3O6QB

The structure of spoiisa and spoiisb, a toxin - antitoxin system
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
43
structure length
43
Chain Sequence
CEPRAAKPFKILKKRSTTSVASYQVSPHTARIFKENERLIDEY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure and interactions of SpoIISA and SpoIISB, a toxin-antitoxin system in Bacillus subtilis.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Toxin/antitoxin
molecule keywords Stage II sporulation protein SA
total genus 7
structure length 43
sequence length 43
chains with identical sequence D
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF14185 SpoIISB_antitox Antitoxin SpoIISB, type II toxin-antitoxin system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.740 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3o6qB01
2RH0A 2AXCA 3O6QB 2O01N 1OZHA
chains in the Genus database with same CATH superfamily
2YIUB 2G3AA 1IK9A 5APUA 4IFFA 1JM0A 2V7QH 2D2CC 5KAIE 1SQQD 3VP8A 1YI2P 1BGYE 2V7QJ 4GDOA 1ZXGA 1BGYD 1KILE 1L4AB 2R5DA 3AEGC 3H1HE 2Y9ZA 1K04A 1EDJA 1OX3A 1DD4A 1NU1E 1Q82Q 1AVYA 5GTIE 2WTYA 3NXSA 1Y9BA 3HUSB 1L0LE 2OYHC 2L5GB 2WQYC 1PPJD 4WY4A 3H32A 2XV5A 1VQLP 1YYCA 1RF0A 3I5CA 3L74J 1SQXK 3CXHE 4I6MC 3E1IA 1K8AQ 1KYOE 1RF0C 3CWBJ 3RL0B 2P2UA 2YO2A 3V6IA 2WT7B 1KYOH 1S3JA 2N1TB 1AA0A 1M7LA 2AXTH 2E74D 1IFJA 2YKQA 5H2FH 5AW7B 3CC4P 1NAYA 3IN6A 1NTZJ 1S5LX 3TF5A 2FYNB 5AW9B 5TISH 2OTLP 1QVFO 3VMYA 1QL1A 1SVFA 1KFNA 3AEBC 1M1JC 3AE7C 2QG4A 3L75E 4EIJA 1SQPG 1LT1A 4JQ0D 4QMAA 5KKZB 4RJTA 1ZRTD 2VRSA 5AVSB 1LTTC 2LXCB 3T97B 1FC2C 1OW6A 2IZ0A 3CC7P 1VQNP 3EWKA 4OGQB 3P8CD 2ITAA 3C8VA 3OW2O 2A06D 2WWWA 1SFCD 3CCVP 1JY3N 1KTMA 2K9JB 2H89C 1BSNA 3L71G 1SQQJ 3MGNA 2QSIA 2NPSB 4H44B 3V5BA 2FYZA 2KNCA 3H1HG 1PV3A 3A7OA 1LTJC 3M9HA 4H13B 4UB8H 1EZVE 4Y99B 5C39A 1KILA 2W6JH 4PJ0E 1KV4A 1SFCA 1KQGB 2BCCE 5GTHE 1JUNA 2OTKE 1Q90D 1H8AA 1NTMG 4IOIH 1QL2A 1S2EA 3D6ZA 1LGHB 1JTHA 3RGUA 4OVNF 1VQ9P 1BE3J 2QM7A 3FX0A 4D6TG 1IO4A 2QJKC 4AUWA 3B5NC 1MFTA 1CSBA 3MHVA 4TLFA 3H1JG 2D2CD 1CZQA 3WU2H 3L72G 3I55P 1SQBD 2BEQD 2W83C 3CMAP 2K9JA 1BDDA 1GDTA 2OGUA 1SQBK 1J1DC 2P7JA 1JY2P 3TGUG 1SQVD 2B89A 4K3AA 1NU1K 5AVTB 3VYIA 4WWIA 5TJHA 1CI6B 1M56D 1KC8Q 1FDMA 1KFMA 5E79E 1OFCX 3Q5SA 3PTZA 2RKLA 1JO5A 3R4YA 3V4QA 3P7KA 5B5EH 1HTLC 1HJBA 2RH0A 4UB8E 4W7YA 2A45I 4WY4D 3CCSP 2FFDB 1OVUA 5KJ7D 2ZXXA 1T3JA 2Y0DA 3L4FA 1NTKD 5AVUB 2WPRA 3WUUA 2H8PD 5AVZB 1RHZB 4CPGA 1T3UA 3AE1C 2QEXP 1KD1Q 1UIIA 1SQBG 4R4LA 1FJPA 2KS1A 3L36A 2YKPA 1SS1A 4KHXA 3U1CA 1NTZG 1OZHA 2KXPB 2JR8A 2Q3EA 5AVXB 1LWUB 2JDIH 4H44D 1GW4A 2FXMA 5AVQB 2R32A 1BSHA 2A45G 4NPDA 4U3FE 2ZYDA 1VQPP 1EZVD 1W5CE 3VTPC 2FYUK 5APVA 1FDIA 1JB0J 2KOGA 3KZIH 1U7MA 3LW5J 5APQA 4JYBA 