3O78A

The structure of ca2+ sensor (case-12)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
415
structure length
402
Chain Sequence
GPGSSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSFQSVLSKDPNEKRDHMVLLEFVTAAGITLGGTGSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLLKCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIGFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, smooth muscle,Green fluorescent p
publication title The structure of Ca2+ sensor Case16 reveals the mechanism of reaction to low Ca2+ concentrations
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 116
structure length 402
sequence length 415
chains with identical sequence B
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o78A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3o78A01
1RMPA 5GQQC 3C1VA 4PE7A 5DY6A 3VICA 2DD7A 2AH8A 2M97A 2MRDA 1B9AA 4QJ3B 1R6PA 1QJTA 2R2IA 2M29A 3BXBA 4C0LA 1IWQA 3I5FC 3BXKA 4LQTA 2JULA 2ZNEA 2G2SB 4W6FA 2VADA 1DJIA 4H3LA 4P2YB 3EVPA 1YJ2A 5DKRA 1KFXS 3K1KA 2I2RE 2NCPA 4W76A 3I19A 1IJ6A 2JQ6A 1RROA 2H9WA 4NQGA 1KFXL 5I8NA 2LANA 2LE9B 1CDMA 1XFXO 2L0PA 2LV7A 3U0NA 3BOWB 4JFGA 1B7TY 3SVSA 4CPVA 3DPWA 1UHJA 4I2YA 4DUQA 5KSZA 5CSJA 2BE4A 1C7WA 1K9PA 3EK8A 4IK1A 5HYDA 4XL5A 4ZB1A 1UISA 4IL1A 3MSEB 2GGMA 2F8PA 4IK9A 1CMGA 1Y0VH 2IOVA 4YGEB 1CLBA 2L4IA 1C07A 1UP5A 2OJKA 2M0RA 4DXIA 1WRKA 4YI9A 1UHIA 2O5GA 3RLZA 2Q4UA 3H1RA 2AWJA 1J1EA 2LM5A 3DQ8A 3SVRA 3CR4X 4DRWA 1VRKA 2QACA 1F70A 2AHAA 1SYMA 4YGBB 4W73A 4MZLA 2LMVA 5H89A 3E5WA 3GJ2A 1JFJA 5H87A 2LLUA 5AANA 3OSRA 1DJYA 2B3QA 4Z4KA 4HQ8A 1H4UA 3SSTA 5F6TA 3MGFA 4PALA 4EMQA 2JU0A 3DQAA 1EL4A 1XO5A 3TDZA 4LJDA 1NX2A 2ZNDA 2LVIA 4JC2A 1OMDA 1KWOC 2MLEC 2ZMUA 1CDLA 3D0YA 4DXOA 4ZIOA 2VAEA 3DQCA 3CS1A 4OJ0A 1KSOA 1NX1A 1LKJA 3IQQA 2HCGA 5BTTB 1OZOA 2KDHA 2G5ZB 4J8AA 3O6BA 4YI8A 5B8IB 2FZUA 3A4UB 3GK2A 1XAEA 2AWLA 3NSKA 2A52B 1SMGA 4I5LB 5FVGA 3DQIA 1IRJA 2LVJA 3SG2A 5I2QA 3ZUJA 2MAZA 3PSRA 4B5YA 2E30A 2WORA 3DVEA 2H5RA 1F8HA 4W6OA 2LP2A 2A48A 2WCBA 1XSSA 2L50A 2K7CA 1SPYA 1SCMB 1F09A 1U5IB 3ST4A 1S6JA 1XFUO 2BBMA 3WHTB 1N0YA 2EMNA 1UUSA 4W6CA 2PXSA 2JT8A 4XJKB 1K2HA 4WQ2A 3TS5C 5HZUA 3LK1A 2B1UA 1E8AA 4ZBLA 2M7LA 3GEXA 3SG3A 3WLDA 2NCOA 4D1EA 1W7UA 2L5XB 1QIWA 2AUCA 1S3PA 2BECA 1B47A 2G2BA 4EDOA 4DXPA 4A4CA 2I94A 3BQ3A 1CMFA 1G33A 3P28A 4PE1A 3CZTX 1RM9A 1XVJA 1D1OA 4WRIA 1RMMA 1NIWA 3FWCA 2KAVA 3M24A 2WNDA 4DCKA 1XMZA 2YDZA 2BCAA 3LLEA 1S6IA 5IBWA 2FL1A 2MJWB 4MLWA 3LSAA 4Q9XA 1DVIA 1ALVA 2K7OA 4N1FA 4N3DA 1A4PA 2YE1A 2PASA 1KK8B 1NPQA 4DKMA 2OTGB 4KF4A 1NWDA 4RYWA 4R6BA 3LS3A 2WHTA 4BY5A 5DKQA 2O60A 2DDCA 2A4JA 2MLFC 1UHKA 3EK4A 2KBMA 1QLKA 1V1FA 1B9CA 4AS8A 1EXRA 4W6AA 3SVDA 4IK3A 1ZUZA 2FCDA 4NDDA 1PK0D 1BF5A 1Z1PA 3CGLA 3KEVA 4ORCB 4A4BA 3NEDA 4OGSA 1QV1A 2QLGA 2OTEA 