3O78A

The structure of ca2+ sensor (case-12)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
415
structure length
402
Chain Sequence
GPGSSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSFQSVLSKDPNEKRDHMVLLEFVTAAGITLGGTGSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLLKCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIGFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, smooth muscle,Green fluorescent p
publication title The structure of Ca2+ sensor Case16 reveals the mechanism of reaction to low Ca2+ concentrations
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 116
structure length 402
sequence length 415
chains with identical sequence B
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o78A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3o78A01
4EDOA 4M2QA 4ZF5A 1IQ5A 5DPGA 1TNWA 3WLDA 4RTCA 3ZNIA 2GV5A 1H8BA 2QLGA 3NF0A 1ZUXA 2KAVA 2O29A 3SS0A 1LKJA 5HZSA 1Y1XA 2PRUA 3CLNA 1OQPA 3SSHA 4YGCB 1JSAA 1XFXO 4JPZB 4L13A 2MBXA 1L2OB 2M1KB 4I5NB 2OKYA 1GGZA 2HJOA 1DTLA 3U8CA 4DXOA 1Z1QA 5HZUA 3PJ7A 1B8RA 1XFYO 3QRXA 1B8LA 4XVPA 5FHVA 3EK8A 1CLMA 3DQ2A 4ICBA 2HCGA 2LVVA 1V1FA 2QLEA 2CXJA 1XYDA 1YVHA 1EMCA 1LA3A 5H88A 2E6WA 1CDNA 2LNKA 5LK4A 2HQ8A 1U5IA 3CR5X 2F2PA 4HVFA 4Q7RA 2AWJA 4W7CA 3CD9A 4JFGA 3TMRA 2LVJA 3G9AA 5EB6A 1EMMA 2KGBC 4DXIA 3LF3A 1AK8A 1AP4A 1KQMB 2L4IA 2B1UA 1UHJA 2LMTA 2DUIA 4YRUA 2PVBA 5HZTA 5ER4X 4HRGA 1Y1AA 1XA9A 3EKHA 3KCSA 5BT0A 3DPZA 2F33A 4B5YA 2D8NA 3DF0B 2A47A 4BDUA 3EKJA 1CFPA 4OR9B 4OVNF 2KYFA 5DQMA 4PFEA 2O60A 3DQOA 5D69A 1EMLA 2H61C 1A4PA 4KW9A 1Y0VH 1RWYA 1NX0A 1LINA 1UWOA 2KI4B 3DQ8A 2LCPA 1KQMC 4P5OE 2I7AA 3SJSA 1CB1A 4JQ0D 2A48A 5KSZA 1CTRA 1SYMA 2B3QA 1QYFA 4W6FA 4P2YB 4XJKB 2DUFA 1YUUA 1QLSA 1DGVA 2MRDA 1OMRA 1PVAA 4CFQA 4OJ0A 3SVDA 5AANA 1LXFC 3BOWB 4GPLB 3CFAA 1QX5B 2R2IA 4IK4A 2V4EC 3DQKA 1YHGA 4W77A 4CPVA 4IK5A 1JC1A 1QATA 3DVEA 2KI4C 4RYWA 3U0KA 2P4MA 1CFFA 1UP5A 4Q7TA 4XYNA 1TNQA 1TCOB 1XFUO 1WLZA 3D0YB 2RGIA 4R6DA 1CMGA 1DJZA 3ST3A 3RWAA 2IOVA 1QY3A 3LLEA 3GOFA 3BUXB 1XQMA 1NPQA 4DRWA 3SSVA 3UFZA 1NSHA 1S3PA 1S1EA 5LTQA 4TNCA 2ZRSA 5EXCI 1NCZA 1CFDA 1WRLA 3BUOB 3CWGA 1W7UA 2CT9A 2H61A 1OZOA 1AVSA 2Q91A 4FQOA 2FZUA 3H4SE 5CSFA 3NXAA 1PSRA 1UHHA 4FTGA 2V53A 3SVCA 4KGFA 2DDCA 2TN4A 1X02A 4ZCUA 2A53B 1DGUA 3DF0A 4W6AA 4MRXA 1XK4C 2V4EA 1F0BA 4B30B 2G6YA 3BYAA 4N1FA 4KW8A 3A8RA 1F54A 1QIWA 1YX8A 2OPOA 1V1GA 1OXDA 3DVJA 5BQLA 5T3IA 4XGYA 1MUXA 1HQVA 4GESB 2Q57A 2PXWA 4XJKA 1W7JB 3BX9A 4ZBLA 3U8PA 3BOWA 3KPXA 2JT8A 1EXRA 1TNPA 2G16B 1KYSA 3IF7A 2GX0A 3EK4A 1MXEA 1N2DA 1BG1A 4Q9WA 1CM4A 3ED8A 3D10A 3K21A 3NSKA 1Q4CA 1WY9A 4PPJA 3LS3A 2KI6C 2KQ6A 4U2VA 2JNXA 4L12A 2OTBA 3D0YA 2A50B 5CSJA 1GGWA 1H6RA 3TS5B 1NYAA 1EMFA 4W6IA 2Q6PA 1XMZA 3SSKA 5J2OA 1SR6C 3O2PA 1K9UA 2BCBA 1AHRA 1RK9A 2LLUA 1ZGPA 3W1CA 1N0YA 4J8AA 1BR4B 2K0JA 3DPWA 1XK4A 4AS8A 4W6NA 3CFFA 2H2KA 2WURA 1KQVA 1WRKA 2LVIA 1YUTA 2LE9B 4C0KA 2LHIA 1QVIZ 4MVFA 3WHTB 3TS5C 1YVLA 1S26D 2JOJA 1MXLC 2GW3A 5DKRA 4R1EA 5EHUA 1C7WA 2G5ZB 4W72A 4Q04A 4N3DA 3SVSA 1BLQA 2H5QA 2HPSA 4OGSA 1W7IB 5BPJA 3NEZA 2ISDA 1IH0A 1YHIA 5B8IB 2L98A 3RM1A 4H3MA 2JT0A 4AR7A 3LK0A 1IJ5A 2NCOA 4W6UA 4GAOA 3ZTFA 4MRYA 1RFJA 2L2EA 5EBJA 4ORNA 1XSSA 2WC8A 3EK7A 3P28A 2OJKA 2O5GA 2POXA 3EVVA 5J3XA 3UG0A 4OY4A 1FI5A 4D1EA 3E5VA 1J7QA 4AOMA 3GJ1A 2HQWA 3SVRA 1JWDA 1FW4A 4N1GA 4H48A 3SG7A 4LJBA 4OCIA 1UHNA 3WNXB 4W6BA 3BXBA 1NCYA 1CDMA 2LANA 4ANJA 1QXTA 5DKQA 1KFXL 3BQ3A 1H4UA 4KGEA 2WISA 3CFHA 3I5HB 4HQCA 1MWNA 2K2FA 1KFXS 2KQYA 3GL4A 2HFCA 1GL4A 2NZ0A 2H8QA 1DVIA 2HGYA 3CS1A 4YGAA 1ZGQA 1EMBA 1QVIY 3DQFA 4W74A 4USLA 1SL8A 1KSOA 5I2LA 1MR8A 5HKYA 5H89A 1YRTB 1K90D 2COLB 1B7TZ 2QLIA 1ZACA 3GK2A 5GQQC 3NT9A 2M9GA 2VAEA 3I5HC 5AXIA 2AHAA 1QIVA 4W7FA 1TRFA 2AWLA 3SG2A 4P1QA 1CKKA 1KK7Y 5DU0A 5IBWA 3FIAA 2LP2A 4JGEA 2JNFA 4DXNA 1Q4DA 5DTYA 4MEWA 1KFUL 2JTTA 2A56B 2AUCA 3CTNA 5F9GA 1D1OA 1IGVA 2Y0GA 3E5TA 1QJTA 4BY5A 3CR4X 5HZOA 1QV1A 1UURA 1KFUS 5DRGA 2LAPA 1B4CA 4Z4MA 3BUWB 4CLNA 2GGZA 4DUQA 1CLBA 3SG6A 3WCKA 2LHLA 3DQ1A 1IWQA 2KBIA 3KO0A 3TUYB 2M0RA 3C1VA 5TNCA 2FWQA 2BL0C 4KF4A 3PM8A 1G33A 1SMGA 1S6IA 2ZRTA 4PHNA 4HQ8A 2JRFA 3V3DA 3DPXA 1S6CA 1JBZA 2H5OA 4ZFSA 2IS9A 1IQ3A 2V4EB 4DXMA 4DCKA 1NUBA 1LA0A 3E5WA 2KDHA 1J7RA 3RWTA 5HLOA 2JADA 2BE6A 5FVFA 3TUYC 4AQJA 2ZO6A 3I5IB 4M2OA 3NSLA 4RYSA 2ZNEA 4PDZA 4J88A 4EULA 1BR1B 2C9IA 1IKUA 2EMOA 1YURA 1MOVA 4NQGA 2F3ZA 3NEDA 3PFVA 1F8HA 1YJ2A 1NX1A 3SSYA 2JZIA 1CM1A 1NWDA 3KHEA 5FYXA 2GX2A 2JWWA 2EHBA 2Y4QA 1SRAA 1K9KA 3A4UB 4YGEB 4E68A 2ZMWA 4W69A 1JUOA 1DT7B 3WLCA 3I5IC 1YUSA 4W6OA 1WDCB 3OSRA 4HSZA 2K8MB 4MBEA 1Q80A 2PXSA 3CB9A 2CCMA 3PN7B 1PALA 4A4CA 3VRNA 1AJ4A 2FCEA 3IP2A 3VRQA 3OHMB 4C0JA 1CDLA 1JF0A 4UPGA 1TN4A 5HYDA 3VROA 2FL1A 4W6LA 1MQ1A 2KFHA 3CD1A 1SY9A 2VVJA 2GGMA 1MOUA 3GK1A 2KYCA 3VRRA 4QJ4B 1OE9B 2HQZA 1CFCA 1KK8B 4Z4KA 1AUIB 2LUXA 4W6GA 3W1DA 1Q4BA 3WXAA 2Z6YA 4R6BA 1PVBA 4NDCA 1BODA 2YFPA 3DVKA 1WDCC 1JFJA 2MLFC 1WLMA 2DD7A 3EVPA 3O78A 3PN7C 2KHNA 2QT2A 2MLEC 2FCDA 1KWOB 3M22A 3H1RA 2DUEA 2LLTA 1N65A 1XO5A 3I19A 3P8UA 2YE0A 1TCFA 1TNXA 2KFFA 1KK8C 2KFGA 1BMOA 2LC5A 1J7OA 2JPTA 3SG3A 3SRYA 1CMFA 3FS7A 2BBMA 3HCMA 4NDDA 2WCBA 1L7ZA 2F2OA 4MLWA 2ZN8A 2JXCA 4AQIA 4W6HA 1CDPA 1FBVA 1KWOC 3SSPA 1CLLA 2HF5A 2JULA 3DQHA 1SR6B 3BUMB 2WHUA 4W6KA 3SVEA 1A75A 3SVOA 3DQIA 2WOSA 2PMYA 2PSRA 4IK9A 2QZ0A 4PALA 1EJ3A 1RROA 2LV7A 2H5RA 2LVKA 4ZB1A 4MZJA 1R6PA 2QRFA 2L50A 2BBNA 4NDBA 3IR8A 1SCMB 5ER5A 1FI6A 1SNLA 2M8UA 2K7OA 1A2XA 1G7KA 3DQ4A 2E30A 4I5KA 3NSIA 1UHKA 2ZN9A 4WRIA 2A46A 1PRWA 3CBEA 2M97A 1J1DA 1ODBA 1SKTA 3DQ9A 4DXPA 1YFPA 5HKZA 1OXFA 1RMMA 1SW8A 3OGOA 2DUGA 5JOLA 2WSNA 3TDUA 4W6JA 1EMGA 2IB5A 1SPYA 4PE1A 3U0LA 1EMEA 1JF2A 4XL5A 3ZUFA 4WQ2A 3ZWHA 3BXCA 1ZFSA 1HT9A 1SCMC 2LUCA 2OKWA 4GNKB 4TZGA 2FOTA 1YTZC 5DTXA 2NCPA 1K93D 2G2SB 2K61A 2O2BA 5FVGA 2ZMUA 4H3NA 2DUHA 2Y1MA 1KYRA 2L0PA 3IQOA 5H87A 4Q9XA 5LTPA 4M2PA 1RM9A 1QXPA 1VRKA 4MSPA 4LJDC 3PALA 2CBLA 2NXQA 1IG5A 4EN1A 4KAGA 5HBDA 5AFPA 1F55A 3SVNA 2EMNA 2BTJA 1BOCA 5AQBB 1CV7A 1SBJA 4W6MA 1XAEA 4QJ3B 3SG5A 3HX4A 3AKBA 3AAKA 2QU1A 1Q4EA 4PHKA 4EMQA 4EDSA 2MA2A 2KI6D 2IB6A 1YRUB 1LVCD 1G8IA 1JFKA 2AAOA 3DQ7A 3LA1A 4PPKA 2M3WA 4TZAA 5DTZA 2H5PA 3SSLA 2MHHA 1W7SA 3JTDC 4ZF3A 1JC2A 4L9MA 2BE4A 2I2RE 2KAYA 1RTP1 4MN0A 4OQWA 1OOJA 3O6BA 1J7PA 2JTZA 1RECA 3GEXA 4W7EA 2I18A 3M0WA 4GGNA 4WQ3A 4ZINA 1K96A 3OB1B 1MF8B 1ZUZA 3FWCA 2EMDA 2WCFA 4ETOA 2LMUA 1GFLA 1IJ6A 4OHSA 2WIQA 4LJDA 1E8AA 1QX7A 2ZFDA 3VK1A 3EVUA 2B3PA 2WHSA 1RMPA 1AJ5A 4DS7A 1OZSA 2VADA 2C9JA 4HRHA 2JQ6A 2OTEA 4GGFC 4IK3A 5CSNA 3PJBA 3DQ6A 4ZCVA 2VRGA 1RJVA 4C0LA 1RRXA 1EH2A 5FVIA 4DIRA 3O4YA 2L4HA 1KCYA 1YJFA 1DF0A 1F4QA 2FJUB 2AMIA 5DY6A 5EJUA 1IRJA 4PE4A 3CZTX 1GJYA 4YI8A 4W7XA 4JF9A 3SIAA 1GQMA 1Q4AA 1BFPA 4JEOA 2BL0B 3LCPC 2JU0A 1DJYA 3ST2A 5KU1A 3RLZA 3VHTA 3DQLA 4QJ5B 2KSPA 1YX7A 3OX6A 1M63B 2KBMA 4GUKA 1B8CA 2M29A 4KEXA 4CFRA 1SCVA 1TTXA 5EB7A 4MZLA 1JBAA 3I5FB 3DQUA 3CGLA 5LTRA 4UTSA 3BXKA 1OMDA 4KW4A 4JC2A 3DQ5A 1DJIA 1K2HA 2L51A 3KF9A 1L2OC 1B9AA 2YE1A 2EC6B 4NWSA 4JRBA 2M7NA 2O24A 4PPLA 2LMVA 1M45A 3SVBA 1YR5A 4GFTA 4Q7UA 4GGFA 4N5XA 4A4BA 3I5FC 5CPVA 3VICA 1Z1PA 3SSTA 2ZKMX 2OS8B 3GK4X 1Y1UA 4ZF4A 4I5JA 1OMVA 3ST0A 2G6EA 4H47A 4YGDB 3ST4A 3NSOA 2EC6C 1J1EA 1G4YR 4W6CA 4ZIOA 4W6DA 4YBHB 3ICBA 2HETA 2A52B 1R2UA 2OTGB 1B9CA 1EMAA 2SASA 2K2AA 2DOQA 2F3YA 3LVDA 3MGFA 4W7RA 2BKHB 5G08A 1BU3A 3VRPA 2Z6ZA 1A75B 1B7TY 3PJ5A 2Z1OA 1A29A 4XOWA 5I8NA 2OS8C 1XA5A 2PASA 1QYOA 1M46A 4DKNA 3OX5A 2A4JA 1QASA 4PHJA 1KSMA 3AI4A 3KCTA 4OV2A 3VGOA 1NX2A 2OTGC 5DPJA 3TDZA 1F09A 3BUNB 1DJGA 1BF5A 1S6ZA 2YDZA 2BCXA 3LVCA 5DQBA 2BKIB 5AEQA 3DQAA 1JBYA 1DJWA 4U8DA 4JWQA 1UUSA 1S5GZ 3I5GB 1MHOA 2K7BA 3PSRA 3TMTA 1F4OA 1EL4A 2HGDA 2QLHA 1NIWA 1QYQA 4PHMA 1HCJA 2VZXA 1BJFA 4IZNA 2H6VA 4KPIA 3OP0A 3MSEB 1UISA 1ZGOA 2G2BA 5JJGA 3SV5A 4DXQA 2ICRA 3IQQA 1XFZO 3I5GC 3S05A 3O77A 1C7VA 2SCPA 2DDDA 4P76A 1M31A 3E3RA 5CSIA 2HPWA 2K7DA 2Y5IA 1K95A 1PSBA 3BXAA 1XFWO 1YZWA 2JXLA 1CNPA 3PLFB 1B1GA 2K7CA 5DTLA 2M7LA 1KYPA 3LVAA 1NX3A 3F45A 2AH8A 3A8SA 1TIZA 4F0ZB 1OXEA 1B47A 5BTTB 2ARLA 1F70A 5K89A 1C07A 1F71A 1YHHA 3AKOA 4OKHA 1XVJA 2LM5A 4W6PA 2GW4B 4HQ9A 3NT3A 4IK1A 5HKWA 3U8AA 4KF5C 1QX2A 3TZ1A 1TOPA 4IL1A 2CTNA 3U0MA 4PE7A 3GB3A 2PALA 3DD4A 4YI9A 1K9PA 4IK8A 2WNDA 2F8PA 4W73A 1C4FA 1PK0D 3SVUA 1QLKA 2P6BB 3KEVA 4KA9A 5KTGA 3JVTB 2Z6XA 3SG4A 2JT3A 1XFVO 2HRSA 1QV0A 1S5GY 2H9WA 1S6JA 2NLNA 1RMOA 1SL9A 2I94A 2IE2A 3TDIA 4LQTA 3EVRA 2DD9A 1ALWA 3LSAA 5DPHA 3WHUB 2Y1NA 4J89A 3H1OA 3DQNA 2ZO7A 2A54B 3DQJA 3DQDA 5DRFA 1JC0A 2WCEA 2VVIA 4W6TA 1A03A 2QLGB 1DF0B 2L5XB 3FWBA 4YGBB 5AERA 3M24A 3JVTC 2WSOA 3PATA 3DVMA 1ALVA 5HLVA 4MZKA 4DKMA 1HUYA 1DMOA 2G3DB 3U0NA 4W75A 4ORAB 3ZULA 3JTDB 5EXUA 2M1UA 2JC2A 3PIBA 3SIBA 2VVHA 4KF5A 1OSAA 2LP3A 4W6SA 1DJXA 2BCAA 3AI5A 3LF4B 1SK6D 1QTXA 2G9BA 1DJHA 2G6XA 3VHTB 1K94A 4XOVA 5D7FA 2WHTA 3ADFA 4B30A 1KK7Z 3DQCA 4BY4A 4H3LA 5HGEA 2MJWB 4W7DA 3GJ2A 3CR2A 4ORBB 1SL7A 1EG3A 5BTTA 4L1IA 2AWKA 1PULA 2G3OA 5I2OA 1ZOTB 1WRZA 3AKAA 1MYWA 4LQUA 5DPIA 2MAZA 2ZNDA 2KOTA 1KP5A 1U5IB 1UHIA 5PALA 4PE0A 4I5LB 1J55A 2KGRA 4LW5A 4CIDA 2RH7A 3DQ3A 2OGRA 1NCXA 2WORA 5I2QA 4ORCB 4LJCA 2LLSA 1M39A 1EMKA 4W6RA 1NP8A 4W76A 4HREE 3DQEA 3LK1A 3K1KA 2KAXA 4GOBA 2EGDA 5F6TA 2KNEA 1GGXA 3CGAA 3AAJA 4W7AA 1K8UA 2QACA 3OSQA 3ZUJA 1Y6WA 3DQMA 2CNPA 4GBAA 2HQKA 4HE4A 1FPWA 2BECA 5EXBA 1Q73A 2QPTA 2M49B 2Q4UA 2AWMA 4GF6B 1QS7A 1FF1A 1ZMZA 1BT6A 1W7TA 5HW9A 4I2YA 1S36A 3LL8B 3OB2B 4PCWA 1H4BA 5KTYA 1EG4A 5DKNA
