3O74A

Crystal structure of cra transcriptional dual regulator from pseudomonas putida
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
270
structure length
270
Chain Sequence
b'HTRTLGFILPDLENPSYARIAKQLEQGARARGYQLLIASSDDQPDSERQLQQLFRARRCDALFVASCLPPEDDSYRELQDKGLPVIAIDRRLDPAHFCSVISDDRDASRQLAASLLSSAPRSIALIGARPELSVSQARAGGFDEALQGYTGEVRRYQGEAFSRECGQRLMQQLIDDLGGLPDALVTTSYVLLQGVFDTLQARPVDSRQLQLGTFGDNQLLDFLPLPVNAMAQQHGQIAATALELALAAIEEKRYEPGVHAVGRTFKQRIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fructose 1-phosphate is the preferred effector of the metabolic regulator Cra of Pseudomonas putida
pubmed doi rcsb
molecule keywords Fructose transport system repressor FruR
source organism Pseudomonas putida
molecule tags Transcription
total genus 98
structure length 270
sequence length 270
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o74A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o74A01
2L2QA 1P8AA 1AB5A 5KQMA 3C3WA 2LP4Y 1RXEA 2V0NA 4H60A 3RVJA 4FB4A 4EVQA 4QYWA 4MGEA 1APBA 5JNRA 1M2EA 2E4YA 2B4AA 2PLNA 3NNDA 4RXTA 4NCBA 4MAAA 3H5VA 1USKA 3JPWA 1QKKA 1YK1A 4TLLB 2FEWB 5FWYA 2FSPA 4QYMA 3UKJA 2R47A 1GLGA 2IOYA 4Q6BA 3LTEA 4TLMB 3GRCA 3IP7A 4HNQA 3OM1A 1W25A 1ZHHA 2H0AA 3C6QA 4MRMB 5BQ3A 3OMWA 4Z0NA 2LPMA 1TM2A 3D8UA 2F8SA 5JS1A 3Q9SA 1GUBA 2LBPA 3EULA 1OXKB 4HNRA 1C0EA 3OO0A 3SNKA 1URPA 4F12A 5TQ0A 4OLBA 2HSGA 3RVRA 1CEYA 4F3TA 4MQEA 2PJUA 5EWMA 3ROTA 1AB6A 1I3CA 1Z2DA 4RKQA 1GCGA 4RXUA 2PUBA 3SQNA 1PNRA 5FWXB 1D5WA 2LIVA 2FXIA 2IYNA 2TMYA 3CFYA 5EWLA 5B3JA 5KQGA 2HQRA 2GKGA 1B00A 2LUOA 3FDFA 3I42A 1WETA 3N0RA 4L4UA 1JL3A 1DC7A 2PUEA 2NT3A 4G0QA 3H1GA 3QEKA 5PNTA 1ZGGA 3RVKA 3QELB 1TLFA 3HUUA 2QXYA 4RK1A 2WWVD 2PUCA 2FMIA 2E4WA 1L5YA 2IPAB 4MS1A 1LJLA 2A9RA 1JWLA 2R48A 1QP4A 3DGFC 1MB0A 1XHEA 1YMVA 2MYTA 3NNNA 6ABPA 1JYEA 3QLUC 2MSLA 4N47A 1CYEA 3IP9A 3JTEA 4LDZA 1DBWA 4EGSA 3EAFA 1ZN2A 3NBMA 1BVHA 1ZY2A 2HPHA 5FBKA 4P98A 1BDHA 1FSPA 2ZWMA 3FGZA 4JA2A 5TQJA 1RPJA 3RVSA 5KQLA 1RXIA 3QEMA 2HJ9A 1USIA 3OMXA 2ID7A 3CG0A 3OLYA 3P9YA 4PE5B 4B09A 4KRFA 3SY8A 4L85A 1NXWA 1NXTA 2FQXA 4JB0A 4MYRA 2O20A 4W5QA 5E3JA 1U8TA 3LKVA 1DCKA 5FWYB 3CKMA 3RVLA 2F8TA 2JVKA 3W9SA 5C5CA 5IEJA 5EWJA 2MYPA 3H5OA 4G0OA 1FFSA 1YS7A 3BRSA 3HS3A 2FEKA 1JDPA 2R25B 4OLAA 4MS3A 5IUNC 3F73A 1LJUA 2M98A 1LK0A 5D2CA 4RK5A 1IIBA 1NATA 4TMYA 4G0PA 4IMJB 3IPCA 5TQ0B 1FQWA 3GYBA 1A04A 1DCFA 1USGA 4DADA 3HJFA 4HNSA 4MR8A 4MQEB 5EWMB 4WWHA 5TPWA 3HDVA 3ILYA 2RDMA 1JHZA 1Z17A 3F6PA 4CBVA 2DRIA 3O21A 3DLBA 3LUAA 4IGAA 4IF4A 5HKOA 3JVDA 4YO7A 4Z99A 2QVCA 3H5WA 4EYOA 5EWLB 1JDNA 2WRZA 3KYIB 4RS3A 3LKBA 2VYCA 3GL9A 1ABEA 4E7OA 3M9WA 3L6UA 3EDCA 1YIOA 1DC8A 3BBLA 4IRXA 5HM6A 2Q5CA 1SRRA 3H6GA 1DBPA 3G85A 3QELA 2PMCA 3RH0A 3ROFA 1Z15A 3IPAA 4MS1B 5CHYA 5TQ2B 5DCLA 4PYRA 1SXIA 1EWKA 2FW0A 3EGCA 3LUGA 4F11A 1OXBB 1ABFA 1GCAA 2QR3A 4MQFA 2RJNA 4Z4FA 5DLEA 2MSKA 3E3MA 3N0XA 3OLWA 1PHRA 4FE4A 2VK2A 3GA5A 5HSGA 1K66A 2MSWA 3QEMB 3KJXA 4WUTA 3QLVA 3F6CA 5CNJA 4F8JA 5JNSA 3O2SB 4Q7EA 4IILA 2L17A 3H5TA 4LDAA 1UDRA 2WJWA 2XDYA 3D02A 3LUKA 4ZMRA 4YV7A 4RU1A 4KPYA 4H3KB 1KRWA 4ETNA 2PUDA 3HXMA 1DZ3A 3LUCA 3KYJB 4LE2A 5EWJB 4EY3A 4Z4EA 1JX6A 2QW1A 5DTEA 5F64A 3OQMA 1W9HA 4RXMA 1EWVA 4RY9A 1FFWA 2QVGA 4MS3B 4RY8A 3GBVA 3OLXA 5C5EA 4UHJA 3HEBA 3CG4A 2JB9A 1TJYA 2HQOA 1E2BA 4MS4A 4G97A 3N0WA 1U04A 3Q7SA 2FMHA 3H1EA 4PICA 5GQSA 2RGYA 2YHBA 4KMRA 4MR8B 1NTRA 1QO0A 1XWWA 4NICA 4EYGA 2WB4A 3QLTA 1QPZA 3IP6A 1FFGA 2AYXA 5TPWB 1JLKA 2MYNA 5DGCA 3EODA 4H3HB 4P1ZA 4TN5A 5JS2A 1E6KA 3A0UA 4RK7A 4NV3A 2CHEA 1DRJA 1NXPA 2J48A 3OM0A 4NQRA 2CWDA 4XAQA 1JBEA 5T3YA 2E4XA 3NNSA 3TB6A 4ETMA 1F51E 4RDCA 3HZHA 3DGEC 1U0SY 3KLNA 4N0QA 3HVRA 3LUJA 3OQOA 4WZZA 4KREA 5TQ2A 3QK7A 2VUIB 2FQYA 2QZJA 3HO1A 1NXVA 3DZDA 2PUAA 2FN9A 1HEYA 1F4VA 4O1HA 1Z16A 3NHZA 2ZAYA 3E61A 4G0ZA 4LRQA 1VPWA 1YS6A 1PNTA 2A9OA 4W5TA 3TX6A 5KWSA 6CHYA 1EFAA 4ML3A 3C97A 4RKRA 3MYYA 4MQFB 5ABPA 3I5AA 5JNUA 3HV2A 3LUDA 4YLEA 3N53A 3TD9A 3SAJA 4DN6A 4W5RA 3KG2A 2WJAA 3N75A 2W42A 2PUGA 3H5IA 3JPYA 4RK6A 3CLKA 4DQDA 2PL9A 3MMNA 4N41A 2AYZA 3S99A 3K9CA 1YTUA 3CZCA 2PAFA 2NUBA 4Z4CA 3A3KA 1P2FA 5CNKA 4Q6WA 5IULC 3LMKA 2IPNA 3HM9A 4JB2A 5B3JC 3TO5A 1A2OA 3HDGA 3K4HA 4MS4B 5T7BA 1JFTA 1DJMA 3HCWA 1NXOA 2GBPA 5TPZD 5JNTA 3CNBA 4KQCA 5GOTA 1M5TA 3A0RB 4MR7A 4XARA 1YMUA 1E6MA 2P4UA 2QSJA 3BREA 3C3KA 3MQ4A 4HYEA 5BRJA 4F06A 3KHTA 5JNVA 4MLCA 3HUTA 4KNYA 2M1ZA 4EVRA 4MLDA 3O2JA 4YS6A 5TE9A 3I45A 4MPTA 1ZITA 2FEPA 4PEVA 3EQZA 4MR9B 3DBIA 3L49A 1A0OA 3M9XA 3H75A 5BR1A 3KS9A 4RK4A 5BRAA 4Z4IA 4S04A 5IC5A 4KK3A 3JVIA 1RZRA 5KC8A 1JH9A 1ZVVA 4RV5A 2FN8A 3N8IA 4UHKA 2R4QA 4FE7A 1R8JA 4RK0A 1D1QA 1KGSA 3LOPA 3UK0A 4YRZA 3IP5A 2BGGA 3KCNA 5IX8A 3CTPA 1H9CA 1TMYA 4Z4GA 1QP0A 5ED4A 3MA0A 4XFKA 4YWHA 3RVMA 2PE5A 2IDMA 1ISRA 4KVFA 5IBQA 3RQIA 1P6QA 1XHFA 1JF8A 3OLVA 4KZKA 3IDOA 1CHNA 2FLKA 3FMVA 3JY6A 4QICA 1DRKA 1K68A 1U2QA 4EYKA 1ZGZA 1SXHA 5IUJC 3UUGA 1Z25A 2P9HA 1C4WA 4G0XA 4Z9AA 3QX8A 3RVNA 3HK2A 1PEYA 2CHFA 2OQRA 2NT4A 1Z13A 4D74A 3LFTA 2RJOA 4EUKA 2JK1A 1PEAA 2JVIA 4ZYLA 1BDIA 1M5UA 1QQAA 