3O74A

Crystal structure of cra transcriptional dual regulator from pseudomonas putida
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
270
structure length
270
Chain Sequence
HTRTLGFILPDLENPSYARIAKQLEQGARARGYQLLIASSDDQPDSERQLQQLFRARRCDALFVASCLPPEDDSYRELQDKGLPVIAIDRRLDPAHFCSVISDDRDASRQLAASLLSSAPRSIALIGARPELSVSQARAGGFDEALQGYTGEVRRYQGEAFSRECGQRLMQQLIDDLGGLPDALVTTSYVLLQGVFDTLQARPVDSRQLQLGTFGDNQLLDFLPLPVNAMAQQHGQIAATALELALAAIEEKRYEPGVHAVGRTFKQRIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fructose transport system repressor FruR
publication title Fructose 1-phosphate is the preferred effector of the metabolic regulator Cra of Pseudomonas putida
pubmed doi rcsb
source organism Pseudomonas putida
molecule tags Transcription
total genus 98
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o74A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o74A01
1M2EA 1Z15A 4MLCA 1TJYA 4JB2A 4MR8B 4EYQA 1E6LA 2FTKE 3P9YA 2FLWA 3HUUA 1DRKA 1JL3A 2CD7A 2WB4A 2E4YA 4TLLB 5TQ0B 3O1JC 2PUBA 2NT3A 4MR9A 1EAYA 4KV7A 5CHYA 4GPAA 4ZPJA 3GRCA 3H1GA 5HM6A 3FDFA 4Q6BA 3SQNA 5JS2A 4RK7A 4LE1A 1JH9A 1BDHA 2PAFA 4JA2A 1FQWA 1XHEA 4G0XA 1D1QA 3TB6A 3JPWA 4W5RA 3C3KA 1YVUA 1ZGGA 8ABPA 3QELB 1VRVA 3O1IC 4TLMB 1JLKA 4KREA 4PZ0A 1ZESA 2CHEA 2LUOA 2JBAB 4ETIA 2HJ9A 2PL1A 3H6GA 5B3JC 1APBA 1CEYA 3LUHA 4DADA 2GKGA 1P2FA 5TPWA 1JFSA 4EYOA 3QLTA 4WXMA 2QW1A 3LOPA 1LBIA 2R48A 3DGEC 3EQ2A 4IRXA 2FW0A 3I45A 3IPCA 3B2NA 4WUTA 4PICA 3N0XA 2HQBA 3CZ5A 1ISRA 3CKMA 4LRQA 2FQYA 1SRRA 3QX8A 3HCWA 2L18A 1M2FA 2P4UA 5EWLA 3QX9A 3L49A 1DBPA 4IMJB 4D6XA 2BGGA 3NNNA 3C97A 1Z13A 3BRQA 1XHFA 3C6QA 2QVCA 7ABPA 1NXXA 3RVKA 2FN9A 3O75A 3DGFC 4MS3A 4HYEA 5IUJC 5FWXA 3O1HB 1CYEA 3KTOA 3OQMA 4WT7A 2E4ZA 2FEKA 2MSKA 3W9SA 2PE5A 5JNVA 1KRWA 2WJAA 2IPLA 3RVJA 1S8NA 3GBPA 1RXIA 4KQ9A 4NICA 1PEAA 4XASA 4CBVA 3N0WA 3DZDA 4OBBA 3RVLA 4XFKA 4N47A 4G0YA 3UUGA 3G85A 2PUAA 2LIVA 3MQ4A 4S05A 5IC5A 3HVRA 2PUEA 1BDIA 2JVKA 5GOTA 1EFAA 1YTUA 1LK0A 2NT4A 3Q9SA 1HEYA 1AB6A 3CS3A 3EDCA 5JNUA 3H5VA 4G0OA 1QQBA 1U2PA 3I09A 3LKVA 4ZJPA 3NNDA 3KG2A 3MYYA 2FKAA 4Q7EA 3A0UA 3FGZA 1VKRA 1DC7A 1MB3A 4KPYA 4LDZA 2FMIA 3SG0A 4ETMA 3KSMA 1Y1LA 1YMUA 3RVMA 1SD5A 3NNSA 3LUCA 4EY3A 4EVSA 1DCKA 2LPMA 2A9RA 5KWSA 3I5AA 3T6KA 2FEWB 3SNKA 3RVPA 4Y9TA 4N0QA 2CHFA 5DLEA 2FMHA 3EULA 4LX8A 3CG4A 3OMXA 6ABPA 3T95A 2H3HA 1MIHA 4YLEA 2IKSA 4H3HB 2A9PA 2LP4Y 1OXBB 1C4WA 3ROFA 4W5NA 4IILA 4G0PA 1D2AA 1Z18A 2OQRA 4N0PA 1GCGA 1JDPA 5JNSA 2JCGA 3QLUA 4RK5A 2Q5CA 2QVGA 3H1EA 4RK1A 1AB5A 3O21A 2L2QA 5EWJB 4EGSA 5ABPA 3OM0A 3NHMA 3IDOA 4P98A 3NBMA 4O5AA 5FWYB 1PNTA 1YIOA 2QZJA 1JYFA 1NTRA 1K68A 3N53A 5TE9A 4XARA 1YS7A 3O74A 3Q7TA 4KNYA 3N6VA 2FXIA 1F51E 4G0ZA 1IIBA 1PHRA 4N76A 4YCSA 3GA5A 4NQRA 4MR7B 2FQWA 2HQOA 4PYRA 5TQ2A 5JS1A 2L19A 4KQCA 2E4WA 4YO7A 1P8AA 2JVJA 1F4VA 4XAQA 1JWLA 4G0MA 1SXHA 1QKKA 1FFGA 2V0NA 1DCMA 3N0RA 4E7PA 1DBWA 1W25A 1JFTA 5BRJA 1J56A 3KLOA 3EJWA 5KI6A 1A04A 4YGXB 4FB4A 4Z4GA 3OLXA 4UHKA 3H1FA 4MQEA 3TD9A 4JASB 1ZY2A 1NY5A 4RK0A 5B3JA 3OLVA 4DN6A 2VYCA 2ID9A 5DKFA 1USKA 2F8TA 2MSWA 3DLBA 3F73A 4LZLA 3HXMA 1ISSA 2QV0A 4W5OA 2PKXA 4KVFA 3IP9A 3IP6A 2M1ZA 4Z9BA 4ZYLA 1L5ZA 4RSMA 3KHTA 5IX8A 4MQFA 1QNLA 5EWMB 1ABFA 5GQSA 2R25B 2M98A 2QR3A 4FE4A 4L4UA 2WMYA 4E7OA 4PEVA 3RVQA 2B4AA 3KS9A 5KC9A 3CG0A 2WY2D 1ZHHA 3QK7A 4G97A 4YS6A 4KRFA 3H5LA 1GUBA 5HKOA 1NXVA 1Z26A 5CNIA 3HO1A 1GLGA 2WWVD 3F6PA 3A10A 3IP5A 1C0EA 2ZAYA 4MRMA 2F8SA 4MS1B 3RVNA 4Z4HA 1YMVA 4MYRA 4RS3A 4RZSA 2FMKA 3GV0A 3KJXA 4H60A 1JFVA 4UHJA 3QEMB 5BR1A 4RY8A 3FMVA 4ML3A 4O1HA 2QSJA 1BVHA 3E3MA 3ROTA 4DQDA 1QP0A 4XLTA 3BRSA 3DLHA 2I6FA 4YRZA 1DZ3A 1RNLA 1ZITA 5CNKA 5PNTA 1Z16A 3OO0A 2GBPA 5I4CA 1FSPA 3I42A 4OTZA 5TQ0A 2DRIA 4JOQA 4QPJC 1DJMA 2FVYA 3H6HA 4MS4A 1OXKB 3GL9A 4S04A 2J48A 5HQJA 4NCBA 4F11A 1ABEA 4LE2A 4ETNA 1JHZA 2PMCA 3C3MA 5FBHA 4W5QA 2FEPA 3O2SB 4Z4FA 3K9CA 4MR9B 4IMIB 3F6CA 4YWHA 2RGYA 2O20A 3S99A 1CHNA 3L6UA 2XDYA 2NUBA 3BBLA 3GYBA 3LUAA 3Q15C 5JNWA 4M88A 5KQLA 1WETA 5TQ2B 3QELA 3HK2A 3N75A 3VNBA 5IUNC 1TLFA 1YS6A 3LUKA 1E6MA 2JBAA 3LUGA 4G0QA 2R4QA 3SAJA 3ILHA 5CNJA 5IEJA 3OLWA 2W42A 1RZRD 3VNAA 3EAFA 2HPHA 4NV3A 4EUKA 3T38A 1QQAA 4MQEB 1JX6A 1ZN2A 3BREA 3FFWA 3H75A 2MYUA 4MPTA 2AYXA 5JNTA 2AYZA 2WJWA 5TPWB 1SXGA 3GWGA 3GT7A 4WWHA 1Z25A 5HSGA 4O1IA 2X7XA 4Z9AA 5BRAA 1DP4A 1A2OA 1QP7A 2RJNA 2WRZA 4HNRA 4KFCA 1ZH4A 3DBIA 1SXIA 4EVQA 3C3WA 5EWLB 5TQJA 5KC8A 1P6QA 1MVOA 2NZUG 2JVIA 1TMYA 1QO0D 4EYGA 3HS3A 1LJUA 4MS3B 5FWXB 3OQOA 2E4XA 3OM1A 3OMWA 3H5TA 3RVRA 1EWTA 4F12A 1JF8A 3CZCA 3O2JA 2QU7A 4KK4A 4OLAA 3MF4A 4F3TA 4MAAA 6CHYA 3QLVC 2GI4A 1W9HA 5IEBA 1ZGZA 3O2QB 1E2BA 2R47A 2FMFA 5JNRA 1ZAYA 1FFWA 3Q7RA 4W5TA 3KLNA 3LKBA 2N9UA 4QICA 5TPZD 5T7BA 2PUFA 3JY6A 3URMA 4XXHA 3UKJA 4L85A 3LUJA 3JVDA 4EVRA 2OENG 5C5EA 2CWDA 2RJOA 1I3CA 3QEKA 4B09A 3HSYA 2PJUA 3HM9A 4RDCA 3CFYA 1EWVA 1NXTA 2A9QA 1BA2A 4JAVC 3CLKA 4MS4B 5IUKC 4PE5B 1EWKA 1R8JA 1U2QA 3N8IA 2PUGA 5DCLA 4MGEA 1YK0A 1ZDMA 1YK1A 2FQXA 2ZWMA 3JTEA 3NHZA 4RXMA 4ZMRA 3FFTA 4JB0A 1BDJA 3K4HA 1D1PA 1QPZA 3KYJB 3HV2A 3HEBA 