1KB9D 3H1IG 3CLQA 3H1JE 1AQTA 5EFWB 1S1CX 3CX5H 1DD3A 1SFCB 2B9BA 4JF7A 4EDFA 3ITKA 3TDKA 3VMXA 1M1KQ 3H1KD 3RK3D 3AE2C 5KAIH 3BRTB 3H1HJ 1NJIQ 1UIXA 5AW2B 1JMBA 1TU3F 1Y8AA 3O6QA 4PJ0H 2FXOA 1GD2E 1Q81Q 3MTUE 2IBZD 3HD7B 3HE4A 2ZVNB 1NVOA 1KILB 5KLVK 5GTIH 3RK3C 1U7JA 2XNXA 3C1LA 5KLIC 3O6QB 3CCRP 4U3FG 2BCCJ 5AVRB 4AYCA 3L74E 4PD4D 4D6TJ 3WUTA 1SQPD 3L35A 3RBZA 3MP7B 4AQRD 1FZCC 2M5AA 2QRXA 1KORA 4OWFA 1BCCJ 2XU6A 5KTBA 3CXHD 3PHLA 3RBXA 2WITA 5CMZA 3H25A 1R8EA 1KILC 2W6BA 2E75D 3HD7C 3UIAA 1LTSC 1SQPE 5B66E 3O8ZA 4GOEA 3SFEC 2JP3A 1URQC 2M8RA 2O1KA 3VN0A 5KLVG 3HD7A 4L76A 3WU2E 1JTHB 2OQQA 5L8RJ 1FJKA 2V4HA 3RK2D 1N7SB 2J58A 4GKGA 2E42A 2ZT9C 1P84H 3MUDA 4ASWA 3P32A 4L74A 4ZMDA 2DW3A 2A45H 1SQVE 2K3RA 2KSJA 3GHGA 3H1KE 4N3YB 3RK3E 3TGUE 1NO4A 2OYIA 2HODB 1QGKB 1J1EB 3GHGC 1SQBE 2RN0A 3M0DC 3JSVC 1EDLA 3L73G 2M0BA 3CWBG 2K9YA 4KT0J 3H1JD 4N6JA 5BU8B 1GL2B 1S5LH 1LWUC 4D6TE 2HPCB 3PJSK 1KZUB 1LTAC 1SQVK 1BDCA 1KMIZ 2C9NY 1N7SD 3V4WA 3E1RA 4GT1A 1EDKA 2FBWC 1PP9G 2PFXA 3H1LD 2P1JA 2KS1B 2BCCD 1L0ND 1FS0E 2KUBA 4BWNA 1LJ2A 3FXEA 1CW5A 2KI7B 1SQPJ 2WMMA 3KPEA 3A5TA 4L73A 1JCDA 2K1AA 4XFJA 2ZVOB 3Q5RA 3KYQA 5APWA 1PIXA 3A0HH 4IL6X 4R4MA 1X8YA 2FYUJ 3VMZA 5B66H 2WT7A 1YHQP 2J59M 1SQXG 3ZDMA 1E79H 1PZQA 2W6AA 1R5LA 3RL0D 3AE5C 2HODA 5AW8B 2IDBA 2JWAA 3H1KJ 2Z5IA 2KP8A 3H32B 1KILD 1OVRA 1NTME 3H1HD 3L75D 3VOPA 1L2PA 2OTJP 1ZMEC 3SFDC 2BCCG 1L0NG 2K88A 3M0AA 2QJKB 2FYUD 3USSA 5APSA 2N9YB 2WPSA 3D70A 2PGDA 3F89A 5AVWB 4ZKPA 2KB7P 3PRJA 1FZGA 1BE3G 1HJ0A 1L4AD 2UWJE 4OH8B 3TNUA 3A0BH 3L70J 4D6TD 4IL6E 1S72P 1IJDB 3CL3D 1KYOD 2NPSA 3A3YB 1NKZB 4IL6H 2WSFH 5BU5A 1LTJB 4Y99C 3AECC 2QA4P 2NPSC 4H44C 4I1LA 3WUVA 3TGUD 3M9BA 2Q3IA 1L0LD 4H13D 2Y0CA 4HKZH 1GL2C 1E5WA 2FYUE 2PP6A 3T97A 1FZCA 3IR9A 4GIFA 3GMAA 4WBAA 1NH4A 2M3BA 2GM4A 3M06A 1Z56A 3GHGB 1J1EC 3S1KA 5CJ0A 1KYOI 1FZAA 3WMM0 4DJGA 3CXHI 3L72J 1JY3P 1LP1B 1VQKP 2JWDA 3AEAC 3HE5A 1K73Q 2A06E 1M1JB 1N7SA 1PPJG 3P8CE 3QWOC 5GTHH 3TGUJ 2IYPA 1PGQA 2QVAA 2ZT9B 1L0LJ 3VP9A 1N8RQ 1N7SC 1SQBJ 2FYNC 2J5UA 4MN4C 1EQ7A 1IFPA 1HF9A 1KQLA 2Y9YA 4Y28J 3FXDA 5AW1B 1LTIC 1IZNB 2HFED 2M3EA 2N1TC 4IFMA 1URQB 2P10A 1BCCD 1IFMA 2ZYAA 4UB6H 4WB4A 1GL2D 2C0WA 2HG5D 2HYNA 3L74D 5CCGC 2Q1KA 3GG2A 1FZBA 1GZLA 3IAOA 1X0TA 3NTNA 1K05A 1ZLLA 2O01J 3A0BE 5H2FE 1Q2NA 3N4XA 5AW6B 1LP1A 1EC5A 4C7NA 1H0TB 1FZCB 4I2LC 1LWUA 1JY2N 3HUSC 1D7MA 2KZIA 2OYHB 3BCCJ 2IYOA 1YQ3C 1JMMA 1RF1A 1MV8A 1FDOA 2JJLA 2O1JA 1PFIA 5KLIB 1HBWA 1L4AC 2QIWA 4K35A 3RK3B 1N7LA 3LIEA 1G1JA 2OARA 2B87A 1MKMA 2Q5UA 2D2CB 3MZWB 3H1KG 2FXPA 1K9MQ 2I8DA 2PAJA 2YIUC 3QH9A 4PD4I 3OA7A 3GF3A 3BATA 1YJNP 3CD6P 3HE4B 4GODA 2E43A 4JPZB 5AW5B 3L71D 3TNUB 1JY2O 1ZOYC 3U1AA 1N86A 3HTKB 3W67A 4B86A 3EFFK 