1JYFA 1D1PA 3N6VA 3H6HA 1DP4A 1SXGA 4G0YA 1DCMA 1Y1LA 2JRLA 4ZPJA 3TMYA 1S8NA 3VNAA 1NY5A 3DLHA 2A9PA 1D4ZA 3A10A 4KV7A 3T38A 1NXXA 3Q15C 1ZH2A 4MR7B 1QO0D 2IKSA 1J56A 1MB3A 4OTZA 1VKRA 3BRQA 1Z26A 3CRNA 1KMIY 2FMKA 3QLUA 1Z18A 1EHCA 3FFTA 3KSMA 1EWTA 2E4ZA 2FQWA 9ABPA 4YP9A 1JFVA 1QP7A 2VUHB 5IEBA 3CS3A 3O2QB 4XLTA 4MR9A 3MIZA 5KC9A 3SG0A 2L19A 1DBQA 5KI6A 1P6UA 3OLZA 4JP1A 4W5NA 3VNBA 1NXSA 3RVOA 2PKXA 4JAVC 2JBAA 3QLVC 4E7PA 4G0MA 3OO1A 5IUKC 2JCGA 1EAYA 2MYUA 3FFXA 3T6KA 2PUFA 3RVPA 3GBPA 3O1IC 3T8YA 3O75A 4YR7A 3QX9A 1BA2A 3KLOA 3I09A 1Z12A 1Z2EA 3ILHA 3LUFA 4S05A 2QV0A 5DKFA 1DG9A 7ABPA 1M2FA 1BDJA 3MM4A 4RWEA 3GV0A 4RY0A 1TVMA 2A9QA 3CU5A 4O5AA 3HSYA 2I6FA 3MF4A 4ETIA 4YCSA 3H1FA 1QQBA 5FBHA 2QU7A 4N03A 1ZESA 3GWGA 3BILA 2N9UA 4KK4A 2YHAA 2GX6A 4RSMA 2H3HA 4Z9BA 4M88A 4D6XA 1YVUA 2NZUG 3Q41A 1MVOA 3B2NA 1JFSA 3RVQA 3LUHA 4OATA 1VLZA 1ZDMA 3M6MD 4GPAA 4EVSA 2L18A 2NZVG 4NCAA 3CZ5A 1VRVA 5JNWA 2FVYA 2CD7A 3O1HB 3CHYA 1LBHA 4XASA 1KRXA 3H5LA 1ZH4A 1QMPA 4YGXB 4EYQA 4N0PA 1MAVA 8ABPA 2FTKE 2KYRA 2GWRA 2IPLA 2ID9A 4N76A 4MRMA 4RZSA 1T34A 5I4CA 4Z4HA 1GUDA 1SD5A 4LE0A 4ZMSA 3EJWA 2GI4A 2PL1A 4JOQA 5CNMA 5KQPA 3KTOA 5TPZA 1RZRD 4KFCA 4QPJC 2X7XA 3FFWA 1PUXA 2B1JA 2JBAB 4LX8A 3GT7A 1RNLA 1YK0A 2FMFA 3URMA 1ZAYA 2FLWA 2OENG 2E4VA 2JVJA 4Y9TA 4WXEA 3T95A 1LBIA 2E4UA 4LE1A 4PZ0A 3F7NA 4WXMA 5FWXA 4KQ9A 3G1WA 4JASB 3KKEA 4ZJPA 3C3MA 3NHMA 4XXHA 5HQJA 4IMIB 2WY2D 2IPMA 3OQNA 1E6LA 3Q7TA 3O74A 4LZLA 3EQ2A 4D6YA 4OG2A 4GNRA 4WT7A 5CNIA 3SM9A 1L5ZA 1ISSA 1MIHA 1QNLA 3R0JA 3JS5A 2WMYA 4G86A 4O1IA 1D2AA 3Q7RA 2HQBA 4OBBA 1U2PA 2FKAA 3O1JC 4W5OA 1BAPA
chains in the Genus database with same CATH superfamily
1LK5A 1P8AA 3BZUA 2JFHA 2X7JA 1E3TA 2RG7A 2XNJA 3DZBA 1GRNA 1X1CA 3AP2A 4HQKA 1NVFA 2V0NA 4Q16A 4XM2A 3DKIA 3O90A 5LYYA 1SKAA 3ZCVA 5I6DA 3BD9A 3OOJA 3TSWA 4MLPA 1TYAE 4HDNB 4TLDA 1A2BA 1NM5C 4U0JA 2ZIAA 4BZPA 3S2ZA 3FYCA 1FYXA 3KUKA 2WWFA 3MJHA 1NLUA 4WZAA 2G4VA 3ZEAA 4MROA 4HOYA 4BNTA 4N01A 3ET5A 2ZYDA 3QPAA 1EUZA 5KUTA 5GADl 3LTEA 3VJLA 3FHLA 2P6OA 3S2SA 3B78A 1QH0A 4HWKA 4O3FA 1EIWA 1E98A 2XXAB 2PLAA 2ZBPA 3ORFA 4X44A 1RYEA 4GLOA 2XOXA 4GSYA 2XE8A 4KYVA 4RTJA 3VNVA 4X7MA 1LTHR 3EWSA 1C0EA 1V43A 3SNKA 3JZFA 4U2KA 4Q1CA 1K97A 4ZGBA 5KVQA 2VJYA 5AR1A 1F2VA 5A2QA 2BGKA 2ILVA 2IP4A 2WIBA 1KSJA 4JKYA 1PKXA 1T0IA 1ZOLA 2ODPA 5C35A 3DR3A 1GG5A 1PO7A 3PUXA 5DI9A 1KOFA 1NP6A 4I4LA 2LGJA 2VL7A 4MV9A 5C37A 4ZT4A 1LDNA 4YV2A 1V8DA 4WESA 3QBJA 4MB2A 4EPXA 5F2NA 1JEYA 3FTDA 4D9BA 2A0UA 4YJ3A 2QIOA 5J4HA 3UJ8A 4E5PA 3T3MB 2JCBA 3HKEA 4OHZA 5B1YA 4B8WA 5BSUA 3VR1A 5KNCA 4J3FA 5BW6B 3V6LA 3PSHA 1R8XA 2WKQA 3ETGA 2Q5IA 2J4DA 4LQCA 1Y8CA 4M83A 3EZYA 3MRXA 1AQIA 3ENKA 3WLQA 1JWLA 2HXSA 3TTXA 2WYIA 5GONF 5CB6A 3IXMA 3STXA 1XHEA 5GGXA 4G6ZA 1GNQA 1T36A 1N7GA 4W5JA 5B1HA 3RAEC 4DSZA 2D7JA 1BU5A 2ZJAA 2EJCA 3D7LA 4H6VA 4LJKA 4A82A 2KJQA 4WKBA 3HXOA 2WT9A 2O8VA 2G5GX 2WHYA 3WY9A 4XYGA 4AUNA 1N33B 2NU6B 3CVXA 3EMDA 4BO2A 3LO8A 1SU8A 2DBQA 3ONFA 3VTFA 1D7OA 4P3OA 1OXMA 2WUWE 4L85A 2FQXA 5GTDA 4JU9A 2VP5A 5CG2A 2GO1A 1RLJA 2AC4A 3GI1A 5BWMA 1W4LA 1HKUA 1YQGA 2R79A 3FROA 3LKVA 4FJ0A 4V0RA 1XG5A 3W79A 1XVTA 3OQIA 1JZSA 3TBKA 2YHSA 2XW6A 2YNMC 4NS1A 4ZI5A 1G3IA 1V1RA 5KC8A 1O95C 2ZRGA 5FQOA 4DMRA 1VI5A 4FOSA 1CDOA 5FLYA 5IUNC 4CKWB 1RRMA 3VI4B 2WZCA 1U1DA 2FK8A 1FPQA 1O96B 2IF2A 2ZAMA 3A4LA 3HXTA 3KOMA 3PIDA 4OM7A 2DFKB 2BTQB 2C2MA 1ZIOA 4RV4A 5DBIA 1QIMA 3C8HA 1L8OA 2CNOA 5A5EA 4W5WA 5JI2E 2C2HA 3NM5A 2DPGA 5KNDD 3BXXA 1KI1A 4MKHA 2ZJOA 5IK2A 2X0FA 3R7FA 3S3TA 5CBPA 4BO7A 5J2TA 1VJCA 1UPAA 4BUJA 1IUNA 3MS4A 3QE3A 5HKOA 1JEAA 5DW3A 3P7MA 5FTWA 4RE6A 4Q3KA 2FW9A 1G4HA 1N5JA 4O4IA 2WLSA 3V1MA 1VPVA 3RYCA 4P3NA 1E5VA 3HU1A 4R9RA 1EXDA 1Y6ZA 2R8RA 4IHJB 4KYTA 3I2IA 5KS2A 1E6EA 1E59A 3K9GA 2VZ9A 3N87A 4EPWA 1UWKA 2XVMA 4MUKA 4KN5A 2Y0CA 4XQ9A 5I9SA 3DWIA 2HLNA 3MOSA 5TQ2B 4E30A 4PYRA 2HCFA 5ARBA 4N9WA 2GPTA 1I36A 2BKEA 1PYOA 2IXDA 5I7EA 5L4NA 1USWA 1U99A 2W4QA 2ZRMA 1M66A 2FSUA 2JAOA 5J4YA 4EOGA 3COJA 4MGIR 1DL5A 3ECCA 4L4RA 3TRHA 3WQSB 3RC8A 4I3FA 1FYEA 1CR2A 3EVZA 1CRQA 1E9VA 5H8WA 4FE4A 1F1JA 4H1VA 1NJ1A 3JYPA 3I2YX 3IHWA 2D00A 2NTVA 4UPEA 4N8SA 2KSQA 3GRYA 5AVVA 3KJXA 5HGXA 1HQDA 1Y48E 1ZHFA 2BFAA 3OHSX 4GPBA 3W5DA 3A70A 2AG8A 3JWHA 3PA8A 3H19A 4B3XA 2PT9A 5REQB 4UMEA 3I9LA 3QU4A 2BFEB 1FTWA 1GQ2A 4FZJA 3TVDA 1KAEA 3ZHZA 1F38A 4ARZB 1EZ1A 2RAFA 4JLPA 2ODNA 4HFJA 3IB6A 5F7ZA 2QW1A 4OMFG 2B2CA 1FLDA 3UMGA 4MDFA 2JI8A 1JDSA 2GCIA 1Z8DA 2M6SA 4MO9A 4BWFB 2FXVA 1E0DA 1GAWA 1NWHA 2YVQA 4PHHA 3R23A 3LVFO 3Q5GA 4PXAA 3ETJA 3EQ7A 3N0WA 4RVSA 1EU1A 4RNCA 3AF5A 4HDCA 5EZQA 2QRVB 3IP6A 4GBED 2VDQB 5ALZA 13PKA 2G7ZA 1LPAB 3TOSA 5JI3E 5F9MA 2Q5LA 4P1ZA 3SLRA 2ORWA 2J85A 4BE9A 3A0UA 4GMHA 5KJCA 2RCNA 5AW1A 2CHEA 3ZUPA 5CDTA 1YB5A 5BXQC 3KFLA 2GBCA 3FJYA 3KLPX 1TKCA 1V35A 1DWQA 2JGDA 4B3BA 4GP9A 4TXMA 5JPCA 3KQMA 1HRDA 4TL6A 5HPYB 3JD3A 1K8YB 3JXEA 1OAOC 1D2CA 3OLQA 5J9FA 5DWDA 4S1VA 1QH8A 3WKAA 3QYFA 2H6EA 4DBZA 2V65A 4WZZA 5MGNA 2QAIA 5K6AA 5KTRA 1OU4A 5B58C 5J4VA 3U13A 4IJWA 1I32A 4KR9A 2XSZD 3IXQA 4D2IA 1FRVA 1ZC4A 