1M5UA 1FFSA 2E4VA 3JVIA 3JS5A 4Z4IA 3E61A 3OLYA 1PEYA 1JDNA 4HNSA 3UK0A 3H5WA 3H5OA 5BQ3A 4KK3A 4RKRA 1UDRA 3LFTA 4IGAA 4TMYA 2VK2A 1USIA 2VUHB 1L5YA 3LUDA 1DRJA 1Z2DA 3HUTA 3MM4A 1USGA 4NCAA 1PNRA 2LBPA 4OATA 4OG2A 1QP4A 2IYNA 3FFXA 1VLZA 2P9HA 3EGCA 5T3YA 1RPJA 4F06A 1GCAA 4G86A 2GWRA 3A3KA 4FE7A 1M5TA 3D02A 1GUDA 2MYTA 2TMYA 3D8UA 3OLZA 3CNBA 3ILYA 1XWWA 1NXSA 4LE0A 1Z12A 5EWJA 2E4UA 2FN8A 4RXUA 2RDMA 3CTPA 3CRNA 3OQNA 4KMRA 5FWYA 4LDAA 1ZH2A 5IULC 4N41A 5KQPA 2QXYA 3LTEA 4YV7A 4Z99A 3RVSA 3KCNA 4MR8A 4QYMA 4YR7A 2JK1A 1Z2EA 4ZMSA 1Z17A 2YHBA 1NXWA 2HQRA 1JYEA 1BAPA 2L17A 3M9XA 4RK6A 4GNRA 1H9CA 4RU1A 5FBKA 3M9WA 3TMYA 2HSGA 3R0JA 4MR7A 5DGCA 1U0SY 4OLBA 2NZVG 4WXEA 4RV5A 1ZVVA 2KYRA 4F8JA 4N03A 4TN5A 3SM9A 1RXEA 1NXPA 2PLNA 3HZHA 2FSPA 1NXOA 3RVOA 4D6YA 3RH0A 4KZKA 1A0OA 2GX6A 2IDMA 1RZRA 3Q41A 1K66A 2ID7A 5D2CA 1URPA 1LJLA 1E6KA 2FLKA 3HDGA 3MIZA 3BILA 1PUXA 1KRXA 2IPNA 2VUIB 4Z0NA 4D74A 5IBQA 1T34A 5DTEA 5E3JA 3HJFA 3GBVA 1MAVA 2MYNA 1U04A 3SY8A 4EYKA 3RQIA 3CHYA 1B00A 5ED4A 1TM2A 1U8TA 5EWMA 3M6MD 5KQGA 1DBQA 1QMPA 3T8YA 5CNMA 3IPAA 2IPMA 1VPWA 1KGSA 2PUDA 4RKQA 4Z4EA 1DC8A 3LUFA 3Q7SA 4RXTA 3TO5A 1QO0A 2YHAA 3F7NA 1D5WA 4IF4A 4MQFB 4WZZA 5C5CA 1NATA 2PUCA 4JP1A 4RY9A 4RWEA 4MS1A 5F64A 3EODA 3JPYA 3A0RB 3KKEA 3MA0A 3OO1A 4QYWA 3QEMA 3HDVA 4Z4CA 2IOYA 2PL9A 4MRMB 1P6UA 4MLDA 3IP7A 4P1ZA 4H3KB 4RY0A 3CU5A 3H5IA 1KMIY 3QLUC 1DCFA 2H0AA 9ABPA 3QLVA 2A9OA 3TX6A 4HNQA 2JRLA 2JB9A 5TPZA 1DG9A 2IPAB 1D4ZA 2MYPA 1JBEA 4Q6WA 1TVMA 3EQZA 1LBHA 3MMNA 5KQMA 4RK4A 2B1JA 2MSLA 3KYIB 4YP9A 3G1WA 3LMKA 1EHCA 1MB0A
chains in the Genus database with same CATH superfamily
4TUYF 1JR4A 1KSJA 1VE7A 1QDLB 1BN6A 5CYOA 5IK2D 1SBIA 4MLCA 4MGZR 3HJAA 3DXXA 2WJVA 4KXXA 3FXAA 4H6XA 2QD3A 2DJIA 3NVKI 3HXPA 3LT2A 1LDBA 1UOEA 4JIMA 3ZCTA 1YR3A 3C1OA 3R0XA 3N2KA 4KUHA 3GAAA 4RY2A 3UYLA 4GPAA 3PDUA 1N5MA 4JMLA 5HEKA 4C4AA 2JFUA 1P3JA 1LX6A 1MLDA 1Z39A 1IEXA 4ZEMA 5JAUA 1N9GA 3AH8A 2YFQA 3EIUA 1ZD2P 1A9OA 2LCFA 3FNFA 1Z6TA 4DOMA 4R7ZA 1WA5A 5K0FA 1DC3A 1M2JA 3G0BA 4FMDF 2VRWA 5J3JA 1YQDA 2D0OB 4UU1A 2DU8A 2XNDD 3NGMA 4J91A 3PC6A 1RKXA 3ROPA 3T1TA 2HU5A 1K8ZB 1FBNA 3HBLA 2V6MA 1G8YA 2CHEA 2HV9A 4OQMA 2AI3A 2QBYB 3B7GA 1APBA 1N6IA 4IINA 1BDMA 2C9CA 2V7UA 2QUHA 4GQBA 4UOEA 2D5IA 3BX1A 1QAMA 1PDVA 1MF7A 1JR3D 3E0XA 1VE5A 3QBDA 1P7YA 1AO0A 2XRYA 1WHTA 4HATA 1G8HA 5LMZA 3E4DA 1PW7A 1NX9A 1OBCA 1WXGA 3HJGA 3UOAB 3PXDA 5H9WA 1IQ0A 1A9ZA 4GX2A 1RYMA 3EIFA 4IVPA 1HBJA 2XY4A 3CWZA 3HCFA 4LRQA 4Y2PA 2FQYA 2HJWA 1COZA 5D85A 5ITVA 1V48A 1EBBA 3QX9A 1DB3A 4LMPA 4L07A 2JEOA 1U9CA 2ACEA 1TYBE 1QKIA 3UJNA 1NXXA 1ZN7A 4H4DA 4X54A 5DGTA 1A8UA 3LLUA 3AQ4A 1PV2A 1TL7C 4MS3A 1JAHA 2BF7A 5HTKA 2PA0A 4WBNA 3KTOA 4XCXA 2AN1A 3G5LA 3MWEA 3EFOB 5IRCD 4ZV9A 1ZK2A 2Q29A 3OOHA 3W9SA 4DTCA 4ECAA 1GR0A 3N0TA 2E4AA 4UZEA 5A71A 3VSAA 1WHSA 3RVJA 4C0LA 2IIPA 3PITA 3RIMA 1A9XA 1ZM3A 3X2EA 2EX4A 3QOYA 3SVZA 3UMCA 2BJHA 1P19A 4A4DA 5F4BA 4JEMA 5I5GA 4E3ZA 3GLFA 1U7HA 1XJQA 3RHFA 3HA2A 5JVDF 3E03A 4PZZA 4RWZA 4B6QA 4EGAA 1JZTA 3OZEA 4X8HA 4AS3A 4F1KA 2WWGA 4GM4A 4B40A 3KYDB 3NBUA 2PUAA 3PRYA 2LIVA 2D74A 1SCAA 1GL7A 5BSKA 4QUDA 1OREA 1GTG1 3QFRA 5GOTA 3LSTA 1XKLA 3EZ9A 3JYNA 3H99A 2P2NA 3CNHA 4YJDA 1Z4IA 5CDFE 3C1UA 1BXGA 2OB1A 3HMKA 1GXSA 2NXCA 2VDJA 1FW8A 1G5TA 2OCYC 2PEZA 3BXHA 3I8OA 2VBFA 4QASA 5DYYA 3SXUB 4PBRA 1Z6GA 3T1OA 3MBOA 1YA6A 2J5KA 3G0IA 3PZBA 2XMDA 3KEFA 3WGGA 1YZ3A 4GBED 4FZ3A 2C92A 1I32A 3FGZA 4R0NA 3SBOA 3ZLVA 4DYDA 3VQTA 2ZB2A 4K2AA 1XF1A 4KOAA 5JRJA 2Q5JA 3ZGLA 3A4LA 3U19A 1T24A 3NEJA 3DCIA 2RK6A 1RLJA 3WFJA 3O95A 5A7GA 4HYQA 3NAQA 5FIUA 3Q0IA 4GXRA 3AHFA 4OQNA 4ZVKA 4Y9TA 2PH7A 1JSRA 4V0SA 1TZBA 2AOVA 1PR3A 2PSFA 2NUAA 2YMPA 3FUTA 5BV8A 5DXFA 3NH9A 5E6RB 2J46A 5DTIA 2Z09A 2X0FA 3WR5A 3OMXA 5AW4A 5LJIA 6ABPA 2HZ7A 3GFBA 2PXCA 3GW8A 4GWKA 4PIMA 3WQHA 4MW9A 4BO1A 1JP7A 2I6TA 1QSGA 3BJRA 2BR3A 1IBMB 2ZBUA 2CXTA 4A6DA 2I6SA 3PC8A 1V1RA 3WLIA 1DTEA 1F4LA 4AMVA 3QIAA 4CW7A 3RBAA 4KVAA 3C7TA 5AW0A 3HL0A 1NV8A 2Q6KA 3JU3A 1MORA 3L7JA 3GMIA 4DZZA 3E3NA 4M9SA 4NX2A 1IAQA 3ZQUA 2JLWA 5E4FA 4F4FA 3B36A 5TE9A 2N3ZA 1IZ9A 4TN1A 4BWVA 5KCZA 4IDFA 1SQ5A 1K5PA 3IUQA 1CCWA 3CISA 3K2IA 2GPBA 3IJRA 4KG7A 1CNFA 2VR1A 4BO3A 3CEHA 1V8BA 3DG9A 4NNOA 2NSHA 2B4RO 5B4TA 4AJKA 3GA5A 3EUEA 2G04A 3L0BA 5K6RA 5TQ2A 1KYXA 5LXTA 1K9VF 3NDJA 4J43A 2R6GA 3BXPA 4P86A 4FEAA 4EPYA 1QVRA 2HMTA 4LXIA 5CX4A 3VM6A 2QOEA 4N7JA 1FFHA 3MWYW 3T54A 1UIRA 2ZRPA 3KLOA 3RWOA 2EFEB 1VL8A 2ZI6A 3RYTC 3TYXA 3N2YA 4UHKA 4JLOA 1F9EA 1XDGA 2W6OA 2YW2A 3CUYA 2Y9MB 2JNWA 4CM5A 2WJGA 3PZRA 3VKGA 4JBNA 1OIVA 2VDOB 4GGOA 2QL6A 4CF3A 2PZAA 4JP2A 4GD3Q 3RS0A 1EDDA 3JSXA 4DIMA 3GAZA 1ENYA 3MWJA 3QKUA 3S40A 1FUEA 4PX9A 6NULA 2QV0A 3LC1O 5GIOE 4G5FA 1I7SB 3E5RA 2GF2A 2B1RA 3EH1A 3X1WA 1YASA 1BMQA 4QGHA 5EJGA 3L6EA 2HNBA 3IH5A 3RDPA 1QTQA 1GZHB 1ZD3A 3K0HA 3L7NA 1AZSC 1GGJA 2AWNA 4G1CA 4PEVA 3C87A 1I13A 3O9MA 3N70A 4LYDA 4JLDA 1Y8ZA 4DDMA 1KP9A 3VZBA 5HW0A 4DWJA 1Z6PA 5AW5A 1E4OA 1OA1A 4L1KA 4YRJA 4K46A 5C81A 2W70A 2J9YB 1KI8A 3IP5A 4F8YA 3EPLA 1IK4A 2QGFA 4OL9A 4MRMA 1ZVMA 5HUQA 