chains in the Genus database with same CATH superfamily
4EDOA 4M2QA 4ZF5A 1IQ5A 5DPGA 1TNWA 3WLDA 4RTCA 3ZNIA 2GV5A 1H8BA 2QLGA 3NF0A 1ZUXA 2KAVA 2O29A 3SS0A 1LKJA 5HZSA 1Y1XA 2PRUA 1TWOA 3CLNA 1OQPA 3SSHA 4YGCB 1JSAA 1XFXO 4JPZB 3RZSA 4L13A 2MBXA 1L2OB 2M1KB 4I5NB 3NHTA 2OKYA 1GGZA 2HJOA 1DTLA 3U8CA 4DXOA 1Z1QA 5HZUA 2QEOA 3PJ7A 2QEBA 1B8RA 1XFYO 3QRXA 1B8LA 4XVPA 5FHVA 3EK8A 1CLMA 3DQ2A 4ICBA 2HCGA 2LVVA 1V1FA 2QLEA 2CXJA 1XYDA 1YVHA 1EMCA 1LA3A 5H88A 2E6WA 1CDNA 2LNKA 5LK4A 2HQ8A 1U5IA 2QEVA 2F2PA 3CR5X 4HVFA 4Q7RA 2AWJA 4W7CA 3CD9A 4JFGA 1DEKA 3TMRA 2LVJA 3FE8A 3G9AA 5EB6A 5FI7A 1EMMA 2KGBC 4DXIA 1C3ZA 3LF3A 1AK8A 1AP4A 1KQMB 2L4IA 2B1UA 1UHJA 2LMTA 2DUIA 4YRUA 2PVBA 5HZTA 5ER4X 4HRGA 1Y1AA 1XA9A 3EKHA 3KCSA 5BT0A 2WC5A 3DPZA 2F33A 4B5YA 2D8NA 3DF0B 2A47A 4BDUA 3EKJA 1CFPA 4OR9B 4OVNF 2KYFA 5DQMA 4PFEA 5FI2A 2O60A 3B88A 3DQOA 5D69A 1EMLA 2H61C 1A4PA 4KW9A 1Y0VH 1RWYA 1NX0A 1LINA 1UWOA 2KI4B 3DQ8A 2LCPA 1KQMC 3DXLA 4P5OE 2I7AA 3SJSA 1CB1A 4JQ0D 2A48A 5KSZA 1CTRA 1SYMA 2B3QA 1QYFA 4W6FA 4P2YB 3PJIA 4XJKB 2DUFA 1YUUA 1QLSA 1DGVA 2MRDA 1OMRA 1PVAA 4CFQA 4OJ0A 3SVDA 5AANA 1LXFC 3BOWB 4GPLB 3CFAA 1QX5B 2R2IA 3D76A 4IK4A 2V4EC 3DQKA 1YHGA 4W77A 2P71A 4CPVA 4IK5A 2L2CA 1JC1A 1QATA 3DVEA 2KI4C 4RYWA 3U0KA 2P4MA 1CFFA 1UP5A 4Q7TA 4XYNA 1TNQA 1TCOB 1XFUO 1WLZA 3D0YB 2RGIA 4R6DA 1CMGA 1DJZA 4INXA 3N7HA 3D75A 3ST3A 3RWAA 2IOVA 3B86A 1QY3A 5I94A 3BFHA 3LLEA 3GOFA 3BUXB 1XQMA 1NPQA 4DRWA 3SSVA 3UFZA 1NSHA 1S3PA 1S1EA 5LTQA 3SS3A 4TNCA 2ZRSA 5EXCI 1NCZA 1CFDA 1WRLA 3BUOB 3CWGA 1W7UA 2CT9A 2H61A 1OZOA 2WCMA 1AVSA 2Q91A 3FE9A 4FQOA 2FZUA 3H4SE 5CSFA 4PT1A 3NXAA 2H8VA 2WCKA 1PSRA 1UHHA 4FTGA 2V53A 3SVCA 4KGFA 2DDCA 2TN4A 1X02A 4ZCUA 2A53B 1DGUA 3DF0A 4W6AA 4MRXA 1XK4C 2V4EA 1F0BA 4B30B 2G6YA 3BYAA 4N1FA 4KW8A 3A8RA 1F54A 1QIWA 1YX8A 2OPOA 1V1GA 1OXDA 3DVJA 5BQLA 5T3IA 4XGYA 1MUXA 1HQVA 4GESB 2Q57A 2PXWA 4XJKA 1W7JB 3DYEA 3BX9A 4ZBLA 3U8PA 3BOWA 3KPXA 2JT8A 2G16B 1EXRA 1TNPA 1KYSA 3IF7A 2GX0A 3EK4A 1MXEA 1N2DA 1BG1A 4Q9WA 1CM4A 3ED8A 3D10A 3K21A 3NSKA 1Q4CA 1WY9A 4PPJA 1P28A 3LS3A 1OW4A 2KI6C 2KQ6A 4U2VA 2JNXA 4L12A 2OTBA 3D0YA 2A50B 5CSJA 1GGWA 1H6RA 3TS5B 1NYAA 1EMFA 4W6IA 2Q6PA 1XMZA 3SSKA 5J2OA 1SR6C 3O2PA 1K9UA 2BCBA 1AHRA 1RK9A 2LLUA 1ZGPA 3W1CA 1N0YA 4J8AA 1BR4B 2K0JA 3DPWA 1XK4A 4AS8A 3D73A 3CFFA 4W6NA 2H2KA 2WURA 1KQVA 1WRKA 2LVIA 1YUTA 2LE9B 4C0KA 2LHIA 1QVIZ 4MVFA 3WHTB 3TS5C 1YVLA 1S26D 2JOJA 1MXLC 3UO9A 2GW3A 5DKRA 4R1EA 5EHUA 1C7WA 2G5ZB 4W72A 4Q04A 4N3DA 3SVSA 1BLQA 2H5QA 3CABA 2HPSA 4OGSA 1W7IB 1ORGA 5BPJA 3NEZA 2ISDA 3DZTA 1IH0A 3Q8IA 1YHIA 5B8IB 2L98A 3RM1A 4H3MA 2JT0A 4AR7A 3LK0A 1IJ5A 2NCOA 4W6UA 4GAOA 3ZTFA 4MRYA 1RFJA 2L2EA 5EBJA 4ORNA 1XSSA 2WC8A 3EK7A 3P28A 2OJKA 2O5GA 2POXA 3EVVA 5J3XA 3UG0A 4OY4A 1FI5A 4D1EA 3E5VA 1OOFA 1J7QA 4AOMA 3GJ1A 2HQWA 3SVRA 1JWDA 1FW4A 4N1GA 4H48A 3SG7A 4LJBA 1LS8A 4OCIA 3B87A 1UHNA 2FJYA 3WNXB 4W6BA 3BXBA 1NCYA 1CDMA 2LANA 4ANJA 1QXTA 5DKQA 1KFXL 3BQ3A 1H4UA 4KGEA 2WISA 3CFHA 3I5HB 4HQCA 1MWNA 2K2FA 1KFXS 2KQYA 3GL4A 2HFCA 1GL4A 2NZ0A 2H8QA 1DVIA 2HGYA 3CS1A 4YGAA 1ZGQA 1EMBA 1QVIY 3DQFA 4W74A 4USLA 1SL8A 1KSOA 5I2LA 4JKTA 1MR8A 5HKYA 5H89A 1YRTB 1K90D 2COLB 1B7TZ 2QLIA 1ZACA 3GK2A 5GQQC 3NT9A 2M9GA 2VAEA 3I5HC 5AXIA 3DY9A 2AHAA 1QIVA 4W7FA 1TRFA 2AWLA 3SG2A 4P1QA 1CKKA 1KK7Y 5DU0A 5IBWA 3FIAA 2LP2A 3R1OA 4JGEA 2JNFA 4DXNA 2ERBA 1Q4DA 3L47A 1DELA 5DTYA 3OBVA 4MEWA 1KFUL 2JTTA 2A56B 2AUCA 3CTNA 5HL1A 5F9GA 1D1OA 1IGVA 2Y0GA 3E5TA 1QJTA 2P70A 4BY5A 3BFBA 3CR4X 5HZOA 1QV1A 1UURA 1KFUS 5DRGA 2LAPA 1B4CA 4Z4MA 3BUWB 4CLNA 2GGZA 3D78A 4DUQA 1CLBA 3SG6A 3WCKA 3O4XA 2LHLA 3DQ1A 1IWQA 2KBIA 3KO0A 3TUYB 2M0RA 3C1VA 5TNCA 2FWQA 2BL0C 4KF4A 3PM8A 1G33A 1SMGA 1S6IA 2ZRTA 4PHNA 4HQ8A 2JRFA 3V3DA 1DQEA 3DPXA 1S6CA 3BJHA 1JBZA 2H5OA 4ZFSA 2IS9A 2WC6A 1IQ3A 2V4EB 4DXMA 4DCKA 1NUBA 1LA0A 1QWVA 3E5WA 2KDHA 1J7RA 3RWTA 5HLOA 2JADA 2BE6A 2YGUA 5FVFA 3TUYC 4AQJA 2ZO6A 3I5IB 4M2OA 3NSLA 4RYSA 2QEHA 2ZNEA 4PDZA 4J88A 4EULA 1BR1B 2C9IA 1IKUA 2EMOA 1YURA 1MOVA 3S0GA 4NQGA 2F3ZA 3FE6A 3NEDA 3PFVA 1F8HA 1YJ2A 1NX1A 3CDNA 3SSYA 2JZIA 1CM1A 1NWDA 3KHEA 5FYXA 2GX2A 2JWWA 2EHBA 2Y4QA 1SRAA 1K9KA 3A4UB 4YGEB 4E68A 2ZMWA 4W69A 1JUOA 1DT7B 2WCLA 3WLCA 3I5IC 1YUSA 3SS5A 4W6OA 1WDCB 3OSRA 4HSZA 2K8MB 4MBEA 1Q80A 2PXSA 3CB9A 2CCMA 3PN7B 1PALA 4A4CA 3VRNA 1AJ4A 2FCEA 3IP2A 3VB1A 3VRQA 3OHMB 4C0JA 1CDLA 1JF0A 4UPGA 1TN4A 5HYDA 3VROA 2FL1A 2BAPA 4W6LA 1MQ1A 2KFHA 3CD1A 1SY9A 2VVJA 2GGMA 1MOUA 3GK1A 1SSEB 2KYCA 3VRRA 1OE9B 4QJ4B 2HQZA 1CFCA 1KK8B 4Z4KA 1AUIB 2LUXA 4W6GA 3W1DA 1Q4BA 3WXAA 2Z6YA 4R6BA 1PVBA 4NDCA 1BODA 2YFPA 3DVKA 1WDCC 1JFJA 2MLFC 1WLMA 2DD7A 1TUJA 3EVPA 3O78A 3PN7C 2KHNA 3OGNA 2QT2A 2MLEC 2FCDA 1KWOB 3M22A 3H1RA 2DUEA 1Z4HA 3B6XA 3SS4A 2LLTA 1N65A 1XO5A 3I19A 3P8UA 2YE0A 1TUZA 1TCFA 1TNXA 2KFFA 1KK8C 2KFGA 1BMOA 2LC5A 3D77A 4IJ7A 1J7OA 2JPTA 3SG3A 3SRYA 1CMFA 3FS7A 2BBMA 3HCMA 4NDDA 2WCBA 1L7ZA 2F2OA 4MLWA 2ZN8A 2JXCA 4AQIA 4W6HA 1CDPA 1FBVA 1KWOC 3SSPA 1CLLA 1OOIX 2HF5A 2JULA 3DQHA 1SR6B 3BUMB 2WHUA 4W6KA 3SVEA 1A75A 3SVOA 3DQIA 2WOSA 2PMYA 2PSRA 2PYQA 4IK9A 2QZ0A 4PALA 1EJ3A 1RROA 2LV7A 2H5RA 2LVKA 4ZB1A 4MZJA 1R6PA 3NHIA 2QRFA 2L50A 2BBNA 4NDBA 3IR8A 1SCMB 5ER5A 1FI6A 1SNLA 2M8UA 2K7OA 1A2XA 1G7KA 3DQ4A 2E30A 4I5KA 3NSIA 1UHKA 2ZN9A 4WRIA 2A46A 1PRWA 3CBEA 4OZDA 2M97A 1J1DA 1ODBA 1SKTA 3DQ9A 4DXPA 1YFPA 5HKZA 1OXFA 1RMMA 1SW8A 3OGOA 2DUGA 5JOLA 2WSNA 3TDUA 4W6JA 1EMGA 2IB5A 1SPYA 4PE1A 3U0LA 1EMEA 1JF2A 1OOHA 4XL5A 3ZUFA 4WQ2A 3ZWHA 3BXCA 1ZFSA 1HT9A 1SCMC 2LUCA 2QDIA 2OKWA 4GNKB 4TZGA 2FOTA 1YTZC 5DTXA 2NCPA 1K93D 2G2SB 2K61A 2O2BA 5FVGA 2ZMUA 4H3NA 2DUHA 2Y1MA 1KYRA 2L0PA 3IQOA 5H87A 4Q9XA 5LTPA 4M2PA 1RM9A 2KLEA 1QXPA 1VRKA 4MSPA 4LJDC 3PALA 2CBLA 2NXQA 1IG5A 4EN1A 3B7AA 5DICA 4KAGA 3PM2A 5HBDA 5AFPA 1F55A 3SVNA 2EMNA 2BTJA 3NGVA 1BOCA 5AQBB 1W9ZA 1CV7A 1SBJA 4W6MA 1XAEA 4QJ3B 3SG5A 3HX4A 3AKBA 3AAKA 2QU1A 1Q4EA 4PHKA 4EMQA 4EDSA 2MA2A 2KI6D 2IB6A 1YRUB 1LVCD 1G8IA 1JFKA 2AAOA 3DQ7A 3LA1A 4PPKA 2M3WA 4TZAA 5DTZA 5EL2A 2H5PA 3SSLA 2MHHA 1W7SA 3JTDC 4ZF3A 1JC2A 4L9MA 2BE4A 2WCJA 2I2RE 2KAYA 1RTP1 4MN0A 4OQWA 1OOJA 3O6BA 3CYZA 1J7PA 2JTZA 1RECA 3GEXA 4W7EA 3UNWA 3S0AA 2I18A 3M0WA 4GGNA 4WQ3A 4ZINA 1K96A 3OB1B 1MF8B 1ZUZA 3FWCA 2EMDA 2WCFA 4ETOA 2LMUA 1GFLA 1IJ6A 4OHSA 2WIQA 2JPOA 4LJDA 1E8AA 1QX7A 2ZFDA 3VK1A 3EVUA 2B3PA 2WHSA 1RMPA 1AJ5A 4DS7A 1OZSA 2VADA 2C9JA 4HRHA 2JQ6A 2OTEA 4GGFC 4IK3A 5CSNA 3PJBA 3DQ6A 4ZCVA 2VRGA 1RJVA 4C0LA 1RRXA 1EH2A 5FVIA 4DIRA 3O4YA 2L4HA 1KCYA 1YJFA 1DF0A 1F4QA 2FJUB 2AMIA 5DY6A 5EJUA 1IRJA 4PE4A 3CZTX 1GJYA 4YI8A 4W7XA 4JF9A 3SIAA 1GQMA 1Q4AA 1BFPA 4JEOA 2BL0B 3LCPC 2JU0A 3R1VA 1DJYA 3ST2A 5KU1A 3RLZA 3VHTA 3DQLA 4QJ5B 2KSPA 1YX7A 3OX6A 1M63B 2KBMA 4GUKA 1IIOA 1B8CA 2M29A 4KEXA 4CFRA 1SCVA 4INWA 1TTXA 5EB7A 4MZLA 1JBAA 3I5FB 3DQUA 3CGLA 5LTRA 4UTSA 3BXKA 1OMDA 4KW4A 4JC2A 3DQ5A 1DJIA 1K2HA 2GTEA 2L51A 3KF9A 1L2OC 1B9AA 2YE1A 2EC6B 4NWSA 1C3YA 4JRBA 2PQLA 2M7NA 2O24A 4PPLA 2LMVA 1M45A 3SVBA 1YR5A 4GFTA 4Q7UA 4JD9A 4GGFA 4N5XA 4A4BA 3I5FC 5CPVA 3VICA 1Z1PA 3SSTA 3S0EA 1GM0A 2ZKMX 2OS8B 3GK4X 1Y1UA 4ZF4A 4I5JA 1OMVA 3ST0A 2K60A 2G6EA 4H47A 4YGDB 3ST4A 3NSOA 2EC6C 3IVTA 1J1EA 1G4YR 4W6CA 4ZIOA 5FI6A 4W6DA 4YBHB 3ICBA 2HETA 2A52B 1R2UA 2OTGB 1B9CA 3EG5B 1EMAA 2SASA 2K2AA 2DOQA 2F3YA 3LVDA 3MGFA 4W7RA 2BKHB 5G08A 1BU3A 3VRPA 2Z6ZA 1A75B 1B7TY 3PJ5A 2Z1OA 1A29A 4XOWA 2KPHA 5I8NA 2OS8C 1XA5A 2PASA 1QYOA 1M46A 4DKNA 3OX5A 2A4JA 1QASA 1OOGA 4PHJA 1KSMA 3AI4A 3KCTA 4OV2A 3VGOA 2KLDA 1NX2A 4KYNA 2OTGC 3V2LA 5DPJA 3TDZA 1F09A 3BUNB 1DJGA 1BF5A 1S6ZA 2YDZA 2BCXA 2BNXA 3LVCA 5DQBA 2BKIB 5AEQA 2WCHA 