4YHHB 1CVRA 1TAQA 3CEJA 4PO1A 2O8CA 1DAFA 5TGDA 1LDEA 3TX6A 4B5KA 1T91A 3DM9B 3OQPA 4C0KA 1ENOA 2J4FA 4KDCA 5BW5A 3LUDA 1JFLA 2KMLA 4OP3A 4URZR 5EXSA 4QNNA 3EGEA 4YT8A 1W96A 1RBMA 1YB4A 4RK6A 3RDPA 2HRRA 4C78A 2ZKIA 2FG5A 2ZIEA 4GF5A 4WASA 3REQB 1JEQB 4AZSA 1X13A 2PL9A 3EEYA 4YT2A 2XNDA 5FBQB 3FUCA 4JJZA 4OYYA 4KPUB 3ITKA 1R8QA 2JFGA 4H3SA 3E3AA 4PLCA 2REBA 1JQLB 5G0SA 2IIVA 4CV0A 2NV0A 4NS4A 4QRHA 4RH3A 3IVMA 1QYIA 1ZMTA 3TLJA 3R7WB 3TQFA 3WWDA 1YU9A 1UXOA 2GA9A 2WF6A 3DLAA 4KDRA 4QYSA 4RKEA 5FBRB 1RM0A 2O05A 1EE9A 1TM7E 2C84A 2PYIA 2Z57A 4FX2A 4LHZA 3HCWA 3PUWA 2HRBA 3CC8A 3AJAA 4DSUA 4EEZA 1W4AA 1T5OA 2GM3A 3GUYA 3KOYA 1B6GA 1PGPA 2PLWA 1LZKA 4BN5A 2FPXA 1L1EA 2HEIA 2JLQA 3DE6X 3I34X 4PYMA 5KKNB 4GKBA 3P9QA 4QTZA 3EVDA 4G1FA 5T64A 3U4QA 1OI2A 1QR6A 3IIIA 2V6FA 1QFYA 4P80A 3RWBA 4JLDA 4OQPA 1CUBA 4OL9A 5TE9A 3SSNA 4OEHA 4WPGA 3CN9A 1XKQA 1LWOA 1P18A 3G0IA 4MVJG 4NSNA 1H4TA 4PLVA 3M9XA 3ZDRA 4B0OA 3N9IA 3U4HA 3CO5A 2IEIA 2HHJA 4QE3A 2QJTA 3SKYA 1R0ZA 4ZT7A 1JH9A 1M33A 1GTZA 3LOUA 5IT9A 1LXCA 2GHQA 2GD6A 3OIGA 4YRSA 4UMVA 4OXIA 1XF9A 1FDOA 3MHTA 5E7QA 3GX1A 3BMCA 3LPDA 3IP5A 4IDGA 2RHMA 4TVOA 4EELA 3FUWA 4AJEA 2VDNB 2CXPA 4LOJA 1Z6TA 2G76A 5IT4A 3GW8A 1PV4A 4JT8A 3DE0X 4XFKA 1T3TA 2IDMA 5IBQA 2GLXA 3U7QA 5HE8A 2QW0X 3GRAA 3OT4A 3R0ZA 3ZQUA 3HY3A 1W59A 3C6XA 4PTZA 2FLKA 1Q14A 3FMVA 4PYJA 4JOCA 1FXWA 1LI5A 1K68A 4LSZA 3TTUA 3R3SA 4FS8A 3E9NA 4B2LA 3FHCB 1VE1A 2D5IA 2Z2JA 4KO4S 1QRAA 5EIBC 4CMEC 3CBQA 3THYA 2DQKA 3E81A 3LAWA 4LGCA 3OIFA 4RKFA 5KWSA 2CFSA 2WM2A 3UJHA 2MHCA 5I8WA 1YI8A 4S2UA 1W44A 5JAOA 2LCQA 4GOJA 1WHTB 3UC5A 1UOOA 1QOQB 3L7LA 2W5UA 4J91A 3LDGA 3FX2A 2XUPA 5JD5A 2GLTA 4IJMA 5MFPA 1QLJA 1QF6A 3A10A 5C4IA 1BXZA 1UR5A 4M7RA 1UJMA 1US8A 4CQLB 4EG1A 1ZH2A 3DOEA 1KMCA 3F71A 2IKSA 4MGKR 4X3OA 2AGVA 4A2PA 1J5EB 1VKRA 1OWLA 3QLUA 4TYMA 4ECEA 1RYZA 4EI8A 3TYXA 1MCZA 1Q0UA 2W6QA 2Z4SA 4RMHA 3EF0A 4D1YA 4LGVA 2AOUB 2W6CX 4MIEA 4XB2A 9ABPA 3T3HA 2NTYC 3RIEA 1SIOA 4J03A 1B8VA 1T6XA 2DP4E 1G21E 1KRHA 2XWQA 3W9UA 5EQTA 4A03A 2FZWA 4D4IA 1T2EA 2C9YA 2NSYA 3CX8A 4KIUA 3A1TA 4D4KA 1I1QB 1G9TA 5JXGA 4MKIA 3GOHA 1AQ6A 1HYBA 3TFOA 4YQZA 5IKMA 3EVEA 2EKLA 3TFWA 4BO0A 1WEHA 4BLTA 2QOEA 2GEDA 4TZKA 5DASA 4OI1A 3S2YA 2YJ3A 4CR6A 2JZNA 2RGXA 2PRSA 2ZJ2A 2RI0A 3QENA 4JBNA 3NETA 1TQ4A 2VHYA 1ZGBA 2VSYA 1DUSA 3C74A 4AY3A 4D9FA 1I33A 4FKBA 2IPOA 3TZHA 3V8RA 3FZYA 4BP8A 5M7EA 1X19A 3F9IA 1YD7A 1DKLA 2BKVA 1HL3A 4CMKA 2PBLA 2AQIA 2P9EA 2RHDA 3EFEA 5K51A 2OUIA 2P5YA 4C7JA 1Z4KA 2B0CA 4QXRA 5E2AA 4E2YA 2ZGVA 2AEJA 2BJWA 2VQEB 4GR5A 3L7IA 3I6YA 3KUCA 2Y67A 3EJ6A 3F5QA 5LJLA 5FYQA 1PLKA 2ZUEA 3HSYA 2EQ5A 1A50B 2LVBA 3GFRA 1GGNA 3ZWPA 3FTPA 5KSZA 4AS1A 4WADA 3GOQA 2GERA 3W3AH 1YASA 3OTHA 2P9GA 4PW0A 4J7XA 4MTCA 4NJMB 2GPJA 3BCHA 4AVYA 3OKCA 1FFHA 2Z5VA 2YHAA 2QX6A 3DFUA 1GILA 2V55B 1LTQA 2ATVA 4Z9BA 5B7GA 3HHEA 4D6XA 4R2JA 1EVJA 1VL0A 1Z62A 4OI4A 4KU4A 3ZWBA 4TWAA 3U81A 1DEAA 3IAS1 3ETEA 4N5NA 4TQGA 2H31A 2D0IA 3SE7A 1E96A 5EJ7A 2A6PA 2GESA 1DC4A 4R84A 3K4QA 3GJQA 1J0CA 1WXFA 2IJGX 2QYHA 2PL3A 4XASA 2CJYA 3BIWA 2C04A 4DCPA 3W5BA 1Z33A 4P0PB 5AW8A 1QV6A 1X2BA 2B83A 2CLIB 2HLDD 3AERA 4GXRA 4P2BA 4D46A 4ENPA 3UAYA 2NQ8A 3ZE6A 3BK7A 3TDKA 2AUMA 3M2TA 4WKOA 2D13A 1S5PA 5CCDA 1KKLA 2IP1A 1NE2A 4E1BA 2B7LA 5LB4A 1XK7A 1DJOA 3RROA 4EHAA 4JJEA 3R3UA 2EFEB 2DSNA 3IJ5A 1PUXA 2FRXA 2XEDA 3P9SA 2JBAB 3DZGA 3QV2A 3WL4A 4OQMA 2LXNA 8MHTA 4ZVNA 1XZIA 3OCWA 1AIPA 1LBIA 3RS3A 1W35A 3W3ZB 3Q2KA 1ZM2A 3QFTA 4RV9A 1Z4OA 2PX8A 3AFMA 5EFOA 4ZOLB 2C8VA 3AI3A 2WY2D 3VZQA 4TL8A 2BKAA 1EVEA 1WMDA 5KYKA 4L3OA 1MRNA 3L1JA 4BKUA 3BF7A 3U9LA 2A9FA 2JJMA 2VHXA 1H66A 2E21A 2FPUA 2PSEA 3JS5A 4IDFA 4BQOA 4CU2A 4D9CA 4DRXA 3DMDA 2QSYA 3PQ6A 5JHHB 3I04M 1QLWA 2PH3A 4KITB 3UJAA 4W5OA 2ASVA 3MWEA 5TMPA 3NHPA 1MQAA 5IJXA 5JCOC 5I7SA 1L7QA 1SKBA 2MSNA 1Z2PX 3P2IA 3TLXA 1ZA2A 3O38A 2AW5A 3PR2B 3C1AA 4BIIA 2YYAA 5BN5B 4CKEB 2EHJA 3ZNPA 4DGQA 1XQ1A 3HFJA 5A5VA 2E5LB 1GPH1 2PT6A 1CK4A 1Z0KA 1U3CA 2ODEA 2WD7B 3N0TA 2ECOA 3F5MA 1W5SA 5IBPA 5EQFA 4EFLA 1Z07A 2E4YA 2B4AA 2OCIA 1FS5A 4TN1A 5DOZA 3UAWA 2A1IA 4FHEA 5CLJA 4GKJB 3FCUB 2D0DA 3HJUA 3NTOA 4P3KA 4CEJB 1KI8A 4I9GA 1Q7EA 1USKA 3E1SA 3H5VA 2FEWB 3NBYC 4GM4A 1VMKA 4NMXB 3CGWA 2B35A 1MJFA 2XRYA 1X7HA 3GRCA 5DBEX 4Q1AA 3U80A 1W25A 2O1XA 3C6QA 1CF2O 5MN5A 5EE1A 5FTLA 2DLDA 2H4FA 2HLHA 1NBHA 3M5PA 3A1CA 4B31A 3GLFE 4EHFA 1GUBA 1XZNA 2MOKA 4DIMA 3GPIA 2LV8A 3EULA 4XYBA 1UPBA 2IEDA 3QWAA 1XC7A 1YS9A 2E85A 3OO0A 4AKIA 1FOEB 3MWDB 3HCPA 4PINA 5DF1A 3SZGA 4ER0A 3PGA1 2B9EA 2Q4OA 1MDBA 1HSZA 1SELA 2XV1A 2NNLD 5H9VA 4QVKA 2OECA 4UU8A 3RVDA 3T4EA 4X1KA 5EWMA 4EHIA 1CIPA 4H6WA 4RS4A 3AUYA 1EFUA 2R7NA 5DDIP 1QDLB 5CJJA 3L7CA 5GV7A 1O95D 1YUBA 4MVJF 2PH7A 1GTJ1 3NHSA 2V8OA 2E87A 4EY6A 1Q95A 1EQ2A 2GKGA 2XCQA 3FZNA 4KH0A 4WXRA 3VH2A 2VA9A 2NXWA 2QQ5A 3AU8A 2WU8A 5JAMA 3KR0A 2R85A 1V5WA 1K7EB 1ZGGA 1ZL2A 3QELB 5L53A 3SHVA 2Y9PB 4HEJA 2HZBA 4ZICA 3IODA 3PPVA 1X7YB 2IPAB 1UXGA 5IH3A 3WYAA 4AJOA 1VLLA 4BNWA 3SC6A 3I5XA 3UGTA 4LFAB 1T3SA 2ZXFA 3TNDA 4UTRA 1QHIA 1NR5A 4M37A 2ZT7A 3KSUA 2J0SA 4A9AA 3JAMA 1GJRA 2WYUA 