2M0BA 1SFCA 1SLQA 1SQPK 2R3CA 5KJ7C 1KB9E 3L70J 5TISE 5H2FE 4H0LB 1H89A 3TGUJ 1CSBA 1GK4A 4D6TG 3H1KJ 4U3FG 1GTWA 1JMBA 2FYUJ 1KTMA 2Y9YA 1NO4A 1Z56A 1FDOA 1SFCC 2Z4EA 4CPGA 3CXHI 1SQXG 3H1JD 3M06A 4NPEA 1NWQA 1GDTA 5AVZB 2OGUA 3FX0A 3V5BA 3I56P 3OJAB 4AYCA 3SWYA 2BEQD 5DJTB 1N7SA 2AEMA 1NTKK 1UIXA 1N86A 1EZVE 3M91A 4PV1B 3WMM0 2LR2A 3M0AA 2YXRB 3GF7A 1SQBK 1SQXJ 2YIUC 2YNYA 2H89C 1OVRA 1RE3C 3MUDC 3CI9A 1HGZA 1Y9BA 3RK3D 2NPSA 1BDDA 1QL2A 4B86A 1AV1A 3AEFC 5K5GB 1WT6A 1SQXK 1L4AB 2H43A 1ZMEC 5CCHD 2KZIA 4BXLA 2O1KA 3KQGA 5BU5A 4DT0A 1IFPA 2QJKC 4NPDA 1BSHA 1JY2P 1IZNB 3L72J 1FDMA 2J58A 2KSEA 5KJ7D 1GU5A 1KD1Q 1LTJA 3V2RA 2OARA 1N2DC 2ZYGA 3A0BE 3D71A 1KFMA 5APVA 1SQVD 3OW2O 1VQ6P 3K5BA 1K04A 4KT0J 1N73C 2E74B 2DW3A 2XNDH 2H7HA 1JB0J 1OW6A 4UB8H 3HE5A 2RH0A 3LW5H 3G9RA 1FBMA 3P8CE 5APWA 3CWBG 3H6PA 4I2LC 5KLVD 3H1LD 1VQ9P 1IJDB 3GF3A 2J59M 3M9BA 2V4HA 2OTKE 1LP1B 1GMJA 1LTJC 2KS1A 2UWJE 2ZT9C 3VMXA 4DCKA 2O01N 5AVUB 3O6QB 2Y9ZA 3KZIH 2ZVOB 4I6MC 1FAVA 2IPPA 5GTIE 2GUSA 1RF1B 2O01J 2D2CB 5CBNA 1EDJA 5AVYB 1FZGA 2POHA 2Q9IA 3L72E 1X0TA 1KV4A 1NU1D 3L37A 3M0DA 4WY4D 1QGKB 1AVYA 1RE3A 4DJGA 3VYIA 1JY3P 1N73B 2JWDA 1KB9H 1N7SD 3BCCJ 1KILE 1PPJE 2YO2A 1BSNA 3EQ2A 3L73E 3V2PA 2IZ1A 2KB7P 1GL2A 3AE8C 4C7RA 3A0BH 3TGUD 1KILB 3II6A 2RN0A 2FYUD 1LT9A 1MUUA 3HE5B 2E76C 1OX3A 3S4RA 3BCCE 1EZVD 3Q5RA 1IO4A 1ZXGA 1JUNA 1FZAA 2IYPA 2G3AA 3SWFA 3AEGC 3B5NC 1FOSF 1SFCD 2I8DA 3CWBD 5CCGD 2C9NY 2IBZD 3L75E 3RL0B 2KNCA 3RBZA 3SFEC 2E74C 4WBAA 1EXIA 2KSJA 2E42A 1IFDA 1RE4A 2E5YA 1NTKJ 3PTZA 1ZLLA 5CBOA 2N1TD 3Q2YA 3RL0g 3VP8A 4WB4A 3CCRP 3A7OA 1GL2D 3AE1C 4N78D 4I1LA 1OWAA 4RKUJ 1USDA 3L70E 1L0NK 1PGQA 2E76B 2WVRA 4I7ZB 4D6TE 1QVGO 1JCCA 1S5LX 4PV1C 2FXPA 3AE2C 2Z5HA 1HTLC 3NTNA 5KLVJ 2OTLP 3H1LJ 3CMEP 2RKLA 4H13D 2FFDC 4D6TD 2A45H 4HH2A 4PD4H 4YXWH 4U3FE 1VQ7P 3H1ID 2O1JA 2R5DA 5AW2B 1YJ9P 2IYOA 1M7LA 1RQVA 2FXMA 3V4WA 3D70A 1H8AA 