1AJYA 3B4SA 1SQVJ 1SFCC 3B5ND 3KDPB 1DIPA 1PP9D 1BGYG 1SQQE 2IPPA 3H1LG 3IFMA 5AW3B 1T2KD 4ASVA 4IFDK 2RMZA 2HLOA 1ZR2A 1S9KD 2CK3H 2WSFJ 1GU4A 2OYHA 1YITP 2WSCH 2Z4EA 1IFNA 3CCMP 5APYA 4XA4A 1OXZA 1NTKJ 1G2CB 1RE4A 2GUSA 2BEZF 2MKVA 4W80A 4PD4E 3GW6A 3JCUH 3LW5H 1IK7A 1NKNA 1L0NK 2C0XA 2XNDH 3TSIA 2XDJA 5APTA 2JKVA 1ZN5A 2IBZE 2QE7H 1OWAA 1NTMK 1HWTC 2FFDC 3KQGA 1IC2A 5M1BA 5CHXA 1DEEG 3F5HA 1VPCA 1R5SA 1M1JA 2FFDA 2JO1A 1QX8A 1PGOA 2N9BA 3G6EP 3II6A 1NWQA 3CMEP 3Q1MA 1AQ5A 1S5LE 3EQ2A 5AVVB 1GL2A 2E76D 3L73D 1SQXE 1NTMJ 2M5AB 3H1IE 4PV1D 1LT9C 2E74B 3G4SP 2A06G 3GF7A 2QM8A 1CI6A 3TYYA 2FY8A 1LT9A 2HPCA 4EOTA 1N73A 1J1DB 5KJ7A 1L0LK 1VDFA 1NTZD 3SSUA 3SWFA 4EYYQ 1LNQA 2WSSH 4LGDE 2YMKA 1M8OB 1RE3A 5KJ7C 1OMIA 1L0NE 1URQD 2ZAEB 4WY4C 3B5NB 3ABVC 3W68A 4C7NB 3Q5PA 4JYCA 1EZVG 3AE8C 1A02J 2QJYB 5AVYB 2XZRA 4C7RA 2IX7C 5CCHA 1EXIA 2G8YA 3M91A 2OYIB 1G1IA 2E76B 3E7KA 1FZEA 1RY3A 2AXCA 3KZIE 4N78D 5DJUB 1EXJA 2H7HA 4HH2A 1ZW0A 2ZJSE 3JCUE 4H13C 5KAFE 2OYIC 3KHUA 3LIDA 1SP4A 3BRVB 3FGAD 5DJTB 1Q86Q 1SQVG 1EDIA 3M0DA 2NPSD 1GTWA 3L75G 3B8EB 4DCKA 5CBOA 2C9LY 2IBZG 2JEEA 3L74G 1VQ5P 4OGQC 1DX7A 2CPBA 1M57D 1AFOA 2KZJA 3H1IJ 1KB9I 1L4AA 2CPSA 3A0HE 3S4RA 3V2PA 2KIKA 4U3FD 2LR2A 1JCCA 5KKZC 1SQPK 2IFNA 4H0LD 1RH5B 3H6PA 1H0TA 5TISE 2XKMA 1EZVI 3V2QA 1NAFA 2YXQB 4ZNCA 5B5EE 4LC1A 3AEDC 1IFDA 1NTKG 1WRGA 2QJPB 2WZ7A 3L37A 4O9BA 2BASA 4BXLA 3Q2YA 1VQ6P 2MJZA 1GK6A 4Z1MH 2Y0EA 1H88A 1NTKE 3D71A 1VQMP 4YXWH 4PV1C 3AE4C 3CC2P 2WSCJ 2ZFCA 4U3FJ 3U59A 5KLVD 3RL0C 2P58A 3P8MC 3L70G 1AV1A 1HVVA 1WMKA 1YQ4C 1HH0A 1SQQK 2NRGA 3BCCE 3C9IA 3OAKA 1JOCA 4LLHA 1N2DC 1OIPA 4L75A 3HE5B 2E5YA 3PP5A 4RKUJ 3FWLA 3L71J 4W7ZA 3CCQP 2B88A 1YJWP 4BRYA 2KK7A 2R3SA 1ZV8A 3CI9A 1S4XA 4TT3H 5K5GB 2WPQA 3EFGA 3V2RA 2FKWB 3VMAA 3L73E 1ZP0C 2IZ1A 3NFQA 3NMDA 4NPFX 4HYTB 3AEEC 4YTPC 2W27A 4U7JA 4UB6E 3G71P 5AW0B 1XTCC 2WVRA 2GA1A 1JY3O 1KB9E 1PGPA 3OJAB 4N78E 1QVGO 4OGQD 2ZYGA 2HR3A 4PV1B 1NU1G 1FU1A 1JEKA 4RESB 1ZR4A 4YPCA 1SQQG 1X79B 2YNYA 1XTGB 3BASA 3BCCD 3G3ZA 3PLNA 2YXRB 2NZ2A 2AXTE 2KLUA 1M90Q 1USDA 4ZKUA 1HGZA 2O01H 1VL2A 2QJPC 2R5BA 4I7ZC 3CCUP 5KLVE 2L91A 1QEXA 3MD0A 2AEMA 3SWYA 1BCCE 2AEJA 2KYVA 2POHA 2Q9IA 1NTZE 1T2KC 3CXHH 2OYOA 3D6YA 2YKOA 4H0LB 1N73C 1T6AA 1JNMA 1WT6A 2ZT9D 3TK1A 1LTGC 3BVHA 1IFIA 3AEFC 2IBZI 2WSEJ 1RE3C 1SQXD 1H89A 1USEA 1VF5D 3CCLP 1PP9J 1PPJE 4DZOA 5CCHD 1NTZK 5CCHC 1NU1D 1URQA 1VF5C 3JC22 3L73J 2H43A 1BGYJ 3BCCG 3HRNA 1FBMA 1P84E 1X9VA 3AE3C 3RL0g 3CCEP 1KN7A 2FYUG 1VQ7P 2E76C 1SQXJ 4JBZA 5AW4B 3MUDC 2I1JA 4GOFA 2P67A 1QLED 3V2NA 5CCGD 2SPZA 4HJGH 4C46A 5APXA 1FOSE 2QJYC 1GMJA 1KB9H 3G9RA 3Q3DA 3CPWO 1MZ9A 1NYHA 3CWBD 1DEBA 4WY4B 5CJ4A 1RQUA 1X22A 2N1TD 3CWBE 3H1LJ 3RK2C 1LTBC 2B87B 