1GCIA 1YMVA 2R2AA 2XQKA 4ZYVA 2WLSA 1NF8A 4FS8A 2G7MC 4N5LA 5K3FB 1DQYA 1PGOA 2HYDA 4NR0A 5I9NA 3KFLA 3DHNA 4RY8A 5EVJA 4P8RA 5ECYA 5H4HA 3UJ9A 4UBIA 3DT6A 4DMGA 1J2JA 3W2EA 1M2OB 1V47A 2D2FA 1VHQA 2O07A 1SH7A 3QU5A 3RS4A 1PTKA 1WUYA 4W5JA 1NE7A 2BZGA 4RFLA 1YKGA 2OB2A 3EG9B 5DW0A 4M1ZA 1VJTA 2HNKA 3G6WA 4M9ZA 5EHQA 5DFAA 1H9BA 3FOZA 3I42A 5JT1A 1CG6A 1D6SA 2NTYC 4V03A 2WVAA 3KTDA 2ICAA 2F43A 4I8XA 4HGQA 4F84A 4M89A 1BWQA 3IR6A 3VYRB 2FVYA 3NIBA 3PD0A 5KZMB 1EXVA 4JJ8A 5KPDA 3U6BA 1USWA 5C3UA 4RSRA 1KRHA 4X24A 5AI9A 4RD6A 3ZZ0A 3KR2A 4DA6A 2JRCA 3GZNB 2FEPA 3AF2A 2F6RA 2ZT7A 4O63O 3I53A 1E9FA 1KPIA 1KYWA 3DYBA 3CBQA 3F6CA 4CIWA 3B70A 2L0XA 2G1AA 1LV7A 1OUMA 1PJRA 3L6UA 3MTAA 4B87A 4AS2A 1P2VA 1PK9A 3VJRA 4M1SA 1G64A 2G8NA 2BGNA 5IUNC 4OIMA 1IXZA 4IWNA 3E6AA 4BNXA 3NIWA 2PSSA 1Z6AA 2OHHA 1YQWA 3D7RA 3G2PA 5IAEA 1WXFA 4CMHA 1DO8A 1L8QA 2BZ0A 4YT5A 2UYHA 3MGAA 4XQGA 4QUGA 5C31A 2LR0A 1YRQA 4RVUA 2AJ8A 3BMNB 3DFIA 5KU7A 3AR7A 3ADKA 3PWTA 3H2IA 1XLVA 2VT2A 1W581 4JR0A 5CM8B 4M0DA 2CXQA 1DEOA 3M6LA 4OQ4A 4XEHA 3MFYA 2PRKA 2C4HA 3FFBA 4MPTA 1D2EA 3IBCA 4IRMA 4Q19A 1V96A 5I51A 4RCZA 1FTWA 1O5OA 1DC4A 5TPWB 4QPDA 2BJWA 2V0GA 1XKTA 1NUUA 5CBKA 2FEXA 4C89A 5KAPA 3NIFB 2VHUA 1XZGA 1N9ZA 3B8HA 5BQOA 3LZ6A 2B4TO 3EUFA 1YD7A 1D6JA 1KYYA 2SBTA 1MQ8B 1PZHA 1SXIA 2X1MA 5CRIA 4IIXA 4C5AA 3CTMA 3EWAA 2DZDA 2OM6A 3CGWA 1KK1A 1TMYA 3O7WA 4H08A 4LC1A 3IKTA 3V1KA 5F9MA 1E9RA 1LJUA 3H4VA 4TRNA 1MR3F 1XQ1A 1ZXXA 3ZHTA 3VPHA 2ZK7A 3M34A 3ZUGA 5JR3A 4ICIA 1A8PA 1H2RS 3H5TA 3FOBA 4NTZA 5J1TB 1FVHA 2ZAMA 4MWEA 1PQYA 2YC2C 3MWFA 3EEBA 3DV0B 1N2BA 4L16A 4UAVA 1NPTO 4UMFA 4X8OA 4KR9A 1MQAA 5B2EA 1ZGZA 4AWAA 4R5MA 1XO1A 2WHPB 3VAAA 1WSBA 5AM1A 2JA2A 1XEWX 2ANBA 2CE7A 2LWIA 4IXWA 4LK2A 5DNCA 3AVTA 4J6FA 3E8MA 2BM8A 1Q0PA 4I1IA 3JQCA 1I2AA 2H57A 2CWDA 3ZU5A 1JDZA 1U7WA 1QYWA 5EJ6A 4LCEA 4LJ5A 4O0MA 5AJVB 3SVLA 1ND6A 3LJKA 1Z4OA 4QFBA 4ZWNA 3T34A 3U2QA 2PQ6A 4I4LA 1V43A 1H4QA 1DXQA 3RS5A 4ZRMA 2AC4A 4MS4B 3G89A 3CMMA 1JLMA 3F9IA 5KAMA 1YK0A 2GKSA 3CF4A 1FLVA 3S4YA 3TZHA 1T2EA 4B2PA 2F17A 3PVCA 3WDSA 1FP4B 2DETA 5DTMA 2G63A 5DBFA 3VYTB 2B5WA 1W5SA 2EFDB 3V1TC 1R7RA 4EBBA 5K2OA 3SEZA 4D8WA 1QU3A 1KZ1A 3FDXA 2GWHA 4M9UA 4YALA 1AHPA 1XZAA 1CWUA 2W2LA 4TWRA 2E4VA 3MRXA 1EQ2A 1Y8AA 4OPMA 1K3TA 2OZPA 5TARA 3UK0A 2P2SA 2CBXA 3KQTA 1MABB 4FHCA 4PM4A 2XZTA 4GLLA 3WG9A 1P9RA 3DWFA 1RYBA 4LJKA 2PYDA 1JQKA 1UBUS 4JJIA 3VHXA 3QY9A 1NQWA 4OG2A 4EFNA 3FF1A 1Z8DA 2ZZKA 3LA6A 3RYHB 1C5KA 1K2VN 1U02A 1U94A 3OPMA 1WABA 2ZYIA 3KBBA 3DKPA 3RU3A 4IHKA 1YUNA 1H8HD 3K96A 4C4ZA 1PWEA 4D9JA 3OLZA 4QBKA 4E51A 4OJYA 1HE1C 3G9UA 3WQSB 4HQLA 2RDMA 4PZDA 4MH0R 2H1RA 2UVQA 3CUSA 4HS9A 1OWMA 4CKWA 1RHJA 4BECA 5JSFA 4OLJA 2IEZA 2H7CA 5KVAA 3HKDA 4WOJA 3DEZA 1AK9A 1L4HA 3OOEA 3UXYA 4ZK6A 4UMEA 3K8YA 4BVFA 2B7LA 4ZMSA 3TR5A 4BO2A 1Z17A 2YIJA 5KMGB 3DE6X 3N2IA 1GILA 1N2CE 2BTQB 1RAHA 2OCDA 1IJEA 2RHMA 1VYUA 3CWQA 5H16A 2EGUA 4QEKA 2D7CA 4KNWA 3PQFA 4E30A 2CSUA 1GGVA 3EUWA 2QENA 1G7TA 2YQ4A 1UINA 1UP4A 4TL9A 1U0LA 3NYIA 1AM4D 3EEIA 1AG9A 1ZOSA 2VAMA 3DOFA 1PNOA 2VH1A 5EJ8A 1RXEA 1IY2A 1L3IA 1YB7A 3RSQA 4IKOA 3CRVA 1DKUA 1ZPDA 3HZHA 3OAAA 2FSPA 2OBBA 2YYZA 2RKOA 1CY1A 3KAJA 1HI9A 2ZTUA 3HWRA 4KBFA 4L3VA 4YJGA 3VR5H 1U3FA 1VSTA 2FGKA 4IDQA 5EZYB 3H5RA 2C5EA 3GLTA 4NU5A 5CFPA 2KM1A 5K0EA 3KQNA 2B8WA 3FVWA 4OHWA 1NSYA 5EKXA 4F91B 4IF6A 4RIHA 3DTYA 3WL3A 4Q03A 5ALPA 4I4IA 3QVXA 4YH1A 1EB8A 1PFUA 5J2UB 3UA3A 5H68A 3UYKA 4RC9A 5CK4A 5KYYB 2XKAA 2P9EA 3PFCA 4W7HA 2KB0A 2ZUWA 4IIBA 3PEUA 4BBAA 5K05A 3KFXA 3CHYA 3IMFA 4KGDA 1FVOA 1A4XA 4D0RA 4DMFA 2O1XA 1DBQA 4DA4A 3D0KA 1J33A 1L7MA 2X9QA 2FWIA 5J4YA 1JQJC 3AJEA 3IPAA 3WADA 2IHNA 4F5EA 1NW8A 3JRWA 4LYAA 4IG9A 1SEVA 2B83A 1D5WA 2WAMA 4MYTA 2EGGA 4LXTA 2XAAA 4WFJA 1JFFB 1K6IA 3RIGA 5K0JA 5F5XA 3VHRA 1M6VA 1JI3A 4YCMA 4P9NA 3KVYA 5B36A 5A62A 3IL2A 4CL8A 4IDOA 1FDRA 3NUQA 4R1PA 4ZVSA 4F4JA 1KTVA 1U9YA 2ZFUA 3QNMA 4R8SA 3AEYA 4ROTA 4QJ5A 4CG0A 4Z4CA 1SZCA 3EDOA 4EYSA 2OSVA 2G9ZA 4GT1A 3VPAA 1TAUA 2PRSA 3M2TA 1EP1B 2I3GA 3STXA 4AW9A 4PQEA 1JKJA 1ZYUA 3NT4A 2JRLA 5KNLA 4LJ9A 4U3JB 1J8YF 2UDPA 3EK2A 4H77A 2ALJA 2XGOA 2CNNA 3SK0A 2QUIA 1AKNA 3D7SA 2R1TB 3LBNA 3VKHA 3W2TA 3NDIA 1UK7A 2GNPA 4NK5A 4TV9F 4WL0A 3P9CA 4QUKA 3RRMA 3OSZA 4FXPA 4MR8B 3H2BA 1Q0SA 5FHQA 2E4YA 4MUHA 5FPPA 2PUBA 4YA6A 4XA8A 2RC6A 2BBWA 3PP8A 4LYFA 4FFPA 1ONOA 2Q4RA 2DHDA 5ICSA 3HDJA 4XOIA 3K1YA 4XUGB 4D80A 3FDFA 5BURA 3FLMA 4B76A 1IPEA 1ISIA 1MB4A 4JYMA 5BRNA 2RCYA 3LAWA 5AKYA 1O3YA 2VNKA 1N5RA 1JPJA 1NZDA 4BRWA 1JH9A 5JFOA 4GR9A 3L79A 3RRYA 3FNQA 4WOPA 1E1NA 1CY0A 3N3AC 2EP8A 4M22A 1ORDA 5B5SA 8ABPA 4OI2A 2Q8NA 5IN5A 2JLXA 5F7ZA 2CCKA 2BFMA 3AUXA 4TSFA 1FC0A 3SP1A 3A6LA 3L7MA 4ETIA 2GJSA 1VMIA 2P9CA 3W4IA 4CT0A 1JRLA 1FFXA 2OGWA 4PO3X 3VU8A 4BCCA 2CMDA 3QJYA 2OD9A 5F98A 4I6GA 1QBGA 2D4AA 2FW0A 4B0OA 3IHTA 4DRXA 3I9NA 3CZ5A 4L57A 5LQMA 1W48A 1PQ4A 1QM5A 4CMBA 3MBKA 3ZXIA 5AM0A 2Y0BA 2UYYA 1CULC 2VNIA 1XHFA 2F8LA 2QYTA 3QUQA 3DE1X 3VX4A 4ZCSA 1QHGA 2EZ4A 3I6YA 1VCNA 4BNZA 2OHFA 3OQMA 1RP1A 3FBGA 4ZOLA 3LOQA 3WSVA 3BH0A 2FRXA 4YRAA 4PLTA 