1NTZD 2A45G 2K1AA 2Y0EA 1SQPG 2ZFCA 4GOFA 4HB1A 2KIKA 1PP9J 4EIJA 3L75J 2N9YB 1KC8Q 1AQTA 1OMIA 5E79H 4YPCA 2E5TA 2KK7A 1E5WA 1BCCD 3UIAA 5AVRB 4RO0A 3W67A 5GTHE 5KTBA 4OGQC 1FC2C 5BU8B 3Q5PA 3C8VA 1LJ2A 1SQQG 3RK3C 1Q7YQ 1AA0A 1JO5A 1FU1A 2E75B 4R4MA 3G71P 3CCSP 1PP9E 4JQ0D 4HJGH 1K73Q 1NKNA 1S3JA 1FDIA 2K37A 2WSFH 1Q86Q 1BCCG 5CHXA 5DJUB 3B5NA 3I55P 3EFFK 3H1JE 5B66H 1T2KC 1USEA 3TNUA 1N7LA 4BWNA 3O8ZA 5KKZB 1PP9G 3VP9A 3AEEC 3L74E 2I1KA 4EDFA 3VMZA 4Y99C 1GL2C 3R2PA 1MZ9A 1W5CE 4EOTA 2WSCH 2ZT9B 1HWTC 4IFMA 1KQLA 1L4AA 2KOGA 4NPFX 3BRTB 5L8RJ 4L74A 3L71J 3Q1MA 5H2FH 1LWUB 2XU6A 3B8EB 1S5LH 3FWLA 1PL5A 3B5NB 2PP6A 5APTA 4PJ0E 3C9IA 2OTJP 3T97A 2ZJSE 2OYIA 1E79H 1XTCC 4OGQD 1NTMJ 1YTZI
chains in the Genus database with same CATH topology
1OZHA 2O01N 2RH0A 3O6QB 2AXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OZH A;  2O01 N;  2RH0 A;  3O6Q B;  2AXC A; 
#chains in the Genus database with same CATH topology
 2PRR A;  2WPS A;  2B89 A;  2M5A B;  1NVO A;  2CPS A;  2IBZ G;  2KI7 B;  2Z5I A;  1JY2 N;  2FKW B;  1NHL A;  1VQK P;  2JP3 A;  3Q3D A;  4HKZ H;  5AW5 B;  1URQ D;  1G1I A;  1YYC A;  1IFN A;  2IFN A;  2ZYA A;  2QM8 A;  2VRS A;  1JCD A;  3NXS A;  5CMZ A;  3H1L E;  3L72 G;  3WU2 E;  5B5E H;  1NGM B;  3MD0 A;  1U7J A;  1SQQ E;  3GHG C;  2I1J A;  4JF7 A;  4U3F D;  3A0H H;  3WUU A;  3F89 A;  5M1B A;  1X22 A;  2W27 A;  4GT1 A;  2MKV A;  3H1J G;  2P58 A;  4IFF A;  1GZL A;  1VQP P;  3MTU E;  1Y8A A;  3L4F A;  3V2Q A;  1R8E A;  1JTH A;  3CWB J;  1CI6 B;  1L0L J;  1GU4 A;  4PD4 E;  2YKQ A;  1SQQ J;  3BAS A;  1BE3 J;  2HFE D;  1VQ8 P;  2Q3I A;  3H1H D;  1T6A A;  1LTT C;  1NTM E;  2HG5 D;  3H1I J;  4M3L A;  1S5L E;  3CCV P;  2OYI C;  2Q5U A;  1RY3 A;  2K9J B;  2QVA A;  4H13 C;  3RK2 B;  1EDI A;  2KUB A;  4HYT B;  2W6B A;  1A02 F;  1J1D C;  1PP9 D;  2W83 C;  3B71 A;  5AVV B;  1RF1 A;  3NMD A;  4IL6 H;  1VQ4 P;  1H0T