3DQAA 1JBYA 1DJWA 4U8DA 4JWQA 1UUSA 1S5GZ 3I5GB 1MHOA 2K7BA 3PSRA 3TMTA 1F4OA 3K1EA 1EL4A 2HGDA 2QLHA 1NIWA 1QYQA 4PHMA 1HCJA 2VZXA 1BJFA 4IZNA 2H6VA 4KPIA 3OP0A 3R72A 1XFRA 3MSEB 1UISA 1ZGOA 2G2BA 5JJGA 3SV5A 4DXQA 2ICRA 3IQQA 1XFZO 3I5GC 3CZ2A 3S05A 3O77A 1C7VA 2SCPA 2DDDA 4P76A 1M31A 3E3RA 5CSIA 2HPWA 2K7DA 2Y5IA 1K95A 1PSBA 3BXAA 1XFWO 1YZWA 2JXLA 1CNPA 3PLFB 1B1GA 2K7CA 5DTLA 2M7LA 1KYPA 3LVAA 1NX3A 3F45A 2AH8A 3A8SA 1TIZA 4F0ZB 1OXEA 1B47A 5BTTB 2ARLA 1F70A 5K89A 1C07A 1F71A 1YHHA 3AKOA 4OKHA 1XVJA 2LM5A 3L4LA 4W6PA 2GW4B 4HQ9A 3NT3A 4IK1A 5HKWA 3U8AA 4KF5C 1QX2A 3TZ1A 1TOPA 4IL1A 2CTNA 3U0MA 3CZ1A 4PE7A 3GB3A 2PALA 3DD4A 3S0BA 4YI9A 1K9PA 4IK8A 2WNDA 2F8PA 4W73A 1C4FA 1PK0D 3SVUA 1QLKA 2P6BB 3KEVA 3D74A 4KA9A 5KTGA 3JVTB 2Z6XA 3SG4A 2JT3A 1XFVO 2HRSA 1QV0A 1S5GY 2H9WA 1S6JA 2NLNA 1RMOA 1T14A 1SL9A 3R1PA 2I94A 2IE2A 3TDIA 4LQTA 3EVRA 2DD9A 1ALWA 3LSAA 5DPHA 3WHUB 2Y1NA 4J89A 3H1OA 3DQNA 2ZO7A 2A54B 3BFAA 3DQJA 3DQDA 5DRFA 1JC0A 2WCEA 2VVIA 2L5YA 4W6TA 1A03A 2QLGB 1DF0B 2L5XB 3FWBA 4YGBB 5AERA 3M24A 3JVTC 2WSOA 3PATA 3DVMA 1ALVA 5HLVA 4MZKA 5D3OA 4DKMA 1HUYA 1DMOA 2G3DB 3U0NA 4W75A 4ORAB 3ZULA 3JTDB 5EXUA 2M1UA 2JC2A 3PIBA 3SIBA 2VVHA 4KF5A 1OSAA 2LP3A 4W6SA 1DJXA 2BCAA 3AI5A 3LF4B 1SK6D 1QTXA 1Z2CB 2G9BA 1DJHA 2G6XA 3VHTB 1K94A 4XOVA 5D7FA 3S0DA 2WHTA 3ADFA 4B30A 1KK7Z 3DQCA 4BY4A 4H3LA 5HGEA 2MJWB 4W7DA 3GJ2A 4F7FA 3CR2A 4ORBB 1SL7A 1EG3A 5BTTA 4L1IA 2AWKA 1PULA 2G3OA 5I2OA 1ZOTB 1WRZA 3AKAA 1MYWA 4LQUA 3S0FA 5DPIA 2MAZA 2ZNDA 2KOTA 1KP5A 1U5IB 1UHIA 5PALA 4PE0A 4I5LB 1J55A 2KGRA 4LW5A 4CIDA 2RH7A 3DQ3A 2OGRA 1NCXA 2WORA 5I2QA 4ORCB 4LJCA 2LLSA 1M39A 1EMKA 3CZ0A 4W6RA 1NP8A 4W76A 4HREE 3DQEA 3LK1A 3K1KA 2KAXA 4GOBA 2EGDA 5F6TA 2KNEA 1GGXA 3CGAA 3AAJA 3L4AA 4W7AA 1K8UA 2QACA 4FQTA 3OSQA 3ZUJA 1Y6WA 3DQMA 2CNPA 4GBAA 2HQKA 4HE4A 1FPWA 2BECA 5EXBA 1Q73A 2QPTA 2M49B 2Q4UA 2AWMA 4GF6B 1QS7A 1DC1A 1FF1A 1ZMZA 1BT6A 1W7TA 5HW9A 4I2YA 1S36A 3LL8B 3OB2B 3QMEA 4PCWA 1H4BA 5KTYA 1EG4A 5DKNA
chains in the Genus database with same CATH topology
4EDOA 4M2QA 4ZF5A 1IQ5A 5DPGA 1TNWA 3WLDA 4RTCA 3ZNIA 2GV5A 1H8BA 2QLGA 3NF0A 1ZUXA 2KAVA 2O29A 3SS0A 1LKJA 5HZSA 1Y1XA 2PRUA 3CLNA 1OQPA 3SSHA 4YGCB 1JSAA 1XFXO 4JPZB 4L13A 2MBXA 1L2OB 2M1KB 4I5NB 2OKYA 1GGZA 2HJOA 1DTLA 3U8CA 4DXOA 1Z1QA 5HZUA 3PJ7A 1B8RA 1XFYO 3QRXA 1B8LA 4XVPA 5FHVA 3EK8A 1CLMA 3DQ2A 4ICBA 2HCGA 2LVVA 1V1FA 2QLEA 2CXJA 1XYDA 1YVHA 1EMCA 1LA3A 5H88A 2E6WA 1CDNA 2LNKA 5LK4A 2HQ8A 1U5IA 3CR5X 2F2PA 4HVFA 4Q7RA 2AWJA 4W7CA 3CD9A 4JFGA 3TMRA 2LVJA 3G9AA 5EB6A 1EMMA 2KGBC 4DXIA 3LF3A 1AK8A 1AP4A 1KQMB 2L4IA 2B1UA 1UHJA 2LMTA 2DUIA 4YRUA 2PVBA 5HZTA 5ER4X 4HRGA 1Y1AA 1XA9A 3EKHA 3KCSA 5BT0A 3DPZA 2F33A 4B5YA 2D8NA 3DF0B 2A47A 4BDUA 3EKJA 1CFPA 4OR9B 4OVNF 2KYFA 5DQMA 4PFEA 2O60A 3DQOA 5D69A 1EMLA 2H61C 1A4PA 4KW9A 1Y0VH 1RWYA 1NX0A 1LINA 1UWOA 2KI4B 3DQ8A 2LCPA 1KQMC 4P5OE 2I7AA 3SJSA 1CB1A 4JQ0D 2A48A 5KSZA 1CTRA 1SYMA 2B3QA 1QYFA 4W6FA 4P2YB 4XJKB 2DUFA 1YUUA 1QLSA 1DGVA 2MRDA 1OMRA 1PVAA 4CFQA 4OJ0A 3SVDA 5AANA 1LXFC 3BOWB 4GPLB 3CFAA 1QX5B 2R2IA 4IK4A 2V4EC 3DQKA 1YHGA 4W77A 4CPVA 4IK5A 1JC1A 1QATA 3DVEA 2KI4C 4RYWA 3U0KA 2P4MA 1CFFA 1UP5A 4Q7TA 4XYNA 1TNQA 1TCOB 1XFUO 1WLZA 3D0YB 2RGIA 4R6DA 1CMGA 1DJZA 3ST3A 3RWAA 2IOVA 1QY3A 3LLEA 3GOFA 3BUXB 1XQMA 1NPQA 4DRWA 3SSVA 3UFZA 1NSHA 1S3PA 1S1EA 5LTQA 4TNCA 2ZRSA 5EXCI 1NCZA 1CFDA 1WRLA 3BUOB 3CWGA 1W7UA 2CT9A 2H61A 1OZOA 1AVSA 2Q91A 4FQOA 2FZUA 3H4SE 5CSFA 3NXAA 1PSRA 1UHHA 4FTGA 2V53A 3SVCA 4KGFA 2DDCA 2TN4A 1X02A 4ZCUA 2A53B 1DGUA 3DF0A 4W6AA 4MRXA 1XK4C 2V4EA 1F0BA 4B30B 2G6YA 3BYAA 4N1FA 4KW8A 3A8RA 1F54A 1QIWA 1YX8A 2OPOA 1V1GA 1OXDA 3DVJA 5BQLA 5T3IA 4XGYA 1MUXA 1HQVA 4GESB 2Q57A 2PXWA 4XJKA 1W7JB 3BX9A 4ZBLA 3U8PA 3BOWA 3KPXA 2JT8A 1EXRA 1TNPA 2G16B 1KYSA 3IF7A 2GX0A 3EK4A 1MXEA 1N2DA 1BG1A 4Q9WA 1CM4A 3ED8A 3D10A 3K21A 3NSKA 1Q4CA 1WY9A 4PPJA 3LS3A 2KI6C 2KQ6A 4U2VA 2JNXA 4L12A 2OTBA 3D0YA 2A50B 5CSJA 1GGWA 1H6RA 3TS5B 1NYAA 1EMFA 4W6IA 2Q6PA 1XMZA 3SSKA 5J2OA 1SR6C 3O2PA 1K9UA 2BCBA 1AHRA 1RK9A 2LLUA 1ZGPA 3W1CA 1N0YA 4J8AA 1BR4B 2K0JA 3DPWA 1XK4A 4AS8A 4W6NA 3CFFA 2H2KA 2WURA 1KQVA 1WRKA 2LVIA 1YUTA 2LE9B 4C0KA 2LHIA 1QVIZ 4MVFA 3WHTB 3TS5C 1YVLA 1S26D 2JOJA 1MXLC 2GW3A 5DKRA 4R1EA 5EHUA 1C7WA 2G5ZB 4W72A 4Q04A 4N3DA 3SVSA 1BLQA 2H5QA 2HPSA 4OGSA 1W7IB 5BPJA 3NEZA 2ISDA 1IH0A 1YHIA 5B8IB 2L98A 3RM1A 4H3MA 2JT0A 4AR7A 3LK0A 1IJ5A 2NCOA 4W6UA 4GAOA 3ZTFA 4MRYA 1RFJA 2L2EA 5EBJA 4ORNA 1XSSA 2WC8A 3EK7A 3P28A 2OJKA 2O5GA 2POXA 3EVVA 5J3XA 3UG0A 4OY4A 1FI5A 4D1EA 3E5VA 1J7QA 4AOMA 3GJ1A 2HQWA 3SVRA 1JWDA 1FW4A 4N1GA 4H48A 3SG7A 4LJBA 4OCIA 1UHNA 3WNXB 4W6BA 3BXBA 1NCYA 1CDMA 2LANA 4ANJA 1QXTA 5DKQA 1KFXL 3BQ3A 1H4UA 4KGEA 2WISA 3CFHA 3I5HB 4HQCA 1MWNA 2K2FA 1KFXS 2KQYA 3GL4A 2HFCA 1GL4A 2NZ0A 2H8QA 1DVIA 2HGYA 3CS1A 4YGAA 1ZGQA 1EMBA 1QVIY 3DQFA 4W74A 4USLA 1SL8A 1KSOA 5I2LA 1MR8A 5HKYA 5H89A 1YRTB 1K90D 2COLB 1B7TZ 2QLIA 1ZACA 3GK2A 5GQQC 3NT9A 2M9GA 2VAEA 3I5HC 5AXIA 2AHAA 1QIVA 4W7FA 1TRFA 2AWLA 3SG2A 4P1QA 1CKKA 1KK7Y 5DU0A 5IBWA 3FIAA 2LP2A 4JGEA 2JNFA 4DXNA 1Q4DA 5DTYA 4MEWA 1KFUL 2JTTA 2A56B 2AUCA 3CTNA 5F9GA 1D1OA 1IGVA 2Y0GA 3E5TA 1QJTA 4BY5A 3CR4X 5HZOA 1QV1A 1UURA 1KFUS 5DRGA 2LAPA 1B4CA 4Z4MA 3BUWB 4CLNA 2GGZA 4DUQA 1CLBA 3SG6A 3WCKA 2LHLA 3DQ1A 1IWQA 2KBIA 3KO0A 3TUYB 2M0RA 3C1VA 5TNCA 2FWQA 2BL0C 4KF4A 3PM8A 1G33A 1SMGA 1S6IA 2ZRTA 4PHNA 4HQ8A 2JRFA 3V3DA 3DPXA 1S6CA 1JBZA 2H5OA 4ZFSA 2IS9A 1IQ3A 2V4EB 4DXMA 4DCKA 1NUBA 1LA0A 3E5WA 2KDHA 1J7RA 3RWTA 5HLOA 2JADA 2BE6A 5FVFA 3TUYC 4AQJA 2ZO6A 3I5IB 4M2OA 3NSLA 4RYSA 2ZNEA 4PDZA 4J88A 4EULA 1BR1B 2C9IA 1IKUA 2EMOA 1YURA 1MOVA 4NQGA 2F3ZA 3NEDA 3PFVA 1F8HA 1YJ2A 1NX1A 3SSYA 2JZIA 1CM1A 1NWDA 3KHEA 5FYXA 2GX2A 2JWWA 2EHBA 2Y4QA 1SRAA 1K9KA 3A4UB 4YGEB 4E68A 2ZMWA 4W69A 1JUOA 1DT7B 3WLCA 3I5IC 1YUSA 4W6OA 1WDCB 3OSRA 4HSZA 2K8MB 4MBEA 1Q80A 2PXSA 3CB9A 2CCMA 3PN7B 1PALA 4A4CA 3VRNA 1AJ4A 2FCEA 3IP2A 3VRQA 3OHMB 4C0JA 1CDLA 1JF0A 4UPGA 1TN4A 5HYDA 3VROA 2FL1A 4W6LA 1MQ1A 2KFHA 3CD1A 1SY9A 2VVJA 2GGMA 1MOUA 3GK1A 2KYCA 3VRRA 4QJ4B 1OE9B 2HQZA 1CFCA 1KK8B 4Z4KA 1AUIB 2LUXA 4W6GA 3W1DA 1Q4BA 3WXAA 2Z6YA 4R6BA 1PVBA 4NDCA 1BODA 2YFPA 3DVKA 1WDCC 1JFJA 2MLFC 1WLMA 2DD7A 3EVPA 3O78A 3PN7C 2KHNA 2QT2A 2MLEC 2FCDA 1KWOB 3M22A 3H1RA 2DUEA 2LLTA 1N65A 1XO5A 3I19A 3P8UA 2YE0A 1TCFA 1TNXA 2KFFA 1KK8C 2KFGA 1BMOA 2LC5A 1J7OA 2JPTA 3SG3A 3SRYA 1CMFA 3FS7A 2BBMA 3HCMA 4NDDA 2WCBA 1L7ZA 2F2OA 4MLWA 2ZN8A 2JXCA 4AQIA 4W6HA 1CDPA 1FBVA 1KWOC 3SSPA 1CLLA 2HF5A 2JULA 3DQHA 1SR6B 3BUMB 2WHUA 4W6KA 3SVEA 1A75A 3SVOA 3DQIA 2WOSA 2PMYA 2PSRA 4IK9A 2QZ0A 4PALA 1EJ3A 1RROA 2LV7A 2H5RA 2LVKA 4ZB1A 4MZJA 1R6PA 2QRFA 2L50A 2BBNA 4NDBA 3IR8A 1SCMB 5ER5A 1FI6A 1SNLA 2M8UA 2K7OA 1A2XA 1G7KA 3DQ4A 2E30A 4I5KA 3NSIA 1UHKA 2ZN9A 4WRIA 2A46A 1PRWA 3CBEA 2M97A 1J1DA 1ODBA 1SKTA 3DQ9A 4DXPA 1YFPA 5HKZA 1OXFA 1RMMA 1SW8A 3OGOA 2DUGA 5JOLA 2WSNA 3TDUA 4W6JA 1EMGA 2IB5A 1SPYA 4PE1A 3U0LA 1EMEA 1JF2A 4XL5A 3ZUFA 4WQ2A 3ZWHA 3BXCA 1ZFSA 1HT9A 1SCMC 2LUCA 2OKWA 4GNKB 4TZGA 2FOTA 1YTZC 5DTXA 2NCPA 1K93D 2G2SB 2K61A 2O2BA 5FVGA 2ZMUA 4H3NA 2DUHA 2Y1MA 1KYRA 2L0PA 3IQOA 5H87A 4Q9XA 5LTPA 4M2PA 1RM9A 1QXPA 1VRKA 4MSPA 4LJDC 3PALA 2CBLA 2NXQA 1IG5A 4EN1A 4KAGA 5HBDA 5AFPA 1F55A 3SVNA 2EMNA 2BTJA 1BOCA 5AQBB 1CV7A 1SBJA 4W6MA 1XAEA 4QJ3B 3SG5A 3HX4A 3AKBA 3AAKA 2QU1A 1Q4EA 4PHKA 4EMQA 4EDSA 2MA2A 2KI6D 2IB6A 1YRUB 1LVCD 1G8IA 1JFKA 2AAOA 3DQ7A 3LA1A 4PPKA 2M3WA 4TZAA 5DTZA 2H5PA 3SSLA 2MHHA 1W7SA 3JTDC 4ZF3A 1JC2A 4L9MA 2BE4A 2I2RE 2KAYA 1RTP1 4MN0A 4OQWA 1OOJA 3O6BA 1J7PA 2JTZA 1RECA 3GEXA 4W7EA 2I18A 3M0WA 4GGNA 4WQ3A 4ZINA 1K96A 3OB1B 1MF8B 1ZUZA 3FWCA 2EMDA 2WCFA 4ETOA 2LMUA 1GFLA 1IJ6A 4OHSA 2WIQA 4LJDA 1E8AA 1QX7A 2ZFDA 3VK1A 3EVUA 2B3PA 2WHSA 1RMPA 1AJ5A 4DS7A 1OZSA 2VADA 2C9JA 4HRHA 2JQ6A 2OTEA 4GGFC 4IK3A 5CSNA 3PJBA 3DQ6A 4ZCVA 2VRGA 1RJVA 4C0LA 1RRXA 1EH2A 5FVIA 4DIRA 3O4YA 2L4HA 1KCYA 1YJFA 1DF0A 1F4QA 2FJUB 2AMIA 5DY6A 5EJUA 1IRJA 4PE4A 3CZTX 1GJYA 4YI8A 4W7XA 4JF9A 3SIAA 1GQMA 1Q4AA 1BFPA 4JEOA 2BL0B 3LCPC 2JU0A 1DJYA 3ST2A 5KU1A 3RLZA 3VHTA 3DQLA 4QJ5B 2KSPA 1YX7A 3OX6A 1M63B 2KBMA 4GUKA 1B8CA 2M29A 4KEXA 4CFRA 1SCVA 1TTXA 5EB7A 4MZLA 1JBAA 3I5FB 3DQUA 3CGLA 5LTRA 4UTSA 3BXKA 1OMDA 4KW4A 4JC2A 3DQ5A 1DJIA 1K2HA 2L51A 3KF9A 1L2OC 1B9AA 2YE1A 2EC6B 4NWSA 4JRBA 2M7NA 2O24A 4PPLA 2LMVA 1M45A 3SVBA 1YR5A 4GFTA 4Q7UA 4GGFA 4N5XA 4A4BA 3I5FC 5CPVA 3VICA 1Z1PA 3SSTA 2ZKMX 2OS8B 3GK4X 1Y1UA 4ZF4A 4I5JA 1OMVA 3ST0A 2G6EA 4H47A 4YGDB 3ST4A 3NSOA 2EC6C 1J1EA 1G4YR 4W6CA 4ZIOA 4W6DA 4YBHB 3ICBA 2HETA 2A52B 1R2UA 