1UBFA 3EF3A 3L8HA 2XWSA 1Y7HA 4PSUA 3WHPA 3HBJA 1QDUA 4CNBA 4KFRA 4L76A 4DILA 2D7DA 3O8NA 4GPZA 5FBKA 1FVHA 2J6CA 4I55A 4PF1A 3L01A 4MA5A 5TQJA 3RVSA 1IN7A 3W78A 4KRFA 1ACJA 2DFLA 2ID7A 4L5YA 1X7WA 2FEAA 4JWKA 1GPDG 1R15A 2PGNA 3QITA 3QYAA 4RTNA 2BHSA 2JFVA 3LT5A 4JI4B 4KR2A 1IBLB 2HD4A 3C8MA 3CEPB 2HM7A 1BOFA 3H5OA 9MHTA 3ND5A 1GA6A 3AF3A 1QGZA 4N65A 1DKQA 2ZBRA 1V3UA 2OV1A 2ZCVA 4KRXA 3MJDA 4YMSA 1MW9X 3DB1A 3WX0A 1OR8A 2OWDA 1OB2A 3B1VA 3F73A 1WXHA 4X66B 1U2DA 3TMAA 3V1NA 5KYXB 2CE2X 2HCTA 4TMYA 4WXHA 1B16A 1SZCA 3E0QA 2XVAA 3E35A 1RW4A 4PC7A 3MELA 1G41A 1Y81A 2FPOA 1WXWA 3BMQB 5BR7A 3NASA 4DSOA 3J81k 3DL2A 3KXLA 4ILEA 1IXZA 3HDVA 1Z17A 3VI3B 2FQQA 1IEWA 2X6RA 2ZVQX 1EPUA 4RIGA 1AKEA 3UA3A 4R2IA 3NYRA 1P0IA 1XRMA 2XRFA 3QKSA 4PSAA 4EG3A 5JSHA 5JWOA 4E5DA 5LJIA 2YY7A 1EBBA 3WR5A 2R6HA 2QSUA 1Y9AA 1MEOA 2RD2A 1ATZA 3TKLA 1I2MA 1HG1A 1MX1A 4NMHA 1X14A 2I4LA 4Z1MD 1E9EA 1VXOA 5CMLA 3JQBC 1YDFA 3LSTA 4PRKA 3EH2A 4OGLA 3OECA 3BWDD 5EERA 4ZD6A 2XCRB 4EGFA 2VNJA 3DTVD 1RDFA 1LF0A 3VVMA 3BD6A 4UVEA 1G8FA 4CW7A 1E7YA 1NKVA 2N47A 3QIVA 3PGJA 4UEQA 1XD2A 3TDNA 5KMGA 2Z9CA 1NNUA 4IY1A 3VC1A 5EEHA 4F9FA 3EFHA 3GLFB 1OXBB 4ZCLA 4EG4A 3JWEA 1IG0A 1N3LA 5IJ0A 2QR3A 5DHFA 3DXXA 4MUGA 4AJPA 1N2CE 4MQFA 1QYVA 2FNAA 3PXEA 4P7KA 3ZU5A 1WPQA 4UAUA 3DFIA 2LIPA 1F20A 1YDWA 2X4LA 1YCGA 3NOQA 4V38A 5BN4A 3UHAA 3ND8A 4F8JA 3D4PA 2GSDA 4DA9A 4ZCMA 3AEUB 3DEKA 2Z83A 3OH8A 1I5OA 1I5RA 3UPUA 4Z3DA 3RSFA 3OHPA 3O0DA 4H3KB 4QOJA 4KPYA 1Q17A 3R3JA 3PX3A 2R00A 5JS6A 4Y2HA 4PANA 2Z56A 5FUWA 5FRDA 1X80A 3BD7A 1CR1A 2IHTA 1TJ4A 3I8OA 3PBKA 3S29A 2CXTA 4U7JA 4IDDA 4YRDA 4F1JA 3ASVA 1L5GB 3UMFA 4BNFA 3DZJA 3OQMA 2FMTA 5ALXA 3AB7A 3GBVA 1LVHA 1C1YA 1CC1S 4H4DA 4C7OA 1TJYA 3EBPA 3MSCA 4GR4A 1LRJA 2IUTA 5CXXA 5G4KA 2KW5A 2ORIA 4LWZA 4DREA 2W2QA 2AJCA 1FLVA 5IXYA 1Q0HA 3NTVA 1A2KC 5SYMA 1Z34A 1KQ3A 1NWCA 4KWEA 4NICA 1MJ5A 3C3AA 4HB4A 4C88A 2ZIZA 3VPCA 2O8DA 3TLGA 2PRKA 4KBYA 1O08A 4KO2S 2DOKA 4MW2A 4R2WA 1GLNA 2JD2A 3MCZA 3W5IA 5BT8A 3IV9A 3KXPA 3IIMA 2IXAA 2WWYA 2FPIA 2GQ0A 3QBVA 3RANA 1MGOA 2DZDA 5GVRA 6YASA 2BFCA 2HMSA 5JJKA 3VOAA 1TQ6A 1JNXX 2J31A 3SZRA 5K8LA 3SS8A 1H0RA 2DWOA 1V0JA 3IE1A 3ANNA 5IG2A 1SM4A 1BGWA 2ZRLA 4HB0A 2A5LA 3DGEC 2V7QA 3JAKB 1COWA 4OGGA 2XNHA 1GPLA 4IJVA 1UBEA 2QB5A 2FZ5A 1YS2X 2Q99A 2I55A 2ZQ5A 5IC4A 3VYWA 1T4BA 3TR0A 2ZAYA 4B44A 4N3GA 5J40A 1Q7BA 4UKDA 1B0ZA 4X1IB 4BFZA 2K2WA 5AK5A 6CHYA 3GJ7A 4O4HB 2EYQA 2B6NA 1G0OA 1DT5A 1XAIA 1JFFB 1Z8NA 4HTFA 3NATA 4HWGA 4J0EA 5KWVA 4JR1A 3L41A 1XWFA 3IKTA 3UMYA 3TXYA 1Z4NA 1TL7C 5HKKD 1PR4A 1YJBA 2JKVA 3KJHA 3LC7O 3MBKA 3SXUA 2PUGA 4AN0A 2KBEA 1P4JA 1BVUA 4LBZA 3F0TA 3WIBA 4BLOA 1QVWA 2V7VA 2POCA 5JFTA 2IIQA 4ER3A 4ND5A 4ZV7A 4QFMA 3KSAC 1ZINA 1L6RA 2GM5A 4ALNA 3EWIA 4YV0A 2I3ZA 1P2FA 2XJ9A 1UBLS 3M49A 1VFNA 3A4VA 4BNVA 3UXYA 5L40A 1ND5A 2IH5A 3FCXA 4OCZA 3NGLA 1LPBB 1RJ9A 2P41A 4KGVA 4XEUA 2B34A 2C4UA 1PTJC 8GPBA 2YZ7A 2IPNA 1NJ5A 3LYUA 1N77A 1EK1A 4ZDJA 3N74A 5T7BA 4G9BA 3FYHA 1SWVA 1E3EA 4AZ3B 1PFUA 1YGYA 3EZ2A 4URFA 3C3DA 3DMTA 1KU0A 3G13A 3LECA 3IOEA 3PX2A 4B8YA 3MQ4A 4ZTBA 3A2LA 3E7FA 4I4TF 4ZT2A 1E1CB 1VA5A 3PQCA 5I7UA 1CB7A 5D6OA 4PSKA 5EZYA 1CJTC 1N2CB 1Y42X 2I7TA 1XPOA 4ZDIA 3AUUA 2ZIGA 1TCUA 3DBIA 3TECE 1GZ4A 1GGHA 1NY6A 3JQ7B 1C9EA 1PGQA 3S1AA 1RLTA 2D54A 3KPUA 5ILOA 1Z82A 3ZQ6A 1CV2A 1FRZA 3JVIA 1ULHA 1VKHA 1EJ2A 3L1KA 2GO7A 2HQ1A 2OCKA 4RX1A 4I0WB 1XRRA 1Y7PA 4P0TA 2GHRA 2PZKA 1CS0B 2C4TA 2RHJA 3E9ZA 3OPXA 4U6NA 2NV6A 3U1TA 4WTOA 2XADA 5H02A 5CK5A 4Z3KA 2WWWA 4EWLA 1PX2A 3G0OA 4ZARA 1YR8A 2V96A 3DAOA 4KVFA 3LX6A 4PU0A 5FOUA 2QK4A 5E9JA 2A1UA 1OX5A 1OLUA 3K4PA 2WSSA 4YFVA 3RTAA 3ABZA 1E2LA 1OTHA 3EQ6A 4FUQA 3UUGA 5HIAA 1JG1A 2PGJA 3DEFA 1THMA 4WEOA 5K3FB 1C7RA 3MJFA 1OV6A 4LOIA 5CLFA 3D8SA 1AKYA 4PFSA 1XPRA 4G4SO 1DGQA 1VBNA 2JLUA 2RJOA 4NL4H 5IYZB 4LIPD 1FJXA 3NOVA 1GSHA 1UWVA 4TWBA 3SQMA 3EIFA 4A27A 2DYKA 5D3KA 5JJ5A 2VTBB 3QVMA 4JI3B 1P1CA 1ZEMA 2C9MA 4TXLA 3EXAA 4MV1A 2CLEB 3WMXA 2NZYA 1ZFNA 2R2AA 2PO5A 1SQGA 4HDKB 1SUSA 3A27A 3WGNA 3GGGA 3T0IA 4DRYA 1NI4A 3KEFA 4JIMA 1H6CA 4I50B 1IHPA 1J1UA 2RBKA 1PZFA 1TLTA 1YJXA 5KSWB 3ZBTA 1QO0D 1TLLA 3HKCA 3DMFA 4QNMA 1Z26A 4JBIA 1KVRA 3SR0A 1JDVA 2Z08A 4UVGA 4PCLA 2BFOA 3KSMA 3PQ3A 4AZTA 3R9XB 1H22A 5KAMA 3HABA 3U9TA 1XB2A 1Y3AA 4H35A 2PGDA 1N1EA 1KYWA 2EIXA 3V32A 4BVGA 1UH5A 1YVRA 2VHZA 4WBNF 3OQBA 3RK1A 4BMPB 3FE2A 2CWWA 2J6IA 3FMPB 1CZKA 1LUAA 1NMEA 4YRFA 1Z08A 1ZK2A 4TV8A 4WFJA 2C54A 2YR0A 1Q6ZA 3SXPA 1EDOA 1BKDR 5C32A 1HT2E 3S2IA 4WMLA 1ACLA 1I7QB 3U7EB 1ZISA 3H2SA 1IHXA 3DEYX 2HBQA 4PWYA 3MZ0A 2COUA 1U8EA 2PGIA 2WA2A 4LJ5A 1KORA 1SBYA 2X86A 2C2YA 3AR8A 4NFHA 4WGGA 5DX8A 2JGFA 5IUKC 1GR0A 1G38A 4L75A 3DTYA 3FFXA 3UK7A 4G65A 2PGXA 2EL9A 4FFOA 3RVPA 4YRAA 2VYND 4AP9A 1CFJA 1H6AA 5B64A 2F9FA 1NG1A 4QAJA 1QGOA 1Z5ZA 1EZ4A 4J4HA 5JPIA 5CFRA 1DG9A 2AA3A 3A6LA 2FGJA 1CNMA 3KWJA 3R5FA 4N12A 1MC5A 2UVPA 4NABA 4X00A 4YAFA 1GEGA 4DCVA 2ZXUA 1TAUA 5HIIA 1LFDB 1P75A 4B79A 1U3GA 3ANYB 2GTHA 1P2DA 2GZRA 1Z4QA 3IERA 3PF9A 5CGZA 5HCIA 4MKXA 5HUJA 2I1VB 3FVRA 5IZCA 5JVDA 1EI9A 4O0MA 2VCHA 4D9JA 1FE8A 