B;  1BGY D;  1L0N D;  2BAS A;  2P67 A;  4L76 A;  4WVZ A;  1ZW0 A;  2FFD B;  1BE3 G;  1JY3 O;  3HRN A;  4KJM A;  2ITA A;  1T8Z A;  3AEB C;  3H1L G;  1AQ5 A;  3B4S A;  2PAJ A;  3MIW A;  3CX5 H;  1HJB A;  1J1E C;  1XTG B;  1KYO E;  2V7Q H;  5KAF H;  2NPS D;  5AVW B;  3TGU E;  4D6T J;  1SP4 A;  3BRV B;  3RK3 E;  3T97 B;  1SQV G;  3V4Q A;  3L70 G;  4EYY Q;  5CCH A;  3P32 A;  1YJN P;  2LXB A;  4XFJ A;  1EDK A;  2A06 E;  4W7Z A;  1HVV A;  2NPS B;  3H1K E;  1SQP D;  1LWU C;  2XKM A;  1PGJ A;  2JR8 A;  1D7M A;  1WRG A;  2WSF J;  4L73 A;  3KXD A;  1URQ B;  3L74 G;  1KOR A;  1PIX A;  1TU3 F;  4LC1 A;  3MGN A;  3VMY A;  3LW5 J;  1L4A C;  1DEB A;  1S1C X;  3M9Q A;  2B88 A;  1SQX E;  2AXC A;  1OXZ A;  2ZAE B;  4BRY A;  1NTZ J;  3HD7 C;  4GKG A;  2IFM A;  3RK2 D;  3SFD C;  1VQN P;  2HOD A;  3SSU A;  4UB6 H;  2A45 I;  1JM0 A;  2K88 A;  1FS0 E;  4PD4 I;  1NOH A;  3HD7 A;  2M5A A;  1OFC X;  4H13 B;  2OQQ A;  2YKO A;  3B5N D;  2WT7 A;  1YJW P;  4BRY B;  1U57 A;  3CL3 D;  1NKZ B;  2KXP B;  1NTZ E;  3L71 D;  1KQG B;  1BCC E;  2E76 D;  2XV5 A;  3MP7 B;  3TYY A;  1RF1 C;  3TK1 A;  2JEE A;  1M56 D;  3JSV C;  3TF5 A;  3PH0 A;  1DEE G;  2M8R A;  3FGA D;  3VMA A;  1BE3 E;  2HR3 A;  1CZQ A;  2QSI A;  3JCU E;  4K35 A;  2G8Y A;  1KQF B;  2OYI B;  1PGP A;  3HTK A;  3AE6 C;  2HYN A;  3RK2 C;  1HH0 A;  3IF4 A;  3HTK B;  1T3J A;  5KAI E;  2QM7 A;  3L74 D;  3L73 D;  1FZF A;  1Q81 Q;  1EZV I;  1SQV K;  1YQ4 C;  1QL1 A;  3E1R A;  4OGQ B;  3CX5 I;  2FBW C;  2J5U A;  3C1L A;  1S9K D;  1QEX A;  1YTZ T;  5CJ0 A;  3GHG B;  1YIJ P;  1URQ C;  2IBZ I;  1OW7 A;  3S9O A;  2YKP A;  3VTP C;  4ZKU A;  4UB8 E;  2QJY B;  2V7Q J;  2ZVN B;  2IBZ E;  1W2E A;  2FYZ A;  1R5S A;  3HUS C;  1L0L G;  3L75 D;  4N6J A;  1MFZ A;  1VQ5 P;  3AE3 C;  1JEK A;  2QJP C;  2WPV B;  1SQB J;  3CMA P;  1M1K Q;  2KP8 A;  3GG2 A;  4N3Y B;  2A06 D;  4GOD A;  4H44 C;  4C46 A;  5BVZ A;  