2M8UA 1XFZO 3FS7A 1Y1AA 2ZMWA 1JSAA 4BY4A 2HQWA 1BOCA 1W7IB 4GFTA 1S1EA 1KK7Z 5EXCI 1AHRA 1M31A 2CT9A 1TN4A 4H48A 5F9GA 1QX5B 1TTXA 3HX4A 3PJBA 4RTCA 5DPJA 3SSPA 4XGYA 2OS8C 1GJYA 2WISA 2HFCA 2M7NA 2Q57A 4TZGA 1Q4DA 4FTGA 5BPJA 1JBAA 4IZNA 3SVUA 1SY9A 4MRXA 3EK7A 2C9JA 1YVLA 5AQBB 3ZULA 1B8CA 1TIZA 3QRXA 3RWAA 5HZSA 4NDCA 2Y1MA 3LK0A 3DF0A 1YTZC 2QT2A 4HREE 3D0YB 4UPGA 2LVVA 1YHIA 2H5QA 1GL4A 2EGDA 4PHNA 3SJSA 5HKYA 2Z6YA 1SR6C 2KYCA 1QY3A 3WCKA 1QYQA 2ISDA 1QVIZ 3JVTC 2KNEA 1EMCA 2QLHA 1ODBA 1EMEA 2L51A 4PFEA 2QLEA 2WHUA 4YRUA 1J7PA 1IQ5A 3H1OA 1AJ5A 1CB1A 1WDCC 1N2DA 2H61A 1YUTA 4Q7RA 1RTP1 2JNFA 2HJOA 1EMAA 4B30A 2M49B 3BUNB 3IF7A 2V4EC 1JC1A 1NYAA 1QXPA 2KBIA 2AMIA 1FF1A 1SKTA 4OVNF 3U0LA 1V1GA 2JPTA 2F33A 3ZUFA 4HQ9A 2OTBA 3PIBA 4CFRA 3VGOA 4L1IA 3U8PA 2NXQA 2CCMA 3FWBA 3PALA 3GJ1A 4C0KA 1HUYA 3DVKA 4LQUA 5D7FA 5D69A 4MBEA 1B8LA 1QYFA 2M1UA 1SNLA 4IK8A 3I5IC 4HRHA 2DUEA 1F4OA 3UG0A 2KFFA 4HE4A 1M63B 4NWSA 2QRFA 3KO0A 2JWWA 2ZO7A 3H4SE 3DQ2A 2Y1NA 1KQMC 4UTSA 4W6HA 1QATA 2V4EA 5BT0A 4E68A 4YGAA 1DGUA 4W6RA 4AOMA 1FI5A 2LUXA 2G3OA 3TUYB 1WRLA 3DQDA 1PSBA 3K21A 4N1GA 4BDUA 4GGFC 3NT3A 3ICBA 1OOJA 2QPTA 5DKNA 2JOJA 1ZGPA 2NLNA 3OSQA 4ANJA 3F45A 1EMKA 4AQJA 1H4BA 1Q4CA 4NDBA 5I2OA 4PPKA 2BE6A 4OV2A 5J2OA 1JUOA 1Y1XA 2CTNA 2MA2A 1GFLA 3KCSA 3CLNA 1FI6A 1KK7Y 4ZCVA 4GAOA 1M39A 2QLIA 1CFCA 2DUHA 3BXAA 2KOTA 4W6MA 2EC6B 1WLZA 1FW4A 2OPOA 3I5GB 3PJ7A 5EB7A 3SVBA 3OP0A 1WY9A 3GK1A 3SRYA 1ZGOA 2QLGB 1SW8A 1BLQA 4GGFA 2M9GA 2WCEA 1EMMA 2DD9A 3OGOA 2BCBA 3V3DA 2Z1OA 2OKWA 1YURA 3NSIA 5LTPA 2DUIA 2VVHA 4JWQA 2LVKA 2G6EA 5DPHA 5HLOA 3E3RA 4U2VA 1SL7A 4W6UA 1QVIY 2KQYA 1IGVA 2ZFDA 2V53A 4OHSA 1F54A 1OZSA 1DF0A 2JT3A 4KW9A 4W72A 4DXMA 3SV5A 3E5TA 1CFDA 5HKZA 4ZF5A 1RRXA 4EN1A 3HCMA 3SVCA 5KTGA 3JTDB 1G8IA 3O2PA 2G3DB 3PN7C 4W6NA 4I5NB 2HGDA 1BR4B 5DPGA 5KU1A 3LF4B 2G16B 3M0WA 3DF0B 2WHSA 3DQLA 2CNPA 5EXBA 1NP8A 3PM8A 1S5GZ 4LJCA 2ARLA 1KFUS 1SK6D 1Q73A 4ORAB 1F55A 1TNWA 2LAPA 2VRGA 1EMFA 2M3WA 2A50B 2TN4A 5ER4X 1KFUL 2OS8B 3AKBA 1Q4AA 2VVJA 3ST2A 2M1KB 3SIBA 2HF5A 5HBDA 3NSOA 2H5OA 3OX6A 1CDPA 5H88A 4KGFA 4B30B 1IG5A 3VRQA 2F3YA 1OQPA 4F0ZB 3ED8A 1KQVA 3DQKA 1YHGA 1IH0A 4N5XA 3EVUA 1ZACA 2KI4B 3E5VA 1ZFSA 5BQLA 3SIAA 2LCPA 4I5KA 2Z6XA 4L9MA 3CD1A 2JZIA 1QYOA 2KI6D 2YFPA 1OMRA 1SR6B 4JF9A 1JBYA 1A75A 3CB9A 2LLTA 1G4YR 3JVTB 3GL4A 5DQBA 3KHEA 5DRGA 4MEWA 2L2EA 5EHUA 2JT0A 5PALA 4ZINA 4J89A 2BL0B 3CR2A 4HSZA 5FVIA 1XK4C 1BJFA 1AVSA 1XFVO 1AP4A 4MRYA 1YUSA 2K0JA 2HQ8A 1DGVA 2Q91A 1K9KA 2Q6PA 4W7AA 1QIVA 1OSAA 1GGWA 2V4EB 3EVVA 4W69A 2KQ6A 2FOTA 3I5HB 1NX0A 4Q7TA 4YGCB 3DVJA 4PDZA 2MBXA 4W6GA 1MF8B 2P4MA 3P8UA 3CFAA 2ZN9A 1R2UA 1PULA 3TMTA 4PHMA 3AKOA 4R6DA 1RJVA 3SVEA 1WRZA 1J7OA 1LVCD 1KCYA 1K93D 4KA9A 3DQ6A 4PPJA 4ETOA 3A8SA 4W6IA 1X02A 1DT7B 3U0KA 2PALA 1EMBA 