1USVA 3S8YA 4L5BA 4P7KA 1EFHA 1FJ2A 5FYDA 2FR8C 2FPRA 3JQRA 1HDGO 4XOUA 5HKKD 1EFLA 4PZLA 1LGYA 3INNA 1KDVA 3K1TA 4NCKA 5DHTA 4QLAA 4G25A 4MUNA 4RZUA 5J4HA 1W4RA 4XX0A 2XB9A 5HMLA 3I73A 1R0CA 1KH2A 4QUJA 2HH9A 2VNJA 1P45A 4J7XA 3P2IA 1ZMBA 4HQOA 2W2QA 2ZRIA 5JXWA 1PZNA 5HE8A 1GTL1 2FWPA 2NU6B 2ZKLA 3BF7A 2PYIA 4DKJA 1IBSA 4LWZA 1K7CA 1EVLA 1UMDA 4KGZA 2IH4A 2HBRA 2JVKA 4V02A 2GN9A 1ULBA 3QQ5A 2HA3A 1EK5A 1HTWA 1XDDA 3M6XA 4KWIA 3TAUA 5B1YA 5IJ9A 3REOA 1YJBA 1CR4A 3AJ8A 3HP1A 4AB1A 5IMBA 4N54A 1PZXA 3I01M 4N3BA 1WDTA 3P2EA 1CUGA 2F59A 4OQXA 2Z8YM 5MN5A 4MRAA 1OWPA 2QP3A 3PYXA 3E5MA 1YJXA 2HSJA 1R0XA 4UNRA 4AJ1A 3FAKA 1RADA 2EP5A 1VKRA 3HEAA 3S8EA 1O7JA 1YCFA 2JL1A 2NADA 4KXWA 2ZB3A 2X0IA 3DQZA 1ZLYA 4OF4A 4XVQA 5JPIA 1WU7A 1Y1LA 4DLZA 1GTSA 1UANA 1GQYA 2AW5A 3G2MA 1BKSB 1XCOA 1Z3CA 3LY8A 3ZE2B 1Y8QA 3GGGA 4JUCA 4OBEA 4GMHA 1QG6A 3BHIA 2CK3D 1G63A 4GI1A 3KETA 4WZAA 4RTSA 1F14A 4OXKA 1S2GA 3B1KA 2P2ZA 4UEWA 1C3XA 5JH7F 3RSSA 2ZSAA 1YXMA 2ODNA 3LL4A 2Q6OA 3IV6A 5TF4A 3D6MA 3SQLA 3TGWA 1LBQA 1CZRA 4P4TA 1UWCA 2EKZA 3LPCA 3H18A 5ADHA 5LP6B 4I3HA 2KLHA 5FWNA 2HWUA 3EXG1 2ZIFA 4ND3A 2HA0A 3DWEX 5BWCA 2P27A 4P08A 2Q5CA 3FDZA 4Z49A 3W3AA 2ILVA 3UEOA 3NHMA 2F1OA 3C8MA 4N5HX 4D45A 1NN0A 1TW2A 2P2DA 5T3UA 3LU1A 3I9FA 5BYJA 5IK2A 1TOAA 2WJ4A 1NJGA 2Z2YA 4UZFA 2EGHA 2WWXA 2M6KA 3CYFA 4ZGGA 5BW8A 3A4VA 2EFCB 1PGJA 3V2UA 5MN4A 1YRAA 1ECJA 1VLJA 4RVCA 4K9QA 1G8GA 3VC1A 1DI0A 4L95C 2B98A 1R4NA 1W5FA 3OT1A 3PL5A 5FV4A 2QSUA 3DDCA 4EK9A 4CM4B 1MRSA 5DM70 2W8BB 1FPMA 3FHCB 1Y5NA 2E4WA 3A1WA 4ZQIA 1P8AA 5KUTA 1Y3HA 3Q40A 1DAIA 1SHUX 3JR7A 4KQHA 1FS5A 5A4FS 2F3SA 3PICA 3KB8A 1NUTA 2XNDA 1P74A 3E4CA 4GZLA 2FPPA 4LWQA 3KJHA 3TTVA 2Y77A 3EW7A 3PDWA 4O2AA 5KWEA 4NBLA 5FOUA 4MW4A 5IKEA 1DG3A 3LO5A 3RUEA 5FV7A 3VDNB 4BP3A 3TQQA 3NM6B 1VP3A 3TLZA 5DM60 4UEJA 1JR3A 3L6DA 1DT3A 1FMTA 2JW5A 2R8EA 2XVYA 3LV8A 1NM5C 1B6TA 3DMHA 1DTSA 4LJLA 4DDWA 4ZI7F 1NVVQ 1FDSA 3MJTA 4J0FA 3I34X 4UVIA 2DG2A 3E9QA 3VO2A 1GWNA 2EZ8A 4F5YA 4IJ6A 2PKXA 3IP6A 2RHCA 3QHAA 1H8ED 4NLLA 4RE6A 2ONZA 3S68A 2CB0A 4JXZA 4L4YA 3ACBA 1P77A 4YV2A 4E7OA 2R7MA 4BATA 5DEIA 3WSWA 4D9IA 4JI4B 2QTWB 4PXYA 2D06A 4WXPA 1T29A 2BM9A 4EW3A 3WBFA 3TCXB 1BFDA 2GEVA 1R8QA 1KI2A 3QNUA 5JROA 2Q2VA 2QORA 1IN5A 5LP6C 1A69A 1VL0A 4UFNA 2BZSA 1MO4A 1L3CA 5K1ZA 1TXGA 3CRQA 3RGGA 3F49S 3TMKA 3V2GA 3PPXA 4F2GA 4KPEC 1PR1A 3SC2B 1U7PA 4KBYA 4FQ8A 1MH9A 1U28A 4DPMA 2YMMA 1F6WA 2IEDA 5IHXA 4AL4A 1XTQA 1UF9A 3PWSA 4XFJA 5AJZA 2VWHA 3EGXA 1M2GA 3TIIA 5JYBA 1BVHA 3E3MA 1K06A 1O87A 3DL7A 4ZVRA 3K0FA 3UV7A 3ZDZB 2FK8A 2BFFB 1XZFA 3DW3X 3HFGA 4K8OA 5D7NA 5HIAA 4W7IA 3KPUA 4BGDA 4BLUA 4S1OA 2GBPA 1RPAA 2Z3ZA 2IVZA 3AI3A 3PHJA 4OTZA 5AJWA 1OFTA 3STHA 3UAGA 5KYXA 1KSFX 1ULSA 3K35A 3CEJA 2Q0QA 4L9WA 4WKBA 3UHFA 2VQDA 1OPXA 5DX8A 4LV6A 3DAYA 3P97A 1WB9A 1IIRA 2O50A 4JVOA 4M83A 1FRNA 2ADFA 4LE2A 4ALJA 4EOGA 4YREA 4FFBA 3PFFA 1G17A 1HY3A 3IE0A 4IDEA 5B6PA 3O2SB 4Z4FA 2HQSA 3T1HB 1E6CA 4XD7A 1CHNA 2HM7A 3S99A 2XDYA 3FJOA 4WLFA 1E7SA 2R60A 5JCXA 2EHDA 4N5MA 2IF0A 1XLTC 4Q7JB 2ZI5A 4X44A 2HCBA 3RU7A 5T8KC 5F7XA 3WWPA 2AQHA 3C14C 3DOJA 3HGMA 3HI6A 4TTJA 4Q3AA 5LB2A 5GZ3A 5U9CA 3ET5A 4BQQA 2CXSA 5FD8A 4XTRA 3ZJ4A 4AZSA 1RJEA 2GJAA 3DFMA 5AVUA 1U2GA 2ZG6A 3EGVA 4OUKX 4EF6A 3WB1A 5AW6A 4Q1AA 5DBHX 4BAZA 2QD2A 3AHIA 5L3QB 4TWBA 1E69A 2IDZA 1EVJA 2QF7A 3EAQA 1Y8RB 4TXNA 3H75A 2IP2A 1YT5A 1U1DA 3QXCA 1UFRA 4ZOCA 4JUFA 5BMVF 1M5RA 3CX4A 5A7HA 4PGFA 5AMXA 2ZJ1A 5B55A 2C3YA 3DO8A 1F0YA 2H1CA 1UM8A 1AGXA 2BC9A 4KQIA 3WKEA 5K9ZA 4XQ0A 2G1JA 4KUGA 4Z6KA 8ATCA 5LP1A 4IYJA 4P3YA 1NNI1 1UXJA 1ZH4A 5AUQA 4LJ7A 3KZXA 4CXMA 1FE8A 5ARCA 2JLYA 1FLDA 5HK8A 3GU3A 2HT6A 4NOLA 4RLHA 1XTJA 4Q1FA 4MV8A 4TTSA 1GVNB 1O6FA 3KD3A 1G5FA 1QO0D 5JALA 1X7WA 3GCGA 3JX9A 3DE0X 4NFSA 4QHTA 4D4GA 3FTNA 4EYGA 2JFZA 3PX7A 4WY2A 1V1JA 1NUAA 4LVOA 3WL5A 2ZYAA 3TE6A 2VWGA 1XL0A 4LX0A 3D9QX 1IXKA 3T5BA 4A0QA 2ZRHA 3KJGA 2X1VA 3K6SB 4ALIA 1GPLA 2I5PO 3OFKA 2XWBF 1P73A 2OECA 1NQAO 1DXOA 2Q7XA 2FY8A 3QPUA 3R0VA 4UDYX 4D8YA 3ZE0B 2WEKA 5B1DA 3A6JA 1I51A 3D31A 2QN9A 3FIUA 2ZT8A 4YMLA 1ST2A 3URMA 1TM5E 4Q3LA 3UAZA 4C0JA 5TSDA 1U2EA 5BYBA 4AJHA 4LF7B 2OO5C 2ZBEA 1NJ5A 4QXQA 1DQSA 2AOTA 1N7GA 5AOVA 4ZEXA 4QDOA 5K0GA 3OJFA 4PHHA 2ZM6B 3MCAA 1R9GA 3ISTA 1QQ5A 2A58A 2KJQA 1E9CA 2CUKA 3KAPA 2BHNA 2UZIR 5DI3B 4ZT4A 5FOQA 5JVDA 1DMSA 2Q9BA 1FDWA 1T6ZA 1W59A 5LOVA 2VHCA 5THQA 4MGEA 5GOZA 2QSYA 3ICWA 3FCSB 1BMFD 4FBLA 2PJZA 3F2IA 1JS1X 1ADCA 2JEZA 3AG6A 3KC2A 2XDAA 3MJDA 2GAIA 4YT4A 5E4TA 5CD1A 1Z83A 4S1VA 5HFNA 3RAFC 4D5GA 1OXSC 2GUWA 2PM8A 2SCUB 3HKEA 4RHCA 4Y1GA 5G3YA 4ADSG 1BW9B 3Q5GA 4ZC8A 3VMMA 3EGDA 3WDMA 1GPWB 1IATA 3K5WA 1UJ6A 2EYQA 4FBGA 4QECA 1I0LA 3V55A 5JQGA 1SPBS 1VI2A 4XR9A 4MCAA 3AFHA 1E61A 1GUYA 4ZHQA 3MM4A 4MQMA 1XZIA 1ZK3A 2LBPA 3D6HA 3DVAA 1B8NA 1TJ4A 2X3UA 3GDGA 3GFGA 3L7BA 4HEJA 4ARZB 3ZE9A 3CZMA 3MQFA 4EFKA 1TM7E 2DQYA 3TW8A 3F5FA 4HUTA 1VYVA 2DEUA 3TQIA 4TMTA 3V8RA 5T6MA 2CJWB 4QUEA 2R1ZA 2ZJ6A 4DV1B 5E1MA 2YJZA 5EIXA 1UMBB 5JZOA 3CRNA 2E9SA 1ZH2A 1DWOA 2QTLA 4QM7A 1ZNQO 2BM0A 1SHTX 4X94A 5ALKA 1U7ZA 1ZSYA 