2OTGB 1B9CA 1EMAA 2SASA 2K2AA 2DOQA 2F3YA 3LVDA 3MGFA 4W7RA 2BKHB 5G08A 1BU3A 3VRPA 2Z6ZA 1A75B 1B7TY 3PJ5A 2Z1OA 1A29A 4XOWA 5I8NA 2OS8C 1XA5A 2PASA 1QYOA 1M46A 4DKNA 3OX5A 2A4JA 1QASA 4PHJA 1KSMA 3AI4A 3KCTA 4OV2A 3VGOA 1NX2A 2OTGC 5DPJA 3TDZA 1F09A 3BUNB 1DJGA 1BF5A 1S6ZA 2YDZA 2BCXA 3LVCA 5DQBA 2BKIB 5AEQA 3DQAA 1JBYA 1DJWA 4U8DA 4JWQA 1UUSA 1S5GZ 3I5GB 1MHOA 2K7BA 3PSRA 3TMTA 1F4OA 1EL4A 2HGDA 2QLHA 1NIWA 1QYQA 4PHMA 1HCJA 2VZXA 1BJFA 4IZNA 2H6VA 4KPIA 3OP0A 3MSEB 1UISA 1ZGOA 2G2BA 5JJGA 3SV5A 4DXQA 2ICRA 3IQQA 1XFZO 3I5GC 3S05A 3O77A 1C7VA 2SCPA 2DDDA 4P76A 1M31A 3E3RA 5CSIA 2HPWA 2K7DA 2Y5IA 1K95A 1PSBA 3BXAA 1XFWO 1YZWA 2JXLA 1CNPA 3PLFB 1B1GA 2K7CA 5DTLA 2M7LA 1KYPA 3LVAA 1NX3A 3F45A 2AH8A 3A8SA 1TIZA 4F0ZB 1OXEA 1B47A 5BTTB 2ARLA 1F70A 5K89A 1C07A 1F71A 1YHHA 3AKOA 4OKHA 1XVJA 2LM5A 4W6PA 2GW4B 4HQ9A 3NT3A 4IK1A 5HKWA 3U8AA 4KF5C 1QX2A 3TZ1A 1TOPA 4IL1A 2CTNA 3U0MA 4PE7A 3GB3A 2PALA 3DD4A 4YI9A 1K9PA 4IK8A 2WNDA 2F8PA 4W73A 1C4FA 1PK0D 3SVUA 1QLKA 2P6BB 3KEVA 4KA9A 5KTGA 3JVTB 2Z6XA 3SG4A 2JT3A 1XFVO 2HRSA 1QV0A 1S5GY 2H9WA 1S6JA 2NLNA 1RMOA 1SL9A 2I94A 2IE2A 3TDIA 4LQTA 3EVRA 2DD9A 1ALWA 3LSAA 5DPHA 3WHUB 2Y1NA 4J89A 3H1OA 3DQNA 2ZO7A 2A54B 3DQJA 3DQDA 5DRFA 1JC0A 2WCEA 2VVIA 4W6TA 1A03A 2QLGB 1DF0B 2L5XB 3FWBA 4YGBB 5AERA 3M24A 3JVTC 2WSOA 3PATA 3DVMA 1ALVA 5HLVA 4MZKA 4DKMA 1HUYA 1DMOA 2G3DB 3U0NA 4W75A 4ORAB 3ZULA 3JTDB 5EXUA 2M1UA 2JC2A 3PIBA 3SIBA 2VVHA 4KF5A 1OSAA 2LP3A 4W6SA 1DJXA 2BCAA 3AI5A 3LF4B 1SK6D 1QTXA 2G9BA 1DJHA 2G6XA 3VHTB 1K94A 4XOVA 5D7FA 2WHTA 3ADFA 4B30A 1KK7Z 3DQCA 4BY4A 4H3LA 5HGEA 2MJWB 4W7DA 3GJ2A 3CR2A 4ORBB 1SL7A 1EG3A 5BTTA 4L1IA 2AWKA 1PULA 2G3OA 5I2OA 1ZOTB 1WRZA 3AKAA 1MYWA 4LQUA 5DPIA 2MAZA 2ZNDA 2KOTA 1KP5A 1U5IB 1UHIA 5PALA 4PE0A 4I5LB 1J55A 2KGRA 4LW5A 4CIDA 2RH7A 3DQ3A 2OGRA 1NCXA 2WORA 5I2QA 4ORCB 4LJCA 2LLSA 1M39A 1EMKA 4W6RA 1NP8A 4W76A 4HREE 3DQEA 3LK1A 3K1KA 2KAXA 4GOBA 2EGDA 5F6TA 2KNEA 1GGXA 3CGAA 3AAJA 4W7AA 1K8UA 2QACA 3OSQA 3ZUJA 1Y6WA 3DQMA 2CNPA 4GBAA 2HQKA 4HE4A 1FPWA 2BECA 5EXBA 1Q73A 2QPTA 2M49B 2Q4UA 2AWMA 4GF6B 1QS7A 1FF1A 1ZMZA 1BT6A 1W7TA 5HW9A 4I2YA 1S36A 3LL8B 3OB2B 4PCWA 1H4BA 5KTYA 1EG4A 5DKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EDO A;  4M2Q A;  4ZF5 A;  1IQ5 A;  5DPG A;  1TNW A;  3WLD A;  4RTC A;  3ZNI A;  2GV5 A;  1H8B A;  2QLG A;  3NF0 A;  1ZUX A;  2KAV A;  2O29 A;  3SS0 A;  1LKJ A;  5HZS A;  1Y1X A;  2PRU A;  3CLN A;  1OQP A;  3SSH A;  4YGC B;  1JSA A;  1XFX O;  4JPZ B;  4L13 A;  2MBX A;  1L2O B;  2M1K B;  4I5N B;  2OKY A;  1GGZ A;  2HJO A;  1DTL A;  3U8C A;  4DXO A;  1Z1Q A;  5HZU A;  3PJ7 A;  1B8R A;  1XFY O;  3QRX A;  1B8L A;  4XVP A;  5FHV A;  3EK8 A;  1CLM A;  3DQ2 A;  4ICB A;  2HCG A;  2LVV A;  1V1F A;  2QLE A;  2CXJ A;  1XYD A;  1YVH A;  1EMC A;  1LA3 A;  5H88 A;  2E6W A;  1CDN A;  2LNK A;  5LK4 A;  2HQ8 A;  1U5I A;  3CR5 X;  2F2P A;  4HVF A;  4Q7R A;  2AWJ A;  4W7C A;  3CD9 A;  4JFG A;  3TMR A;  2LVJ A;  3G9A A;  5EB6 A;  1EMM A;  2KGB C;  4DXI A;  3LF3 A;  1AK8 A;  1AP4 A;  1KQM B;  2L4I A;  2B1U A;  1UHJ A;  2LMT A;  2DUI A;  4YRU A;  2PVB A;  5HZT A;  5ER4 X;  4HRG A;  1Y1A A;  1XA9 A;  3EKH A;  3KCS A;  5BT0 A;  3DPZ A;  2F33 A;  4B5Y A;  2D8N A;  3DF0 B;  2A47 A;  4BDU A;  3EKJ A;  1CFP A;  4OR9 B;  4OVN F;  2KYF A;  5DQM A;  4PFE A;  2O60 A;  3DQO A;  5D69 A;  1EML A;  2H61 C;  1A4P A;  4KW9 A;  1Y0V H;  1RWY A;  1NX0 A;  1LIN A;  1UWO A;  2KI4 B;  3DQ8 A;  2LCP A;  1KQM C;  4P5O E;  2I7A A;  3SJS A;  1CB1 A;  4JQ0 D;  2A48 A;  5KSZ A;  1CTR A;  1SYM A;  2B3Q A;  1QYF A;  4W6F A;  4P2Y B;  4XJK B;  2DUF A;  1YUU A;  1QLS A;  1DGV A;  2MRD A;  1OMR A;  1PVA A;  4CFQ A;  4OJ0 A;  3SVD A;  5AAN A;  1LXF C;  3BOW B;  4GPL B;  3CFA A;  1QX5 B;  2R2I A;  4IK4 A;  2V4E C;  3DQK A;  1YHG A;  4W77 A;  4CPV A;  4IK5 A;  1JC1 A;  1QAT A;  3DVE A;  2KI4 C;  4RYW A;  3U0K A;  2P4M A;  1CFF A;  1UP5 A;  4Q7T A;  4XYN A;  1TNQ A;  1TCO B;  1XFU O;  1WLZ A;  3D0Y B;  2RGI A;  4R6D A;  1CMG A;  1DJZ A;  3ST3 A;  3RWA A;  2IOV A;  1QY3 A;  3LLE A;  3GOF A;  3BUX B;  1XQM A;  1NPQ A;  4DRW A;  3SSV A;  3UFZ A;  1NSH A;  1S3P A;  1S1E A;  5LTQ A;  4TNC A;  2ZRS A;  5EXC I;  1NCZ A;  1CFD A;  1WRL A;  3BUO B;  3CWG A;  1W7U A;  2CT9 A;  2H61 A;  1OZO A;  1AVS A;  2Q91 A;  4FQO A;  2FZU A;  3H4S E;  5CSF A;  3NXA A;  1PSR A;  1UHH A;  4FTG A;  2V53 A;  3SVC A;  4KGF A;  2DDC A;  2TN4 A;  1X02 A;  4ZCU A;  2A53 B;  1DGU A;  3DF0 A;  4W6A A;  4MRX A;  1XK4 C;  2V4E A;  1F0B A;  4B30 B;  2G6Y A;  3BYA A;  4N1F A;  4KW8 A;  3A8R A;  1F54 A;  1QIW A;  1YX8 A;  2OPO A;  1V1G A;  1OXD A;  3DVJ A;  5BQL A;  5T3I A;  4XGY A;  1MUX A;  1HQV A;  4GES B;  2Q57 A;  2PXW A;  4XJK A;  1W7J B;  3BX9 A;  4ZBL A;  3U8P A;  3BOW A;  3KPX A;  2JT8 A;  1EXR A;  1TNP A;  2G16 B;  1KYS A;  3IF7 A;  2GX0 A;  3EK4 A;  1MXE A;  1N2D A;  1BG1 A;  4Q9W A;  1CM4 A;  3ED8 A;  3D10 A;  3K21 A;  3NSK A;  1Q4C A;  1WY9 A;  4PPJ A;  3LS3 A;  2KI6 C;  2KQ6 A;  4U2V A;  2JNX A;  4L12 A;  2OTB A;  3D0Y A;  2A50 B;  5CSJ A;  1GGW A;  1H6R A;  3TS5 B;  1NYA A;  1EMF A;  4W6I A;  2Q6P A;  1XMZ A;  3SSK A;  5J2O A;  1SR6 C;  3O2P A;  1K9U A;  2BCB A;  1AHR A;  1RK9 A;  2LLU A;  1ZGP A;  3W1C A;  1N0Y A;  4J8A A;  1BR4 B;  2K0J A;  3DPW A;  1XK4 A;  4AS8 A;  4W6N A;  3CFF A;  2H2K A;  2WUR A;  1KQV A;  1WRK A;  2LVI A;  1YUT A;  2LE9 B;  4C0K A;  2LHI A;  1QVI Z;  4MVF A;  3WHT B;  3TS5 C;  1YVL A;  1S26 D;  2JOJ A;  1MXL C;  2GW3 A;  5DKR A;  4R1E A;  5EHU A;  1C7W A;  2G5Z B;  4W72 A;  4Q04 A;  4N3D A;  3SVS A;  1BLQ A;  2H5Q A;  2HPS A;  4OGS A;  1W7I B;  5BPJ A;  3NEZ A;  2ISD A;  1IH0 A;  1YHI A;  5B8I B;  2L98 A;  3RM1 A;  4H3M A;  2JT0 A;  4AR7 A;  3LK0 A;  1IJ5 A;  2NCO A;  4W6U A;  4GAO A;  3ZTF A;  4MRY A;  1RFJ A;  2L2E A;  5EBJ A;  4ORN A;  1XSS A;  2WC8 A;  3EK7 A;  3P28 A;  2OJK A;  2O5G A;  2POX A;  3EVV A;  5J3X A;  3UG0 A;  4OY4 A;  1FI5 A;  4D1E A;  3E5V A;  1J7Q A;  4AOM A;  3GJ1 A;  2HQW A;  3SVR A;  1JWD A;  1FW4 A;  4N1G A;  4H48 A;  3SG7 A;  4LJB A;  4OCI A;  1UHN A;  3WNX B;  4W6B A;  3BXB A;  1NCY A;  1CDM A;  2LAN A;  4ANJ A;  1QXT A;  5DKQ A;  1KFX L;  3BQ3 A;  1H4U A;  4KGE A;  2WIS A;  3CFH A;  3I5H B;  4HQC A;  1MWN A;  2K2F A;  1KFX S;  2KQY A;  3GL4 A;  2HFC A;  1GL4 A;  2NZ0 A;  2H8Q A;  1DVI A;  2HGY A;  3CS1 A;  4YGA A;  1ZGQ A;  1EMB A;  1QVI Y;  3DQF A;  4W74 A;  4USL A;  1SL8 A;  1KSO A;  5I2L A;  1MR8 A;  5HKY A;  5H89 A;  1YRT B;  1K90 D;  2COL B;  1B7T Z;  2QLI A;  1ZAC A;  3GK2 A;  5GQQ C;  3NT9 A;  2M9G A;  2VAE A;  3I5H C;  5AXI A;  2AHA A;  1QIV A;  4W7F A;  1TRF A;  2AWL A;  3SG2 A;  4P1Q A;  1CKK A;  1KK7 Y;  5DU0 A;  5IBW A;  3FIA A;  2LP2 A;  4JGE A;  2JNF A;  4DXN A;  1Q4D A;  5DTY A;  4MEW A;  1KFU L;  2JTT A;  2A56 B;  2AUC A;  3CTN A;  5F9G A;  1D1O A;  1IGV A;  2Y0G A;  3E5T A;  1QJT A;  4BY5 A;  3CR4 X;  5HZO A;  1QV1 A;  1UUR A;  1KFU S;  5DRG A;  2LAP A;  1B4C A;  4Z4M A;  3BUW B;  4CLN A;  2GGZ A;  4DUQ A;  1CLB A;  3SG6 A;  3WCK A;  2LHL A;  3DQ1 A;  1IWQ A;  2KBI A;  3KO0 A;  3TUY B;  2M0R A;  3C1V A;  5TNC A;  2FWQ A;  2BL0 C;  4KF4 A;  3PM8 A;  1G33 A;  1SMG A;  1S6I A;  2ZRT A;  4PHN A;  4HQ8 A;  2JRF A;  3V3D A;  3DPX A;  1S6C A;  1JBZ A;  2H5O A;  4ZFS A;  2IS9 A;  1IQ3 A;  2V4E B;  4DXM A;  4DCK A;  1NUB A;  1LA0 A;  3E5W A;  2KDH A;  1J7R A;  3RWT A;  5HLO A;  2JAD A;  2BE6 A;  5FVF A;  3TUY C;  4AQJ A;  2ZO6 A;  3I5I B;  4M2O A;  3NSL A;  4RYS A;  2ZNE A;  4PDZ A;  4J88 A;  4EUL A;  1BR1 B;  2C9I A;  1IKU A;  2EMO A;  1YUR A;  1MOV A;  4NQG A;  2F3Z A;  3NED A;  3PFV A;  1F8H A;  1YJ2 A;  1NX1 A;  3SSY A;  2JZI A;  1CM1 A;  1NWD A;  3KHE A;  5FYX A;  2GX2 A;  2JWW A;  2EHB A;  2Y4Q A;  1SRA A;  1K9K A;  3A4U B;  4YGE B;  4E68 A;  2ZMW A;  4W69 A;  1JUO A;  1DT7 B;  3WLC A;  3I5I C;  1YUS A;  4W6O A;  1WDC B;  3OSR A;  4HSZ A;  2K8M B;  4MBE A;  1Q80 A;  2PXS A;  3CB9 A;  2CCM A;  3PN7 B;  1PAL A;  4A4C A;  3VRN A;  1AJ4 A;  2FCE A;  3IP2 A;  3VRQ A;  3OHM B;  4C0J A;  1CDL A;  1JF0 A;  4UPG A;  1TN4 A;  5HYD A;  3VRO A;  2FL1 A;  4W6L A;  1MQ1 A;  2KFH A;  3CD1 A;  1SY9 A;  2VVJ A;  2GGM A;  1MOU A;  3GK1 A;  2KYC A;  3VRR A;  4QJ4 B;  1OE9 B;  2HQZ A;  1CFC A;  1KK8 B;  4Z4K A;  1AUI B;  2LUX A;  4W6G A;  3W1D A;  1Q4B A;  3WXA A;  2Z6Y A;  4R6B A;  1PVB A;  4NDC A;  1BOD A;  2YFP A;  3DVK A;  1WDC C;  1JFJ A;  2MLF C;  1WLM A;  2DD7 A;  3EVP A;  3O78 A;  3PN7 C;  2KHN A;  2QT2 A;  2MLE C;  2FCD A;  1KWO B;  3M22 A;  3H1R A;  