5FHVA 4W77A 3FIAA 3TDIA 3W1DA 1J1DA 1IKUA 3VROA 4R1EA 2JXLA 3I5FB 4TZAA 1TNXA 3VRNA 3TZ1A 1K94A 1TRFA 4DIRA 5DTZA 4PE4A 1PRWA 2BKIB 2WCFA 4GPLB 3O78A 1S5GY 5AEQA 1MR8A 3BOWA 5CSNA 4W6JA 1TCOB 4DXQA 4XYNA 3U8AA 1KP5A 4W7FA 1YHHA 1DF0B 2FWQA 4W7XA 4KW4A 3S05A 2HPSA 2KAXA 4QJ5B 1UWOA 2BBNA 1BG1A 4YBHB 4AR7A 3M22A 1DJXA 5CSFA 2A53B 3DD4A 2O24A 2RH7A 2IS9A 2AWMA 1C7VA 3WHUB 1DJGA 3SSKA 5HKWA 1YX7A 5AFPA 4W7CA 1UHHA 1K9UA 1CTRA 1SL8A 5DRFA 1NCXA 4W6DA 5EB6A 1B8RA 3WNXB 1SRAA 3GK4X 1MXEA 4Q7UA 1QX2A 4GUKA 2H6VA 3VRPA 1JC2A 1OMVA 2HETA 2ZO6A 2MHHA 2DDDA 3NSLA 4KPIA 2K7DA 3U0MA 3SSHA 1PVAA 1XA9A 5DQMA 2KI6C 3PFVA 4GF6B 1AJ4A 3NEZA 4W7DA 1A03A 1NX3A 4KW8A 1MHOA 1UURA 1QTXA 2GX2A 1RFJA 1PALA 2JC2A 2WSNA 3RWTA 1NUBA 1XFYO 1TNQA 1MUXA 1OXEA 2QZ0A 3DQNA 1CV7A 1A75B 4ZFSA 1MQ1A 1KWOB 3UFZA 2AAOA 1Y1UA 4KGEA 2KSPA 2L4HA 1YJFA 1DJWA 2JXCA 1L7ZA 1WLMA 1CDNA 2LLSA 2KHNA 1Y6WA 4CIDA 3DQMA 4ICBA 4W7RA 1FBVA 3ST0A 1DTLA 3BUMB 3NF0A 2FJUB 1G7KA 3KF9A 3SG7A 2KFHA 4MSPA 4M2OA 3PJ5A 1S36A 2CBLA 4JQ0D 3SS0A 1EMLA 2LHIA 1J55A 3BUXB 1S6CA 1U5IA 4QJ4B 4FQOA 4PHJA 5TNCA 2K7BA 3O77A 1KK8C 4OKHA 2HPWA 2DUFA 2EMOA 5KTYA 2PVBA 4M2PA 1MXLC 5HGEA 4MZKA 1A2XA 3CGAA 3SSYA 1HQVA 5AXIA 5LK4A 3LF3A 4JGEA 3RM1A 2Y0GA 3TMRA 2POXA 2LHLA 3ZNIA 3TS5B 1JC0A 4H3MA 1RWYA 1LA3A 3PLFB 1BR1B 1W7SA 4MVFA 4W75A 1EH2A 2H5PA 1F4QA 1JF2A 5EBJA 1GGXA 1TOPA 4HRGA 1YX8A 1QLSA 3OX5A 3LCPC 4ZCUA 5DTXA 1Q80A 2CXJA 1CKKA 1XFWO 2PMYA 4J88A 1J7RA 2LNKA 4ORBB 5K89A 3GOFA 4JEOA 5FYXA 1CFFA 4EULA 1C4FA 1EMGA 3SG4A 2GX0A 2SASA 1ZMZA 4OY4A 4M2QA 3CFFA 1L2OC 4TNCA 2KFGA 2L98A 1F0BA 4WQ3A 1ZGQA 1YUUA 4L13A 1AUIB 2HRSA 1N65A 2H8QA 2K2AA 2LUCA 4GESB 1B4CA 1QASA 5DPIA 4LJDC 1Q4EA 1EG4A 5HZOA 4CLNA 4GOBA 4AQIA 3DQUA 1YVHA 2PRUA 4PHKA 2KGRA 1YR5A 3IR8A 1LXFC 2E6WA 1CLMA 4PPLA 2Y4QA 3WXAA 1SBJA 1BT6A 2O2BA 2ICRA 3DQ7A 2IB6A 1DMOA 2WOSA 4OR9B 1BFPA 4C0JA 2GW4B 2GV5A 2JTTA 1BODA 3SSLA 4MN0A 2Z6ZA 2DUGA 3EVRA 3DQHA 1GQMA 2ZN8A 2ZKMX 4IK5A 1MWNA 4P76A 1CM4A 4W74A 1GGZA 2JNXA 1PVBA 1K8UA 4W6BA 3VK1A 1W7JB 1NSHA 5DU0A 3LA1A 4DS7A 4W6PA 4ZF3A 4CFQA 1QXTA 4Q9WA 5T3IA 2K8MB 3TDUA 4RYSA 3AAKA 2BKHB 4W6LA 1HT9A 3EKJA 5ER5A 3KCTA 1YRUB 1A29A 2WIQA 2YE0A 2BTJA 2KAYA 1CM1A 1DJHA 2ZRSA 2HQKA 3CBEA 2KGBC 1YZWA 5HW9A 2I7AA 3DQ9A 4HVFA 2AWKA 4DKNA 3VHTA 2A56B 3LL8B 3SVNA 3PATA 1JBZA 3AI5A 2WURA 3D10A 1H6RA 1WDCB 1S6ZA 3O4YA 3OB2B 4MZJA 3TUYC 3LVAA 2D8NA 4I5JA 4PCWA 1RECA 1CLLA 1ZOTB 2SCPA 3WLCA 1K90D 3LVDA 2I18A 1Q4BA 3NT9A 4XOWA 5AERA 2IB5A 4OQWA 3CD9A 1M46A 5HLVA 2HGYA 2WC8A 2FCEA 3W1CA 4GBAA 4W6SA 3I5IB 1JF0A 3AKAA 2EC6C 3ZTFA 4XOVA 4JPZB 3I5GC 4ORNA 1XK4A 1CNPA 1NCZA 1KYPA 4Q04A 1EJ3A 1ZUXA 3AAJA 1KQMB 1OE9B 2Y5IA 3NXAA 1FPWA 4XVPA 1ALWA 2KYFA 3EKHA 3CWGA 3ZWHA 2P6BB 4EDSA 2JTZA 3DPZA 2DOQA 3DQOA 1RK9A 2EMDA 1LA0A 5DTLA 5JOLA 4KAGA 