1X8KA 1R18A 1HKUA 4PX5A 4QXRA 1L5HA 3RC7A 4BASA 3WYAA 1FUUA 5LZ4A 2B1IA 1E2KA 3EF0A 1AD2A 1M3SA 3GIDA 1U5BB 1JEYB 4CQNA 3LX5A 3IUSA 2RGDA 3KB1A 1JYEA 2PBFA 3HACA 3IQIX 5B3LA 4YMHA 5AVRA 1G3UA 2AG1A 3DMTA 4MR7A 4PR3A 4HGRA 4B82A 2GCOA 2W93A 5I4KA 2E5LB 4K9KA 1KVTA 1EVKA 4ND2A 4WN3A 3FWZA 3U7QA 3GLIA 2J85A 1ZI8A 4J0QA 4IBOA 4R3NA 4R7TA 3OPXA 1H4SA 3H8VA 4MNTA 5ITZB 1DXHA 3LYHA 3K6KA 2Q4BA 4MIOA 2XQIA 1P5ZB 3IEVA 5EGSA 3F6BX 4E4YA 4IJQA 5D5QA 1MAUA 1GTRA 2FZGA 1MAHA 2X3FA 3AEXA 3BFKA 3MIZA 1DEAA 1RCTE 3G0CA 1PT5A 4H27A 1JEJA 2VUIB 4GGMX 4E5KA 1UM9A 5E0KB 4V3BA 3SU8A 4H16A 4BQPA 3D1VA 3SJCA 3PEVA 4PCVA 4KZPA 2XEXA 1XN4A 4JR1A 3VAYA 2VDUE 2QP9X 5DYWA 4RVDA 2BEUA 5P8WA 4XWKA 1B00A 4KWHA 3KKLA 1E3DA 4WLNA 2V6BA 2VP0A 2CFRA 5FT9A 4DA7A 4E5DA 2LNDA 1NXQA 1LI5A 1VG1A 4FIDA 4M3NA 2R00A 4KP7A 3O8DA 4JQOA 4KAJA 3BIWA 3TLXA 4R68A 5DRTA 4C0QC 3B82A 4FI3F 4MA5A 2IPMA 1VPWA 1X70A 1KGSA 4JI7B 2O59A 2IH5A 3KTAB 3QVSA 3OD5A 1RJ9A 2HB6A 3E1KA 4FDAA 2VDLB 5FO1A 4OKIA 5AKEA 2AN3A 3R0IA 4ZO9A 5AM4A 5K8JB 4RH3A 2WSIA 1NUSA 2GEFA 3HDVA 2PT7A 4J29A 2M1XA 3FB4A 4XX1A 3CE9A 3HI4A 4GQIA 1CB0A 1PJ4A 3QW2A 4QYIB 5L7TA 1M10A 1HZZA 4NK4A 1T0UA 1I24A 3CU5A 3I9V6 2C2BA 4ZIRB 3ANXA 5C1PA 1V2HE 4AMZA 4UD6A 1L4MA 2FZWA 2ID4A 4Q4HB 1H93A 1AK2A 2Q2QA 1D4ZA 3WWEA 1UJ5A 3ICOA 3OX3A 5COQA 1QB8A 5J1SB 1IOZA 4H7FA 1SR8A 5EGNA 1UMKA 5K8VA 2VFAA 3TZKA 1Z15A 3D6JA 1GA1A 1HRKA 2AMVA 1Z7GA 2IYPA 5JWRA 2B61A 3W5JA 3VOBA 5AW1A 1DRKA 1XV5A 1D9ZA 3LPNA 4LZWA 4Q82A 4IIFA 1IU9A 2FN7A 4N6NA 1KXJA 1N0WA 10MHA 4K9DA 1HFKA 1KP3A 1R6BX 2XCIA 4R1SA 4RGBA 1WDLA 1K8XB 3IP1A 4D4JA 2O3QA 4MWOA 2NPIA 4P36A 3IT3A 1QG2A 4RYDA 3PE3A 4Q6BA 1J1ZA 1U0NA 2JGDB 3M7IA 3ZKAA 3JAWB 1DEXA 3SFZA 1P2SA 4QWMA 2DBVO 4JQZA 3CLTC 3O9ZA 4JA2A 1VDMA 4J7UA 1NBOA 3C3KA 2UYCA 2FWJA 2A5LA 4R8MA 5IAAA 4DUYB 3O8CA 4GC5A 1C50A 3TKYA 1OVGA 2VO1A 4B34A 4LFCB 1L7AA 3C3BA 2WW8A 5AVQA 3QBEA 1E2JA 4Q4DA 3AB7A 4EHBA 4EHIA 3DWGA 1G8PA 4DR5B 3C45A 4RMJA 1BHSA 1PTJA 4V0LA 3LLCA 1NBAA 3LQRA 5ALGA 4ZC1A 1U0BB 1H8HA 3I45A 3PQ2A 5DLYA 3WLQA 2HQBA 3GNTA 1FDIA 4NFHA 1P1JA 1CJKC 2H17A 3K5HA 5KNCD 3NKLA 4YPVA 1CEXA 1TA4A 3UH0A 4RDIA 3MS7A 2HX1A 5DM4A 2Q5EA 1LSJA 1Z74A 2IE8A 3UNXA 3ANNA 4CE6A 3U17A 4GOXA 3MJEA 2O0JA 5FPSA 4S1PA 5JWOA 4FGJA 4YQYA 2JLZA 1WUHS 1PD1A 4B73A 4YRCA 5B37A 5BSEA 3BYZA 4N3GA 4TMZA 2DHEA 4JJKA 3O47A 3A6GA 3RYIB 3MTGA 2MSKA 3MPUA 2HGSA 3IA2A 4J90A 2Y3IA 3NMUF 4DARA 3LY7A 1GIAA 3TMAA 3V1YA 4YFYA 3OPVA 3IO5A 1E2HA 2GQ0A 3F7MA 3IODA 4ZVPA 2BE7A 1KZGB 4XDHA 4PRKA 1L5GB 4TKVA 4YRBA 3CCBA 3ZWAA 1F0KA 2FSVA 1W7AA 1ZNZA 4D8UA 1EFVB 3JATB 4M1TA 2FPUA 1RWNA 3UUGA 5K3SA 1W29A 5JXGA 4FFSA 3RIYA 2DY1A 5K3BA 4BBPA 2QN1A 3KU1A 1QE5A 4S05A 3IAS6 2DR3A 4W9NC 2D2IA 3CNOA 5IC5A 3W6ZA 5LIPA 3WAGA 5GONF 4Z9XA 2CXHA 4Y3UA 1LK0A 1ZNXA 1XRRA 3LDAA 1NQTA 3NHLA 4D0SA 1BVUA 1VTKA 1PQWA 3WYGA 2QW0X 3AFOA 3V4PB 5ENDA 4NBNA 4ENVA 5TT0A 4AXBA 5JSKA 1KS2A 2YNMD 4JUDX 1P4JA 2H92A 3UFXB 1KDRA 2O5VA 2YIMA 5EMJA 2P5SA 3DC7A 5FCDA 3L8EA 5CYFA 4O4HF 5G1NA 4D4KA 5J59A 1P5RA 3AFIA 4C01A 5B58C 1OTYA 1I1QB 1W2GA 2AQ8A 4BLOA 2X19A 4KW7A 1HG1A 1YZUA 1P7WA 4JKOA 4MQBA 2AUNA 4K40A 5L4SA 3P0RA 4LDRA 1XAIA 3EVEA 1JMKC 3SLRA 1C0KA 2IIBA 4OLFA 4RJ2A 4X9XA 3W6UA 3MJSA 1H2FA 1Y3CE 4G3XA 1XXHA 2C5BA 2O1EA 3TINA 2FMHA 1JLHA 2WU8A 1K8QA 3IIJA 3V9AA 3M8KA 4D43A 4XYBA 3OHMA 4XIFA 1DINA 1O9GA 2GPTA 2O2HA 3MCZA 4JN6B 3T95A 2ZXEA 4QNRA 2ZW9A 3PC4A 1XRSB 5GZ1A 3RQSA 3E8XA 3OH8A 4DYHA 2OCGA 2H7YA 4F7DA 3OZAA 1PFGA 2A35A 1QFXA 1M9NA 1MIOA 1JE1A 3DLTA 2XWPA 3KR0A 5AI5A 3I9MA 3Q9LA 5FYQA 5TMDA 3TSYA 2PZKA 3JARA 4EX7A 3OTWA 4QU9A 4HDRB 3O21A 4TMFA 3L8YA 2GKOA 3I1IA 3LHSA 1WY7A 3IDOA 3W1WA 2VK4A 2H4HA 1TIBA 2WUEA 1I1HA 3HV0A 3I2GA 1NUPA 1JYFA 2AG8A 2C9DA 2TYSB 3GEBA 4R8LA 3AUFA 5H3HA 2HU8A 1EXMA 2ZANA 4JEHA 3FUVA 2XWSA 3UMSA 1F8YA 4LRTB 2DWPA 3GK3A 2EQBA 2IITA 4GI7A 5LA6B 2HRCA 2WD9A 1O8CA 1H94A 2OPBA 3DULA 1F5SA 1KI6B 2Q6LA 3HU2A 2NACA 2XE7A 4ZAXA 1G8AA 2GLTA 3KV1A 3PLNA 1JSCA 4HT3B 2EG5A 4U7WA 3PENA 2B20A 3DBLA 4XWWA 1IXSB 4UEKA 4AX8A 4MKFA 4CT4B 2MCFA 1Q19A 2ZSBA 5FUWA 5JV5A 1IJFA 1FYXA 1A7JA 2NVUB 3L1VA 2J0EA 2R84A 2QJRA 1Q11A 4OLHA 1BIFA 2GTPA 4BMVA 5JPCA 3TH5A 3BIFA 4U6QA 3S7ZA 3FB1A 2FEMA 3DQPA 2XDQA 1XRLA 4GPIB 3TD9A 1SQ6A 4X41A 4C0SA 1WMBA 3PXUA 3UB4A 2NSLA 1JBKA 1GQQA 1YI8A 5DNDA 3TS1A 4DRZA 4ECEA 3CVVA 1U3UA 3MINA 2F8TA 4WKNA 1Z0IA 2VT3A 1BX3A 2ZWOA 4RFVA 3IBGA 3T3PB 1UOQA 1T0JB 1WUJS 3CRW1 4RULA 3IP9A 4KACA 1NQVA 4GVXA 4KH0A 4ZYLA 2GZAA 2PKQO 5FOWA 4L5AA 5BN3B 3X1KA 2P9QA 3UAWA 4MQFA 2ORYA 3DAFA 1ZJ6A 4FZRA 3VTKA 3PNSA 3PD1A 5FUVA 5HFJA 2J9FB 3OJXA 3QJGA 1E1KA 2RGEA 2IYAA 4OKNA 1ZHHA 1INLA 1CR1A 3GI1A 2GPYA 1X38A 2H0RA 3OE7D 3SR0A 1YI0A 1Z29A 1LS6A 1OH5A 1WF3A 3HYTA 3E3AA 1V11A 1RQ2A 3AL0C 5HKKA 4B32A 3LHIA 2BKXA 2P6MA 2HF2A 1FLAA 3E7FA 3N2ZB 2FMKA 2GT1A 4EEKA 2H1LA 1YFKA 1OLXA 1LVHA 2GVNA 1Y7HA 2R7NA 5GM1A 5JE8A 1YFLA 2YDYA 3ZK9A 1EINA 3D3WA 4UHJA 4GL2A 1EM8B 1KEZA 2EC5A 1ECCA 3CH7A 4PSAA 1OASA 3RWMB 4U2DA 2A0UA 3B3JA 2OV6A 5A5FA 5D00A 2R97A 5M2QA 2CZQA 2WG0A 2XECA 5IJWA 2KWIA 2HUNA 1QAQA 1E4EA 3FMGA 5K45A 1ZITA 