1T2K D;  5KLV G;  1LGH B;  3EFG A;  1QX8 A;  4I7Z C;  5B66 E;  1KQS O;  4N78 E;  2D2C D;  2WZ7 A;  3H1K G;  3L75 G;  3QWO C;  3TDK A;  3A0H E;  2LKM A;  2Y0C A;  2NPS C;  4RES B;  1VQM P;  1U7M A;  2QEX P;  3BVH A;  3JCU H;  1K8A Q;  2KLU A;  1J1E B;  1MV8 A;  4Y28 J;  1NTM K;  4GDO A;  2HOD B;  1NTK E;  4DOJ A;  3HUS B;  5B5E E;  4W7Y A;  2QA4 P;  1EZV G;  1FZB A;  1J2J B;  1SQX D;  2E75 D;  2L91 A;  2N1T B;  4MN4 C;  5TJH A;  3N7N A;  3RL0 C;  5AW8 B;  1FJK A;  1NTM G;  2AEJ A;  1AFO A;  5KLI B;  1HGV A;  2NRG A;  1R5L A;  1LTI C;  3AE4 C;  2L5G B;  3L73 G;  1SQB D;  3V6I A;  1MKM A;  3WUT A;  1DD3 A;  3H32 A;  5APS A;  2XNX A;  1SFC B;  3JC2 2;  2BCC D;  1KZU B;  2BCC J;  5TIS H;  2D2C C;  2HPC A;  5E79 E;  1DH3 A;  1EXJ A;  3CCU P;  1ZR4 A;  3P8M C;  1NTM D;  3SWK A;  1EDL A;  3G3Z A;  1Q2N A;  1KB9 D;  2QRX A;  1KMI Z;  4IOI H;  5AVQ B;  5AVT B;  2XZR A;  3EWK A;  1JY3 N;  1L0N G;  1Q90 D;  3CX5 E;  3V2N A;  4JBZ A;  3M9H A;  4IFD K;  4ZMD A;  5AVS B;  3F5H A;  2ZT9 D;  1RQU A;  1DD4 A;  2BCC G;  2H88 C;  2JJL A;  2K9J A;  1L0N E;  3CXH D;  2Q1K A;  3H1I G;  1LTJ B;  3H32 B;  3L36 A;  4WY4 B;  5KLV K;  1KYO D;  1ZOY C;  3CCE P;  1BDC A;  5APU A;  1ZRT E;  1H88 A;  1SQQ K;  4TLF A;  1H0T A;  1IFI A;  5CJ4 A;  3RL0 D;  3ZDM A;  1L0L D;  4GIF A;  1KN7 A;  1P84 D;  2WT7 B;  2WIT A;  1G2C B;  1RHZ B;  2R5B A;  1RF0 C;  2W6A A;  3KDP B;  4XA4 A;  3USS A;  1SQP E;  5AW4 B;  1X9V A;  1PGO A;  3CXH H;  1M90 Q;  2MJZ A;  2QIW A;  5AW1 B;  2WSS H;  1GW3 A;  1JMM A;  2QG4 A;  3H1H J;  3H1K D;  4OVN F;  4AQR D;  2KZJ A;  3O6Q A;  3GW6 A;  3P7K A;  1RE4 C;  2W90 A;  4IL6 E;  1OVV A;  1BCC J;  1RH5 B;  1SQV J;  2YMK A;  3VOP A;  3H25 A;  1LTB C;  2FXO A;  3H1J J;  4Y99 B;  4WY4 C;  1X79 B;  1CW5 A;  4LGD E;  3QH9 A;  2Q3E A;  1LT9 C;  1SQQ D;  1LP1 A;  2KS1 B;  2FYU K;  3WUV A;  1UII A;  3L73 J;  2H8P D;  3P8C D;  1IK7 A;  