4GGNA 1LINA 1EG3A 3SVOA 3ST3A 1QX7A 3OHMB 5HZTA 5JJGA 3BX9A 1H8BA 2K61A 1XA5A 3DQ3A 3BYAA 1BU3A 1TNPA 2JRFA 1OXDA 2O29A 1W7TA 4P5OE 3BUOB 2COLB 2OKYA 3U8CA 1S26D 4W6KA 2G6YA 1JFKA 3JTDC 1OXFA 4HQCA 4DXNA 5J3XA 1CFPA 1M45A 3IQOA 5LTQA 3DQ4A 4USLA 2HQZA 2ZRTA 2H2KA 2VVIA 3GB3A 1IQ3A 4GNKB 3DQJA 1MOVA 4H3NA 5EJUA 2F2OA 1QS7A 1IJ5A 2G6XA 3CR5X 1L2OB 4W7EA 1B7TZ 4U8DA 3KPXA 1QV0A 2GGZA 2PXWA 2LMTA 5LTRA 2C9IA 2H61C 1SL9A 3DVMA 4OCIA 2BCXA 5FVFA 2A54B 2LMUA 4KF5C 2WSOA 2KI4C 1PSRA 2LP3A 1UHNA 2PSRA 2RGIA 5G08A 3DPXA 3DQEA 5I2LA 1MOUA 2A47A 5EXUA 1HCJA 4KEXA 3DQ5A 3BUWB 3PN7B 1RMOA 2F3ZA 3CFHA 4LJBA 1Z1QA 5CPVA 3OB1B 1SCMC 1B1GA 1J7QA 4JRBA 3SG6A 1F71A 1XYDA 3A8RA 3ADFA 1K96A 1K95A 3G9AA 4PE0A 2EHBA 4H47A 4P1QA 2BL0C 2QU1A 4IK4A 3AI4A 4Z4MA 3DQFA 4LW5A 3IP2A 1YFPA 5BTTA 4W6TA 2B3PA 2LC5A 1JWDA 3VRRA 3CTNA 4ZF4A 3VHTB 1BMOA 2NZ0A 1KSMA 2F2PA 2GW3A 4KF5A 1TCFA 3SG5A 3I5HC 2G9BA 2IE2A 2OGRA 1AK8A 1KYSA 1KYRA 2A46A 3BXCA 1YRTB 3SSVA 1NCYA 2K2FA 4YGDB 2VZXA 1MYWA 1XQMA 1SCVA 1DJZA 3LVCA 4L12A 2JADA 5DTYA 2OTGC 4XJKA 3DQ1A 5CSIA
chains in the Genus database with same CATH superfamily
1RMPA 5GQQC 3C1VA 4PE7A 5DY6A 3VICA 2DD7A 2AH8A 2M97A 2MRDA 2JPOA 1B9AA 4QJ3B 1R6PA 4INWA 1QJTA 2R2IA 2M29A 3NHTA 3BXBA 4C0LA 1IWQA 3I5FC 3BXKA 1DQEA 4LQTA 2JULA 2ZNEA 2G2SB 5FI7A 4W6FA 2VADA 1DJIA 4H3LA 4P2YB 3B86A 3EVPA 1YJ2A 5DKRA 1KFXS 3K1KA 2I2RE 2NCPA 4W76A 3I19A 1XFRA 1IJ6A 2JQ6A 1RROA 2H9WA 4NQGA 1KFXL 5I8NA 2LANA 2LE9B 1CDMA 1XFXO 2L0PA 2LV7A 3U0NA 3BOWB 4JFGA 1B7TY 1QWVA 3SVSA 4CPVA 2QEBA 3DPWA 1UHJA 1GM0A 4I2YA 4DUQA 5KSZA 5CSJA 2BE4A 1C7WA 1K9PA 3EK8A 4IK1A 5HYDA 5HL1A 4XL5A 4ZB1A 1UISA 4IL1A 2H8VA 3NGVA 3MSEB 2GGMA 2F8PA 4IK9A 1CMGA 1Y0VH 2IOVA 4YGEB 1CLBA 2L4IA 1C07A 1UP5A 2OJKA 2M0RA 4DXIA 1WRKA 3PJIA 4YI9A 1UHIA 2O5GA 3RLZA 2Q4UA 3H1RA 2AWJA 3R1VA 1J1EA 2KLEA 2LM5A 3DQ8A 3SVRA 3CR4X 4DRWA 1VRKA 2QACA 1F70A 2AHAA 1SYMA 4YGBB 4W73A 4MZLA 2LMVA 5H89A 3E5WA 3GJ2A 1JFJA 5H87A 3S0DA 2LLUA 5AANA 3OSRA 1DJYA 2B3QA 1TUJA 4Z4KA 4HQ8A 1H4UA 3SSTA 5F6TA 3MGFA 4PALA 4EMQA 2JU0A 3DQAA 1EL4A 1XO5A 3TDZA 4LJDA 1NX2A 2ZNDA 2LVIA 4JC2A 1OMDA 1KWOC 2MLEC 2ZMUA 1CDLA 3D0YA 4DXOA 4ZIOA 2VAEA 3PM2A 3DQCA 3CS1A 4OJ0A 1KSOA 1NX1A 1LKJA 3IQQA 2HCGA 5BTTB 1OZOA 2KDHA 2G5ZB 4J8AA 3O6BA 4YI8A 5B8IB 2FZUA 3A4UB 3GK2A 1XAEA 2AWLA 3NSKA 2A52B 1SMGA 4I5LB 5FVGA 3DQIA 1IRJA 2LVJA 3SG2A 5I2QA 3ZUJA 2MAZA 3PSRA 4B5YA 2E30A 2WORA 3DVEA 2H5RA 1F8HA 4W6OA 2LP2A 2A48A 2WCBA 1XSSA 2L50A 2K7CA 1SPYA 1SCMB 1F09A 1U5IB 1C3YA 3ST4A 3B88A 1S6JA 1XFUO 2BBMA 3WHTB 1N0YA 2EMNA 1UUSA 4W6CA 2PXSA 2JT8A 4XJKB 1K2HA 4WQ2A 3TS5C 5HZUA 3LK1A 2B1UA 1E8AA 4ZBLA 2M7LA 3GEXA 3SG3A 3WLDA 2NCOA 4D1EA 1W7UA 2L5XB 1QIWA 2AUCA 1S3PA 2BECA 1B47A 2G2BA 4EDOA 4DXPA 4A4CA 2I94A 3BQ3A 1CMFA 1G33A 3P28A 4PE1A 3CZTX 3SS5A 1RM9A 1XVJA 