2IOQA 5K8UA 3IBTA 2QQEA 3PFNA 2DGDA 4GL2A 4YRJA 2OAP1 2AOXA 5HM8A 2F3QA 4E94A 3ZHRA 2QM0A 3H8SA 2GTPA 1JSXA 2O2ZA 4WY5A 2AZXA 2C00A 3WGMA 5F1OA 4NPAA 1FMFA 2PZFA 2C2ZA 3BS4A 5JY1A 1SKUA 1LPSA 4MKGA 3L02A 3AK4A 5FB3A 4NBWA 3H6KA 3CVYA 3JAWA 3PHCA 1XK6A 4YUWA 2KHZA 4N3BA 4IVPA 4KCGA 1MIOB 4A8TA 1HFJA 2NUPB 2HA4A 3CHYA 4RESA 1KE2A 2JD1A 2VP6A 4N0PA 4EYQA 5E9WA 2VR1A 4KVGA 3KUUA 2XX3A 3WLLA 1LQTA 3ZNNA 4BB0A 4ID9A 1O89A 1GNRA 1VHTA 4XW2A 1XTIA 4TROA 4QRIA 2G28A 5BUCA 4RTPA 1H1LB 2ECFA 1H6DA 2QA5A 4RABA 4I2VA 4B3JA 5CNMA 2O2XA 1IATA 3KTOA 4WOJA 5EJGA 3KUDA 4D0NA 5CDHA 1QVZA 3QU5A 1UADA 2WKWA 2OD9A 3N8HA 2IYEA 1Y5NA 4N39A 4KXYA 1TA4A 2P0AA 3M6VA 4U6QA 3S44A 1NX9A 2C97A 1JPVA 1WVIA 1YQTA 3P1JA 5ANRB 1G2PA 1ADJA 4WZAE 3DVLA 2KLBA 1K7FB 3CSDA 4CIVA 2PBFA 3DOFA 1W581 3AUSA 5TEWA 3MT0A 1R88A 4XWWA 3E3NA 3EGXA 1NFFA 1GIAA 5DNWA 3H7AA 2IPMA 2HIMA 1NU8A 1OFIA 3H2YA 3KPYA 3LKZA 4ZT3A 2CXQA 5DTQA 4EARA 2ERCA 5KYWA 3PPYA 4YJGA 4CMJA 3IEMA 3ZE1B 1U3WA 2QS9A 1HTBA 3JQPA 3JU3A 5ALNA 3HKBB 1RYMA 1TI7A 4FOPA 1INLA 1T1EA 2BR3A 1EK6A 1U2PA 5CB0A 5AW5A 3OEHD 1ZJ6A 2C8KA 3GJTA 2OV8A 3NEAA 3NTUA 4KMMA 3UXHA 8OHMA 1EFVA 1UKAA 4RMNA 3U4GA 4MI6A 3V8EA 1AB5A 3DNMA 3A6HA 4TV9A 2AN4A 4ZT6A 2WSMA 4OQEA 2CZQA 2OCDA 3AETA 2I2FA 4G8BA 3I4LA 1WQ3A 5F98A 5DE3A 3PQEA 1C8LA 3BEDA 3K31A 1RABA 2CVHA 4QWWA 4FDUA 3UH0A 3PKZA 1PL8A 3WHLA 1MA0A 4FB4A 5MDHA 1APBA 4RJJA 1E2QA 3IAS6 4R4JA 3PNYA 3DW1X 2IHBA 4PRLA 4U8HA 1DQYA 3MINB 5F3DA 5KO2A 3OQ1A 5LBUA 1BS9A 3G9QA 5AVTA 3M8KA 3ZDCA 4LV8B 3DLPX 2NTJA 5AOVA 3TH5A 1PQPA 3ZNQA 1XLUA 2IOYA 5JYCA 1WV1A 1Z6AA 2HWXA 1D2MA 5DHRA 4UU0A 4X3CA 3RHSA 4WLUA 1MOSA 2BJHA 4MRMB 2ZATA 1TM2A 4TYPA 4CM9A 4YIHA 3R6TA 4LMAA 2YBEA 4BO8A 2NG1A 3UFBA 5C2JB 3DBLB 3OEWA 5A5DA 5LYJB 4ZAXA 3HDJA 2BGIA 2EIHA 1C8BA 5AIAA 1V8ZA 5LVAA 1PIWA 2HSGA 3WNCA 3HO8A 1DHTA 2YIDA 4C2TA 3N70A 1E1DA 2XUKA 2NU7B 4BGIA 4PN7A 3F78A 4UEKA 1I2BA 5FA8A 1I3CA 4E88A 3FDXA 3K1YA 3QZUA 4NAUA 1S2DA 2PBZA 4M9XA 4ENTA 1O87A 4UTNA 1DKMA 4GUAA 4YRMA 2YWGA 1KO7A 1PKEA 3GAZA 4YMTA 2X9NA 1O6BA 3IC5A 1HSOA 1N9KA 4WN3A 3VO8A 1XQXA 3ZGZA 4WCFA 1WBJB 2J7KA 3IRUA 4BAZA 3Q0TA 1BHO1 1SCBA 1ECCA 4XD7D 3FGPA 1K92A 3RUIA 2R84A 1CYDA 1TLFA 1T1IA 2QG6A 1UFOA 1VJ0A 2FMIA 2Y4NA 2YCLA 4NQZA 3CPJB 3LA8A 1XX6A 3UFXB 2EFHB 3FKQA 2ZQZA 1NT4A 3FWNA 4GBJA 1O0SA 3N8KA 3FWKA 2ATIA 4WI1A 3NR2A 4EX6A 3VKUA 3UV6A 4X8HA 3BDVA 4ZU3A 4HKTA 3P94A 1J8FA 1R0SA 2C5GA 3TK1A 5JC8A 3OBBA 1U2RA 2CF6A 2MDTA 2YS7A 4R1SA 4Q9JA 5JT1A 4LDZA 5JOQA 3ZXIA 1HFKA 5C8DA 1OYWA 2AIRA 5FULA 2A57A 1I14A 3JQ9A 3WI7A 3LVBA 3U3ZA 2X0RA 3OC6A 5LQSA 1RXIA 2F8LA 2B37A 2HGSA 3FW1A 3QPDA 4FOTA 3A1FA 4HWPA 2C31A 4NDNE 1V16A 4P7JA 4RLFA 4YPFA 4A91A 3ZHSA 4C14A 2HK7A 4NWIA 4CEIA 3VDXA 2ZB7A 5KDDA 1U2GA 2E89A 4BLRA 4WZAB 3WMWA 3H0CA 1LA2A 3OKFA 3RVLA 4NULA 2VF5X 3VC7A 5EWJA 3MILA 4CV3A 5SZJA 5LP6A 1EXWA 4CI9A 3FUVA 2RGDA 5KJFA 5JPDA 1KETA 1O9HA 4FLFA 4Y1RA 1Y3HA 3HS3A 4GPEA 2FEKA 1N36B 1JDPA 1ES9A 3SX2A 3LI2A 3B7GA 5I9NA 2M98A 1JJAA 1ZCFA 4F2DA 2FFJA 1YHNA 3ZZ1A 3U17A 2H4HA 2YWJA 3BWXA 3AR5A 1OWPA 1O3YA 4L5AA 1A04A 1USGA 3BSFA 3GJRA 2ICAA 2XE6A 5ER9A 2GMWA 4FSXA 5JQGF 1MNQA 2OVFA 4HMOA 4LXUA 2OD7A 2F43B 3F6PA 4Z9FA 4RFVA 3RS5A 3PWZA 5BSKA 3IUNA 4FIDA 4UJ3A 8LDHA 1N1GA 2QUZA 2W2OA 4OFZA 4B82A 5HZKA 3GQVA 2Q2VA 3ABRB 4WESB 3CONA 3M5WA 1HDRA 3LQ4A 5DW0A 1JDNA 1A77A 2GM9A 4NVRA 3VYSB 2PR7A 3EOBI 1JEYB 5EXDA 4HZGA 1TZBA 2DBZA 4YJ3B 2EX1A 1TYEB 2X3YA 2JAQA 4IL5A 5P8WA 3HKEB 3VKVA 4DA8A 5CA0A 4OQLA 2E82A 3TAHA 1RC0A 3D6TB 3V4SA 5ADWA 1NASA 3ZZ0A 4TWZA 3U7IA 3NI2A 4MUIA 4HFNA 2IYZA 5DCUA 4MUAA 3FOBA 4BYGA 1N3YA 4C29A 2XLBA 2PTHA 4WY8A 3ZWKA 1GKYA 1PJCA 1T36B 2RAPA 3FNIA 1O5TA 3N2YA 4ND6A 4QFDA 5FKJA 2HHHB 1K9SA 4TTIA 4P3XA 4PHCA 1ZN9A 5LQAA 2OKCA 1WSDA 1YZTA 1IU9A 2EJWA 2AI2A 3C48A 5L9AA 3G1TA 1ZNWA 3NCHA 4UDXX 4OXKA 4P33A 2EFJA 2QPOA 4H0NA 1NC3A 3VZCA 3QLVA 3WJ7A 3HZRA 4BV8A 3UOGA 3H8JA 4LDAA 4D0GA 2WJWA 3OY7A 4IV8A 1E9RA 2CDCA 1R50A 2RGAA 3ETNA 4UU7A 3U31A 3M6UA 5C52B 2UDPA 3OQIB 3THOA 3OICA 5KNBH 1BRTA 4OQDA 3BDAA 4PZUA 4TT8A 4EHNA 3UT0A 1V1RB 4FFWA 3GCDA 1O9BA 1V3TA 2ZYTX 2EDAA 1EG7A 1W9HA 4R5HA 3UWKA 4B1FA 5JNLA 4R1OA 2ZI3A 4IPTA 3OLXA 5C5EA 4QJ5A 3QY9A 1L4BA 4PCVA 1NVWQ 1KYZA 3DDWA 4QM6A 4AZ0A 4C7KA 4EJ6A 4COKA 2YKGA 3AHIA 2RGYA 1FFXA 2VSOA 2AMFA 1UT6A 2JFZA 1XWWA 4GKKB 4BVBA 2QROA 2WB4A 3ONEA 4XCQA 4GGPA 3MWGA 1ADCA 4CI0B 5CBPB 3RTCA 1XCPA 5TGZA 1U9IC 4YBZA 3FLAA 2FPGA 1CY0A 3X1JA 4CG2A 1UBJS 3PKJA 1DRJA 1TUBA 1XMIA 2Z30A 1YOVA 4XAQA 3S1SA 2PUVA 4O4IB 4W9NC 421PA 4C4YA 3RYCB 1WU8A 1JBEA 1I0LA 2PQ6A 3O8RA 4RWZA 1Q0TA 1SXJA 2B21A 2WFLA 4HAXA 3SE0A 1ZMBA 4YRIA 3BWBA 4R31A 3KQYA 4GX5A 1TKBA 1WQ4A 1XN4A 3KLMX 4D8YA 4MI3A 4PG7A 3KYCA 2W9XA 4UHHA 1YS4A 2IS4A 4TQ9A 5A5GA 3P32A 1WZEA 1T9HA 3IEXA 4Q1VA 1NXVA 3DZDA 1K89A 4JXKA 1U0HC 2PUAA 3H84A 3G7UA 3HKDA 5KVCA 4UQLA 1IG3A 3TR6A 4GLLA 4LZZA 4CT0A 2GNOA 4PLGA 4NU6A 2I8LA 2VWQA 2QD2A 1Z6QA 1OBHA 1KEZA 4R0VA 3IAXA 1EFLA 2I7VA 4YLEA 4AROA 4EG8A 4ZZ2A 1K6IA 2G63A 4R1PA 5TR9A 3QW2A 3VR3D 4W5RA 1ECFA 3K1ZA 4JLKA 1XWIA 4FZ5A 1VLVA 1IBSA 3ORSA 1NFQA 1Y1QA 3N07A 