2DUE A;  2LLT A;  1N65 A;  1XO5 A;  3I19 A;  3P8U A;  2YE0 A;  1TCF A;  1TNX A;  2KFF A;  1KK8 C;  2KFG A;  1BMO A;  2LC5 A;  1J7O A;  2JPT A;  3SG3 A;  3SRY A;  1CMF A;  3FS7 A;  2BBM A;  3HCM A;  4NDD A;  2WCB A;  1L7Z A;  2F2O A;  4MLW A;  2ZN8 A;  2JXC A;  4AQI A;  4W6H A;  1CDP A;  1FBV A;  1KWO C;  3SSP A;  1CLL A;  2HF5 A;  2JUL A;  3DQH A;  1SR6 B;  3BUM B;  2WHU A;  4W6K A;  3SVE A;  1A75 A;  3SVO A;  3DQI A;  2WOS A;  2PMY A;  2PSR A;  4IK9 A;  2QZ0 A;  4PAL A;  1EJ3 A;  1RRO A;  2LV7 A;  2H5R A;  2LVK A;  4ZB1 A;  4MZJ A;  1R6P A;  2QRF A;  2L50 A;  2BBN A;  4NDB A;  3IR8 A;  1SCM B;  5ER5 A;  1FI6 A;  1SNL A;  2M8U A;  2K7O A;  1A2X A;  1G7K A;  3DQ4 A;  2E30 A;  4I5K A;  3NSI A;  1UHK A;  2ZN9 A;  4WRI A;  2A46 A;  1PRW A;  3CBE A;  2M97 A;  1J1D A;  1ODB A;  1SKT A;  3DQ9 A;  4DXP A;  1YFP A;  5HKZ A;  1OXF A;  1RMM A;  1SW8 A;  3OGO A;  2DUG A;  5JOL A;  2WSN A;  3TDU A;  4W6J A;  1EMG A;  2IB5 A;  1SPY A;  4PE1 A;  3U0L A;  1EME A;  1JF2 A;  4XL5 A;  3ZUF A;  4WQ2 A;  3ZWH A;  3BXC A;  1ZFS A;  1HT9 A;  1SCM C;  2LUC A;  2OKW A;  4GNK B;  4TZG A;  2FOT A;  1YTZ C;  5DTX A;  2NCP A;  1K93 D;  2G2S B;  2K61 A;  2O2B A;  5FVG A;  2ZMU A;  4H3N A;  2DUH A;  2Y1M A;  1KYR A;  2L0P A;  3IQO A;  5H87 A;  4Q9X A;  5LTP A;  4M2P A;  1RM9 A;  1QXP A;  1VRK A;  4MSP A;  4LJD C;  3PAL A;  2CBL A;  2NXQ A;  1IG5 A;  4EN1 A;  4KAG A;  5HBD A;  5AFP A;  1F55 A;  3SVN A;  2EMN A;  2BTJ A;  1BOC A;  5AQB B;  1CV7 A;  1SBJ A;  4W6M A;  1XAE A;  4QJ3 B;  3SG5 A;  3HX4 A;  3AKB A;  3AAK A;  2QU1 A;  1Q4E A;  4PHK A;  4EMQ A;  4EDS A;  2MA2 A;  2KI6 D;  2IB6 A;  1YRU B;  1LVC D;  1G8I A;  1JFK A;  2AAO A;  3DQ7 A;  3LA1 A;  4PPK A;  2M3W A;  4TZA A;  5DTZ A;  2H5P A;  3SSL A;  2MHH A;  1W7S A;  3JTD C;  4ZF3 A;  1JC2 A;  4L9M A;  2BE4 A;  2I2R E;  2KAY A;  1RTP 1;  4MN0 A;  4OQW A;  1OOJ A;  3O6B A;  1J7P A;  2JTZ A;  1REC A;  3GEX A;  4W7E A;  2I18 A;  3M0W A;  4GGN A;  4WQ3 A;  4ZIN A;  1K96 A;  3OB1 B;  1MF8 B;  1ZUZ A;  3FWC A;  2EMD A;  2WCF A;  4ETO A;  2LMU A;  1GFL A;  1IJ6 A;  4OHS A;  2WIQ A;  4LJD A;  1E8A A;  1QX7 A;  2ZFD A;  3VK1 A;  3EVU A;  2B3P A;  2WHS A;  1RMP A;  1AJ5 A;  4DS7 A;  1OZS A;  2VAD A;  2C9J A;  4HRH A;  2JQ6 A;  2OTE A;  4GGF C;  4IK3 A;  5CSN A;  3PJB A;  3DQ6 A;  4ZCV A;  2VRG A;  1RJV A;  4C0L A;  1RRX A;  1EH2 A;  5FVI A;  4DIR A;  3O4Y A;  2L4H A;  1KCY A;  1YJF A;  1DF0 A;  1F4Q A;  2FJU B;  2AMI A;  5DY6 A;  5EJU A;  1IRJ A;  4PE4 A;  3CZT X;  1GJY A;  4YI8 A;  4W7X A;  4JF9 A;  3SIA A;  1GQM A;  1Q4A A;  1BFP A;  4JEO A;  2BL0 B;  3LCP C;  2JU0 A;  1DJY A;  3ST2 A;  5KU1 A;  3RLZ A;  3VHT A;  3DQL A;  4QJ5 B;  2KSP A;  1YX7 A;  3OX6 A;  1M63 B;  2KBM A;  4GUK A;  1B8C A;  2M29 A;  4KEX A;  4CFR A;  1SCV A;  1TTX A;  5EB7 A;  4MZL A;  1JBA A;  3I5F B;  3DQU A;  3CGL A;  5LTR A;  4UTS A;  3BXK A;  1OMD A;  4KW4 A;  4JC2 A;  3DQ5 A;  1DJI A;  1K2H A;  2L51 A;  3KF9 A;  1L2O C;  1B9A A;  2YE1 A;  2EC6 B;  4NWS A;  4JRB A;  2M7N A;  2O24 A;  4PPL A;  2LMV A;  1M45 A;  3SVB A;  1YR5 A;  4GFT A;  4Q7U A;  4GGF A;  4N5X A;  4A4B A;  3I5F C;  5CPV A;  3VIC A;  1Z1P A;  3SST A;  2ZKM X;  2OS8 B;  3GK4 X;  1Y1U A;  4ZF4 A;  4I5J A;  1OMV A;  3ST0 A;  2G6E A;  4H47 A;  4YGD B;  3ST4 A;  3NSO A;  2EC6 C;  1J1E A;  1G4Y R;  4W6C A;  4ZIO A;  4W6D A;  4YBH B;  3ICB A;  2HET A;  2A52 B;  1R2U A;  2OTG B;  1B9C A;  1EMA A;  2SAS A;  2K2A A;  2DOQ A;  2F3Y A;  3LVD A;  3MGF A;  4W7R A;  2BKH B;  5G08 A;  1BU3 A;  3VRP A;  2Z6Z A;  1A75 B;  1B7T Y;  3PJ5 A;  2Z1O A;  1A29 A;  4XOW A;  5I8N A;  2OS8 C;  1XA5 A;  2PAS A;  1QYO A;  1M46 A;  4DKN A;  3OX5 A;  2A4J A;  1QAS A;  4PHJ A;  1KSM A;  3AI4 A;  3KCT A;  4OV2 A;  3VGO A;  1NX2 A;  2OTG C;  5DPJ A;  3TDZ A;  1F09 A;  3BUN B;  1DJG A;  1BF5 A;  1S6Z A;  2YDZ A;  2BCX A;  3LVC A;  5DQB A;  2BKI B;  5AEQ A;  3DQA A;  1JBY A;  1DJW A;  4U8D A;  4JWQ A;  1UUS A;  1S5G Z;  3I5G B;  1MHO A;  2K7B A;  3PSR A;  3TMT A;  1F4O A;  1EL4 A;  2HGD A;  2QLH A;  1NIW A;  1QYQ A;  4PHM A;  1HCJ A;  2VZX A;  1BJF A;  4IZN A;  2H6V A;  4KPI A;  3OP0 A;  3MSE B;  1UIS A;  1ZGO A;  2G2B A;  5JJG A;  3SV5 A;  4DXQ A;  2ICR A;  3IQQ A;  1XFZ O;  3I5G C;  3S05 A;  3O77 A;  1C7V A;  2SCP A;  2DDD A;  4P76 A;  1M31 A;  3E3R A;  5CSI A;  2HPW A;  2K7D A;  2Y5I A;  1K95 A;  1PSB A;  3BXA A;  1XFW O;  1YZW A;  2JXL A;  1CNP A;  3PLF B;  1B1G A;  2K7C A;  5DTL A;  2M7L A;  1KYP A;  3LVA A;  1NX3 A;  3F45 A;  2AH8 A;  3A8S A;  1TIZ A;  4F0Z B;  1OXE A;  1B47 A;  5BTT B;  2ARL A;  1F70 A;  5K89 A;  1C07 A;  1F71 A;  1YHH A;  3AKO A;  4OKH A;  1XVJ A;  2LM5 A;  4W6P A;  2GW4 B;  4HQ9 A;  3NT3 A;  4IK1 A;  5HKW A;  3U8A A;  4KF5 C;  1QX2 A;  3TZ1 A;  1TOP A;  4IL1 A;  2CTN A;  3U0M A;  4PE7 A;  3GB3 A;  2PAL A;  3DD4 A;  4YI9 A;  1K9P A;  4IK8 A;  2WND A;  2F8P A;  4W73 A;  1C4F A;  1PK0 D;  3SVU A;  1QLK A;  2P6B B;  3KEV A;  4KA9 A;  5KTG A;  3JVT B;  2Z6X A;  3SG4 A;  2JT3 A;  1XFV O;  2HRS A;  1QV0 A;  1S5G Y;  2H9W A;  1S6J A;  2NLN A;  1RMO A;  1SL9 A;  2I94 A;  2IE2 A;  3TDI A;  4LQT A;  3EVR A;  2DD9 A;  1ALW A;  3LSA A;  5DPH A;  3WHU B;  2Y1N A;  4J89 A;  3H1O A;  3DQN A;  2ZO7 A;  2A54 B;  3DQJ A;  3DQD A;  5DRF A;  1JC0 A;  2WCE A;  2VVI A;  4W6T A;  1A03 A;  2QLG B;  1DF0 B;  2L5X B;  3FWB A;  4YGB B;  5AER A;  3M24 A;  3JVT C;  2WSO A;  3PAT A;  3DVM A;  1ALV A;  5HLV A;  4MZK A;  4DKM A;  1HUY A;  1DMO A;  2G3D B;  3U0N A;  4W75 A;  4ORA B;  3ZUL A;  3JTD B;  5EXU A;  2M1U A;  2JC2 A;  3PIB A;  3SIB A;  2VVH A;  4KF5 A;  1OSA A;  2LP3 A;  4W6S A;  1DJX A;  2BCA A;  3AI5 A;  3LF4 B;  1SK6 D;  1QTX A;  2G9B A;  1DJH A;  2G6X A;  3VHT B;  1K94 A;  4XOV A;  5D7F A;  2WHT A;  3ADF A;  4B30 A;  1KK7 Z;  3DQC A;  4BY4 A;  4H3L A;  5HGE A;  2MJW B;  4W7D A;  3GJ2 A;  3CR2 A;  4ORB B;  1SL7 A;  1EG3 A;  5BTT A;  4L1I A;  2AWK A;  1PUL A;  2G3O A;  5I2O A;  1ZOT B;  1WRZ A;  3AKA A;  1MYW A;  4LQU A;  5DPI A;  2MAZ A;  2ZND A;  2KOT A;  1KP5 A;  1U5I B;  1UHI A;  5PAL A;  4PE0 A;  4I5L B;  1J55 A;  2KGR A;  4LW5 A;  4CID A;  2RH7 A;  3DQ3 A;  2OGR A;  1NCX A;  2WOR A;  5I2Q A;  4ORC B;  4LJC A;  2LLS A;  1M39 A;  1EMK A;  4W6R A;  1NP8 A;  4W76 A;  4HRE E;  3DQE A;  3LK1 A;  3K1K A;  2KAX A;  4GOB A;  2EGD A;  5F6T A;  2KNE A;  1GGX A;  3CGA A;  3AAJ A;  4W7A A;  1K8U A;  2QAC A;  3OSQ A;  3ZUJ A;  1Y6W A;  3DQM A;  2CNP A;  4GBA A;  2HQK A;  4HE4 A;  1FPW A;  2BEC A;  5EXB A;  1Q73 A;  2QPT A;  2M49 B;  2Q4U A;  2AWM A;  4GF6 B;  1QS7 A;  1FF1 A;  1ZMZ A;  1BT6 A;  1W7T A;  5HW9 A;  4I2Y A;  1S36 A;  3LL8 B;  3OB2 B;  4PCW A;  1H4B A;  5KTY A;  1EG4 A;  5DKN A; 
#chains in the Genus database with same CATH topology
 4EDO A;  4M2Q A;  4ZF5 A;  1IQ5 A;  5DPG A;  1TNW A;  3WLD A;  4RTC A;  3ZNI A;  2GV5 A;  1H8B A;  2QLG A;  3NF0 A;  1ZUX A;  2KAV A;  2O29 A;  3SS0 A;  1LKJ A;  5HZS A;  1Y1X A;  2PRU A;  1TWO A;  3CLN A;  1OQP A;  3SSH A;  4YGC B;  1JSA A;  1XFX O;  4JPZ B;  3RZS A;  4L13 A;  2MBX A;  1L2O B;  2M1K B;  4I5N B;  3NHT A;  2OKY A;  1GGZ A;  2HJO A;  1DTL A;  3U8C A;  4DXO A;  1Z1Q A;  5HZU A;  2QEO A;  3PJ7 A;  2QEB A;  1B8R A;  1XFY O;  3QRX A;  1B8L A;  4XVP A;  5FHV A;  3EK8 A;  1CLM A;  3DQ2 A;  4ICB A;  2HCG A;  2LVV A;  1V1F A;  2QLE A;  2CXJ A;  1XYD A;  1YVH A;  1EMC A;  1LA3 A;  5H88 A;  2E6W A;  1CDN A;  2LNK A;  5LK4 A;  2HQ8 A;  1U5I A;  2QEV A;  2F2P A;  3CR5 X;  4HVF A;  4Q7R A;  2AWJ A;  4W7C A;  3CD9 A;  4JFG A;  1DEK A;  3TMR A;  2LVJ A;  3FE8 A;  3G9A A;  5EB6 A;  5FI7 A;  1EMM A;  2KGB C;  4DXI A;  1C3Z A;  3LF3 A;  1AK8 A;  1AP4 A;  1KQM B;  2L4I A;  2B1U A;  1UHJ A;  2LMT A;  2DUI A;  4YRU A;  2PVB A;  5HZT A;  5ER4 X;  4HRG A;  1Y1A A;  1XA9 A;  3EKH A;  3KCS A;  5BT0 A;  2WC5 A;  3DPZ A;  2F33 A;  4B5Y A;  2D8N A;  3DF0 B;  2A47 A;  4BDU A;  3EKJ A;  1CFP A;  4OR9 B;  4OVN F;  2KYF A;  5DQM A;  4PFE A;  5FI2 A;  2O60 A;  3B88 A;  3DQO A;  5D69 A;  1EML A;  2H61 C;  1A4P A;  4KW9 A;  1Y0V H;  1RWY A;  1NX0 A;  1LIN A;  1UWO A;  2KI4 B;  3DQ8 A;  2LCP A;  1KQM C;  3DXL A;  4P5O E;  2I7A A;  3SJS A;  1CB1 A;  4JQ0 D;  2A48 A;  5KSZ A;  1CTR A;  1SYM A;  2B3Q A;  1QYF A;  4W6F A;  4P2Y B;  3PJI A;  4XJK B;  2DUF A;  1YUU A;  1QLS A;  1DGV A;  2MRD A;  1OMR A;  1PVA A;  4CFQ A;  4OJ0 A;  3SVD A;  5AAN A;  1LXF C;  3BOW B;  4GPL B;  3CFA A;  1QX5 B;  2R2I A;  3D76 A;  4IK4 A;  2V4E C;  3DQK A;  1YHG A;  4W77 A;  2P71 A;  4CPV A;  4IK5 A;  2L2C A;  1JC1 A;  1QAT