1D1OA 4WRIA 1RMMA 1NIWA 3FWCA 2KAVA 3M24A 2WNDA 4DCKA 1XMZA 2YDZA 2BCAA 3LLEA 1S6IA 5IBWA 2FL1A 2MJWB 4MLWA 3LSAA 1DVIA 3O4XA 1ALVA 4Q9XA 2K7OA 4N1FA 3B7AA 4N3DA 1A4PA 2YE1A 2PASA 2WC5A 1KK8B 1NPQA 4DKMA 2OTGB 4KF4A 1NWDA 4RYWA 4R6BA 3CYZA 3L4LA 3LS3A 2WHTA 4BY5A 5DKQA 2O60A 2DDCA 3D77A 2A4JA 2MLFC 1UHKA 3EK4A 2KBMA 1QLKA 1V1FA 1B9CA 4AS8A 1EXRA 2GTEA 4W6AA 3SVDA 4IK3A 3V2LA 1ZUZA 2FCDA 4NDDA 1PK0D 1BF5A 1Z1PA 3CGLA 3KEVA 4ORCB 4A4BA 3NEDA 4OGSA 1QV1A 2QLGA 2OTEA 2M8UA 1XFZO 3FS7A 1Y1AA 2ZMWA 1Z4HA 1JSAA 4BY4A 2HQWA 1BOCA 1W7IB 3DZTA 4GFTA 1S1EA 1KK7Z 5EXCI 1AHRA 1M31A 2CT9A 3D74A 1TN4A 4H48A 5F9GA 2ERBA 1QX5B 1TTXA 3HX4A 3PJBA 4RTCA 5DPJA 3SSPA 4XGYA 2OS8C 1GJYA 2WISA 2HFCA 2M7NA 2Q57A 4TZGA 1Q4DA 4FTGA 5BPJA 1JBAA 4IZNA 3SVUA 1SY9A 4MRXA 3EK7A 2C9JA 1YVLA 5AQBB 3BFBA 3ZULA 1B8CA 1TIZA 3QRXA 3RWAA 5HZSA 4NDCA 2Y1MA 3LK0A 3DF0A 1YTZC 2QT2A 4HREE 3S0GA 3D0YB 4UPGA 2LVVA 1YHIA 2H5QA 1GL4A 2EGDA 4PHNA 3SJSA 1OOIX 5HKYA 2Z6YA 1SR6C 3B87A 2KYCA 1QY3A 3WCKA 1QYQA 2ISDA 1QVIZ 5EL2A 3JVTC 2KNEA 1EMCA 2QLHA 1ODBA 1EMEA 2L51A 4PFEA 2QLEA 2WHUA 4YRUA 1J7PA 1IQ5A 3H1OA 1AJ5A 1CB1A 1WDCC 1N2DA 2H61A 1YUTA 4Q7RA 1RTP1 2JNFA 2HJOA 1EMAA 4B30A 2M49B 3BUNB 3IF7A 2V4EC 1JC1A 1NYAA 1QXPA 2KBIA 2AMIA 1FF1A 1SKTA 2P70A 4OVNF 3U0LA 1V1GA 2JPTA 2F33A 3ZUFA 4HQ9A 3S0EA 2OTBA 3PIBA 4CFRA 3D78A 3VGOA 4L1IA 3U8PA 2NXQA 2CCMA 3FWBA 3PALA 3GJ1A 4C0KA 3BFHA 1HUYA 3DVKA 4LQUA 5D7FA 5D69A 4MBEA 1B8LA 3SS4A 1QYFA 1OOFA 2M1UA 1SNLA 4IK8A 3I5IC 4HRHA 2DUEA 1F4OA 3UG0A 4KYNA 2KFFA 4HE4A 1M63B 4NWSA 2QRFA 3KO0A 2JWWA 2ZO7A 2WCJA 3H4SE 3DQ2A 2Y1NA 1KQMC 4UTSA 4W6HA 1QATA 2QEHA 2V4EA 5BT0A 4E68A 4YGAA 1DGUA 4W6RA 4AOMA 1FI5A 2LUXA 2G3OA 3TUYB 1WRLA 3DQDA 1PSBA 3K21A 4N1GA 4BDUA 4GGFC 3NT3A 3ICBA 1OOGA 3OGNA 1OOJA 2QPTA 5DKNA 2JOJA 1ZGPA 3S0FA 2NLNA 3OSQA 4ANJA 3F45A 1EMKA 4AQJA 1H4BA 1Q4CA 4NDBA 5I2OA 4PPKA 3R1PA 2BE6A 4OV2A 5J2OA 1JUOA 1Y1XA 2CTNA 2MA2A 1GFLA 3KCSA 3CLNA 1FI6A 3FE9A 1KK7Y 4ZCVA 4GAOA 1M39A 2QLIA 1CFCA 2DUHA 3BXAA 2KOTA 4W6MA 2EC6B 1WLZA 2BAPA 1FW4A 2OPOA 2QEOA 3I5GB 3PJ7A 5EB7A 3SVBA 3OP0A 1WY9A 3GK1A 3SRYA 1ZGOA 2QLGB 1SW8A 1BLQA 2YGUA 4GGFA 2M9GA 2WCEA 1EMMA 2DD9A 3OGOA 2BCBA 3V3DA 2Z1OA 2OKWA 1YURA 3NSIA 5LTPA 2DUIA 2VVHA 4JWQA 2LVKA 2G6EA 5DPHA 5HLOA 3E3RA 1DC1A 4U2VA 1SL7A 4W6UA 1QVIY 2KQYA 1IGVA 2ZFDA 2V53A 4OHSA 1F54A 3CZ1A 1OZSA 1DF0A 2JT3A 4KW9A 4W72A 4DXMA 3SV5A 3L47A 3E5TA 1CFDA 5HKZA 4ZF5A 1RRXA 4EN1A 3HCMA 3SVCA 5KTGA 3JTDB 1G8IA 3O2PA 2G3DB 3PN7C 4W6NA 4I5NB 2HGDA 1BR4B 5DPGA 5KU1A 3LF4B 2G16B 3BFAA 3DF0B 3M0WA 2WHSA 3DQLA 2CNPA 5EXBA 1NP8A 3PM8A 1S5GZ 4LJCA 2ARLA 1KFUS 1SK6D 1Q73A 4ORAB 1F55A 1TNWA 2LAPA 2VRGA 1EMFA 2M3WA 2A50B 2TN4A 5ER4X 1KFUL 2OS8B 1DELA 3AKBA 1Q4AA 2VVJA 5FI6A 3ST2A 2M1KB 3SIBA 2HF5A 5HBDA 3NSOA 2H5OA 3OX6A 1CDPA 5H88A 4KGFA 4B30B 