1PZQ A;  3D6Z A;  2P10 A;  3L71 E;  2M3E A;  3E7K A;  3PP5 A;  1SQP J;  3AE5 C;  2HPC B;  1VF5 D;  1M1J C;  3U1A A;  4PD4 D;  1GL2 B;  2Y0D A;  5APY A;  4A7P A;  4Z1M H;  3AE9 C;  1NU1 G;  2ZYD A;  3PHL A;  2AEF A;  4KHX A;  3H1H E;  2WPQ A;  3D6Y A;  4PV1 D;  1SQB G;  1A02 J;  1LWU A;  4K3A A;  1CI6 A;  3NFQ A;  1K05 A;  1J1D B;  1NU1 E;  1W2B O;  1BGY E;  1VDF A;  2N1T C;  1NJI Q;  3LIE A;  2OYH A;  5CCH C;  3IR9 A;  1RF0 A;  1YI2 P;  1LTG C;  5KLI C;  1IC2 A;  1K9M Q;  1HBW A;  2FY8 A;  2W8Z A;  3E1I A;  2WTY A;  1IK9 A;  3CC7 P;  1KIL D;  1KFN A;  1PPJ D;  1S9K E;  1VL2 A;  3IAO A;  3HD7 B;  3LID A;  3MZW B;  3A5T A;  1JTH B;  1NU1 J;  2JDI H;  4JYB A;  3G4S P;  3OA7 A;  3Q5S A;  1EC5 A;  2PFX A;  5KAF E;  4H0L D;  2R32 A;  2FYU E;  1N7S B;  2A06 G;  2IDB A;  2IX7 C;  1KB9 I;  2JO1 A;  2ZXE B;  1L0L E;  3BCC D;  3PJS K;  4IL6 X;  1SVF A;  2NZ2 A;  2QJK B;  2CK3 H;  1PV3 A;  3M0D C;  1QLE D;  4U3F J;  4RJT A;  1YHQ P;  2E43 A;  1LTS C;  5AW7 B;  3TGU G;  1QVF O;  1NH4 A;  5GTI H;  2JKV A;  1YQ3 C;  2YMY A;  1FZC C;  1IFJ A;  3KZI E;  5KAI H;  1VQL P;  3CCQ P;  2GM4 A;  1IFM A;  2B87 A;  2QJY C;  4DZO A;  2YO3 A;  1M57 D;  1KYO I;  3KHU A;  1YIT P;  1SQV E;  3CC2 P;  1S2E A;  2C0X A;  3FWN A;  1JOC A;  4QMA A;  2OYH B;  1FOS E;  1OW8 A;  2LXC B;  3GHG A;  1NYH A;  3U1C A;  1GW4 A;  1ZV8 A;  3OAK A;  1P84 I;  4U7J A;  3S1K A;  4EI2 A;  1NTK D;  2GUV A;  2QE7 H;  2BEZ F;  2HLO A;  2E74 D;  1P84 H;  4H44 D;  3TNU B;  2C9L Y;  1AJY A;  1SS1 A;  1OZH A;  2BCC E;  5APQ A;  3CD6 P;  1NAF A;  2R3S A;  1L0L K;  3HE4 A;  3KPE A;  5KKZ C;  1LT1 A;  1EQ7 A;  1KYO H;  3L74 J;  4H0L C;  5GTH H;  1BGY G;  3RBX A;  4ASV A;  4UB6 E;  3CPW O;  1HF9 A;  3L71 G;  1GK6 A;  4JPZ B;  1M1J B;  2GA1 A;  2N9B A;  3L72 D;  4GOE A;  1BE3 D;  2WWW A;  1LNQ A;  1HJ0 A;  2K3R A;  1JY2 O;  3AED C;  1OIP A;  2IZ0 A;  1FZC A;  1DIP A;  1L2P