A;  3DVE A;  2KI4 C;  4RYW A;  3U0K A;  2P4M A;  1CFF A;  1UP5 A;  4Q7T A;  4XYN A;  1TNQ A;  1TCO B;  1XFU O;  1WLZ A;  3D0Y B;  2RGI A;  4R6D A;  1CMG A;  1DJZ A;  4INX A;  3N7H A;  3D75 A;  3ST3 A;  3RWA A;  2IOV A;  3B86 A;  1QY3 A;  5I94 A;  3BFH A;  3LLE A;  3GOF A;  3BUX B;  1XQM A;  1NPQ A;  4DRW A;  3SSV A;  3UFZ A;  1NSH A;  1S3P A;  1S1E A;  5LTQ A;  3SS3 A;  4TNC A;  2ZRS A;  5EXC I;  1NCZ A;  1CFD A;  1WRL A;  3BUO B;  3CWG A;  1W7U A;  2CT9 A;  2H61 A;  1OZO A;  2WCM A;  1AVS A;  2Q91 A;  3FE9 A;  4FQO A;  2FZU A;  3H4S E;  5CSF A;  4PT1 A;  3NXA A;  2H8V A;  2WCK A;  1PSR A;  1UHH A;  4FTG A;  2V53 A;  3SVC A;  4KGF A;  2DDC A;  2TN4 A;  1X02 A;  4ZCU A;  2A53 B;  1DGU A;  3DF0 A;  4W6A A;  4MRX A;  1XK4 C;  2V4E A;  1F0B A;  4B30 B;  2G6Y A;  3BYA A;  4N1F A;  4KW8 A;  3A8R A;  1F54 A;  1QIW A;  1YX8 A;  2OPO A;  1V1G A;  1OXD A;  3DVJ A;  5BQL A;  5T3I A;  4XGY A;  1MUX A;  1HQV A;  4GES B;  2Q57 A;  2PXW A;  4XJK A;  1W7J B;  3DYE A;  3BX9 A;  4ZBL A;  3U8P A;  3BOW A;  3KPX A;  2JT8 A;  2G16 B;  1EXR A;  1TNP A;  1KYS A;  3IF7 A;  2GX0 A;  3EK4 A;  1MXE A;  1N2D A;  1BG1 A;  4Q9W A;  1CM4 A;  3ED8 A;  3D10 A;  3K21 A;  3NSK A;  1Q4C A;  1WY9 A;  4PPJ A;  1P28 A;  3LS3 A;  1OW4 A;  2KI6 C;  2KQ6 A;  4U2V A;  2JNX A;  4L12 A;  2OTB A;  3D0Y A;  2A50 B;  5CSJ A;  1GGW A;  1H6R A;  3TS5 B;  1NYA A;  1EMF A;  4W6I A;  2Q6P A;  1XMZ A;  3SSK A;  5J2O A;  1SR6 C;  3O2P A;  1K9U A;  2BCB A;  1AHR A;  1RK9 A;  2LLU A;  1ZGP A;  3W1C A;  1N0Y A;  4J8A A;  1BR4 B;  2K0J A;  3DPW A;  1XK4 A;  4AS8 A;  3D73 A;  3CFF A;  4W6N A;  2H2K A;  2WUR A;  1KQV A;  1WRK A;  2LVI A;  1YUT A;  2LE9 B;  4C0K A;  2LHI A;  1QVI Z;  4MVF A;  3WHT B;  3TS5 C;  1YVL A;  1S26 D;  2JOJ A;  1MXL C;  3UO9 A;  2GW3 A;  5DKR A;  4R1E A;  5EHU A;  1C7W A;  2G5Z B;  4W72 A;  4Q04 A;  4N3D A;  3SVS A;  1BLQ A;  2H5Q A;  3CAB A;  2HPS A;  4OGS A;  1W7I B;  1ORG A;  5BPJ A;  3NEZ A;  2ISD A;  3DZT A;  1IH0 A;  3Q8I A;  1YHI A;  5B8I B;  2L98 A;  3RM1 A;  4H3M A;  2JT0 A;  4AR7 A;  3LK0 A;  1IJ5 A;  2NCO A;  4W6U A;  4GAO A;  3ZTF A;  4MRY A;  1RFJ A;  2L2E A;  5EBJ A;  4ORN A;  1XSS A;  2WC8 A;  3EK7 A;  3P28 A;  2OJK A;  2O5G A;  2POX A;  3EVV A;  5J3X A;  3UG0 A;  4OY4 A;  1FI5 A;  4D1E A;  3E5V A;  1OOF A;  1J7Q A;  4AOM A;  3GJ1 A;  2HQW A;  3SVR A;  1JWD A;  1FW4 A;  4N1G A;  4H48 A;  3SG7 A;  4LJB A;  1LS8 A;  4OCI A;  3B87 A;  1UHN A;  2FJY A;  3WNX B;  4W6B A;  3BXB A;  1NCY A;  1CDM A;  2LAN A;  4ANJ A;  1QXT A;  5DKQ A;  1KFX L;  3BQ3 A;  1H4U A;  4KGE A;  2WIS A;  3CFH A;  3I5H B;  4HQC A;  1MWN A;  2K2F A;  1KFX S;  2KQY A;  3GL4 A;  2HFC A;  1GL4 A;  2NZ0 A;  2H8Q A;  1DVI A;  2HGY A;  3CS1 A;  4YGA A;  1ZGQ A;  1EMB A;  1QVI Y;  3DQF A;  4W74 A;  4USL A;  1SL8 A;  1KSO A;  5I2L A;  4JKT A;  1MR8 A;  5HKY A;  5H89 A;  1YRT B;  1K90 D;  2COL B;  1B7T Z;  2QLI A;  1ZAC A;  3GK2 A;  5GQQ C;  3NT9 A;  2M9G A;  2VAE A;  3I5H C;  5AXI A;  3DY9 A;  2AHA A;  1QIV A;  4W7F A;  1TRF A;  2AWL A;  3SG2 A;  4P1Q A;  1CKK A;  1KK7 Y;  5DU0 A;  5IBW A;  3FIA A;  2LP2 A;  3R1O A;  4JGE A;  2JNF A;  4DXN A;  2ERB A;  1Q4D A;  3L47 A;  1DEL A;  5DTY A;  3OBV A;  4MEW A;  1KFU L;  2JTT A;  2A56 B;  2AUC A;  3CTN A;  5HL1 A;  5F9G A;  1D1O A;  1IGV A;  2Y0G A;  3E5T A;  1QJT A;  2P70 A;  4BY5 A;  3BFB A;  3CR4 X;  5HZO A;  1QV1 A;  1UUR A;  1KFU S;  5DRG A;  2LAP A;  1B4C A;  4Z4M A;  3BUW B;  4CLN A;  2GGZ A;  3D78 A;  4DUQ A;  1CLB A;  3SG6 A;  3WCK A;  3O4X A;  2LHL A;  3DQ1 A;  1IWQ A;  2KBI A;  3KO0 A;  3TUY B;  2M0R A;  3C1V A;  5TNC A;  2FWQ A;  2BL0 C;  4KF4 A;  3PM8 A;  1G33 A;  1SMG A;  1S6I A;  2ZRT A;  4PHN A;  4HQ8 A;  2JRF A;  3V3D A;  1DQE A;  3DPX A;  1S6C A;  3BJH A;  1JBZ A;  2H5O A;  4ZFS A;  2IS9 A;  2WC6 A;  1IQ3 A;  2V4E B;  4DXM A;  4DCK A;  1NUB A;  1LA0 A;  1QWV A;  3E5W A;  2KDH A;  1J7R A;  3RWT A;  5HLO A;  2JAD A;  2BE6 A;  2YGU A;  5FVF A;  3TUY C;  4AQJ A;  2ZO6 A;  3I5I B;  4M2O A;  3NSL A;  4RYS A;  2QEH A;  2ZNE A;  4PDZ A;  4J88 A;  4EUL A;  1BR1 B;  2C9I A;  1IKU A;  2EMO A;  1YUR A;  1MOV A;  3S0G A;  4NQG A;  2F3Z A;  3FE6 A;  3NED A;  3PFV A;  1F8H A;  1YJ2 A;  1NX1 A;  3CDN A;  3SSY A;  2JZI A;  1CM1 A;  1NWD A;  3KHE A;  5FYX A;  2GX2 A;  2JWW A;  2EHB A;  2Y4Q A;  1SRA A;  1K9K A;  3A4U B;  4YGE B;  4E68 A;  2ZMW A;  4W69 A;  1JUO A;  1DT7 B;  2WCL A;  3WLC A;  3I5I C;  1YUS A;  3SS5 A;  4W6O A;  1WDC B;  3OSR A;  4HSZ A;  2K8M B;  4MBE A;  1Q80 A;  2PXS A;  3CB9 A;  2CCM A;  3PN7 B;  1PAL A;  4A4C A;  3VRN A;  1AJ4 A;  2FCE A;  3IP2 A;  3VB1 A;  3VRQ A;  3OHM B;  4C0J A;  1CDL A;  1JF0 A;  4UPG A;  1TN4 A;  5HYD A;  3VRO A;  2FL1 A;  2BAP A;  4W6L A;  1MQ1 A;  2KFH A;  3CD1 A;  1SY9 A;  2VVJ A;  2GGM A;  1MOU A;  3GK1 A;  1SSE B;  2KYC A;  3VRR A;  1OE9 B;  4QJ4 B;  2HQZ A;  1CFC A;  1KK8 B;  4Z4K A;  1AUI B;  2LUX A;  4W6G A;  3W1D A;  1Q4B A;  3WXA A;  2Z6Y A;  4R6B A;  1PVB A;  4NDC A;  1BOD A;  2YFP A;  3DVK A;  1WDC C;  1JFJ A;  2MLF C;  1WLM A;  2DD7 A;  1TUJ A;  3EVP A;  3O78 A;  3PN7 C;  2KHN A;  3OGN A;  2QT2 A;  2MLE C;  2FCD A;  1KWO B;  3M22 A;  3H1R A;  2DUE A;  1Z4H A;  3B6X A;  3SS4 A;  2LLT A;  1N65 A;  1XO5 A;  3I19 A;  3P8U A;  2YE0 A;  1TUZ A;  1TCF A;  1TNX A;  2KFF A;  1KK8 C;  2KFG A;  1BMO A;  2LC5 A;  3D77 A;  4IJ7 A;  1J7O A;  2JPT A;  3SG3 A;  3SRY A;  1CMF A;  3FS7 A;  2BBM A;  3HCM A;  4NDD A;  2WCB A;  1L7Z A;  2F2O A;  4MLW A;  2ZN8 A;  2JXC A;  4AQI A;  4W6H A;  1CDP A;  1FBV A;  1KWO C;  3SSP A;  1CLL A;  1OOI X;  2HF5 A;  2JUL A;  3DQH A;  1SR6 B;  3BUM B;  2WHU A;  4W6K A;  3SVE A;  1A75 A;  3SVO A;  3DQI A;  2WOS A;  2PMY A;  2PSR A;  2PYQ A;  4IK9 A;  2QZ0 A;  4PAL A;  1EJ3 A;  1RRO A;  2LV7 A;  2H5R A;  2LVK A;  4ZB1 A;  4MZJ A;  1R6P A;  3NHI A;  2QRF A;  2L50 A;  2BBN A;  4NDB A;  3IR8 A;  1SCM B;  5ER5 A;  1FI6 A;  1SNL A;  2M8U A;  2K7O A;  1A2X A;  1G7K A;  3DQ4 A;  2E30 A;  4I5K A;  3NSI A;  1UHK A;  2ZN9 A;  4WRI A;  2A46 A;  1PRW A;  3CBE A;  4OZD A;  2M97 A;  1J1D A;  1ODB A;  1SKT A;  3DQ9 A;  4DXP A;  1YFP A;  5HKZ A;  1OXF A;  1RMM A;  1SW8 A;  3OGO A;  2DUG A;  5JOL A;  2WSN A;  3TDU A;  4W6J A;  1EMG A;  2IB5 A;  1SPY A;  4PE1 A;  3U0L A;  1EME A;  1JF2 A;  1OOH A;  4XL5 A;  3ZUF A;  4WQ2 A;  3ZWH A;  3BXC A;  1ZFS A;  1HT9 A;  1SCM C;  2LUC A;  2QDI A;  2OKW A;  4GNK B;  4TZG A;  2FOT A;  1YTZ C;  5DTX A;  2NCP A;  1K93 D;  2G2S B;  2K61 A;  2O2B A;  5FVG A;  2ZMU A;  4H3N A;  2DUH A;  2Y1M A;  1KYR A;  2L0P A;  3IQO A;  5H87 A;  4Q9X A;  5LTP A;  4M2P A;  1RM9 A;  2KLE A;  1QXP A;  1VRK A;  4MSP A;  4LJD C;  3PAL A;  2CBL A;  2NXQ A;  1IG5 A;  4EN1 A;  3B7A A;  5DIC A;  4KAG A;  3PM2 A;  5HBD A;  5AFP A;  1F55 A;  3SVN A;  2EMN A;  2BTJ A;  3NGV A;  1BOC A;  5AQB B;  1W9Z A;  1CV7 A;  1SBJ A;  4W6M A;  1XAE A;  4QJ3 B;  3SG5 A;  3HX4 A;  3AKB A;  3AAK A;  2QU1 A;  1Q4E A;  4PHK A;  4EMQ A;  4EDS A;  2MA2 A;  2KI6 D;  2IB6 A;  1YRU B;  1LVC D;  1G8I A;  1JFK A;  2AAO A;  3DQ7 A;  3LA1 A;  4PPK A;  2M3W A;  4TZA A;  5DTZ A;  5EL2 A;  2H5P A;  3SSL A;  2MHH A;  1W7S A;  3JTD C;  4ZF3 A;  1JC2 A;  4L9M A;  2BE4 A;  2WCJ A;  2I2R E;  2KAY A;  1RTP 1;  4MN0 A;  4OQW A;  1OOJ A;  3O6B A;  3CYZ A;  1J7P A;  2JTZ A;  1REC A;  3GEX A;  4W7E A;  3UNW A;  3S0A A;  2I18 A;  3M0W A;  4GGN A;  4WQ3 A;  4ZIN A;  1K96 A;  3OB1 B;  1MF8 B;  1ZUZ A;  3FWC A;  2EMD A;  2WCF A;  4ETO A;  2LMU A;  1GFL A;  1IJ6 A;  4OHS A;  2WIQ A;  2JPO A;  4LJD A;  1E8A A;  1QX7 A;  2ZFD A;  3VK1 A;  3EVU A;  2B3P A;  2WHS A;  1RMP A;  1AJ5 A;  4DS7 A;  1OZS A;  2VAD A;  2C9J A;  4HRH A;  2JQ6 A;  2OTE A;  4GGF C;  4IK3 A;  5CSN A;  3PJB A;  3DQ6 A;  4ZCV A;  2VRG A;  1RJV A;  4C0L A;  1RRX A;  1EH2 A;  5FVI A;  4DIR A;  3O4Y A;  2L4H A;  1KCY A;  1YJF A;  1DF0 A;  1F4Q A;  2FJU B;  2AMI A;  5DY6 A;  5EJU A;  1IRJ A;  4PE4 A;  3CZT X;  1GJY A;  4YI8 A;  4W7X A;  4JF9 A;  3SIA A;  1GQM A;  1Q4A A;  1BFP A;  4JEO A;  2BL0 B;  3LCP C;  2JU0 A;  3R1V A;  1DJY A;  3ST2 A;  5KU1 A;  3RLZ A;  3VHT A;  3DQL A;  4QJ5 B;  2KSP A;  1YX7 A;  3OX6 A;  1M63 B;  2KBM A;  4GUK A;  1IIO A;  1B8C A;  2M29 A;  4KEX A;  4CFR A;  1SCV A;  4INW A;  1TTX A;  5EB7 A;  4MZL A;  1JBA A;  3I5F B;  3DQU A;  3CGL A;  5LTR A;  4UTS A;  3BXK A;  1OMD A;  4KW4 A;  4JC2 A;  3DQ5 A;  1DJI A;  1K2H A;  2GTE A;  2L51 A;  3KF9 A;  1L2O C;  1B9A A;  2YE1 A;  2EC6 B;  4NWS A;  1C3Y A;  4JRB A;  2PQL A;  2M7N A;  2O24 A;  4PPL A;  2LMV A;  1M45 