2E75B 3AE6C 1L0NJ 1YBKA 4DT0A 1VQOP 1RF1C 1BE3E 1YTZI 3FWNA 1P84I 1YTZT 3R2PA 1HUCA 1J2JB 3S9OA 5CBNA 1RF1B 2H88C 1AVOA 2E75C 3CX5I 3HD7D 2E74C 1LT9B 2R3CA 3IF4A 1KQFB 3RK2B 3MIWA 1PP9E 2LKMA 2O3JA 3AE9C 4HB1A 1OVVA 1P84D 1NTMD 1MFZA 2Z5HA 1PL5A 2KLVA 1FOSF 3I56P 1PGJA 4KJMA 1VQ8P 3L71E 5E79H 1FAVA 1LTJA 2W8ZA 1VQ4P 1NTKK 2R44A 2K37A 2W90A 1GK4A 3A2AA 2I1KA 3CX5E 2LXBA 3H1ID 3L72E 3SWKA 1YJ9P 1MUUA 4NPEA 1A02F 4RO0A 3L72D 2GUVA 2N1TA 3N7NA 1ZRTE 1NU1J 1VF5B 3M9QA 1G2CA 1W2BO 1BCCG 4BRYB 1NHLA 5BVZA 3B5NA 5CCGA 4XE5B 4EI2A 3B71A 3L70D 1U57A 1RE4C 1HGVA 3H1LE 2E5TA 4PD4H 1NGMB 3PH0A 1GU5A 3K5BA 4A7PA 2WPVB 1KQSO 1GW3A 3L70E 4H0LC 3HUSA 1N73B 5KLVJ 3KXDA 1OW8A 1DH3A 1T8ZA 1BE3D 2Q6QA 3CCJP 2Q7CA 1Q7YQ 1RQVA 2PRRA 1FZFA 1FE6A 1OW7A 4I7ZB 2YMYA 2IFMA 2YO3A 5KAFH 1SLQA 2AEFA 2KSEA 3GLMA 4M3LA 2ZXEB 2WSEH 1NOHA 4YXDC 2O01N 3H1JJ 4DOJA 3CX5D 2KNCB 3L75J 1W2EA 1S9KE 4WVZA 1Y47A 1L0LG 3HTKA 1YIJP
chains in the Genus database with same CATH topology
2RH0A 2AXCA 3O6QB 2O01N 1OZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RH0 A;  2AXC A;  3O6Q B;  2O01 N;  1OZH A; 
#chains in the Genus database with same CATH topology
 2YIU B;  2G3A A;  1IK9 A;  5APU A;  4IFF A;  1JM0 A;  2V7Q H;  2D2C C;  5KAI E;  1SQQ D;  3VP8 A;  1YI2 P;  1BGY E;  2V7Q J;  4GDO A;  1ZXG A;  1BGY D;  1KIL E;  1L4A B;  2R5D A;  3AEG C;  3H1H E;  2Y9Z A;  1K04 A;  1EDJ A;  1OX3 A;  1DD4 A;  1NU1 E;  1Q82 Q;  1AVY A;  5GTI E;  2WTY A;  3NXS A;  1Y9B A;  3HUS B;  1L0L E;  2OYH C;  2L5G B;  2WQY C;  1PPJ D;  4WY4 A;  3H32 A;  2XV5 A;  1VQL P;  1YYC A;  1RF0 A;  3I5C A;  3L74 J;  1SQX K;  3CXH E;  4I6M C;  3E1I A;  1K8A Q;  1KYO E;  1RF0 C;  3CWB J;  3RL0 B;  2P2U A;  2YO2 A;  3V6I A;  2WT7 B;  1KYO H;  1S3J A;  2N1T B;  1AA0 A;  1M7L A;  2AXT H;  2E74 D;  1IFJ A;  2YKQ A;  5H2F H;  5AW7 B;  3CC4 P;  1NAY A;  3IN6 A;  1NTZ J;  1S5L X;  3TF5 A;  2FYN B;  5AW9 B;  5TIS H;  2OTL P;  1QVF O;  3VMY A;  1QL1 A;  1SVF A;  1KFN A;  3AEB C;  1M1J C;  3AE7 C;  2QG4 A;  3L75 E;  4EIJ A;  1SQP G;  1LT1 A;  4JQ0 D;  4QMA A;  5KKZ B;  4RJT A;  1ZRT D;  2VRS A;  5AVS B;  1LTT C;  2LXC B;  3T97 B;  1FC2 C;  1OW6 A;  2IZ0 A;  3CC7 P;  1VQN P;  3EWK A;  4OGQ B;  3P8C D;  2ITA A;  3C8V A;  3OW2 O;  2A06 D;  2WWW A;  1SFC D;  3CCV P;  1JY3 N;  1KTM A;  2K9J B;  2H89 C;  1BSN A;  3L71 G;  1SQQ J;  3MGN A;  2QSI A;  2NPS B;  4H44 B;  3V5B A;  2FYZ A;  2KNC A;  3H1H G;  1PV3 A;  3A7O A;  1LTJ C;  3M9H A;  4H13 B;  4UB8 H;  1EZV E;  4Y99 B;  5C39 A;  1KIL A;  2W6J H;  4PJ0 E;  1KV4 A;  1SFC A;  1KQG B;  2BCC E;  5GTH E;  1JUN A;  2OTK E;  1Q90 D;  1H8A A;  1NTM G;  4IOI H;  1QL2 A;  1S2E A;  3D6Z A;  1LGH B;  1JTH A;  3RGU A;  4OVN F;  