3VRQA 1IG5A 2F3YA 1OQPA 4F0ZB 3ED8A 1KQVA 3DQKA 1YHGA 3K1EA 1IH0A 4N5XA 1ORGA 3EVUA 1ZACA 2KI4B 3E5VA 1ZFSA 5BQLA 3SIAA 2LCPA 4I5KA 2Z6XA 4L9MA 3CD1A 2JZIA 1QYOA 2KI6D 2YFPA 1OMRA 1SR6B 4JF9A 1JBYA 1A75A 3CB9A 2LLTA 1G4YR 5FI2A 1C3ZA 3JVTB 3D73A 3GL4A 5DQBA 3KHEA 5DRGA 4MEWA 2L2EA 5EHUA 2JT0A 5PALA 4ZINA 4J89A 2BL0B 3CR2A 4HSZA 5FVIA 1XK4C 1BJFA 1AVSA 1XFVO 1AP4A 4MRYA 1YUSA 2K0JA 2HQ8A 1DGVA 2Q91A 3FE6A 1K9KA 2Q6PA 4W7AA 1QIVA 1OSAA 2WC6A 1GGWA 2V4EB 3EVVA 4W69A 2KQ6A 2FOTA 3I5HB 1NX0A 4Q7TA 4YGCB 3DVJA 4PDZA 2MBXA 4W6GA 1MF8B 2P4MA 3P8UA 3CFAA 2ZN9A 1TUZA 1R2UA 1PULA 5D3OA 3TMTA 3Q8IA 4PHMA 3AKOA 4R6DA 1RJVA 3SVEA 1WRZA 1J7OA 1LVCD 1KCYA 1K93D 4KA9A 3DQ6A 4PPJA 2K60A 4ETOA 3A8SA 4W6IA 1X02A 1DT7B 3U0KA 2PALA 1EMBA 5FHVA 4W77A 3FIAA 3TDIA 3W1DA 1J1DA 1IKUA 1P28A 3VROA 4R1EA 2JXLA 3I5FB 4TZAA 1SSEB 1TNXA 3VRNA 3TZ1A 1K94A 1TRFA 4DIRA 5DTZA 4PE4A 1PRWA 2BKIB 2WCFA 4GPLB 2KPHA 3O78A 1S5GY 5AEQA 1MR8A 3BOWA 4OZDA 5CSNA 4W6JA 1TCOB 4DXQA 4XYNA 3U8AA 1KP5A 4W7FA 1YHHA 1OW4A 1DF0B 2FWQA 4W7XA 4KW4A 3N7HA 3S05A 2HPSA 2KAXA 4QJ5B 1UWOA 1BG1A 2BBNA 3BJHA 4YBHB 4AR7A 3M22A 1OOHA 1DJXA 5CSFA 2A53B 3DD4A 2O24A 2RH7A 2IS9A 2AWMA 1C7VA 3WHUB 1DJGA 3SSKA 5HKWA 1YX7A 5AFPA 4W7CA 1UHHA 1K9UA 1CTRA 1SL8A 5DRFA 1NCXA 4W6DA 5EB6A 1B8RA 3WNXB 1SRAA 3GK4X 1LS8A 1MXEA 4Q7UA 1QX2A 4GUKA 2H6VA 3VRPA 1JC2A 1OMVA 2HETA 2ZO6A 2MHHA 2DDDA 3NSLA 4KPIA 2K7DA 3U0MA 3QMEA 3SSHA 1PVAA 2WCLA 1XA9A 5DQMA 2KI6C 3PFVA 3CABA 4GF6B 1AJ4A 3NEZA 4W7DA 1A03A 1NX3A 4KW8A 1MHOA 1UURA 1QTXA 2GX2A 1RFJA 1PALA 2JC2A 2BNXA 2WSNA 3RWTA 1NUBA 1XFYO 1TNQA 1MUXA 1OXEA 2QZ0A 3DQNA 1CV7A 1A75B 4ZFSA 1MQ1A 1KWOB 3UFZA 3VB1A 2AAOA 1Y1UA 4KGEA 2KSPA 2L4HA 1YJFA 1DJWA 2JXCA 1L7ZA 1WLMA 1CDNA 2LLSA 2KHNA 1Y6WA 4CIDA 3DQMA 4ICBA 4W7RA 1FBVA 3ST0A 1DTLA 3BUMB 3NF0A 2FJUB 1G7KA 3KF9A 3SG7A 2KFHA 4MSPA 4M2OA 4PT1A 3PJ5A 1S36A 3CZ2A 5I94A 2CBLA 4JQ0D 3SS0A 1EMLA 2LHIA 1J55A 3BUXB 1S6CA 1U5IA 4QJ4B 4FQOA 4PHJA 5TNCA 2K7BA 3O77A 1KK8C 4OKHA 2HPWA 2DUFA 2EMOA 5KTYA 4JD9A 2PVBA 4M2PA 1MXLC 5HGEA 4MZKA 1A2XA 3CGAA 3SSYA 1HQVA 5AXIA 5LK4A 3LF3A 4JGEA 3RM1A 2Y0GA 3TMRA 1W9ZA 2POXA 2LHLA 4INXA 3ZNIA 3TS5B 1JC0A 4H3MA 1RWYA 1LA3A 3PLFB 1BR1B 2PQLA 1W7SA 4MVFA 4W75A 1EH2A 2H5PA 1F4QA 1JF2A 5EBJA 1GGXA 1TOPA 4HRGA 1YX8A 1QLSA 3OX5A 3LCPC 3D76A 4ZCUA 5DTXA 1Q80A 2CXJA 1CKKA 1XFWO 2PMYA 4J88A 1J7RA 2LNKA 2L2CA 4ORBB 5K89A 3GOFA 4JEOA 5FYXA 1CFFA 4EULA 1C4FA 2WCMA 1EMGA 3SG4A 2GX0A 2SASA 1ZMZA 4OY4A 4M2QA 3CFFA 1L2OC 4TNCA 2KFGA 2L98A 1F0BA 4WQ3A 1ZGQA 1YUUA 4L13A 1AUIB 2HRSA 1N65A 5DICA 1Z2CB 2H8QA 2K2AA 2LUCA 4GESB 1B4CA 1QASA 5DPIA 4LJDC 1Q4EA 1EG4A 2QDIA 5HZOA 4CLNA 4GOBA 4AQIA 3DQUA 3R1OA 1YVHA 2PRUA 4PHKA 2KGRA 1YR5A 3IR8A 2FJYA 1LXFC 3DYEA 2E6WA 1CLMA 4PPLA 2Y4QA 3WXAA 1SBJA 1BT6A 2O2BA 2ICRA 3DQ7A 2IB6A 1DMOA 3B6XA 