A;  3SVB A;  1YR5 A;  4GFT A;  4Q7U A;  4JD9 A;  4GGF A;  4N5X A;  4A4B A;  3I5F C;  5CPV A;  3VIC A;  1Z1P A;  3SST A;  3S0E A;  1GM0 A;  2ZKM X;  2OS8 B;  3GK4 X;  1Y1U A;  4ZF4 A;  4I5J A;  1OMV A;  3ST0 A;  2K60 A;  2G6E A;  4H47 A;  4YGD B;  3ST4 A;  3NSO A;  2EC6 C;  3IVT A;  1J1E A;  1G4Y R;  4W6C A;  4ZIO A;  5FI6 A;  4W6D A;  4YBH B;  3ICB A;  2HET A;  2A52 B;  1R2U A;  2OTG B;  1B9C A;  3EG5 B;  1EMA A;  2SAS A;  2K2A A;  2DOQ A;  2F3Y A;  3LVD A;  3MGF A;  4W7R A;  2BKH B;  5G08 A;  1BU3 A;  3VRP A;  2Z6Z A;  1A75 B;  1B7T Y;  3PJ5 A;  2Z1O A;  1A29 A;  4XOW A;  2KPH A;  5I8N A;  2OS8 C;  1XA5 A;  2PAS A;  1QYO A;  1M46 A;  4DKN A;  3OX5 A;  2A4J A;  1QAS A;  1OOG A;  4PHJ A;  1KSM A;  3AI4 A;  3KCT A;  4OV2 A;  3VGO A;  2KLD A;  1NX2 A;  4KYN A;  2OTG C;  3V2L A;  5DPJ A;  3TDZ A;  1F09 A;  3BUN B;  1DJG A;  1BF5 A;  1S6Z A;  2YDZ A;  2BCX A;  2BNX A;  3LVC A;  5DQB A;  2BKI B;  5AEQ A;  2WCH A;  3DQA A;  1JBY A;  1DJW A;  4U8D A;  4JWQ A;  1UUS A;  1S5G Z;  3I5G B;  1MHO A;  2K7B A;  3PSR A;  3TMT A;  1F4O A;  3K1E A;  1EL4 A;  2HGD A;  2QLH A;  1NIW A;  1QYQ A;  4PHM A;  1HCJ A;  2VZX A;  1BJF A;  4IZN A;  2H6V A;  4KPI A;  3OP0 A;  3R72 A;  1XFR A;  3MSE B;  1UIS A;  1ZGO A;  2G2B A;  5JJG A;  3SV5 A;  4DXQ A;  2ICR A;  3IQQ A;  1XFZ O;  3I5G C;  3CZ2 A;  3S05 A;  3O77 A;  1C7V A;  2SCP A;  2DDD A;  4P76 A;  1M31 A;  3E3R A;  5CSI A;  2HPW A;  2K7D A;  2Y5I A;  1K95 A;  1PSB A;  3BXA A;  1XFW O;  1YZW A;  2JXL A;  1CNP A;  3PLF B;  1B1G A;  2K7C A;  5DTL A;  2M7L A;  1KYP A;  3LVA A;  1NX3 A;  3F45 A;  2AH8 A;  3A8S A;  1TIZ A;  4F0Z B;  1OXE A;  1B47 A;  5BTT B;  2ARL A;  1F70 A;  5K89 A;  1C07 A;  1F71 A;  1YHH A;  3AKO A;  4OKH A;  1XVJ A;  2LM5 A;  3L4L A;  4W6P A;  2GW4 B;  4HQ9 A;  3NT3 A;  4IK1 A;  5HKW A;  3U8A A;  4KF5 C;  1QX2 A;  3TZ1 A;  1TOP A;  4IL1 A;  2CTN A;  3U0M A;  3CZ1 A;  4PE7 A;  3GB3 A;  2PAL A;  3DD4 A;  3S0B A;  4YI9 A;  1K9P A;  4IK8 A;  2WND A;  2F8P A;  4W73 A;  1C4F A;  1PK0 D;  3SVU A;  1QLK A;  2P6B B;  3KEV A;  3D74 A;  4KA9 A;  5KTG A;  3JVT B;  2Z6X A;  3SG4 A;  2JT3 A;  1XFV O;  2HRS A;  1QV0 A;  1S5G Y;  2H9W A;  1S6J A;  2NLN A;  1RMO A;  1T14 A;  1SL9 A;  3R1P A;  2I94 A;  2IE2 A;  3TDI A;  4LQT A;  3EVR A;  2DD9 A;  1ALW A;  3LSA A;  5DPH A;  3WHU B;  2Y1N A;  4J89 A;  3H1O A;  3DQN A;  2ZO7 A;  2A54 B;  3BFA A;  3DQJ A;  3DQD A;  5DRF A;  1JC0 A;  2WCE A;  2VVI A;  2L5Y A;  4W6T A;  1A03 A;  2QLG B;  1DF0 B;  2L5X B;  3FWB A;  4YGB B;  5AER A;  3M24 A;  3JVT C;  2WSO A;  3PAT A;  3DVM A;  1ALV A;  5HLV A;  4MZK A;  5D3O A;  4DKM A;  1HUY A;  1DMO A;  2G3D B;  3U0N A;  4W75 A;  4ORA B;  3ZUL A;  3JTD B;  5EXU A;  2M1U A;  2JC2 A;  3PIB A;  3SIB A;  2VVH A;  4KF5 A;  1OSA A;  2LP3 A;  4W6S A;  1DJX A;  2BCA A;  3AI5 A;  3LF4 B;  1SK6 D;  1QTX A;  1Z2C B;  2G9B A;  1DJH A;  2G6X A;  3VHT B;  1K94 A;  4XOV A;  5D7F A;  3S0D A;  2WHT A;  3ADF A;  4B30 A;  1KK7 Z;  3DQC A;  4BY4 A;  4H3L A;  5HGE A;  2MJW B;  4W7D A;  3GJ2 A;  4F7F A;  3CR2 A;  4ORB B;  1SL7 A;  1EG3 A;  5BTT A;  4L1I A;  2AWK A;  1PUL A;  2G3O A;  5I2O A;  1ZOT B;  1WRZ A;  3AKA A;  1MYW A;  4LQU A;  3S0F A;  5DPI A;  2MAZ A;  2ZND A;  2KOT A;  1KP5 A;  1U5I B;  1UHI A;  5PAL A;  4PE0 A;  4I5L B;  1J55 A;  2KGR A;  4LW5 A;  4CID A;  2RH7 A;  3DQ3 A;  2OGR A;  1NCX A;  2WOR A;  5I2Q A;  4ORC B;  4LJC A;  2LLS A;  1M39 A;  1EMK A;  3CZ0 A;  4W6R A;  1NP8 A;  4W76 A;  4HRE E;  3DQE A;  3LK1 A;  3K1K A;  2KAX A;  4GOB A;  2EGD A;  5F6T A;  2KNE A;  1GGX A;  3CGA A;  3AAJ A;  3L4A A;  4W7A A;  1K8U A;  2QAC A;  4FQT A;  3OSQ A;  3ZUJ A;  1Y6W A;  3DQM A;  2CNP A;  4GBA A;  2HQK A;  4HE4 A;  1FPW A;  2BEC A;  5EXB A;  1Q73 A;  2QPT A;  2M49 B;  2Q4U A;  2AWM A;  4GF6 B;  1QS7 A;  1DC1 A;  1FF1 A;  1ZMZ A;  1BT6 A;  1W7T A;  5HW9 A;  4I2Y A;  1S36 A;  3LL8 B;  3OB2 B;  3QME A;  4PCW A;  1H4B A;  5KTY A;  1EG4 A;  5DKN A; 
#chains in the Genus database with same CATH homology
 4EDO A;  4M2Q A;  4ZF5 A;  1IQ5 A;  5DPG A;  1TNW A;  3WLD A;  4RTC A;  3ZNI A;  2GV5 A;  1H8B A;  2QLG A;  3NF0 A;  1ZUX A;  2KAV A;  2O29 A;  3SS0 A;  1LKJ A;  5HZS A;  1Y1X A;  2PRU A;  3CLN A;  1OQP A;  3SSH A;  4YGC B;  1JSA A;  1XFX O;  4JPZ B;  4L13 A;  2MBX A;  1L2O B;  2M1K B;  4I5N B;  2OKY A;  1GGZ A;  2HJO A;  1DTL A;  3U8C A;  4DXO A;  1Z1Q A;  5HZU A;  3PJ7 A;  1B8R A;  1XFY O;  3QRX A;  1B8L A;  4XVP A;  5FHV A;  3EK8 A;  1CLM A;  3DQ2 A;  4ICB A;  2HCG A;  2LVV A;  1V1F A;  2QLE A;  2CXJ A;  1XYD A;  1YVH A;  1EMC A;  1LA3 A;  5H88 A;  2E6W A;  1CDN A;  2LNK A;  5LK4 A;  2HQ8 A;  1U5I A;  3CR5 X;  2F2P A;  4HVF A;  4Q7R A;  2AWJ A;  4W7C A;  3CD9 A;  4JFG A;  3TMR A;  2LVJ A;  3G9A A;  5EB6 A;  1EMM A;  2KGB C;  4DXI A;  3LF3 A;  1AK8 A;  1AP4 A;  1KQM B;  2L4I A;  2B1U A;  1UHJ A;  2LMT A;  2DUI A;  4YRU A;  2PVB A;  5HZT A;  5ER4 X;  4HRG A;  1Y1A A;  1XA9 A;  3EKH A;  3KCS A;  5BT0 A;  3DPZ A;  2F33 A;  4B5Y A;  2D8N A;  3DF0 B;  2A47 A;  4BDU A;  3EKJ A;  1CFP A;  4OR9 B;  4OVN F;  2KYF A;  5DQM A;  4PFE A;  2O60 A;  3DQO A;  5D69 A;  1EML A;  2H61 C;  1A4P A;  4KW9 A;  1Y0V H;  1RWY A;  1NX0 A;  1LIN A;  1UWO A;  2KI4 B;  3DQ8 A;  2LCP A;  1KQM C;  4P5O E;  2I7A A;  3SJS A;  1CB1 A;  4JQ0 D;  2A48 A;  5KSZ A;  1CTR A;  1SYM A;  2B3Q A;  1QYF A;  4W6F A;  4P2Y B;  4XJK B;  2DUF A;  1YUU A;  1QLS A;  1DGV A;  2MRD A;  1OMR A;  1PVA A;  4CFQ A;  4OJ0 A;  3SVD A;  5AAN A;  1LXF C;  3BOW B;  4GPL B;  3CFA A;  1QX5 B;  2R2I A;  4IK4 A;  2V4E C;  3DQK A;  1YHG A;  4W77 A;  4CPV A;  4IK5 A;  1JC1 A;  1QAT A;  3DVE A;  2KI4 C;  4RYW A;  3U0K A;  2P4M A;  1CFF A;  1UP5 A;  4Q7T A;  4XYN A;  1TNQ A;  1TCO B;  1XFU O;  1WLZ A;  3D0Y B;  2RGI A;  4R6D A;  1CMG A;  1DJZ A;  3ST3 A;  3RWA A;  2IOV A;  1QY3 A;  3LLE A;  3GOF A;  3BUX B;  1XQM A;  1NPQ A;  4DRW A;  3SSV A;  3UFZ A;  1NSH A;  1S3P A;  1S1E A;  5LTQ A;  4TNC A;  2ZRS A;  5EXC I;  1NCZ A;  1CFD A;  1WRL A;  3BUO B;  3CWG A;  1W7U A;  2CT9 A;  2H61 A;  1OZO A;  1AVS A;  2Q91 A;  4FQO A;  2FZU A;  3H4S E;  5CSF A;  3NXA A;  1PSR A;  1UHH A;  4FTG A;  2V53 A;  3SVC A;  4KGF A;  2DDC A;  2TN4 A;  1X02 A;  4ZCU A;  2A53 B;  1DGU A;  3DF0 A;  4W6A A;  4MRX A;  1XK4 C;  2V4E A;  1F0B A;  4B30 B;  2G6Y A;  3BYA A;  4N1F A;  4KW8 A;  3A8R A;  1F54 A;  1QIW A;  1YX8 A;  2OPO A;  1V1G A;  1OXD A;  3DVJ A;  5BQL A;  5T3I A;  4XGY A;  1MUX A;  1HQV A;  4GES B;  2Q57 A;  2PXW A;  4XJK A;  1W7J B;  3BX9 A;  4ZBL A;  3U8P A;  3BOW A;  3KPX A;  2JT8 A;  1EXR A;  1TNP A;  2G16 B;  1KYS A;  3IF7 A;  2GX0 A;  3EK4 A;  1MXE A;  1N2D A;  1BG1 A;  4Q9W A;  1CM4 A;  3ED8 A;  3D10 A;  3K21 A;  3NSK A;  1Q4C A;  1WY9 A;  4PPJ A;  3LS3 A;  2KI6 C;  2KQ6 A;  4U2V A;  2JNX A;  4L12 A;  2OTB A;  3D0Y A;  2A50 B;  5CSJ A;  1GGW A;  1H6R A;  3TS5 B;  1NYA A;  1EMF A;  4W6I A;  2Q6P A;  1XMZ A;  3SSK A;  5J2O A;  1SR6 C;  3O2P A;  1K9U A;  2BCB A;  1AHR A;  1RK9 A;  2LLU A;  1ZGP A;  3W1C A;  1N0Y A;  4J8A A;  1BR4 B;  2K0J A;  3DPW A;  1XK4 A;  4AS8 A;  4W6N A;  3CFF A;  2H2K A;  2WUR A;  1KQV A;  1WRK A;  2LVI A;  1YUT A;  2LE9 B;  4C0K A;  2LHI A;  1QVI Z;  4MVF A;  3WHT B;  3TS5 C;  1YVL A;  1S26 D;  2JOJ A;  1MXL C;  2GW3 A;  5DKR A;  4R1E A;  5EHU A;  1C7W A;  2G5Z B;  4W72 A;  4Q04 A;  4N3D A;  3SVS A;  1BLQ A;  2H5Q A;  2HPS A;  4OGS A;  1W7I B;  5BPJ A;  3NEZ A;  2ISD A;  1IH0 A;  1YHI A;  5B8I B;  2L98 A;  3RM1 A;  4H3M A;  2JT0 A;  4AR7 A;  3LK0 A;  1IJ5 A;  2NCO A;  4W6U A;  4GAO A;  3ZTF A;  4MRY A;  1RFJ A;  2L2E A;  5EBJ A;  4ORN A;  1XSS A;  2WC8 A;  3EK7 A;  3P28 A;  2OJK A;  2O5G A;  2POX A;  3EVV A;  5J3X A;  3UG0 A;  4OY4 A;  1FI5 A;  4D1E A;  3E5V A;  1J7Q A;  4AOM A;  3GJ1 A;  2HQW A;  3SVR A;  1JWD A;  1FW4 A;  4N1G A;  4H48 A;  3SG7 A;  4LJB A;  4OCI A;  1UHN A;  3WNX B;  4W6B A;  3BXB A;  1NCY A;  1CDM A;  2LAN A;  4ANJ A;  1QXT A;  5DKQ A;  1KFX L;  3BQ3 A;  1H4U A;  4KGE A;  2WIS A;  3CFH A;  3I5H B;  4HQC A;  1MWN A;  2K2F A;  1KFX S;  2KQY A;  3GL4 A;  2HFC A;  1GL4 A;  2NZ0 A;  2H8Q A;  1DVI A;  2HGY A;  3CS1 A;  4YGA A;  1ZGQ A;  1EMB A;  1QVI Y;  3DQF A;  4W74 A;  4USL A;  1SL8 A;  1KSO A;  5I2L A;  1MR8 A;  5HKY A;  5H89 A;  1YRT B;  1K90 D;  2COL B;  1B7T Z;  2QLI A;  1ZAC A;  3GK2 A;  5GQQ C;  3NT9 A;  2M9G A;  2VAE A;  3I5H C;  5AXI A;  2AHA A;  1QIV A;  4W7F A;  1TRF A;  2AWL A;  3SG2 A;  4P1Q A;  1CKK A;  1KK7 Y;  5DU0 A;  5IBW A;  3FIA A;  2LP2 A;  4JGE A;  2JNF A;  4DXN A;  