1VQ9 P;  1BE3 J;  2QM7 A;  3FX0 A;  4D6T G;  1IO4 A;  2QJK C;  4AUW A;  3B5N C;  1MFT A;  1CSB A;  3MHV A;  4TLF A;  3H1J G;  2D2C D;  1CZQ A;  3WU2 H;  3L72 G;  3I55 P;  1SQB D;  2BEQ D;  2W83 C;  3CMA P;  2K9J A;  1BDD A;  1GDT A;  2OGU A;  1SQB K;  1J1D C;  2P7J A;  1JY2 P;  3TGU G;  1SQV D;  2B89 A;  4K3A A;  1NU1 K;  5AVT B;  3VYI A;  4WWI A;  5TJH A;  1CI6 B;  1M56 D;  1KC8 Q;  1FDM A;  1KFM A;  5E79 E;  1OFC X;  3Q5S A;  3PTZ A;  2RKL A;  1JO5 A;  3R4Y A;  3V4Q A;  3P7K A;  5B5E H;  1HTL C;  1HJB A;  2RH0 A;  4UB8 E;  4W7Y A;  2A45 I;  4WY4 D;  3CCS P;  2FFD B;  1OVU A;  5KJ7 D;  2ZXX A;  1T3J A;  2Y0D A;  3L4F A;  1NTK D;  5AVU B;  2WPR A;  3WUU A;  2H8P D;  5AVZ B;  1RHZ B;  4CPG A;  1T3U A;  3AE1 C;  2QEX P;  1KD1 Q;  1UII A;  1SQB G;  4R4L A;  1FJP A;  2KS1 A;  3L36 A;  2YKP A;  1SS1 A;  4KHX A;  3U1C A;  1NTZ G;  1OZH A;  2KXP B;  2JR8 A;  2Q3E A;  5AVX B;  1LWU B;  2JDI H;  4H44 D;  1GW4 A;  2FXM A;  5AVQ B;  2R32 A;  1BSH A;  2A45 G;  4NPD A;  4U3F E;  2ZYD A;  1VQP P;  1EZV D;  1W5C E;  3VTP C;  2FYU K;  5APV A;  1FDI A;  1JB0 J;  2KOG A;  3KZI H;  1U7M A;  3LW5 J;  5APQ A;  4JYB A;  1KB9 D;  3H1I G;  3CLQ A;  3H1J E;  1AQT A;  5EFW B;  1S1C X;  3CX5 H;  1DD3 A;  1SFC B;  2B9B A;  4JF7 A;  4EDF A;  3ITK A;  3TDK A;  3VMX A;  1M1K Q;  3H1K D;  3RK3 D;  3AE2 C;  5KAI H;  3BRT B;  3H1H J;  1NJI Q;  1UIX A;  5AW2 B;  1JMB A;  1TU3 F;  1Y8A A;  3O6Q A;  4PJ0 H;  2FXO A;  1GD2 E;  1Q81 Q;  3MTU E;  2IBZ D;  3HD7 B;  3HE4 A;  2ZVN B;  1NVO A;  1KIL B;  5KLV K;  5GTI H;  3RK3 C;  1U7J A;  2XNX A;  3C1L A;  5KLI C;  3O6Q B;  3CCR P;  4U3F G;  2BCC J;  5AVR B;  4AYC A;  3L74 E;  4PD4 D;  4D6T J;  3WUT A;  1SQP D;  3L35 A;  3RBZ A;  3MP7 B;  4AQR D;  1FZC C;  2M5A A;  2QRX A;  1KOR A;  4OWF A;  1BCC J;  2XU6 A;  5KTB A;  3CXH D;  3PHL A;  3RBX A;  2WIT A;  5CMZ A;  3H25 A;  1R8E A;  1KIL C;  2W6B A;  2E75 D;  3HD7 C;  3UIA A;  1LTS C;  1SQP E;  5B66 E;  3O8Z A;  4GOE A;  3SFE C;  2JP3 A;  1URQ C;  2M8R A;  2O1K A;  3VN0 A;  5KLV G;  3HD7 A;  4L76 A;  3WU2 E;  1JTH B;  2OQQ A;  5L8R J;  1FJK A;  2V4H A;  3RK2 D;  1N7S B;  2J58 A;  4GKG A;  2E42 A;  2ZT9 C;  1P84 H;  3MUD A;  4ASW A;  3P32 A;  4L74 A;  4ZMD A;  2DW3 A;  2A45 H;  1SQV E;  2K3R A;  2KSJ A;  3GHG A;  3H1K E;  4N3Y B;  3RK3 E;  3TGU E;  1NO4 A;  2OYI A;  2HOD B;  1QGK B;  1J1E B;  3GHG C;  1SQB E;  2RN0 A;  3M0D C;  3JSV C;  1EDL A;  3L73 G;  2M0B A;  3CWB G;  2K9Y A;  4KT0 J;  3H1J D;  4N6J A;  5BU8 B;  1GL2 B;  1S5L H;  1LWU C;  4D6T E;  2HPC B;  3PJS K;  1KZU B;  1LTA C;  1SQV K;  1BDC A;  1KMI Z;  2C9N Y;  1N7S D;  3V4W A;  3E1R A;  4GT1 A;  1EDK A;  2FBW C;  1PP9 G;  2PFX A;  3H1L D;  2P1J A;  2KS1 B;  