3DXLA 2WOSA 4OR9B 1BFPA 4C0JA 2GW4B 2GV5A 2JTTA 3NHIA 1BODA 3SSLA 4MN0A 2Z6ZA 2DUGA 3EVRA 3DQHA 1GQMA 3L4AA 2ZN8A 2ZKMX 4IK5A 3OBVA 1MWNA 4P76A 1CM4A 4W74A 1GGZA 2JNXA 1PVBA 1K8UA 4W6BA 3VK1A 1W7JB 1NSHA 5DU0A 3LA1A 4DS7A 2KLDA 4W6PA 4ZF3A 4CFQA 1QXTA 4Q9WA 5T3IA 2K8MB 3TDUA 4RYSA 3AAKA 2BKHB 4W6LA 1HT9A 3EKJA 5ER5A 3KCTA 1YRUB 1A29A 2WIQA 2YE0A 2BTJA 2KAYA 1CM1A 1DJHA 2ZRSA 2HQKA 3CBEA 2KGBC 1YZWA 5HW9A 2I7AA 3DQ9A 3CZ0A 4HVFA 2AWKA 3R72A 4DKNA 3VHTA 2PYQA 2A56B 3LL8B 3SVNA 3PATA 3UNWA 1JBZA 3AI5A 2WURA 3D10A 3UO9A 1H6RA 1WDCB 1S6ZA 3O4YA 3OB2B 4MZJA 3TUYC 3LVAA 2D8NA 4I5JA 4PCWA 1RECA 1CLLA 1ZOTB 2SCPA 3WLCA 1K90D 3LVDA 2I18A 1Q4BA 3NT9A 2QEVA 4XOWA 5AERA 1IIOA 2IB5A 4OQWA 3CD9A 1M46A 5HLVA 2HGYA 4F7FA 2WC8A 2FCEA 3W1CA 4GBAA 4W6SA 4JKTA 3I5IB 1JF0A 3AKAA 2EC6C 3ZTFA 4XOVA 4JPZB 3I5GC 4ORNA 1XK4A 1CNPA 1NCZA 1KYPA 4Q04A 1TWOA 1EJ3A 1ZUXA 3AAJA 1KQMB 1OE9B 2Y5IA 3NXAA 1FPWA 4XVPA 1ALWA 2KYFA 3EKHA 3CWGA 3FE8A 3ZWHA 2P6BB 4EDSA 2JTZA 3DPZA 1DEKA 2DOQA 3DQOA 1RK9A 2EMDA 1LA0A 5DTLA 5JOLA 4KAGA 4GGNA 1LINA 1EG3A 3SVOA 3ST3A 1QX7A 3OHMB 5HZTA 5JJGA 3BX9A 1H8BA 2K61A 1XA5A 2WCKA 3DQ3A 3BYAA 1BU3A 1TNPA 2JRFA 1OXDA 2O29A 1W7TA 4P5OE 3BUOB 2COLB 2OKYA 3U8CA 1S26D 4W6KA 2G6YA 1JFKA 3JTDC 1OXFA 4HQCA 4DXNA 5J3XA 1CFPA 1M45A 3IQOA 3IVTA 5LTQA 3DQ4A 4USLA 2HQZA 2ZRTA 2H2KA 2VVIA 3GB3A 3DY9A 1IQ3A 4GNKB 3DQJA 1MOVA 3RZSA 4H3NA 5EJUA 2F2OA 1QS7A 1IJ5A 2G6XA 3SS3A 3CR5X 1L2OB 4W7EA 1T14A 1B7TZ 4U8DA 3KPXA 1QV0A 2L5YA 2GGZA 2PXWA 2LMTA 5LTRA 2C9IA 2H61C 1SL9A 3DVMA 4OCIA 2BCXA 5FVFA 2A54B 2LMUA 4KF5C 2WSOA 2KI4C 1PSRA 2LP3A 1UHNA 2PSRA 2RGIA 5G08A 3DPXA 3DQEA 5I2LA 1MOUA 2A47A 5EXUA 1HCJA 4KEXA 3DQ5A 3BUWB 3PN7B 1RMOA 2F3ZA 2WCHA 3CFHA 4LJBA 1Z1QA 5CPVA 3OB1B 1SCMC 1B1GA 1J7QA 4JRBA 3SG6A 1F71A 1XYDA 3A8RA 3ADFA 1K96A 4FQTA 1K95A 3G9AA 4PE0A 2EHBA 4H47A 4P1QA 2BL0C 2QU1A 4IK4A 3S0BA 3AI4A 4Z4MA 3DQFA 4LW5A 3IP2A 3D75A 1YFPA 5BTTA 4W6TA 2B3PA 2LC5A 4IJ7A 1JWDA 3VRRA 3CTNA 4ZF4A 3VHTB 1BMOA 2NZ0A 1KSMA 2P71A 2F2PA 3EG5B 2GW3A 4KF5A 1TCFA 3SG5A 3I5HC 2G9BA 2IE2A 2OGRA 1AK8A 1KYSA 1KYRA 2A46A 3BXCA 1YRTB 3SSVA 1NCYA 2K2FA 4YGDB 2VZXA 1MYWA 1XQMA 1SCVA 1DJZA 3LVCA 4L12A 2JADA 5DTYA 2OTGC 4XJKA 3DQ1A 3S0AA 3CDNA 5CSIA
chains in the Genus database with same CATH topology
1RMPA 5GQQC 3C1VA 4PE7A 5DY6A 3VICA 2DD7A 2AH8A 2M97A 2MRDA 1B9AA 4QJ3B 1R6PA 1QJTA 2R2IA 2M29A 3BXBA 4C0LA 1IWQA 3I5FC 3BXKA 4LQTA 2JULA 2ZNEA 2G2SB 4W6FA 2VADA 1DJIA 4H3LA 4P2YB 3EVPA 1YJ2A 5DKRA 1KFXS 3K1KA 2I2RE 2NCPA 4W76A 3I19A 1IJ6A 2JQ6A 1RROA 2H9WA 4NQGA 1KFXL 5I8NA 2LANA 2LE9B 1CDMA 1XFXO 2L0PA 2LV7A 3U0NA 3BOWB 4JFGA 1B7TY 3SVSA 4CPVA 3DPWA 1UHJA 4I2YA 4DUQA 5KSZA 5CSJA 2BE4A 1C7WA 1K9PA 3EK8A 4IK1A 5HYDA 4XL5A 4ZB1A 1UISA 4IL1A 3MSEB 2GGMA 2F8PA 4IK9A 1CMGA 1Y0VH 2IOVA 4YGEB 1CLBA 2L4IA 