2IODA 3MMNA 3TOXA 4YFYA 3V4LA 1E3IA 2N42A 1SVLA 1L3CA 3VO2A 5LIPA 1QHGA 2CNWA 3L18A 5NULA 1X8KA 1SUAA 1BEZA 1GAXA 1EM6A 3FGOA 3ZGYA 4F38A 3OTWA 2B8JA 1ZXLA 1E79D 2X5KO 2M2IA 2J9FA 2BC9A 1ORTA 4KW7A 1E3QA 3GEDA 1P8JA 4LY9A 5EPOA 3JQFA 1M1NA 5TEVA 5CXSA 1R64A 4QO8A 3DULA 4JJ8A 2C2BA 4WACA 4IZOA 1XXHA 2CFIA 2PT5A 4KZPA 2N0SA 4Y30A 4ZEOA 1Y4UA 2GEUA 1LFAA 1HM5A 4QQFA 1WA5A 4YMVA 1BDMA 1DIBA 2QZ4A 2JF0A 1Y6QA 4PLFA 1B4DA 5KOHA 3BKXA 3KC2A 4RF5A 5WRFA 4G1VA 3E3LA 1WP9A 4DDUA 1YE3A 3EQZA 4FYPA 2RHTA 4FZRA 4HWOA 4AN1A 4Z54A 2MT9A 1QG6A 2BSQA 2OHGA 2Q8PA 1NJSA 2JGDB 3BWMA 1RADA 3KCQA 4R1LA 5EKTA 4U2BA 1N5RA 5I9MA 1E77A 4Z4IA 1II0A 3R0XA 2Z6UA 4Q05A 3RFVA 1AXGA 2BI4A 2PNJA 1I0ZA 2ZUBA 1CQIA 3MIIA 4HQ6A 1IB6A 1QH8B 2FN8A 4LOLA 3V1TC 3UBTA 5FAKA 3AVQA 3N8IA 5K0JA 4RK0A 3GXOA 3GRRA 4IXDA 4DG9A 1XYVA 2XY4A 3AFIA 1FSSA 1TMYA 2J7PD 2QGFA 1Z36A 4MUXA 5DRYA 2I8AA 2QD4A 3RKSA 1VG8A 3EEFA 4JLMA 4OMDA 3W9BA 2WDZA 4ER5A 3O6VA 2O8CB 1Q0RA 4G2TA 4M76B 3ORYA 4YWHA 4XWGA 3ODPA 2XKBA 5IASA 1QV7A 4WINA 4DAEA 2E2WA 1FC0A 2I4IA 3C4JA 1SXPA 1Q11A 4OMUA 1JF8A 1SC4A 2JJ2D 3OLVA 1I30A 2XA9A 1U7XA 3JY6A 4PV7A 4QDUA 4PO3X 2HGZA 1FDTA 3DNPA 3GPBA 1DKRA 1FRQA 4XPZA 5JBQA 4O3MA 1IZ8A 3DF7A 5ES3A 2GRJA 1MC4A 4I8XA 4E0BA 1Z13A 4F91B 3LFTA 2V58A 5CM2Z 5KWJA 5FTMA 4DV4B 3O83A 1QRUA 2FWAA 1W1UA 4IYRA 2LW7A 2JFPA 5EE0A 1J06A 4S1TA 4PRYA 3ZCUA 1AA9A 3GRVA 3C15C 2ZE5A 4HDRA 3VR4A 5BUSA 1A9YA 3QUAA 1T1SA 1KI6A 2IYUA 1Q92A 1PWZA 2IXFA 3HCBA 1CUZA 4IIJF 4JLNA 121PA 1S96A 1MJGM 1LVGA 4RPGA 4UE2A 3DVQX 1W49A 4RGBA 3R76A 4XIJA 1SG0A 2Q9BA 3M1AA 4M6WA 5DSTA 4C4TA 5M04A 1EP9A 5DGHA 1P0CA 4PLTA 3BRQA 2H8KA 3BJIC 5HJ2A 4M8NE 4G81A 3LHFA 4NR0A 2J08A 2XMCA 4NU0A 3WB0A 4JSRA 3ZIAA 4CCYA 5JH7A 1LLCA 3U1BA 1RKXA 3U4QB 2R3SA 1KE1A 5K4HA 1CKEA 4NCKA 1P77A 3DSRA 3IAAA 2JGMA 4G1CA 1MB2A 3DG9A 5FI0B 3TW0A 4DLXA 2YZ2A 1WXEA 3GJ5A 4DT1A 4Z51A 4B80A 4R8KA 1AV7A 3L7BA 4YMIA 1HUQA 4KXLA 1FFDA 2FRDA 1M6WA 4WOCA 4KLCA 2BEUA 2ZI4A 4J2TA 4YMHA 1LBTA 2C77A 5JRDS 4PQGA 3D0RA 5FBVB 3BMCB 4ZO7A 5JXJA 4L6CA 1MF7A 2J07A 4H1UA 5AHWA 2YVAA 1S0UA 1SPBS 1EAYA 2W8ZA 3CMMA 3FOEC 2JBWA 4GZ3A 4ZHQF 3JWGA 3B1XA 3ZE7A 1OJ7A 3DMHA 3RC9A 1DQPA 4LCEA 1C2TA 4PGHA 1FK8A 1KVSA 3D1LA 3U7QB 4EFMA 4ZKDA 4GT1A 1WF6A 2BEVA 1QORA 4FYIA 4G5GA 3T5CA 3L6CA 1WIWA 2QLLA 2YX1A 2C5EA 4M0KA 2G9RA 2WTMA 3IV7A 5HRUA 4DHEA 1D03A 1XJQA 1KDOA 2EJTA 2GS9A 2JFYA 1HURA 3LCCA 3LCJA 1Y0BA 4O5AA 5U4QA 2DBRA 1QOPB 4GXNA 5BNTA 1G18A 1SOWA 1FTGA 1BXRA 2QPAA 4Q1DA 2ZBQA 3VR5A 5H16A 2AVNA 2WF8A 1NQVA 3ILXA 4IDNA 3RFCA 1S2NA 1I94B 3PNOA 3ANTA 1R6DA 1WXIA 2JHAA 3B3GA 5A02A 1R18A 3K16A 1DT3A 1GL9B 2Q6VA 3HCCA 5F1PA 5ITSA 3OURA 3TLKA 2C83A 3HB7A 2CVZA 2HMWA 1PJSA 1U7OA 2HB6A 1US8B 5ITVA 5C8YA 5DOVA 5JZMA 1OH5A 1YAJA 3NBQA 2VKQA 2FVYA 1A7KA 1TGVA 5AJXA 3AH8A 1FCJA 5SZIA 1RXUA 2XA1A 4OHPA 3WWOA 2JKYA 2O0MA 3QVTA 2ZRNA 3H5LA 3P9RA 5DYGA 4YGXB 3Q8MA 4RF4A 4YCDA 1SK9A 1PX0A 3HYCA 3IQIX 2O50A 1MH1A 3DLIA 4EW1A 4O2AF 1WXQA 2IT1A 4YEDA 1WUTA 2JI7A 3QP9A 3SKXA 3IJRA 5HGJA 4Y9SA 1ZX1A 3TD2A 2W43A 2AG0A 4ENUA 2GI4A 1MUUA 2BEWA 4MCIA 4JOSA 1IZ7A 1RZRD 4B3CA 2GD1O 2P0YA 4O2BA 3VVLA 3KPVA 1GTRA 4O2LA 1HDYA 3QUSA 5HCUA 1BG6A 4H6PA 1XCBA 1D6JA 2WUDA 1OH6A 4LX8A 3GT7A 5FA6A 1I01A 2V6BA 2E0IA 1KS2A 1CJCA 5FLEX 5K6RA 2BTEA 3TUZC 2D3TA 1T0HB 2V6JA 4DUZB 1U1CA 3MTQA 1HWYA 2R7KA 4C7BA 1KA9H 3QFRA 5FWXA 1QBKC 4HYTA 4X45A 3UCEA 2IFTA 1JG3A 1AK9A 3L8MA 3VPGA 3QUTA 1Z4PX 4EJFA 4LC1A 2ZRBA 3AKZA 5BPFA 4CQNA 4XXHA 4TSFA 2AFRA 2BUBA 4PSCA 4IMIB 4OUDA 1Z2NX 4JU8A 3LNTA 2QTNA 4KSCA 4D6YA 3JQCA 1RACA 1LH0A 3CW8X 3UICA 3E1KA 3JZDA 3SM9A 1H2WA 4F9GA 3KKNA 1ZM4A 1ZRNA 2X0IA 4EHBA 1CZOA 4I6JA 4DR5B 2ZVPX 5FOSA 4YP0A 3DV0A 3LBIA 2ZPUA 2Y1CA 3NPMA 3IQDB 4X95A 4JT2A 1LF5A 1JHXA 1ZRHA 1QB8A 3VX4A 1CZHA 1TFRA 2QM7A 3KR2A 3OT1A 3N76A 1K86A 3OZAA 3G2KA 3MTIA 4CFYA 1H23A 2IDZA 1TQDA 2WHQA 4EUSA 2QN8A 3C39A 2O1SA 4I14A 4UU1A 1GZ6A 3RRMA 3KSZO 2G9ZA 3FKSD 4M0PA 4PC2A 1UPCA 5IP5A 4C22A 3PA6A 2CL6X 3AUFA 4L8YA 3LW8A 2H7VA 3EG9A 4NP6A 3P2KA 4QREA 3QGMA 2VOJA 5LMZA 4RCYA 1UBNA 5SY9A 3DYVA 5C8VA 4NLLA 2P2LA 2JAUA 4QHYA 4JZYA 2YIMA 3AERB 1R0KA 1RRKA 4R9SA 4ZRDA 3JQAA 1IDN1 4UE3S 5FUYA 2H0AA 2ZWOA 3WXBA 4E46A 5JS1A 1VC2A 4PHFA 2LPMA 2EWMA 1AU9A 2W2KB 4MRRA 1C3EA 4U5QA 3F46A 4PFKA 4NBRA 1JQJC 1Q22A 3K9HA 1J8VA 4L08A 4Q4JA 1HDOA 1WR8A 3DWGA 3O3CA 3OAAA 2CLDX 2AQ8A 1BWQA 5FAXA 2EVWX 3K0FA 4RD6A 4YCJA 2JD0A 3ESXA 5DBFA 4B85A 4CM4A 5JATA 2C20A 2IZ7A 4DB4A 3EY9A 2AG6A 4RVOA 1BKYA 2ZW9A 3GIDA 3T9DA 5AJUA 2OCBA 1G3UA 1P9RA 4EF4A 3C98A 4XWOA 2CL0X 4RE5A 3ZZTA 2OD2A 4TMZA 1VLMA 2W8BA 3CF6R 3QQPA 3VO9A 3O95A 1BKSB 5LB2A 2PX4A 1PD1A 4H2DA 3FYUA 2XHZA 3PGMA 1VLQA 1DC7A 1H5NA 3L4KA 1QAOA 1IJBA 1ILEA 3AHEA 3I9OA 4F8EA 1PLLA 5K8VA 2YMMA 1EFKA 1K8QA 2GXQA 3WTCA 4E03A 3RSLA 1IN6A 1GZUA 2E4WA 5K4AA 4ZI7A 1AQUA 1JP7A 1YVEI 3KB6A 1G5TA 3FRIA 4YJKA 3WMRA 1OXTA 4DRXB 4MMYB 4OJMX 4Y7CA 3T35A 4G5FA 4OD0A 4ZXPA 1OTYA 1W7AA 1XRJA 2EX4A 5JSYA 4I9NA 3MWEB 3B6MA 3FZEA 3T1QA 2WM3A 3I61A 3PZBA 1C0LA 4QOSA 4O08A 2R6GA 1VCOA 2Z4TA 4V03A 1A9PA 5IBCA 2O5EA 1EBUA 1UBCA 4ATNA 4MKZA 1SKMA 