2BCC D;  1L0N D;  1FS0 E;  2KUB A;  4BWN A;  1LJ2 A;  3FXE A;  1CW5 A;  2KI7 B;  1SQP J;  2WMM A;  3KPE A;  3A5T A;  4L73 A;  1JCD A;  2K1A A;  4XFJ A;  2ZVO B;  3Q5R A;  3KYQ A;  5APW A;  1PIX A;  3A0H H;  4IL6 X;  4R4M A;  1X8Y A;  2FYU J;  3VMZ A;  5B66 H;  2WT7 A;  1YHQ P;  2J59 M;  1SQX G;  3ZDM A;  1E79 H;  1PZQ A;  2W6A A;  1R5L A;  3RL0 D;  3AE5 C;  2HOD A;  5AW8 B;  2IDB A;  2JWA A;  3H1K J;  2Z5I A;  2KP8 A;  3H32 B;  1KIL D;  1OVR A;  1NTM E;  3H1H D;  3L75 D;  3VOP A;  1L2P A;  2OTJ P;  1ZME C;  3SFD C;  2BCC G;  1L0N G;  2K88 A;  3M0A A;  2QJK B;  2FYU D;  3USS A;  5APS A;  2N9Y B;  2WPS A;  3D70 A;  2PGD A;  3F89 A;  5AVW B;  4ZKP A;  2KB7 P;  3PRJ A;  1FZG A;  1BE3 G;  1HJ0 A;  1L4A D;  2UWJ E;  4OH8 B;  3TNU A;  3A0B H;  3L70 J;  4D6T D;  4IL6 E;  1S72 P;  1IJD B;  3CL3 D;  1KYO D;  2NPS A;  3A3Y B;  1NKZ B;  4IL6 H;  2WSF H;  5BU5 A;  1LTJ B;  4Y99 C;  3AEC C;  2QA4 P;  2NPS C;  4H44 C;  4I1L A;  3WUV A;  3TGU D;  3M9B A;  2Q3I A;  1L0L D;  4H13 D;  2Y0C A;  4HKZ H;  1GL2 C;  1E5W A;  2FYU E;  2PP6 A;  3T97 A;  1FZC A;  3IR9 A;  4GIF A;  3GMA A;  4WBA A;  1NH4 A;  2M3B A;  2GM4 A;  3M06 A;  1Z56 A;  3GHG B;  1J1E C;  3S1K A;  5CJ0 A;  1KYO I;  1FZA A;  3WMM 0;  4DJG A;  3CXH I;  3L72 J;  1JY3 P;  1LP1 B;  1VQK P;  2JWD A;  3AEA C;  3HE5 A;  1K73 Q;  2A06 E;  1M1J B;  1N7S A;  1PPJ G;  3P8C E;  3QWO C;  5GTH H;  3TGU J;  2IYP A;  1PGQ A;  2QVA A;  2ZT9 B;  1L0L J;  3VP9 A;  1N8R Q;  1N7S C;  1SQB J;  2FYN C;  2J5U A;  4MN4 C;  1EQ7 A;  1IFP A;  1HF9 A;  1KQL A;  2Y9Y A;  4Y28 J;  3FXD A;  5AW1 B;  1LTI C;  1IZN B;  2HFE D;  2M3E A;  2N1T C;  4IFM A;  1URQ B;  2P10 A;  1BCC D;  1IFM A;  2ZYA A;  4UB6 H;  4WB4 A;  1GL2 D;  2C0W A;  2HG5 D;  2HYN A;  3L74 D;  5CCG C;  2Q1K A;  3GG2 A;  1FZB A;  1GZL A;  3IAO A;  1X0T A;  3NTN A;  1K05 A;  1ZLL A;  2O01 J;  3A0B E;  5H2F E;  1Q2N A;  3N4X A;  5AW6 B;  1LP1 A;  1EC5 A;  4C7N A;  1H0T B;  1FZC B;  4I2L C;  1LWU A;  1JY2 N;  3HUS C;  1D7M A;  2KZI A;  2OYH B;  3BCC J;  2IYO A;  1YQ3 C;  1JMM A;  1RF1 A;  1MV8 A;  1FDO A;  2JJL A;  2O1J A;  1PFI A;  5KLI B;  1HBW A;  1L4A C;  2QIW A;  4K35 A;  3RK3 B;  1N7L A;  3LIE A;  1G1J A;  2OAR A;  2B87 A;  1MKM A;  2Q5U A;  2D2C B;  3MZW B;  3H1K G;  2FXP A;  1K9M Q;  2I8D A;  2PAJ A;  2YIU C;  3QH9 A;  4PD4 I;  3OA7 A;  3GF3 A;  3BAT A;  1YJN P;  3CD6 P;  3HE4 B;  4GOD A;  2E43 A;  4JPZ B;  5AW5 B;  3L71 D;  3TNU B;  1JY2 O;  1ZOY C;  3U1A A;  1N86 A;  3HTK B;  3W67 A;  4B86 A;  3EFF K;  1AJY A;  3B4S A;  1SQV J;  1SFC C;  3B5N D;  3KDP B;  1DIP A;  1PP9 D;  1BGY G;  1SQQ E;  2IPP A;  3H1L G;  3IFM A;  5AW3 B;  1T2K D;  4ASV A;  4IFD K;  2RMZ A;  2HLO A;  1ZR2 A;  1S9K D;  2CK3 