2D00A 5I4CA 3ML1A 4XWYA 1H2WA 2Q5IA 4RUKA 4M1YA 4ZVUA 1GQFA 3PNYA 1P2DA 3KSBC 3ZV4A 1TCCA 3NWBA 3WRXA 1O5TA 1HLFA 3FCXA 1C4KA 3I04M 3M1IA 5MDHA 4HAYA 2R68A 2R5NA 4KXQA 3BH7A 3WXMA 3L4EA 4JLUA 3GJTA 1GGMA 1E3TA 3ZVLA 4OHUA 3CXUA 4DR2B 1KYZA 2O2XA 2YOFA 2FE4A 3BD6A 3HXLA 1AXGA 3O26A 4LC9A 4R1OA 1EUZA 1Q1QA 1BSVA 3ZGZA 1X7ZB 3O84A 4N7RA 4MROA 4PQFA 3DUFA 3N75A 3UJAA 5DGIA 5F3WB 5A02A 1H2HA 2VNAA 1WDWB 3JZAA 3O31A 3U3DA 1YCGA 3JQ9C 2RHRA 1VGQA 2IWRA 1Z0UA 3QF7A 1JIVA 5A2GA 2ADMA 3G2OA 2CMFA 2CK3A 2YX1A 3JZDA 4C7XA 3R5SA 1NKTA 1V6CA 2O0KA 5CLGA 1Q5PA 1Y1TA 3VR4D 5IXYA 1A1SA 2MYUA 2AYXA 4DJ5X 2HU2A 4LFBB 3SYKA 1D4OA 1IRXA 2AYZA 2WJWA 1YZLA 2W6QA 3W2IA 4AIIA 1XMQB 4JC4A 3FYHA 2EW1A 1M2KA 3A27A 1J0DA 3GLHA 5C8VA 1EWQA 3TGLA 2A1TS 4Z9AA 3KUXA 5HRCA 1L7NA 1EYZA 1V3VA 3JQ8A 2AR7A 4CM7A 3DBIA 4KIWA 1TJ3A 4NE2A 5FR1A 5CFOA 3COVA 1KEEA 1YFJA 1OFUX 4HN4B 3E15A 2WJJA 1P6QA 5TQVA 3VV3A 5DU2A 1CQWA 4JJFA 5FBRB 1X7XB 4FMBB 4AY5A 5EJAA 1QOZA 3TNDA 4IOLA 3ECCA 4ZT3A 4LMAA 1GL6A 1LQUA 2IP4A 2VTVA 5TEWA 4B4WA 3QKSA 4HJXA 3VR0A 2MINB 4IHJB 1QGUB 4IQ4A 4NV0A 5E95A 2FF7A 2WWHA 3RWBA 1CQPA 1TO1E 1AOXA 5IAOA 3QUBA 2BFEB 4MV5A 3P4YA 3JQFA 3GB9A 4Q3CA 4S35A 1K7XB 1UK6A 2F7SA 2Y1DA 3IX7A 3T4XA 4M7OA 1ZJWA 3BAFA 3H17A 1HDCA 3AO0B 1KJIA 1RC8A 4EUHA 2BY4A 3Q7RA 2ACKA 1D4AA 1LPOA 1NASA 2P9ZA 2ZPUA 4OJTA 4W1PA 4ZVTA 3AF4A 4F71A 2I66A 2DY0A 1XCGB 3IQFA 3KB6A 2W2NA 1YR6A 3LQ4A 4L4XA 1SUPA 4EI8A 2G9UA 1AKQA 1J0EA 1FRFS 3NBFA 3ZXXA 2YXDA 3P4XA 3HM9A 4JITA 4D96A 3IEXA 1QWSA 4RDCA 4C6HA 5CIYA 2P9TA 2IUFA 2RHBA 4C5BA 4G4IA 1E6WA 4PAGA 1Z8FA 2AL7A 5IUKC 5EJEA 2PVCA 4UEOA 1XWIA 3B9RA 4FXOA 1JEQB 1PBTA 2J09A 3MTQA 1I33A 3LM8A 4NP6A 4DM3A 1JSZA 2ILTA 3V1NA 2JFOA 2VPYA 3CY6A 3LKZA 4WOBA 4PBSA 5EHZA 1PYOA 1H8EA 5M34A 1QPZA 1TIPA 1WNTA 2PT9A 3HV2A 5BR8B 4ZJUA 3DLCA 2I9KA 5AJYA 4BRUA 5IKOA 3LY5A 4OI1A 5C8XA 1QIIA 1SC6A 1JDNA 3K3PA 4HNSA 3H5OA 1T0PA 4LQCA 4EJSC 1H2XA 3LFTA 3D8NA 4QX6A 3FUUA 1USIA 2LVBA 2VUHB 3QNWA 2IHVA 4XM2A 5JD3A 2LW7A 2PPVA 4RCYA 4YAWA 1DOHA 3TD2A 2PZGA 4CLXA 3L8GA 1IN6A 5BSTA 3WIDA 1WB6A 3RAJA 3GRPA 1G5PA 5CA1A 1U5AA 4V3CA 4WNAB 2UXDB 2V1XA 2CVFA 3K0AB 3CB4A 5E0OA 1TT5A 1FXWA 3NOXA 4P3PA 1XDUA 3LXMA 1XU7A 1L7QA 5EWJA 5H81A 4UCWA 4O2BF 5WRFA 1C30A 4H7DA 5KJ6A 2G71A 1Z0FA 3LPDA 2PTGA 3Q6IA 2O8BA 3I76A 5A0TA 2Q21A 1QS0B 3OQJA 3SDZA 1Q0QA 3PCRB 3P9PA 3PQ5A 4EG0A 1ODIA 3TR0A 5IT5A 1FP1D 4ESEA 4WFQA 4LV5B 1DJQA 5EQTA 4X3PA 1KVSA 3OZSA 4CEIA 2E49A 1JZSA 1TFRA 4F0JA 2Z9DA 1O0SA 2L17A 4DAEA 2IOQA 3ZW8A 2AVNA 2XADA 4NZOA 2X15A 4CF5A 2P3OA 4ID9A 5FWAA 3GGPA 3I28A 3U7RA 1PLKA 1WU8A 2ZUVA 4D8XA 5CXXA 3CA8A 2HI0A 4QL3A 3I37X 1EDZA 5AHRA 3EIHA 1YE5A 1EFPB 4HTFA 2MSEB 4E09A 4F92B 3QKTA 4EAQA 2A5JA 3F5DA 1HA3A 4ZVLA 2NO0A 1O6BA 4LF6B 2ZI7A 5JMWA 4PPFA 4K1LA 3P20A 5LYJF 1RI4A 2R6ZA 3WYCA 1CRPA 3IPRA 2J41A 4UVHA 4OY3A 4ND8B 4X95A 1MEJA 1MAAA 1OC4A 3FTQA 4NZYA 4MCJA 5D2CA 3LVQE 5EPUA 1KOLA 3KQPA 1O96A 2B78A 3ECAA 4MWBA 3SLKA 3IT2A 4FONA 4H7PA 3U6KA 4BU0A 1K5DA 4US1R 4P3OA 1F38A 4KWCA 2OL4A 4R2HA 1TMKA 4KHZA 1ZIOA 2PR2A 4FGZA 4DNQA 3BERA 1UAAA 3VSDA 3ITNA 5CVVA 2BRUA 1V2GA 4BE9A 3E27A 2O1SA 2ISQA 1PQPA 1RC0A 1E20A 4RORA 4DY6A 3SS9X 4PZPA 4BNDA 2Q4DA 4MW5A 5JLAA 2IXDA 2WWTA 3X43A 1TGVA 4MV6A 3ZWOA 2C2YA 1BOFA 1W52X 1RI2A 2GTHA 1O6ZA 2OC9A 2P5YA 3KK0A 4ERXA 1J25A 4UTOA 4WA7A 3LE8A 4FFRA 3SZLA 1ORIA 3LHDA 1DIRA 4ROSA 2I99A 5J4LA 3LUFA 2WFLA 4NYJR 4Y1EA 1QO0A 1JA1A 2Z2ZA 3Q10A 1O97C 4IF4A 1OAOA 1X42A 1W5TA 2C9MA 2XMQA 5D3QA 3SCZA 4ZI7A 3L4JA 3BQ9A 2YWGA 2CLMB 4RY9A 3ZEAA 4CR7A 2XF8A 4JQYA 2PUTA 3Q0EA 2YN4A 2K2WA 1RCFA 3I4CA 3ELUA 3I30X 2I4OA 3S1AB 1YIDA 3JPYA 4BLTA 2R7KA 2BEWA 3FWKA 3M3DA 3ZDCA 3D3EA 1DAMA 4QA9A 1YU9A 4GKBA 3UM9A 1XNQB 1YZGA 5ALOA 4YP7A 2PL9A 1UFKA 4YXWD 1R4ZA 4GS5A 2NXWA 1V3QE 2DBQA 4IO0A 4P1ZA 3VC3A 4A6EA 1UL1X 3T41A 1DGQA 1JV2B 3QLUC 1CUHA 1QGED 2QY9A 4C4PA 1NWCA 5GTDA 4L28A 2JAXA 1N3BA 1ZISA 4X45A 1GNQA 1PR9A 1ZR2A 2IXBA 3G8AA 3W5CA 3C6MA 1NWHA 5J58A 1V8OA 3A37A 2MSLA 4Q1VA 1XR3A 3QLTA 1RQRA 1I7PA 5GINE 1Y34E 4D1YA 1VKNA 1SUCA 3CRMA 3ETNA 1KPHA 3H11A 1BJKA 1H66A 1TJYA 4I8DA 1S1CA 4EEZA 3RTGA 2IDJA 2DQZA 4O6VA 5CEJA 3IQXA 4ZZIA 3PC3A 2CMKA 1BRMA 2OO3A 2PQ2A 3CSUA 5LDDC 4DLLA 1TRHA 2AEFA 2QRPA 4RPCA 2A78A 3U9SA 3WISA 1X3LA 4TYYA 1BMFA 5AK3A 3WWYA 4ZPJA 3EISA 4UBMA 4GYWA 4H9GA 1MEEA 4I7EA 3W4JA 3LCJA 1FTQA 2PH3A 2QUJA 4RK7A 5HTOA 2XMGA 3G8DA 3T1YB 1OI3A 1RXCA 4X66B 4Z7OB 3LT0A 4A8JC 4CF4A 3GJYA 1YR2A 1HETA 3DOCA 4MW1A 1LW7A 1J8FA 2HMWA 1VRVA 1MP0A 4FD2A 1IZ0A 4BKOA 1ZJJA 2VWPA 3EDQA 3QHPA 1A9RA 3NVAA 3KSUA 3ESXA 3ZWCA 1J97A 2JBAB 3MZ0A 5KNBD 3LUHA 1VSUA 5FAXA 4NDZA 2I7DA 2VZ0A 3VBCA 4PXAA 4EJ0A 3G49A 3GX1A 3SR3A 3MRVA 4LNUA 3GJXC 3ROKA 4DG9A 1VG8A 3C3AA 2EEZA 1D7OA 1US8A 2AI2A 3JWIA 3SMQA 1ACJA 1GD1O 2PX8A 3DZCA 4M0CA 2PZMA 4QYSA 4BO5A 4E11A 3JQBA 4YUYA 2SICE 3KSAC 3C6BA 2QTVB 5EWLA 1M2FA 2P4UA 3L84A 4CTKA 3DE2X 1OXMA 4OGFA 2BGGA 1S8AA 2AF4C 1B16A 3BTOA 3Q9NA 3AIIA 1UAYA 5K3DA 1XFAA 3W5HA 1P4HA 2GOYA 3F67A 3RVKA 7ABPA 1VL2A 1YE8A 5BMVA 4OK3A 1AIPA 1DMRA 5JYCA 1CYEA 5EJMA 4ENUA 3N7AA 1UBOS 4QHYA 1XJ5A 