A;  1L4A D;  3CCL P;  3H1H G;  4LLH A;  1PFI A;  1FE6 A;  1WMK A;  2SPZ A;  5AW0 B;  2B9B A;  1MFT A;  3MUD A;  3RK3 B;  3CX5 D;  1LT9 B;  2P2U A;  3PLN A;  1NTZ G;  3A3Y B;  3R4Y A;  5KJ7 A;  2E75 C;  2WPR A;  1L0N J;  1BGY J;  2WSE H;  3HUS A;  3L35 A;  2YXQ B;  4R4L A;  1ZR2 A;  1NAY A;  1VF5 C;  3GMA A;  4WWI A;  4O9B A;  1G2C A;  1URQ A;  2AXT E;  1VQO P;  1Q82 Q;  2R44 A;  3CXH E;  3VN0 A;  2B87 B;  1OVU A;  3HD7 D;  4OWF A;  4YTP C;  4C7N B;  1N73 A;  3RGU A;  1FZE A;  1LTA C;  1NTK G;  1ZRT D;  2CPB A;  2P7J A;  4JYC A;  2KYV A;  3TSI A;  4ASW A;  3IFM A;  5C39 A;  1S72 P;  1GD2 E;  3BAT A;  3W68 A;  1DX7 A;  2FYN B;  1YBK A;  5AW9 B;  1P84 E;  3FXE A;  4WY4 A;  5AW3 B;  2OYH C;  3GLM A;  3U59 A;  2ZXX A;  2WSC J;  3WU2 H;  2K9Y A;  4YXD C;  3CWB E;  1ZN5 A;  3KYQ A;  3MHV A;  3N4X A;  4H44 B;  4OH8 B;  4PJ0 H;  4XE5 B;  1AVO A;  1NU1 K;  5APX A;  2JWA A;  2OYO A;  2KNC B;  3AE7 C;  1NTZ K;  1M8O B;  3HE4 B;  1JNM A;  1N8R Q;  2O01 H;  1X8Y A;  2PGD A;  2XDJ A;  3ITK A;  3L70 D;  5AVX B;  2WSE J;  3CCM P;  2YIU B;  3G6E P;  1FZC B;  5AW6 B;  2M3B A;  2W6J H;  1S4X A;  3IN6 A;  1VF5 B;  1M1J A;  2P1J A;  3PRJ A;  1HUC A;  3CC4 P;  4L75 A;  3BCC G;  2FYU G;  1G1J A;  3FXD A;  1KIL A;  1VPC A;  2FYN C;  1T3U A;  3CLQ A;  3A2A A;  4ZNC A;  2O3J A;  1N7S C;  2WQY C;  2QJP B;  5CCG C;  5CCG A;  2C0W A;  2KLV A;  5KLV E;  1SQB E;  3I5C A;  4ZKP A;  2FFD A;  5EFW B;  1KIL C;  3H1I E;  1PPJ G;  3AEA C;  2RMZ A;  2AXT H;  3AEC C;  4W80 A;  2Q6Q A;  1ZP0 C;  2N1T A;  4TT3 H;  2Q7C A;  3ABV C;  1Y47 A;  2WMM A;  4AUW A;  4C7N A;  1FJP A;  3CCJ P;  2M0B A;  1SFC A;  1SLQ A;  1SQP K;  2R3C A;  5KJ7 C;  1KB9 E;  3L70 J;  5TIS E;  5H2F E;  4H0L B;  1H89 A;  3TGU J;  1CSB A;  1GK4 A;  4D6T G;  3H1K J;  4U3F G;  1GTW A;  1JMB A;  2FYU J;  1KTM A;  2Y9Y A;  1NO4 A;  1Z56 A;  1FDO A;  1SFC C;  2Z4E A;  4CPG A;  3CXH I;  1SQX