H;  2WSF J;  1GU4 A;  2OYH A;  1YIT P;  2WSC H;  2Z4E A;  1IFN A;  3CCM P;  5APY A;  4XA4 A;  1OXZ A;  1NTK J;  1G2C B;  1RE4 A;  2GUS A;  2BEZ F;  2MKV A;  4W80 A;  4PD4 E;  3GW6 A;  3JCU H;  3LW5 H;  1IK7 A;  1NKN A;  1L0N K;  2C0X A;  2XND H;  3TSI A;  2XDJ A;  5APT A;  2JKV A;  1ZN5 A;  2IBZ E;  2QE7 H;  1OWA A;  1NTM K;  1HWT C;  2FFD C;  3KQG A;  1IC2 A;  5M1B A;  5CHX A;  1DEE G;  3F5H A;  1VPC A;  1R5S A;  1M1J A;  2FFD A;  2JO1 A;  1QX8 A;  1PGO A;  2N9B A;  3G6E P;  3II6 A;  1NWQ A;  3CME P;  3Q1M A;  1AQ5 A;  1S5L E;  3EQ2 A;  5AVV B;  1GL2 A;  2E76 D;  3L73 D;  1SQX E;  1NTM J;  2M5A B;  3H1I E;  4PV1 D;  1LT9 C;  2E74 B;  3G4S P;  2A06 G;  3GF7 A;  2QM8 A;  1CI6 A;  3TYY A;  2FY8 A;  1LT9 A;  2HPC A;  4EOT A;  1N73 A;  1J1D B;  5KJ7 A;  1L0L K;  1VDF A;  1NTZ D;  3SSU A;  3SWF A;  4EYY Q;  1LNQ A;  2WSS H;  4LGD E;  2YMK A;  1M8O B;  1RE3 A;  5KJ7 C;  1OMI A;  1L0N E;  1URQ D;  2ZAE B;  4WY4 C;  3B5N B;  3ABV C;  3W68 A;  4C7N B;  3Q5P A;  4JYC A;  1EZV G;  3AE8 C;  1A02 J;  2QJY B;  5AVY B;  2XZR A;  4C7R A;  2IX7 C;  5CCH A;  1EXI A;  2G8Y A;  3M91 A;  2OYI B;  1G1I A;  2E76 B;  3E7K A;  1FZE A;  1RY3 A;  2AXC A;  3KZI E;  4N78 D;  5DJU B;  1EXJ A;  2H7H A;  4HH2 A;  1ZW0 A;  2ZJS E;  3JCU E;  4H13 C;  5KAF E;  2OYI C;  3KHU A;  3LID A;  1SP4 A;  3BRV B;  3FGA D;  5DJT B;  1Q86 Q;  1SQV G;  1EDI A;  3M0D A;  2NPS D;  1GTW A;  3L75 G;  3B8E B;  4DCK A;  5CBO A;  2C9L Y;  2IBZ G;  2JEE A;  3L74 G;  1VQ5 P;  4OGQ C;  1DX7 A;  2CPB A;  1M57 D;  1AFO A;  2KZJ A;  3H1I J;  1KB9 I;  1L4A A;  2CPS A;  3A0H E;  3S4R A;  3V2P A;  2KIK A;  4U3F D;  2LR2 A;  1JCC A;  5KKZ C;  1SQP K;  2IFN A;  4H0L D;  1RH5 B;  3H6P A;  1H0T A;  5TIS E;  2XKM A;  1EZV I;  3V2Q A;  1NAF A;  2YXQ B;  4ZNC A;  5B5E E;  4LC1 A;  3AED C;  1IFD A;  1NTK G;  1WRG A;  2QJP B;  2WZ7 A;  3L37 A;  4O9B A;  2BAS A;  4BXL A;  3Q2Y A;  1VQ6 P;  2MJZ A;  1GK6 A;  4Z1M H;  2Y0E A;  1H88 A;  1NTK E;  3D71 A;  1VQM P;  4YXW H;  4PV1 C;  3AE4 C;  3CC2 P;  2WSC J;  2ZFC A;  4U3F J;  3U59 A;  5KLV D;  3RL0 C;  2P58 A;  3P8M C;  3L70 G;  1AV1 A;  1HVV A;  1WMK A;  1YQ4 C;  1HH0 A;  1SQQ K;  2NRG A;  3BCC E;  3C9I A;  3OAK A;  1JOC A;  4LLH A;  1N2D C;  1OIP A;  4L75 A;  3HE5 B;  2E5Y A;  3PP5 A;  4RKU J;  3FWL A;  3L71 J;  4W7Z A;  3CCQ P;  2B88 A;  1YJW P;  4BRY A;  2KK7 A;  2R3S A;  1ZV8 A;  3CI9 A;  1S4X A;  4TT3 H;  5K5G B;  2WPQ A;  3EFG A;  3V2R A;  2FKW B;  3VMA A;  3L73 E;  1ZP0 C;  2IZ1 A;  3NFQ A;  3NMD A;  4NPF X;  4HYT B;  3AEE C;  4YTP C;  2W27 A;  4U7J A;  4UB6 E;  3G71 P;  5AW0 B;  1XTC C;  2WVR A;  2GA1 A;  1JY3 O;  1KB9 E;  1PGP A;  3OJA B;  4N78 E;  1QVG O;  4OGQ D;  2ZYG A;  2HR3 A;  4PV1 