4XTRA 1R10A 1L8XA 3E27A 3RTEA 4NENA 4TYWA 1JKFA 1KARA 4EI2A 4JJKA 1VL5A 1Z4LA 3CLUD 3WWPA 2E3JA 3P2EA 4PE5B 1WMAA 2R8YA 4EAQA 5I47A 4DDMA 3HJRA 2OXFA 3DMGA 3N39C 1Z0UA 3OD1A 1QP8A 1XE3A 2WV9A 3D2AA 1ZJWA 5CJ2A 5IJZA 2XUFA 3JASA 1E9DA 4FGWA 5M5BA 2BLNA 5A6SA 3SF8A 3BRSA 4YAWA 1Q7RA 2I65A 1RT9A 4MS3A 3U09A 3OTGA 4UVIA 2YYZA 3T5DA 4FU0A 4R3WA 2VRCA 3LWNA 1TW2A 2CEAA 1F7VA 1JGTA 4LMRA 3FHTA 3D3WA 3JSAA 3MBOA 2YINC 3DEIA 2VT6A 3IA2A 4JP5A 2COEA 2Z4RA 4X1KB 5EWMB 3OZDA 1CJUC 2PBRA 2V8BA 3H3XA 5EP3A 5KVSA 3OFVA 3S8YA 1S8OA 4DDHA 5EE9A 3AHJA 3PENA 1OI4A 4B6SA 1QX4A 4IOMA 1N0WA 2OO5A 3L8GA 1YZNA 4LV5B 3LKBA 4S24A 4A4DA 2CJFA 3C8DA 1Y5LA 2G5TA 3EYAA 4E7OA 4CT4B 4F97A 3E9CA 3AEQA 3N6XA 1NJ8A 5HM6A 2YRWA 5AM5A 5CCBA 5DT2A 4FB5A 2Q4EA 2CCJA 3PK0A 3VTKA 3SN6A 4TSKA 4NV1A 1T9GS 4U7GA 4DC0A 2EKPA 4HLUA 1THGA 3W1VA 2VHQA 2YHUA 2YVLA 4LTDA 1Z4MA 2GBIA 4MW9A 5H5JA 3RRYA 4C1NA 1ULBA 2FUKA 2I78A 4PYLA 1QH1A 3EC1A 1ABFA 5JAPA 5KNCH 3FF1A 4OO3A 1RAGA 2MSKA 1PHRA 1VMAA 3Q1LA 2BCJQ 2EV9A 2ZAGA 3UMVA 6NULA 4I55B 1IVSA 3B6JA 4LY3A 1B2LA 4B76A 4EJSC 3OA2A 3IMCA 2HWWA 2NVBA 2VSNA 4NATA 3V2IA 1X7WB 3OI7A 4RVNA 4L95C 2FW7A 3U62A 1UDRA 2H1CA 3D02A 3HFGA 4HX2A 2VP9A 4NARA 2ZRCA 4HBGA 2L82A 4ZEXA 4HVLA 1VRCA 2HL6A 4QXPA 1KSGA 2GAIA 3L9XA 3G8DA 2ZJ0A 3OTIA 3D7RA 1D2HA 4E3ZA 1V4BA 3DONA 4HTAA 4Z4EA 1U3UA 3DHNA 2X9GA 2VPWA 1DS6A 3MOGA 3MJTA 3KX2A 4I1PA 2IUFA 3HN6A 3NTLA 4ZIRB 1BFUA 1BX0A 2H51A 4K86A 2JB9A 2OCXA 2ZLBA 5LNK6 1HYHA 3U26A 4UNIA 5FLXA 4IKPA 3KZNA 1H5UA 3B9QA 3CA8A 3SBXA 2DUNA 1LK7A 1DWPA 1J1IA 1PNVA 1QFJA 2ECQA 2ZSFA 4K40A 4EVIA 4NG5A 5LD2C 4RQBA 5DLQC 3DV2A 1JV2B 3Q0IA 4PGAA 1HLDA 1UAGA 3IKVA 4BJ3A 3QKSB 4BLVA 5ICGA 3BULA 4JC4A 4OB8A 4B3GA 2O0KA 3V9PA 1NW9B 2FN4A 1S8FA 3OM0A 1BYIA 1JSRA 4NQRA 2XZLA 3VKGA 1YZQA 1M0WA 3QOWA 4P7BA 4K26A 4DG5A 2IH4A 1PQYA 1P1HA 3IX7A 4CCSA 4BGUA 3PFGA 1NVVQ 1W0KA 3LPAA 3ER8A 2B0JA 2Y27A 2GZSA 1XO1A 2BHNA 1PFQA 3L7YA 2HWUA 1LPMA 3M9LA 1G3RA 3AP3A 1R12A 4G85A 4J1TA 1GTSA 2PO7A 3HVRA 5KHAA 1ODIA 1RHMA 3UHJA 2WK1A 2VXCA 4IRMA 1T4GA 4HQOA 4ZOLF 2OY0A 1XD2B 3EIHA 4G5QA 4G4JA 5KMGB 1JIKA 1KHHA 3D3KA 1JIXA 2OP1A 5KYVA 1C3LA 3CR8A 1VPWA 3TPZA 5IJ0B 4GIBA 4RKRA 4MQFB 3NKLA 3LHKA 4EYOA 5JNUA 1E62A 4J2OA 4P93A 3TCKA 1EX6A 3AINA 3SAJA 1L7NA 2VHTA 3MMZA 3OU6A 5C7OO 1K0UA 2C9OA 3ST7A 3F4BA 1JILA 3PDJA 4GW3A 5BN4B 4P7GA 5C1DA 1YDHA 1Q91A 4DQDA 2GCPA 1D6SA 3QBTA 5B37A 3D7KA 1ZH8A 1JLMA 3DJFA 4H7IA 4UHFA 3V46A 4FHFA 2DQZA 2WPDD 3CT6A 1YNSA 2W48A 2WDPA 3IHLA 3TX2A 5AHOA 4BL5A 4DOMA 3O4HA 5HG0A 1MO6A 5KYYA 1WNFA 4RMGA 2C9CA 1X80B 4IVQA 4XQEA 4GOND 2BLLA 3FVTA 4IJ5A 2JGJA 3HACA 1ENZA 1S1MA 4RFSA 4YCCA 3EFOA 2FFHA 2W0MA 3IILA 2ANCA 3OX3A 2C2WA 4YP1A 4B4OA 2FCAA 3T52A 4WUVA 4BJHB 4C7OB 2K5UA 3C85A 1XMSA 4H7FA 5G4KB 3X44A 1OE0A 1GAQA 2QMOA 4IW3B 1J0AA 1GP2A 4OQYA 1KNQA 2A0WA 5ALEA 3A0RB 1M3SA 2AFHA 5L3ZA 3AI7A 2QT1A 1TF5A 4XARA 3RASA 2C4VA 3UJ6A 1BJRE 1E6MA 2QRZA 2O8DB 1B14A 2AKAB 2W71A 2XMRA 3D2BA 5FO1A 3TLGB 3CJRA 5FJIA 3AW9A 2H48A 1RFLA 2J3DA 3IJPA 1ZGJA 3R6WA 3RNOA 5FA5A 4GRIA 3VUFA 4EUNA 2BFCB 1E0JA 1KY5A 3CUEF 5LFAA 3WWEA 1VKOA 1UEXC 4J0JA 1XQYA 3AT1A 1UAAA 5DEIA 5TMEA 1Z3CA 1Y6GA 4HX5A 1RKBA 1JEJA 1BHJA 5AMXA 5EHQA 4MEBA 4PBSA 4DARA 5LXTA 2DLCX 4E4RA 2O8NA 3UANA 4ROTA 1WDKA 3DBRA 5ALHA 2PJRA 4NCNA 5AVUA 1YZ3A 3OCJA 4WVFA 2Q28A 1A72A 3BICA 2XE4A 3LGSA 4ZO8A 2YMQA 4WFIA 5AXDA 3LH5A 1RWPA 1RAFA 3OZRA 2BGGA 1OA1A 1P29A 1T3HA 4JVLA 1NW5A 4PZDA 3DE7X 1E3WA 5B1EA 1QP0A 4KQIA 3EZNA 2VPXA 4URHA 1RQLA 3AKDA 2DFTA 3VRHA 4TS3A 1SU4A 4MZDA 4HTFB 4MH0R 2NTNA 3C1TA 3ZW9A 1EP3B 1ZD8A 1ABBA 1KXZA 3ASZA 4G1UC 1SKYE 1JEEA 2RH4A 2IWRA 4YYEA 2UUOA 4OSEA 3SXUB 4D4LA 4X20A 1NW7A 4EW3A 3KALA 5ALQA 2QRHA 4Q24A 4CMCA 4CLHA 3DO6A 2PS3A 4H7PA 2X4GA 4Z9AA 1S01A 4GXQA 1J07A 3K53A 1Z88A 4Q9DA 1UJBA 3SQLA 2BGTA 2JK1A 3DVAA 4DJFC 3FCYA 4XJSA 1LX7A 3A6GA 3H2JA 4WNCA 4C0JA 1WVGA 4U7HA 1IWOA 2KWIA 2WSBA 3BCSA 3RKRA 4CMAA 1RJ9B 3Q3JB 1AY0A 1J2EA 1H3NA 2OGUA 2QHXA 3DAFA 3I9MA 5E1DA 4M21A 1BMQA 1K08A 1L5LA 3TBHA 4BU0A 1I1HA 5EN4A 4CIAA 1T5HX 4E31A 1U7HA 2DQSA 3U5TA 2FZGA 2RH5A 2VQSA 4RA9A 1SUEA 1GGFA 4N9QA 3LBAA 1CQXA 1PS0A 5A0VA 2EF0A 2MR5A 1NPTO 3AEYA 4OGKA 4OTZA 2V6IA 2P1RA 3P4XA 3R7SA 4CPDA 2ZJBA 3OUZA 4ARSA 3GJ8A 3WGZA 4DLSA 5EZYB 3WMEA 1T3ZA 4QUEA 4UFPA 4LC9A 3HWRA 2PXAA 1J24A 1NVXQ 5AJZA 4HAIA 1U3TA 2OXIA 3ZX4A 5BW4A 1VSVA 5KTYA 3LF1A 2GH1A 3IEIA 3SHFA 3BB3A 2HPAA 4ZN6A 3QYPA 3L4EA 4HS9A 4WGFA 3MVEA 1I1OA 3UA4A 3KB1A 4ZO9A 3S1AB 4DRZA 4GI7A 4IHAA 3M34A 1A9QA 3I6IA 3WXMA 1Q12A 2R66A 3T5PA 4U0KA 4Z7NB 5F1KA 4D99A 3O8BA 5CDSA 3BKWA 1N2GA 3FCEA 4M0CA 4DUGA 1SCUA 4OX9B 4X41A 3JWPA 4CMBA 2IVZA 1ZN8A 1VSUA 5TIIA 2PS1A 1ADGA 1TD9A 4L02A 4MNTA 2ZRIA 1XRSB 3GBPA 3KV1A 3MMXA 4XUEA 2ZCJA 4CRWB 1LC0A 1SBHA 2IY9A 3FOAA 4KUGA 5EXEA 2C8LA 3UGJA 4V2UA 1KYXA 3K8QA 1B6RA 3TZQA 2QJOA 2M6KA 3SHTA 3DJYA 3IUBA 2A1UB 1OLUB 3CLRC 3HNPA 3PQ2A 2IYLD 1PR5A 1UQUA 3RSSA 2H29A 1CUCA 1BDJA 1PLJA 3V7NA 3GVCA 3KE8A 3OCXA 1E3LA 1ST2A 4IWNA 4LSWA 4PGFA 5AXAA 4C89A 3E7PA 4BNKA 4JXZA 3U7GA 3P27A 3PFBA 2JLVA 2I34A 1RP7A 4HZUA 1KPHA 1RLIA 4AKGA 2ZR9A 5FI5A 