G;  3H1J D;  3M06 A;  4NPE A;  1NWQ A;  1GDT A;  5AVZ B;  2OGU A;  3FX0 A;  3V5B A;  3I56 P;  3OJA B;  4AYC A;  3SWY A;  2BEQ D;  5DJT B;  1N7S A;  2AEM A;  1NTK K;  1UIX A;  1N86 A;  1EZV E;  3M91 A;  4PV1 B;  3WMM 0;  2LR2 A;  3M0A A;  2YXR B;  3GF7 A;  1SQB K;  1SQX J;  2YIU C;  2YNY A;  2H89 C;  1OVR A;  1RE3 C;  3MUD C;  3CI9 A;  1HGZ A;  1Y9B A;  3RK3 D;  2NPS A;  1BDD A;  1QL2 A;  4B86 A;  1AV1 A;  3AEF C;  5K5G B;  1WT6 A;  1SQX K;  1L4A B;  2H43 A;  1ZME C;  5CCH D;  2KZI A;  4BXL A;  2O1K A;  3KQG A;  5BU5 A;  4DT0 A;  1IFP A;  2QJK C;  4NPD A;  1BSH A;  1JY2 P;  1IZN B;  3L72 J;  1FDM A;  2J58 A;  2KSE A;  5KJ7 D;  1GU5 A;  1KD1 Q;  1LTJ A;  3V2R A;  2OAR A;  1N2D C;  2ZYG A;  3A0B E;  3D71 A;  1KFM A;  5APV A;  1SQV D;  3OW2 O;  1VQ6 P;  3K5B A;  1K04 A;  4KT0 J;  1N73 C;  2E74 B;  2DW3 A;  2XND H;  2H7H A;  1JB0 J;  1OW6 A;  4UB8 H;  3HE5 A;  2RH0 A;  3LW5 H;  3G9R A;  1FBM A;  3P8C E;  5APW A;  3CWB G;  3H6P A;  4I2L C;  5KLV D;  3H1L D;  1VQ9 P;  1IJD B;  3GF3 A;  2J59 M;  3M9B A;  2V4H A;  2OTK E;  1LP1 B;  1GMJ A;  1LTJ C;  2KS1 A;  2UWJ E;  2ZT9 C;  3VMX A;  4DCK A;  2O01 N;  5AVU B;  3O6Q B;  2Y9Z A;  3KZI H;  2ZVO B;  4I6M C;  1FAV A;  2IPP A;  5GTI E;  2GUS A;  1RF1 B;  2O01 J;  2D2C B;  5CBN A;  1EDJ A;  5AVY B;  1FZG A;  2POH A;  2Q9I A;  3L72 E;  1X0T A;  1KV4 A;  1NU1 D;  3L37 A;  3M0D A;  4WY4 D;  1QGK B;  1AVY A;  1RE3 A;  4DJG A;  3VYI A;  1JY3 P;  1N73 B;  2JWD A;  1KB9 H;  1N7S D;  3BCC J;  1KIL E;  1PPJ E;  2YO2 A;  1BSN A;  3EQ2 A;  3L73 E;  3V2P A;  2IZ1 A;  2KB7 P;  1GL2 A;  3AE8 C;  4C7R A;  3A0B H;  3TGU D;  1KIL B;  3II6 A;  2RN0 A;  2FYU D;  1LT9 A;  1MUU A;  3HE5 B;  2E76 C;  1OX3 A;  3S4R A;  3BCC E;  1EZV D;  3Q5R A;  1IO4 A;  1ZXG A;  1JUN A;  1FZA A;  2IYP A;  2G3A A;  3SWF A;  3AEG C;  3B5N C;  1FOS F;  1SFC D;  2I8D A;  3CWB D;  5CCG D;  2C9N Y;  2IBZ D;  3L75 E;  