5FFFA 4BRSA 3PSHA 3R3JA 3QEAZ 1O1YA 2XNCA 4Q01A 2VJKA 2WSYB 4R8RA 4CFSA 2HWKA 2BBOA 4F5WA 4EJ2A 1Y6FA 4PRYA 3KXIA 5FUMA 3A36A 3LH5A 4P2GA 5ERYA 3ZCQA 4TPKA 4FMCF 2NUTA 3RSHA 4QOFA 2AFRA 4CQMB 4QGBA 1TAGA 1MBZA 4XFKA 4HUQA 4XWOA 1CUCA 1G2PA 5HIJA 3UXEA 4OQYA 2V8BA 1GGNA 1UBTS 3WQBA 3SYRA 4B3BA 1U3DA 2PGAA 1GKUB 5FA5A 4P84A 3PS9A 2Y71A 4G26A 4DXAA 2JI9A 3EIOA 1VLQA 3AEKB 4L0QA 1N77A 5JIBA 3H2JA 1GZUA 3NHSA 2QTRA 1T4DA 1V5WA 2C97A 4UBJA 3A2NA 3H5VA 3NW9A 4B6SA 1Y9AA 3CLVA 4N6OA 5IJ0B 2RHOA 3JASA 2JLUA 3H7AA 4QUAA 1B0ZA 1JTFA 1KOGA 2ODWA 3N7TA 3CCFA 1UPXA 4YAOA 2BV3A 4CVNA 1B3RA 5CLLA 3WBKA 5CG1A 1ZQ9A 2EJTA 2FMIA 3T7EA 2WF7A 4E5SA 1J90A 2R62A 3B7PA 4EVSA 4YC7A 3T9EA 3MMZA 4EY3A 4NBVA 2XAUA 3ED5A 1YL7A 2CFCA 3IEUA 4O4LB 3IKJA 1CUJA 1QYDA 1U9JA 2BUCA 4ZT2A 3W7AA 4NMMA 1AQ6A 2XB2A 1Z68A 5REQB 3UUEA 3D7MA 2DPHA 3CJTA 4UBKA 3AKDA 1EVQA 4Q4JB 3S2ZA 3CVXA 4EB6A 5AYVA 1WSAA 3FYUA 1YUBA 4NZ9A 4XEUA 1S96A 3PIDA 1ZEMA 4Y1RA 2JGMA 2XT9A 2PR7A 4DCTA 1EAMA 1M2VB 2A9PA 1TKCA 2JAQA 1OHHD 4GBJA 1HDXA 3I01A 2AD5A 2GM5A 2IBMA 3K15A 2JC3A 3PR2B 1PJTA 4CGZA 4UCQA 2Z8YA 1TEHA 3MEQA 4N9WA 1JDPA 4UHCA 4HZIA 3T7IA 3TLMA 4BB6A 4RK5A 3VNRA 2CLLB 3H1EA 4IZ6A 1IWBB 3HE3A 3ZD8A 3PUYA 3VVLA 3KQKA 1XA4A 2CLSA 3OM0A 3A3YA 2O2ZA 5CVCA 2XVMA 2ZJ0A 4UFOA 2QTHA 1JI0A 1EGMB 2A7XA 2JJ2D 2WMNB 4XPIB 1I4DD 4DNPA 4I4TA 4URHA 1JEAA 2DTXA 4D9GA 3EGIA 3DMNA 1ZL0A 2QRNA 4E1VA 3JQPA 4D3YA 4CTJA 2PGNA 4K6KA 3PFNA 3ZTWA 3WBJA 4WW0A 3GH1A 3VI4B 1XTZA 3HDYA 4CV0A 3VNQA 4DQ0A 1PG5A 4CEJB 1T4CA 3HFRA 3H19A 4MVXA 4YCSA 5G4KA 4QM6A 2JCVA 3NTXA 3AI2A 1LSUA 2DTEA 1R3DA 4TSKA 4D9MA 4NL4H 1ZW1A 4UAGA 1A7AA 3R9WA 1QC5A 1O95D 4INPA 1GV0A 4RH1A 3HM2A 1UBFA 1RKUA 2F9LA 3SFVA 1M8FA 3K1ZA 2J9XB 1IY8A 1RE0A 1JFTA 1SVIA 4QZVA 3GGOA 5FULA 1XKQA 4B2LA 1OX4B 4OQFA 4M1QA 1PJ2A 4J1SA 4JQCA 5L3VA 3LQ2A 4U2BA 4X71A 3UO8B 4JASB 4NWIA 3BG5A 1E7YA 1TO2E 1OLUA 4KRXA 3RABA 2WNIA 4Z86A 3DCNA 2MOKA 2ODQA 3H97A 3HB4X 4OU5A 1FP7A 4GX1A 2EYUA 4DXHA 2YBDA 5BWNA 4YJ2A 1HQDA 3OX2A 1GOTA 5KNCA 1VL6A 3C8HA 3C85A 4FFVA 5ERGB 2IRWA 4GMDA 4W5OA 5K8UA 1RSZA 1LFDB 1DAHA 1FFCA 1MT0A 4CEHB 1TF5A 1HFJA 2ERCA 3PGA1 1OT5A 1ABFA 3GMTA 4OHRA 3U4HA 2WAOA 3PFHA 1PL0A 5G1OA 4DV3B 4D6PA 1X7YA 4MLZA 4O4JF 1GUBA 2BM1A 4KRFA 3VU9A 3C3EA 3V7YA 3VNVA 1U6IA 1J39A 4EKYA 4JMPA 4BNFA 3EZNA 4HPWA 3QMPA 1GPUA 3LGXA 3X1JA 5ADWA 4RS3A 1X15A 1JDVA 3QU7A 5CW2A 1D2NA 1ODCA 1BWSA 4RHYA 1GDHA 3CSDA 1REQA 5ECDA 5G0UA 2RCNA 3U7FB 4QUBA 3DZ8A 1Q12A 1XQ6A 3IT0A 4K8RB 2VDNB 3O90A 1G6KA 1ODKA 3MS4A 2FW7A 4MO9A 2OFFA 2O3UA 4DHWA 5BVGA 4I4CA 4MA0A 4U6NA 5ICEA 4AICA 1YKSA 5ELLA 3PU6A 3DEIA 4NBKA 5C8DA 2EERA 3F3YA 5CEEA 3H6HA 3ZI4A 3LK7A 3ONDA 3WMFA 4DABA 4JGBA 4G01B 3SZ3A 5A3SA 2ZXUA 4L5YA 1SN7A 1NN5A 2HJRA 3A8TA 5HRUA 2HRBA 4B3IA 3BHJA 1U2DC 3V4OA 3WK7A 4KX3A 4MIYA 1ZJ5A 3N2KB 2VPXA 5BSWA 2X13A 3QZUA 2HYIC 2WTNA 2E21A 2GHQA 2JARA 5HF6A 7ADHA 2XRZA 1J5XA 3KE9A 4B48A 2OLEA 1N9GB 1KKLA 1X8JA 2XCRB 2QTBA 1MTOA 3WRWA 2VXOA 4JBYA 4BXOA 2HPHA 1OFGA 2O2JA 2GB4A 4MWGA 5C8YF 4IUYA 3TXAA 1E32A 5LZ5A 4L0MA 1N1GA 4CPDA 2ETXA 3FFAA 1XCJA 3WY9A 4AZWA 5HIKA 5JU6A 3CLRD 2UYGA 2ZAGA 4CM9D 4DJDC 5CITA 2J3DA 3PD7A 2YFKA 2JIRA 4ABYA 1WX1A 1ES9A 3K71B 2WA1A 3SVTA 3KR9A 1OY1A 4UTXA 1ZIXA 2Z58A 3OY7A 2X7XA 4YRSA 5GPBA 2ZUCA 1DP4A 3UMVA 2P8SA 4LBVA 4M9XA 2PSJA 5DNEA 2ZYHA 1GV1A 3C2QA 1EFTA 2C4UA 4JSYA 5BSUA 2UU9B 4Q34A 2PZ8A 4R1QA 3R0ZA 1UP6A 2CFOA 2FN4A 4B81A 2NTJA 2Q3MA 1TKBA 3PDCA 2YJ5A 1XRPA 5DCWA 4L2IA 4M0FA 4HWRA 1CD5A 2GBLA 5ELXA 3V32A 4RIIA 4MS3B 3AM5A 4WBNB 1YBVA 2IC5A 3GOHA 3OM1A 2ERXA 2JIQA 4BCBA 1NPDA 3GLKA 3MWEB 1VP9A 4JI8B 1F06A 1SEPA 1NHGA 2C3PA 3D43A 4W82A 4PAWA 5BT8A 5FTKA 1JJBA 3CGGA 3KU4A 4K6CA 4MVJF 1WHSB 4ER0A 2WWFA 2ZB8A 3TZ6A 4JCCA 4NH0A 5AJXA 1A9XB 3F5QA 4WUVA 4CL0A 1C4OA 1ZAYA 2J33A 3BJMA 5K6TA 3LKBA 3C8UA 1QKJA 2HCFA 2UVPA 1DFHA 4XSHA 5DTQA 2EKQA 3D4OA 2M6LA 3S29A 4D02A 1NL3A 2FXVA 2IL1A 2OENG 4M0EA 4TWIA 5C5EA 3O93A 5IYZA 4LY9A 4PO1A 3EXHA 3TQSA 4XCQA 3S81A 1PZMA 1II9A 2V1UA 3RV3A 3WL8A 2WAXA 1OYYA 4ZTBA 5J23A 3UWDA 4ZTZB 3WK8A 5DT2A 1K7SN 3N2GB 2ZWVA 1IEVA 4M21A 2H1IA 2B6NA 3NRBA 4HMOA 3SOZA 5CA0F 1P4GA 1Q83A 1BXGB 4AJ2A 2ZIWB 2EJCA 1GXSB 3D3QA 1U8ZA 5CDFA 3N28A 3TLBA 1ULZA 1QCDA 1TM1E 4MRPA 4J2OA 4ARUA 3CVUA 2JGIA 1JKMA 5ES3A 1V26A 1G5RA 3NG1A 4DNOA 4NMWA 3ISVA 2C7QA 4EPTA 2H5EA 1ORVA 2GN6A 2DLNA 4UBNA 3GFPA 2WUDA 1PEYA 1SK9A 4Q48A 3FLAA 4JC5A 4KK3A 3OE7A 1KETA 1ZMRA 3ELYA 5LLSA 3F74A 2XYRA 1OVMA 4PCUA 1U7XA 5CDUA 2DR0A 2ZTHA 4QEZA 1E5QA 3S2SA 1PNRA 4D98A 1AKMA 3ZV6A 1LTKA 4Q37A 2QQGA 3T7AA 2HC9A 4V0MA 1MD9A 2XYHA 4KE6A 3W7BA 2WTUA 1WMEA 3VYUB 1GCAA 4UUNA 1WZEA 3JRXA 5BWOA 4XIIA 1RKQA 1OLSA 1NF9A 2FSIA 3SXJA 3IOYA 3TJRA 1X0XA 2POCA 4EYEA 4YCDA 3NBXX 5IJAA 1EFCA 2E4UA 4XM0A 2VNHA 2I3BA 3CTPA 2Z1DA 4CTOA 2VDWA 4N82A 4F9GA 5FWYA 1FS4A 1IM5A 4CMIB 2I03A 2IU6A 2PWYA 2XHZA 2AE1A 2Y27A 3O8RA 4NOMA 1LDEA 1Y3AA 1MX5A 1VJ5A 1G98A 1GPDG 1UXHA 5E4JA 3U3OA 3DHEA 1NG1A 4JLPA 1CQXA 1TB4A 4NKRA 2GBFA 1Z5OA 1DOAA 1GARA 5L3SA 1DJPA 3U0BA 1AH2A 1WDKA 2X4DA 3MMSA 1TVEA 4OLBA 3TSWA 1XAJA 4IL5A 1DIOB 2W6PA 4RV4A 