5GZ6A 4N03A 4JKIA 3H8WA 1RZVA 4DSNA 2GX6A 1EE2A 2A58A 1VMIA 1DDGA 4RGVA 4MQLA 4OHBA 2PA0A 2PZEA 4EEKA 4FC7A 4YMGA 3U6KA 1MVOA 1P61B 1BJTA 2QW8A 1NI4B 3LX8A 1GR1A 3Q7PA 1I9CA 4XRRA 3RRNA 3SGLA 4BWYA 5K3OA 3ET4A 1RM3A 3QXJA 4YAKA 5J23A 2NZVG 3EAQA 4JROA 2QBYA 1VRVA 3ROGA 4BX9A 1RCUA 1E7WA 2H59A 1STOA 3C7TA 3HKCB 4MWSA 5JR3A 2I22A 1V2GA 2QAGA 4NX2A 2JC3A 4HAOA 1JNYA 2D0PB 2WIAA 4YXFA 1Q0SA 8ABPA 1R5OA 2P40A 2IPLA 1IXKA 2A14A 5EUQB 4DZTA 4D56A 1U8UA 1QCCA 3OUUA 1SKYB 2H4XA 3UAXA 1LV8A 2Z5GA 2YFKA 2C42A 1DRVA 3L6RA 4TV8B 1NMXA 3G88A 2Z0MA 3S5JA 1UWCA 5FOQA 3TAUA 10MHA 4UM9D 3C4QA 4P3YA 1YFJA 1E58A 3PXAA 3BORA 1NYTA 3FSRA 2QJRA 3CX4A 3HA7A 2EW8A 1TVCA 2QL9A 4FSDA 2FOLA 4XKJA 1MPXA 1YQUA 3R3YA 2JRCA 4UTXA 3DD5A 5ENVA 5PGMA 3ISJA 1KBQA 2WOOA 3T95A 4U2DA 3UV3A 1JG6A 4R2XA 1N32B 1M0SA 2FSVA 3MTEA 1Q44A 5HBGA 4EKNB 4TWIA 3GCXA 3KKMA 1VE5A 1PDOA 2ZRKA 5AM4A 4LMBA 3RNLA 1QHEA 1VP3A 3EQ8A 3R5HA 1QYDA 2NVUA 1I6WA 4Y2QA 3ZD8A 4IDEA 5DNVA 2UVPB 2YWRA 3A3YA 2NUTA 5HF8A 3EZ9A 3B8EA 2CMFA 1J8DA 1J9GA 1BEEA 5LDDC 4ZCTA 4FK8A 3QF7A 4IFTA 1TK3A 3NC1C 5JVDB 4CIYA 4O4HF 1Z5NA 3FCAA 3G5MA 4GOMD 5ITZA 4FIZA 1JKIA 1RRPA 4BNZA 4ZMBA 5JD6A 3VR6D 2OOSA 4C0BA 3U0VA 3LC1O 2NSDA 3T1TA 3WL7A 1EDZA 1FDRA 3D5QA 3H1BA 2L2QA 3D6NB 5C46F 2AEEA 2Y0PA 2GAAA 5KX5A 1T4DA 4FFSA 3RIXA 2FSIA 5AUNB 1LDYA 1CE8A 1NN5A 2ZYRA 3KV3O 1JAYA 4I1IA 1YCFA 3SYRA 3H2IA 5EUMA 5CB4F 1PJTA 4J9VA 2GBGA 2G36A 3Q7IA 4WRRA 4ACBA 5JXHA 4QVGA 1RBQA 1ESMA 4DCSA 5K05A 1WO8A 2WMOB 3NALA 1J4AA 2ISCA 3RADC 3NNDA 3JAWB 3K0KA 4ZK2A 5BSEA 4MTLA 5A71A 2F3RA 5IJAA 3BJMA 3FLEA 3WL6A 3W6NA 4TLLB 2AL7A 1YS1X 1HNXB 2R97A 3KVRA 1QGUA 1X8JA 2CLCX 2GRUA 4JLBA 3B2QA 3FVVA 1B76A 1ISJA 1HV8A 1ZHHA 3H87A 4M38A 1A1VA 2XIQA 1KYIA 3ZLVA 3QNUA 2A33A 1GKIA 2NO7A 2TS1A 4QG7A 1VYVA 2O54A 2XUZA 1XKLA 2W98A 3PFFA 3KSDO 4HNRA 3II6X 2YJNA 4DMMA 2YC2C 4CIXA 1URPA 1V26A 1OXUA 5TQ0A 1COWD 2OM6A 4ALLA 3UQZA 1TMKA 3H2KA 4F3TA 2PRJA 4G4GA 2B8TA 2B8NA 2UZAA 1MR3F 1GT91 2NO5A 5L3RA 3ZY6A 4W4TA 4A8JC 2I7DA 2AJTA 2TMYA 4GL4A 4L16A 4KO8A 5ALVA 1RJGA 3FDFA 1L5OA 3EGXB 3SS7X 2JJ1A 2WHPA 5AQEA 4CL0A 1Z22A 2GEKA 4J16C 3I2GA 1O97D 4RHCA 3THWA 2QTLA 3H1GA 2KQUA 1FMJA 1JJBA 1UZLA 2P6PA 1ZJ5A 1H42A 3DCYA 3IALA 3KLBA 5TNXA 5KYWB 4F3NA 2C5HA 1UL1X 3AGPA 4OLFA 1KYYA 2ZTSA 4YJGB 2OO3A 2VQFB 5IH7A 1GTVA 4NU8X 2XWBF 2IEZA 2A5JA 2I80A 1L7DA 1MT3A 4Y1GA 1P5JA 1IEVA 1AS3A 2H06A 1PFVA 6ABPA 3VH1A 1EFVB 4E4TA 2NACA 1SFRA 3KJEA 2IYOA 4TV9B 1CDEA 3DDNA 2XCUA 1W8DA 1H93A 4FR0A 2PS9A 3AETB 2I2AA 3I9KA 1NSFA 5IAGA 3U3DA 4JI8B 5F9HA 2BCGY 3EUEA 2JGLA 3D1VA 1AUOA 1IXRC 1UBOS 1GEEA 1I3KA 1U11A 2FG6C 2JI9A 2XMGA 3FGZA 3SYMA 1NW8A 3OFJA 1RQ7A 9LDBA 3GFPA 3JZMA 4GMGA 3QXXA 4RBNA 3SY8A 3TUJC 1SCIA 2IELA 5K4GA 3I8XA 4XWYA 1K8ZB 1JUDA 3WNQA 2IITA 3ZV6A 1Q15A 1EFCA 2C59A 2C96A 1A8SA 3VV3A 1CUFA 4MV6A 2XKAA 4OHFA 1RYBA 1YS7A 4YI3A 2X0DA 4IVNA 1M8PA 2NO9A 1P2UA 2FF7A 4ZDWA 5A1TA 1BO6A 1ZKMA 3KOZA 5GJBA 1WDMA 4V3CA 3QU2A 4RGQA 4U63A 5BQ5A 4JUIA 4DV6B 2RHRA 1V7PC 2GLUA 3M2PA 1KOGA 2LKCA 3ROQA 1F06A 3T3EA 4DADA 1GXSA 3Q3CA 5EJ9A 1HEIA 4N49A 2EJVA 4M9ZA 2XB4A 1JHZA 3T9AA 2AUTA 3IOYA 1T4CA 2DRIA 2NTEA 1N8TA 3QBDA 3PQFA 4MUJA 2JZOA 1DLIA 1OJLA 3UUEA 4DA0A 5FPPA 4QNRA 4HB3A 1ZM9A 1XVUA 3NG1A 4W7HA 3REOA 4KP7A 5F52A 2MCFA 1UM9A 2AQHA 2DTDA 2HBYA 2WRZA 5I7AA 4RHTA 4WCFB 1TCAA 2R9VA 4URWR 1LNZA 3RIYA 4Q7QA 5SZHB 3LTNC 5B1DA 1SQSA 3PLRA 3Q1KA 5TJHA 1F12A 1SZDA 4HH3C 2J0UB 3H6GA 5K09A 4JR2A 1M6HA 4N0EA 3TKAA 3B1YA 1XNGA 4HRVA 5EJ8A 2C5BA 1KC3A 1N8NA 4DR7B 3DXYA 4WECA 1N3BA 4ENVA 1NOJA 1YE8A 1YDMA 4LRTB 3O92A 5AYVA 1KAMA 2X77A 5FV7A 3SLKA 4G4IA 3U6BA 5I4KA 3V8PA 1GCAA 3W3AA 1GU0A 3L7MA 3DL7A 2Q62A 2GPAA 3T7JA 2L69A 1I7PA 2HO5A 4FFBB 1L7PA 4L6IA 5DM0A 1DOHA 2VSFA 1ECJA 3RUEA 4MQ4A 5D3MB 1SXJE 3PEFA 4CF5A 1G64A 5JNSA 1ODCA 2W2TA 1V16B 1JMVA 4NMWA 4CEIB 1NP3A 3COYA 5BV1A 5IN4A 2FW1A 2X8WA 3V9AA 4K5QA 1UEIA 1U94A 3GNLA 4MDYA 4NBSA 2PKEA 3H9UA 4U9HS 4DLYA 5BSHA 2PUDA 1A27A 3FG9A 3LUCA 5EWJB 5LP6B 1MXHA 2JGIA 1R6TA 1CZNA 2P4QA 1C80A 4Y1RB 5F64A 4EKEA 4GZLA 4ZCPA 1ZVMA 3NIGB 4RY9A 1MJNA 3A3NA 2CNKA 5AW0A 4DM3A 4PG8A 2FJPA 3HL0A 4D9KA 1JA1A 2JCYA 3KOUA 2A94A 1NGSA 4B4UA 3LT4A 4KMRA 3KTFA 1ZD4A 2VCYA 2IW3A 4UJ5A 1V45E 3WP1B 2C4NA 1GNLA 2WWIA 4LQLA 1J0EA 3KVNA 1NBIA 4DQKA 5B7QA 4TN5A 2Y93A 1PEKE 1EMDA 3GHYA 2R6CA 4QBIA 3U16A 1XDDA 4XJXA 2E1RA 3H7IA 1W4RA 2WWXA 3DZKA 4NV3A 4ZQBA 5JS8A 5FEUA 3A05A 3QYJA 2GJAA 2GDJA 3E0XA 2GYWA 2ORVA 1NE7A 1HO3A 4IDHA 2Y05A 3NDJA 3OMLA 3BXOA 3GEEA 4MV3A 1KJ9A 2ZS8A 5DMXA 5CA0B 3O1LA 1SMKA 3DMPA 3PHBE 5EOVA 4PAGA 4AURA 4B75A 5HQ3A 1E6CA 5JCXA 1ODJA 3U9SA 3OQOA 4KREA 1XXHE 2CXUA 1AHIA 1QMGA 2GKSA 4RVDA 4M22A 5CX1A 3CX6A 5A4JA 4X60A 1Q1AA 5LQUA 1ODSA 1ULTA 4JENA 4KQ6A 4LC0A 5AVWA 1BOOA 1CERA 1MBZA 2EOAA 3GZNA 3N2KA 3NEJA 4HNHA 4PQEA 4YHBA 5JXIA 4LNHA 3VZSA 2VJPA 3BQ9A 3I5AA 4BGVA 3HV2A 1WB4A 4ZA2A 3N53A 4NCXA 4B2YA 2CLMB 4IQGA 3TQQA 5I9LA 2FX2A 2D1FA 3SYTA 1U1FA 1Z5WA 3KTAA 3LYAA 1NBEA 3I92A 4P9NA 4BVLA 3CKYA 4C5CA 2J46A 2VYQA 2WYWA 3GUHA 3L1VA 4P54A 4EO9A 3PEYA 1RWXA 3F9CA 3X1XA 2F3TA 1TTTA 5T8KA 5K20A 1RBYA