B;  1NU1 G;  1FU1 A;  1JEK A;  4RES B;  1ZR4 A;  4YPC A;  1SQQ G;  1X79 B;  2YNY A;  1XTG B;  3BAS A;  3BCC D;  3G3Z A;  3PLN A;  2YXR B;  2NZ2 A;  2AXT E;  2KLU A;  1M90 Q;  1USD A;  4ZKU A;  1HGZ A;  2O01 H;  1VL2 A;  2QJP C;  2R5B A;  4I7Z C;  3CCU P;  5KLV E;  2L91 A;  1QEX A;  3MD0 A;  2AEM A;  3SWY A;  1BCC E;  2AEJ A;  2KYV A;  2POH A;  2Q9I A;  1NTZ E;  1T2K C;  3CXH H;  2OYO A;  3D6Y A;  2YKO A;  4H0L B;  1N73 C;  1T6A A;  1JNM A;  1WT6 A;  2ZT9 D;  3TK1 A;  1LTG C;  3BVH A;  1IFI A;  3AEF C;  2IBZ I;  2WSE J;  1RE3 C;  1SQX D;  1H89 A;  1USE A;  1VF5 D;  3CCL P;  1PP9 J;  1PPJ E;  4DZO A;  5CCH D;  1NTZ K;  5CCH C;  1NU1 D;  1URQ A;  1VF5 C;  3JC2 2;  3L73 J;  2H43 A;  1BGY J;  3BCC G;  3HRN A;  1FBM A;  1P84 E;  1X9V A;  3AE3 C;  3RL0 g;  3CCE P;  1KN7 A;  2FYU G;  1VQ7 P;  2E76 C;  1SQX J;  4JBZ A;  5AW4 B;  3MUD C;  2I1J A;  4GOF A;  2P67 A;  1QLE D;  3V2N A;  5CCG D;  2SPZ A;  4HJG H;  4C46 A;  5APX A;  1FOS E;  2QJY C;  1GMJ A;  1KB9 H;  3G9R A;  3Q3D A;  3CPW O;  1MZ9 A;  1NYH A;  3CWB D;  1DEB A;  4WY4 B;  5CJ4 A;  1RQU A;  1X22 A;  2N1T D;  3CWB E;  3H1L J;  3RK2 C;  1LTB C;  2B87 B;  2E75 B;  3AE6 C;  1L0N J;  1YBK A;  4DT0 A;  1VQO P;  1RF1 C;  1BE3 E;  1YTZ I;  3FWN A;  1P84 I;  1YTZ T;  3R2P A;  1HUC A;  1J2J B;  3S9O A;  5CBN A;  1RF1 B;  2H88 C;  1AVO A;  2E75 C;  3CX5 I;  3HD7 D;  2E74 C;  1LT9 B;  2R3C A;  3IF4 A;  1KQF B;  3RK2 B;  3MIW A;  1PP9 E;  2LKM A;  2O3J A;  3AE9 C;  4HB1 A;  1OVV A;  1P84 D;  1NTM D;  1MFZ A;  2Z5H A;  1PL5 A;  2KLV A;  1FOS F;  3I56 P;  1PGJ A;  4KJM A;  1VQ8 P;  3L71 E;  5E79 H;  1FAV A;  1LTJ A;  2W8Z A;  1VQ4 P;  1NTK K;  2R44 A;  2K37 A;  2W90 A;  1GK4 A;  3A2A A;  2I1K A;  3CX5 E;  2LXB A;  3H1I D;  3L72 E;  3SWK A;  1YJ9 P;  1MUU A;  4NPE A;  1A02 F;  4RO0 A;  3L72 D;  2GUV A;  2N1T A;  3N7N A;  1ZRT E;  1NU1 J;  1VF5 B;  3M9Q A;  1G2C A;  1W2B O;  1BCC G;  4BRY B;  1NHL A;  5BVZ A;  3B5N A;  5CCG A;  4XE5 B;  4EI2 A;  3B71 A;  3L70 D;  1U57 A;  1RE4 C;  1HGV A;  3H1L E;  2E5T A;  4PD4 H;  1NGM B;  3PH0 A;  1GU5 A;  3K5B A;  4A7P A;  2WPV B;  1KQS O;  1GW3 A;  3L70 E;  4H0L C;  3HUS A;  1N73 B;  5KLV J;  3KXD A;  1OW8 A;  1DH3 A;  1T8Z A;  1BE3 D;  2Q6Q A;  3CCJ P;  2Q7C A;  1Q7Y Q;  1RQV A;  2PRR A;  1FZF A;  1FE6 A;  1OW7 A;  4I7Z B;  2YMY A;  2IFM A;  2YO3 A;  5KAF H;  1SLQ A;  2AEF A;  2KSE A;  3GLM A;  4M3L A;  2ZXE B;  2WSE H;  1NOH A;  4YXD C;  2O01 N;  3H1J J;  4DOJ A;  3CX5 D;  2KNC B;  3L75 J;  1W2E A;  1S9K E;  4WVZ A;  1Y47 A;  1L0L G;  3HTK A;  1YIJ P; 
#chains in the Genus database with same CATH homology
 2RH0 A;  2AXC A;  3O6Q B;  2O01 N;  1OZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...