5FFMA 2WZQA 2FG7C 4G07A 2IV7A 3P26A 3ZZTA 5JARA 5ILOA 5LKRA 4ZAZA 3BOSA 4H7HA 3QTBA 2GN8A 1QIFA 1DUIA 1X13A 2PD4A 1IH8A 1TE2A 2RHTA 4H6WA 2NO5A 4HGYA 4C7MA 5LXTB 4Q24A 3UPTA 1NZFA 3TLYA 1RQNA 2C4KA 1PFQA 3V4VB 1XALA 1K66A 3RANA 3WTBA 1AUQA 1QIHA 4JVSB 3BILA 4OB6A 4QGSA 1SCDA 2G5TA 3CEMA 4JWKA 2Q1UA 4O4IA 1IFXA 3VR4A 5KOIA 5LQDA 5LL6P 5IBQA 1ZCAA 2VQ6A 1GUZA 2AI1A 1CUBA 1E2GA 2QUBA 3OCWA 4J07A 4YCBA 5ALUA 3ZZNA 4P0PB 4RQUA 3HJFA 1PF7E 4G4SO 4DLSA 3D5TA 3K32A 3DZJA 4EYKA 2PRZA 1A5BB 2OCXA 5LD2B 2GILA 4Y2QA 1ECFA 2GLXA 4IUBS 4LTDA 1F5NA 1I4TD 2F1IA 4WESA 4ZCLA 3W9YA 1MXHA 1M6WA 1BXRA 4QSMA 1N25A 5HKLA 2VPPA 4YRMA 2XUZA 3B51X 3BWVA 3CT6A 2B69A 2I1VB 1Z4LA 3SHQA 2PU5A 1A5AB 1H65A 2QXUA 5DISB 4Y6LA 2GZHA 1EUYA 2A59A 3ZNOA 4E15A 1H69A 4ZI3A 3N07A 1MAWA 5AT1A 4JHXA 2JI4A 3ZH2A 4KKVA 3FGNA 1TM4E 2ZIUB 4N01A 4ZU3A 2JK0A 3VH1A 4BNJA 2D5BA 4X84A 1C80A 1T8UA 3NOQA 3MOGA 5B3AA 4MRMB 3RD5A 3TZQA 4MLDA 1EFUA 4TV8F 3PC8C 3U62A 1ATIA 1O6GA 4BN5A 4DAOA 1R50A 5A7FA 1T2NA 1EXWA 1KMIY 2XRMA 4BUCA 9ABPA 4JYAB 3TX6A 4DMMA 1DG9A 3LQ1A 2FCRA 1N5DA 3DHWC 1D1SA 3D4NA 2AZDA 3IEKA 3AR4A 4QARA 2CLOB 1JQLB 3KYIB 4ZV7A 4LSWA 3SBDA 2IKQA 5TB5A 1MB0A 4HTAA 2D5LA 3BL6A 3DKIA 1BEZA 4YI3A 1M33A 1AQIA 3QW4B 3P2MA 4DY4A 1TD9A 5FUXA 4U63A 4YCLA 5L4NA 5J2TA 2FLWA 3LP6A 3MTJA 1JL3A 2K5UA 3SEFA 1YL5A 4PLGA 4DZTA 5CHYA 4ZAGA 3CEPB 3RPEA 4AK9A 1SU6A 1UJMA 4LJYA 4Q5IA 3WDKA 1QZUA 4CKEB 4YMTA 1JHVA 4D9FA 1NKSA 1EIZA 1ONPA 4HN2A 3BB3A 1CJSA 4AS1A 2QROA 1XHEA 4JB3A 3FKQA 4KRYA 2YWRA 3A4TA 1WULS 1GM5A 3WLKX 3II6X 2DFPA 3GA0A 1SKBA 3QH4A 1U5CA 3QVUA 4PZ0A 2HDOA 2NX2A 1KY4A 3DPSA 3IVRA 3H6GA 3IR5A 1KL7A 1C9DB 2A1UA 3R6TA 5C51B 1WB5A 2BKEA 2D1RA 1U2ZA 5EP3A 2YL2A 5LD2C 3PT9A 3TL3A 5A4IS 3A05A 3VOSA 4WXMA 1CTQA 3LOPA 1UZNA 3BCSA 3C5VA 2NIPA 1QVZA 3AUJB 1GUFA 4YGYA 1T9GR 3E7WA 2DUMA 3DT8A 4WUTA 1KFEB 5HILA 3GEDA 4H4CA 3U7HB 2HAEA 1E1MA 4RCVA 4HZGA 4EHHA 3PWZA 3CKMA 4G37A 4A3SA 4HH4A 4MW7A 1RXSA 1XVIA 1VHJA 3ESZA 2PDAA 3VO9A 5F9FA 3BRQA 4UM9D 3ILSA 2HA2A 1NDHA 1W94A 1TKRA 2I1WA 2QX9A 3K5IA 4IQFA 4MQ6A 1VPLA 3TLEA 2VJCA 3PKIA 4HYEA 1P72A 5A05A 5IUJC 4F6RB 3L06A 4KN9S 3ESCA 2ZPAA 1T1JA 4B1FA 2Q3EA 3HTXA 1Y81A 2YJ3A 1D7AA 1VDZA 4NIMA 4UE6A 5KKNB 3PUVA 1EG2A 2GN0A 3VKWA 4FJ0A 5KJCA 3RK1A 2NMVA 2J31A 3R3SA 3P71T 2OFOA 1NBEA 4KH1A 3T5DA 4NICA 2GGSA 5DCUA 2MMGA 3GJ3A 1WZUA 2D3TA 4OREX 4PHTA 2Y66A 2HEGA 1S2LA 1NHWA 2BUAA 3PUJA 4IYRA 4JCOA 1RYZA 3MWDA 4BVEA 3FNIA 4V1CA 1G20A 1PN3A 1MFZA 3BE6A 3L92A 4AU1A 3HABA 4EM6A 4Y9UA 1HH4A 2GAJA 4E2WA 2D6FA 2BTEA 2CEAA 4GSKA 4MRSA 3ONWA 5DVZA 2QMUA 4UULA 1U3GA 4RHEA 4HY3A 5FOXA 1NVDA 1B1AA 4Q3DA 4ZCQA 2YJ4A 3ELWA 4B4UA 1L4EA 3AUUA 3HKCA 2AV6A 2VXBA 1NR5A 3Q87B 4HLQB 1Y9JA 3L1KA 3TQOA 4G0OA 3QKIA 2OQIA 1PNVA 3MERA 3I09A 2IQ5A 5DHQA 4CTNA 3LKVA 2EWMA 3BDIA 4ZJPA 3W8EA 1YCDA 2FKAA 4PNHA 4Q7EA 1AKRA 1DJLA 3KAQA 4KQXA 2HRZA 3KQWA 1MB3A 2AJDA 1PZFA 4LDZA 1JIJA 5JJBA 1L5KA 1SVKA 2JI8A 2J6HA 2WR8A 3NAMA 4WZ6A 4MEAA 1HLPA 4MCIA 5JO9A 2GF0A 1E0KA 4IDAA 2XD4A 4MK4A 3SNKA 1R3UA 3CZRA 1N75A 3MXTA 4ER7A 1RE1A 3B5IA 4YAUA 2J07A 3H0EA 3WLSA 1X87A 4B6FA 4ODIA 1SKYE 4HH1A 3T9BA 2ASVA 3MLEA 1T8TA 1RTKA 3ID6C 5ALIA 1MB2A 4DG8A 3VHXB 4K6GA 4YLEA 3JSAA 2EFGA 4J0KA 3X2FA 4YXWA 3U3JA 5EL0A 3AHHA 3RB8A 1SCBA 2ZJ4A 1ZU5A 1LA2A 4W5NA 1GRQA 3RSGA 4O25A 1M8GA 1U0JA 1Y98A 2QVGA 1ZKDA 2W90A 3AR9A 5E38A 1AB5A 1K9SA 2VNSA 4KC0A 4P4GA 4IX1A 1Q91A 4OXXA 1PNTA 4YJ3A 4CKWB 2D54A 4YDHB 4GMKA 3DEKA 1DIAA 3HKDB 1K6EA 2V45A 4N6GA 2VTDA 1MRZA 3M70A 1THMA 2JJMA 1QAOA 2Y93A 5ALQA 2PKYX 3D0QA 4B43A 1QHIA 2AKAB 1F51E 3CM0A 3T61A 2R0QC 1E58A 2BFBA 4WKGA 2IEAA 4B5LA 1B8PA 4G6ZA 5EXEA 4FEGA 4X20A 5F73A 3OKFA 1T5IA 1H4TA 2UVDA 1QKKA 1DU4A 3G9TA 3PNKA 2DKFA 3LRXA 3AERB 1W25A 1LD3A 1T2FA 1J56A 3CJRA 3D7KA 5BV1A 5JXJA 2A3RA 3HCAA 3HVUA 3CUUA 1Y9EA 1CPYA 1N0VC 3N9IA 1FNMA 5G0TA 5KNBA 1HT1E 1HYGA 4YJGB 4MI9A 2BFOA 1AXEA 4CDGA 2PN1A 2CSXA 2IU0A 2H4JA 5B4VA 3B3AA 1J99A 4U2KA 5FNVA 2YV2A 4L3WA 1BCRA 1SG9A 1UMCA 4EI2A 4RTQA 2H54A 3FYSA 3WIBA 1NIPA 3SJUA 1VHDA 1Z5WA 3K8ZA 1CW2B 5K8TA 1FOEB 1DFIA 4IS3A 5DWDA 3QXSA 5IX8A 4IZIA 4JA0A 2NPFA 3N05A 2RIRA 3UT6A 1ZK1A 2WY2D 5HZMA 4KXLA 1MNAA 5CLQA 3SWWA 3AP3A 1XDBA 4MV1A 3HO1A 1TC2A 3ETHA 5H7XA 4CUZA 4C08A 1VRWA 2IY9A 3Q2IA 1BS1A 2ZAYA 2CDAA 3ZJTA 3ENVA 3GROA 4INZA 4A0HA 1M6VB 4RZSA 4C7KA 1LI4A 3ENZA 3V5NA 3CVWA 2P4QA 4H60A 5A1JA 2DBYA 4G5GA 3OZRA 3HMQA 3O0TA 1YI1A 5DE3A 2C0PA 5HYVA 2XCTB 3AR2A 2PGDA 4UC0A 3FMVA 2J87A 3DVSX 3TUZC 4OJKA 4JXXA 3NETA 4V2UA 1MHPA 4IXMA 5AHWA 2JHAA 2IEGA 2MU1A 1TD1A 2EQ5A 2R5WA 3AI1A 3M6WA 2G25A 4V0OA 3NB0A 5D7BA 8AT1A 5U1PA 1JKJB 3CF6R 4B35A 2VWQA 2O7RA 2CVHA 3H8JA 2J7PD 2GPWA 3NTQA 4GOMD 5BYKA 4QQNA 3U4CA 4JOQA 1BHQ1 1P81A 4YP0A 1L9XA 3BVPA 1B14A 1FY2A 7REQA 2Z1NA 3DZIA 1WQ3A 1RLUA 1W93A 2NTEA 2PG3A 2UZ1A 4J0GA 1Z47A 2JGRA 2AFHB 3G3EA 4RA9A 3K09A 2B5VA 3K9CA 3EDMA 4Q9JA 5HGXA 2RGYA 2OQVA 2YCLA 2CFIA 1SY7A 2FR1A 4AM8A 1E79D 1JVBA 2QSZA 4RD3A 2BFAA 4EUNA 1EVZA 2OORA 2HFJA 3QELA 5SY9A 4BN4A 2ANCA 2C88A 2MSCB 3E82A 1FRQA 1SCIA 4FQ7A 1VLMA 3SZUA 4DCSA 3D7NA 1NVAA 3PTLA 2ACWA 2R4QA 2QA5A