1Q4D A;  5DTY A;  4MEW A;  1KFU L;  2JTT A;  2A56 B;  2AUC A;  3CTN A;  5F9G A;  1D1O A;  1IGV A;  2Y0G A;  3E5T A;  1QJT A;  4BY5 A;  3CR4 X;  5HZO A;  1QV1 A;  1UUR A;  1KFU S;  5DRG A;  2LAP A;  1B4C A;  4Z4M A;  3BUW B;  4CLN A;  2GGZ A;  4DUQ A;  1CLB A;  3SG6 A;  3WCK A;  2LHL A;  3DQ1 A;  1IWQ A;  2KBI A;  3KO0 A;  3TUY B;  2M0R A;  3C1V A;  5TNC A;  2FWQ A;  2BL0 C;  4KF4 A;  3PM8 A;  1G33 A;  1SMG A;  1S6I A;  2ZRT A;  4PHN A;  4HQ8 A;  2JRF A;  3V3D A;  3DPX A;  1S6C A;  1JBZ A;  2H5O A;  4ZFS A;  2IS9 A;  1IQ3 A;  2V4E B;  4DXM A;  4DCK A;  1NUB A;  1LA0 A;  3E5W A;  2KDH A;  1J7R A;  3RWT A;  5HLO A;  2JAD A;  2BE6 A;  5FVF A;  3TUY C;  4AQJ A;  2ZO6 A;  3I5I B;  4M2O A;  3NSL A;  4RYS A;  2ZNE A;  4PDZ A;  4J88 A;  4EUL A;  1BR1 B;  2C9I A;  1IKU A;  2EMO A;  1YUR A;  1MOV A;  4NQG A;  2F3Z A;  3NED A;  3PFV A;  1F8H A;  1YJ2 A;  1NX1 A;  3SSY A;  2JZI A;  1CM1 A;  1NWD A;  3KHE A;  5FYX A;  2GX2 A;  2JWW A;  2EHB A;  2Y4Q A;  1SRA A;  1K9K A;  3A4U B;  4YGE B;  4E68 A;  2ZMW A;  4W69 A;  1JUO A;  1DT7 B;  3WLC A;  3I5I C;  1YUS A;  4W6O A;  1WDC B;  3OSR A;  4HSZ A;  2K8M B;  4MBE A;  1Q80 A;  2PXS A;  3CB9 A;  2CCM A;  3PN7 B;  1PAL A;  4A4C A;  3VRN A;  1AJ4 A;  2FCE A;  3IP2 A;  3VRQ A;  3OHM B;  4C0J A;  1CDL A;  1JF0 A;  4UPG A;  1TN4 A;  5HYD A;  3VRO A;  2FL1 A;  4W6L A;  1MQ1 A;  2KFH A;  3CD1 A;  1SY9 A;  2VVJ A;  2GGM A;  1MOU A;  3GK1 A;  2KYC A;  3VRR A;  4QJ4 B;  1OE9 B;  2HQZ A;  1CFC A;  1KK8 B;  4Z4K A;  1AUI B;  2LUX A;  4W6G A;  3W1D A;  1Q4B A;  3WXA A;  2Z6Y A;  4R6B A;  1PVB A;  4NDC A;  1BOD A;  2YFP A;  3DVK A;  1WDC C;  1JFJ A;  2MLF C;  1WLM A;  2DD7 A;  3EVP A;  3O78 A;  3PN7 C;  2KHN A;  2QT2 A;  2MLE C;  2FCD A;  1KWO B;  3M22 A;  3H1R A;  2DUE A;  2LLT A;  1N65 A;  1XO5 A;  3I19 A;  3P8U A;  2YE0 A;  1TCF A;  1TNX A;  2KFF A;  1KK8 C;  2KFG A;  1BMO A;  2LC5 A;  1J7O A;  2JPT A;  3SG3 A;  3SRY A;  1CMF A;  3FS7 A;  2BBM A;  3HCM A;  4NDD A;  2WCB A;  1L7Z A;  2F2O A;  4MLW A;  2ZN8 A;  2JXC A;  4AQI A;  4W6H A;  1CDP A;  1FBV A;  1KWO C;  3SSP A;  1CLL A;  2HF5 A;  2JUL A;  3DQH A;  1SR6 B;  3BUM B;  2WHU A;  4W6K A;  3SVE A;  1A75 A;  3SVO A;  3DQI A;  2WOS A;  2PMY A;  2PSR A;  4IK9 A;  2QZ0 A;  4PAL A;  1EJ3 A;  1RRO A;  2LV7 A;  2H5R A;  2LVK A;  4ZB1 A;  4MZJ A;  1R6P A;  2QRF A;  2L50 A;  2BBN A;  4NDB A;  3IR8 A;  1SCM B;  5ER5 A;  1FI6 A;  1SNL A;  2M8U A;  2K7O A;  1A2X A;  1G7K A;  3DQ4 A;  2E30 A;  4I5K A;  3NSI A;  1UHK A;  2ZN9 A;  4WRI A;  2A46 A;  1PRW A;  3CBE A;  2M97 A;  1J1D A;  1ODB A;  1SKT A;  3DQ9 A;  4DXP A;  1YFP A;  5HKZ A;  1OXF A;  1RMM A;  1SW8 A;  3OGO A;  2DUG A;  5JOL A;  2WSN A;  3TDU A;  4W6J A;  1EMG A;  2IB5 A;  1SPY A;  4PE1 A;  3U0L A;  1EME A;  1JF2 A;  4XL5 A;  3ZUF A;  4WQ2 A;  3ZWH A;  3BXC A;  1ZFS A;  1HT9 A;  1SCM C;  2LUC A;  2OKW A;  4GNK B;  4TZG A;  2FOT A;  1YTZ C;  5DTX A;  2NCP A;  1K93 D;  2G2S B;  2K61 A;  2O2B A;  5FVG A;  2ZMU A;  4H3N A;  2DUH A;  2Y1M A;  1KYR A;  2L0P A;  3IQO A;  5H87 A;  4Q9X A;  5LTP A;  4M2P A;  1RM9 A;  1QXP A;  1VRK A;  4MSP A;  4LJD C;  3PAL A;  2CBL A;  2NXQ A;  1IG5 A;  4EN1 A;  4KAG A;  5HBD A;  5AFP A;  1F55 A;  3SVN A;  2EMN A;  2BTJ A;  1BOC A;  5AQB B;  1CV7 A;  1SBJ A;  4W6M A;  1XAE A;  4QJ3 B;  3SG5 A;  3HX4 A;  3AKB A;  3AAK A;  2QU1 A;  1Q4E A;  4PHK A;  4EMQ A;  4EDS A;  2MA2 A;  2KI6 D;  2IB6 A;  1YRU B;  1LVC D;  1G8I A;  1JFK A;  2AAO A;  3DQ7 A;  3LA1 A;  4PPK A;  2M3W A;  4TZA A;  5DTZ A;  2H5P A;  3SSL A;  2MHH A;  1W7S A;  3JTD C;  4ZF3 A;  1JC2 A;  4L9M A;  2BE4 A;  2I2R E;  2KAY A;  1RTP 1;  4MN0 A;  4OQW A;  1OOJ A;  3O6B A;  1J7P A;  2JTZ A;  1REC A;  3GEX A;  4W7E A;  2I18 A;  3M0W A;  4GGN A;  4WQ3 A;  4ZIN A;  1K96 A;  3OB1 B;  1MF8 B;  1ZUZ A;  3FWC A;  2EMD A;  2WCF A;  4ETO A;  2LMU A;  1GFL A;  1IJ6 A;  4OHS A;  2WIQ A;  4LJD A;  1E8A A;  1QX7 A;  2ZFD A;  3VK1 A;  3EVU A;  2B3P A;  2WHS A;  1RMP A;  1AJ5 A;  4DS7 A;  1OZS A;  2VAD A;  2C9J A;  4HRH A;  2JQ6 A;  2OTE A;  4GGF C;  4IK3 A;  5CSN A;  3PJB A;  3DQ6 A;  4ZCV A;  2VRG A;  1RJV A;  4C0L A;  1RRX A;  1EH2 A;  5FVI A;  4DIR A;  3O4Y A;  2L4H A;  1KCY A;  1YJF A;  1DF0 A;  1F4Q A;  2FJU B;  2AMI A;  5DY6 A;  5EJU A;  1IRJ A;  4PE4 A;  3CZT X;  1GJY A;  4YI8 A;  4W7X A;  4JF9 A;  3SIA A;  1GQM A;  1Q4A A;  1BFP A;  4JEO A;  2BL0 B;  3LCP C;  2JU0 A;  1DJY A;  3ST2 A;  5KU1 A;  3RLZ A;  3VHT A;  3DQL A;  4QJ5 B;  2KSP A;  1YX7 A;  3OX6 A;  1M63 B;  2KBM A;  4GUK A;  1B8C A;  2M29 A;  4KEX A;  4CFR A;  1SCV A;  1TTX A;  5EB7 A;  4MZL A;  1JBA A;  3I5F B;  3DQU A;  3CGL A;  5LTR A;  4UTS A;  3BXK A;  1OMD A;  4KW4 A;  4JC2 A;  3DQ5 A;  1DJI A;  1K2H A;  2L51 A;  3KF9 A;  1L2O C;  1B9A A;  2YE1 A;  2EC6 B;  4NWS A;  4JRB A;  2M7N A;  2O24 A;  4PPL A;  2LMV A;  1M45 A;  3SVB A;  1YR5 A;  4GFT A;  4Q7U A;  4GGF A;  4N5X A;  4A4B A;  3I5F C;  5CPV A;  3VIC A;  1Z1P A;  3SST A;  2ZKM X;  2OS8 B;  3GK4 X;  1Y1U A;  4ZF4 A;  4I5J A;  1OMV A;  3ST0 A;  2G6E A;  4H47 A;  4YGD B;  3ST4 A;  3NSO A;  2EC6 C;  1J1E A;  1G4Y R;  4W6C A;  4ZIO A;  4W6D A;  4YBH B;  3ICB A;  2HET A;  2A52 B;  1R2U A;  2OTG B;  1B9C A;  1EMA A;  2SAS A;  2K2A A;  2DOQ A;  2F3Y A;  3LVD A;  3MGF A;  4W7R A;  2BKH B;  5G08 A;  1BU3 A;  3VRP A;  2Z6Z A;  1A75 B;  1B7T Y;  3PJ5 A;  2Z1O A;  1A29 A;  4XOW A;  5I8N A;  2OS8 C;  1XA5 A;  2PAS A;  1QYO A;  1M46 A;  4DKN A;  3OX5 A;  2A4J A;  1QAS A;  4PHJ A;  1KSM A;  3AI4 A;  3KCT A;  4OV2 A;  3VGO A;  1NX2 A;  2OTG C;  5DPJ A;  3TDZ A;  1F09 A;  3BUN B;  1DJG A;  1BF5 A;  1S6Z A;  2YDZ A;  2BCX A;  3LVC A;  5DQB A;  2BKI B;  5AEQ A;  3DQA A;  1JBY A;  1DJW A;  4U8D A;  4JWQ A;  1UUS A;  1S5G Z;  3I5G B;  1MHO A;  2K7B A;  3PSR A;  3TMT A;  1F4O A;  1EL4 A;  2HGD A;  2QLH A;  1NIW A;  1QYQ A;  4PHM A;  1HCJ A;  2VZX A;  1BJF A;  4IZN A;  2H6V A;  4KPI A;  3OP0 A;  3MSE B;  1UIS A;  1ZGO A;  2G2B A;  5JJG A;  3SV5 A;  4DXQ A;  2ICR A;  3IQQ A;  1XFZ O;  3I5G C;  3S05 A;  3O77 A;  1C7V A;  2SCP A;  2DDD A;  4P76 A;  1M31 A;  3E3R A;  5CSI A;  2HPW A;  2K7D A;  2Y5I A;  1K95 A;  1PSB A;  3BXA A;  1XFW O;  1YZW A;  2JXL A;  1CNP A;  3PLF B;  1B1G A;  2K7C A;  5DTL A;  2M7L A;  1KYP A;  3LVA A;  1NX3 A;  3F45 A;  2AH8 A;  3A8S A;  1TIZ A;  4F0Z B;  1OXE A;  1B47 A;  5BTT B;  2ARL A;  1F70 A;  5K89 A;  1C07 A;  1F71 A;  1YHH A;  3AKO A;  4OKH A;  1XVJ A;  2LM5 A;  4W6P A;  2GW4 B;  4HQ9 A;  3NT3 A;  4IK1 A;  5HKW A;  3U8A A;  4KF5 C;  1QX2 A;  3TZ1 A;  1TOP A;  4IL1 A;  2CTN A;  3U0M A;  4PE7 A;  3GB3 A;  2PAL A;  3DD4 A;  4YI9 A;  1K9P A;  4IK8 A;  2WND A;  2F8P A;  4W73 A;  1C4F A;  1PK0 D;  3SVU A;  1QLK A;  2P6B B;  3KEV A;  4KA9 A;  5KTG A;  3JVT B;  2Z6X A;  3SG4 A;  2JT3 A;  1XFV O;  2HRS A;  1QV0 A;  1S5G Y;  2H9W A;  1S6J A;  2NLN A;  1RMO A;  1SL9 A;  2I94 A;  2IE2 A;  3TDI A;  4LQT A;  3EVR A;  2DD9 A;  1ALW A;  3LSA A;  5DPH A;  3WHU B;  2Y1N A;  4J89 A;  3H1O A;  3DQN A;  2ZO7 A;  2A54 B;  3DQJ A;  3DQD A;  5DRF A;  1JC0 A;  2WCE A;  2VVI A;  4W6T A;  1A03 A;  2QLG B;  1DF0 B;  2L5X B;  3FWB A;  4YGB B;  5AER A;  3M24 A;  3JVT C;  2WSO A;  3PAT A;  3DVM A;  1ALV A;  5HLV A;  4MZK A;  4DKM A;  1HUY A;  1DMO A;  2G3D B;  3U0N A;  4W75 A;  4ORA B;  3ZUL A;  3JTD B;  5EXU A;  2M1U A;  2JC2 A;  3PIB A;  3SIB A;  2VVH A;  4KF5 A;  1OSA A;  2LP3 A;  4W6S A;  1DJX A;  2BCA A;  3AI5 A;  3LF4 B;  1SK6 D;  1QTX A;  2G9B A;  1DJH A;  2G6X A;  3VHT B;  1K94 A;  4XOV A;  5D7F A;  2WHT A;  3ADF A;  4B30 A;  1KK7 Z;  3DQC A;  4BY4 A;  4H3L A;  5HGE A;  2MJW B;  4W7D A;  3GJ2 A;  3CR2 A;  4ORB B;  1SL7 A;  1EG3 A;  5BTT A;  4L1I A;  2AWK A;  1PUL A;  2G3O A;  5I2O A;  1ZOT B;  1WRZ A;  3AKA A;  1MYW A;  4LQU A;  5DPI A;  2MAZ A;  2ZND A;  2KOT A;  1KP5 A;  1U5I B;  1UHI A;  5PAL A;  4PE0 A;  4I5L B;  1J55 A;  2KGR A;  4LW5 A;  4CID A;  2RH7 A;  3DQ3 A;  2OGR A;  1NCX A;  2WOR A;  5I2Q A;  4ORC B;  4LJC A;  2LLS A;  1M39 A;  1EMK A;  4W6R A;  1NP8 A;  4W76 A;  4HRE E;  3DQE A;  3LK1 A;  3K1K A;  2KAX A;  4GOB A;  2EGD A;  5F6T A;  2KNE A;  1GGX A;  3CGA A;  3AAJ A;  4W7A A;  1K8U A;  2QAC A;  3OSQ A;  3ZUJ A;  1Y6W A;  3DQM A;  2CNP A;  4GBA A;  2HQK A;  4HE4 A;  1FPW A;  2BEC A;  5EXB A;  1Q73 A;  2QPT A;  2M49 B;  2Q4U A;  2AWM A;  4GF6 B;  1QS7 A;  1FF1 A;  1ZMZ A;  1BT6 A;  1W7T A;  5HW9 A;  4I2Y A;  1S36 A;  3LL8 B;  3OB2 B;  4PCW A;  1H4B A;  5KTY A;  1EG4 A;  5DKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...