3RL0 B;  2KNC A;  3RBZ A;  3SFE C;  2E74 C;  4WBA A;  1EXI A;  2KSJ A;  2E42 A;  1IFD A;  1RE4 A;  2E5Y A;  1NTK J;  3PTZ A;  1ZLL A;  5CBO A;  2N1T D;  3Q2Y A;  3RL0 g;  3VP8 A;  4WB4 A;  3CCR P;  3A7O A;  1GL2 D;  3AE1 C;  4N78 D;  4I1L A;  1OWA A;  4RKU J;  1USD A;  3L70 E;  1L0N K;  1PGQ A;  2E76 B;  2WVR A;  4I7Z B;  4D6T E;  1QVG O;  1JCC A;  1S5L X;  4PV1 C;  2FXP A;  3AE2 C;  2Z5H A;  1HTL C;  3NTN A;  5KLV J;  2OTL P;  3H1L J;  3CME P;  2RKL A;  4H13 D;  2FFD C;  4D6T D;  2A45 H;  4HH2 A;  4PD4 H;  4YXW H;  4U3F E;  1VQ7 P;  3H1I D;  2O1J A;  2R5D A;  5AW2 B;  1YJ9 P;  2IYO A;  1M7L A;  1RQV A;  2FXM A;  3V4W A;  3D70 A;  1H8A A;  1NTZ D;  2A45 G;  2K1A A;  2Y0E A;  1SQP G;  2ZFC A;  4GOF A;  4HB1 A;  2KIK A;  1PP9 J;  4EIJ A;  3L75 J;  2N9Y B;  1KC8 Q;  1AQT A;  1OMI A;  5E79 H;  4YPC A;  2E5T A;  2KK7 A;  1E5W A;  1BCC D;  3UIA A;  5AVR B;  4RO0 A;  3W67 A;  5GTH E;  5KTB A;  4OGQ C;  1FC2 C;  5BU8 B;  3Q5P A;  3C8V A;  1LJ2 A;  1SQQ G;  3RK3 C;  1Q7Y Q;  1AA0 A;  1JO5 A;  1FU1 A;  2E75 B;  4R4M A;  3G71 P;  3CCS P;  1PP9 E;  4JQ0 D;  4HJG H;  1K73 Q;  1NKN A;  1S3J A;  1FDI A;  2K37 A;  2WSF H;  1Q86 Q;  1BCC G;  5CHX A;  5DJU B;  3B5N A;  3I55 P;  3EFF K;  3H1J E;  5B66 H;  1T2K C;  1USE A;  3TNU A;  1N7L A;  4BWN A;  3O8Z A;  5KKZ B;  1PP9 G;  3VP9 A;  3AEE C;  3L74 E;  2I1K A;  4EDF A;  3VMZ A;  4Y99 C;  1GL2 C;  3R2P A;  1MZ9 A;  1W5C E;  4EOT A;  2WSC H;  2ZT9 B;  1HWT C;  4IFM A;  1KQL A;  1L4A A;  2KOG A;  4NPF X;  3BRT B;  5L8R J;  4L74 A;  3L71 J;  3Q1M A;  5H2F H;  1LWU B;  2XU6 A;  3B8E B;  1S5L H;  3FWL A;  1PL5 A;  3B5N B;  2PP6 A;  5APT A;  4PJ0 E;  3C9I A;  2OTJ P;  3T97 A;  2ZJS E;  2OYI A;  1E79 H;  1XTC C;  4OGQ D;  1NTM J;  1YTZ I; 
#chains in the Genus database with same CATH homology
 1OZH A;  2O01 N;  2RH0 A;  3O6Q B;  2AXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...