1C07A 1UP5A 2OJKA 2M0RA 4DXIA 1WRKA 4YI9A 1UHIA 2O5GA 3RLZA 2Q4UA 3H1RA 2AWJA 1J1EA 2LM5A 3DQ8A 3SVRA 3CR4X 4DRWA 1VRKA 2QACA 1F70A 2AHAA 1SYMA 4YGBB 4W73A 4MZLA 2LMVA 5H89A 3E5WA 3GJ2A 1JFJA 5H87A 2LLUA 5AANA 3OSRA 1DJYA 2B3QA 4Z4KA 4HQ8A 1H4UA 3SSTA 5F6TA 3MGFA 4PALA 4EMQA 2JU0A 3DQAA 1EL4A 1XO5A 3TDZA 4LJDA 1NX2A 2ZNDA 2LVIA 4JC2A 1OMDA 1KWOC 2MLEC 2ZMUA 1CDLA 3D0YA 4DXOA 4ZIOA 2VAEA 3DQCA 3CS1A 4OJ0A 1KSOA 1NX1A 1LKJA 3IQQA 2HCGA 5BTTB 1OZOA 2KDHA 2G5ZB 4J8AA 3O6BA 4YI8A 5B8IB 2FZUA 3A4UB 3GK2A 1XAEA 2AWLA 3NSKA 2A52B 1SMGA 4I5LB 5FVGA 3DQIA 1IRJA 2LVJA 3SG2A 5I2QA 3ZUJA 2MAZA 3PSRA 4B5YA 2E30A 2WORA 3DVEA 2H5RA 1F8HA 4W6OA 2LP2A 2A48A 2WCBA 1XSSA 2L50A 2K7CA 1SPYA 1SCMB 1F09A 1U5IB 3ST4A 1S6JA 1XFUO 2BBMA 3WHTB 1N0YA 2EMNA 1UUSA 4W6CA 2PXSA 2JT8A 4XJKB 1K2HA 4WQ2A 3TS5C 5HZUA 3LK1A 2B1UA 1E8AA 4ZBLA 2M7LA 3GEXA 3SG3A 3WLDA 2NCOA 4D1EA 1W7UA 2L5XB 1QIWA 2AUCA 1S3PA 2BECA 1B47A 2G2BA 4EDOA 4DXPA 4A4CA 2I94A 3BQ3A 1CMFA 1G33A 3P28A 4PE1A 3CZTX 1RM9A 1XVJA 1D1OA 4WRIA 1RMMA 1NIWA 3FWCA 2KAVA 3M24A 2WNDA 4DCKA 1XMZA 2YDZA 2BCAA 3LLEA 1S6IA 5IBWA 2FL1A 2MJWB 4MLWA 3LSAA 4Q9XA 1DVIA 1ALVA 2K7OA 4N1FA 4N3DA 1A4PA 2YE1A 2PASA 1KK8B 1NPQA 4DKMA 2OTGB 4KF4A 1NWDA 4RYWA 4R6BA 3LS3A 2WHTA 4BY5A 5DKQA 2O60A 2DDCA 2A4JA 2MLFC 1UHKA 3EK4A 2KBMA 1QLKA 1V1FA 1B9CA 4AS8A 1EXRA 4W6AA 3SVDA 4IK3A 1ZUZA 2FCDA 4NDDA 1PK0D 1BF5A 1Z1PA 3CGLA 3KEVA 4ORCB 4A4BA 3NEDA 4OGSA 1QV1A 2QLGA 2OTEA 2M8UA 1XFZO 3FS7A 1Y1AA 2ZMWA 1JSAA 4BY4A 2HQWA 1BOCA 1W7IB 4GFTA 1S1EA 1KK7Z 5EXCI 1AHRA 1M31A 2CT9A 1TN4A 4H48A 5F9GA 1QX5B 1TTXA 3HX4A 3PJBA 4RTCA 5DPJA 3SSPA 4XGYA 2OS8C 1GJYA 2WISA 2HFCA 2M7NA 2Q57A 4TZGA 1Q4DA 4FTGA 5BPJA 1JBAA 4IZNA 3SVUA 1SY9A 4MRXA 3EK7A 2C9JA 1YVLA 5AQBB 3ZULA 1B8CA 1TIZA 3QRXA 3RWAA 5HZSA 4NDCA 2Y1MA 3LK0A 3DF0A 1YTZC 2QT2A 4HREE 3D0YB 4UPGA 2LVVA 1YHIA 2H5QA 1GL4A 2EGDA 4PHNA 3SJSA 5HKYA 2Z6YA 1SR6C 2KYCA 1QY3A 3WCKA 1QYQA 2ISDA 1QVIZ 3JVTC 2KNEA 1EMCA 2QLHA 1ODBA 1EMEA 2L51A 4PFEA 2QLEA 2WHUA 4YRUA 1J7PA 1IQ5A 3H1OA 1AJ5A 1CB1A 1WDCC 1N2DA 2H61A 1YUTA 4Q7RA 1RTP1 2JNFA 2HJOA 1EMAA 4B30A 2M49B 3BUNB 3IF7A 2V4EC 1JC1A 1NYAA 1QXPA 2KBIA 2AMIA 1FF1A 1SKTA 4OVNF 3U0LA 1V1GA 2JPTA 2F33A 3ZUFA 4HQ9A 2OTBA 3PIBA 4CFRA 3VGOA 4L1IA 3U8PA 2NXQA 2CCMA 3FWBA 3PALA 3GJ1A 4C0KA 1HUYA 3DVKA 4LQUA 5D7FA 5D69A 4MBEA 1B8LA 1QYFA 2M1UA 1SNLA 4IK8A 3I5IC 4HRHA 2DUEA 1F4OA 3UG0A 2KFFA 4HE4A 1M63B 4NWSA 2QRFA 3KO0A 2JWWA 2ZO7A 3H4SE 3DQ2A 2Y1NA 1KQMC 4UTSA 4W6HA 1QATA 2V4EA 5BT0A 4E68A 4YGAA 1DGUA 4W6RA 4AOMA 1FI5A 2LUXA 2G3OA 3TUYB 1WRLA 3DQDA 1PSBA 3K21A 4N1GA 4BDUA 4GGFC 3NT3A 3ICBA 1OOJA 2QPTA 5DKNA 2JOJA 1ZGPA 2NLNA 3OSQA 4ANJA 3F45A 1EMKA 4AQJA 1H4BA 1Q4CA 4NDBA 5I2OA 4PPKA 2BE6A 4OV2A 5J2OA 1JUOA 1Y1XA 2CTNA 2MA2A 1GFLA 3KCSA 3CLNA 1FI6A 1KK7Y 4ZCVA 4GAOA 1M39A 2QLIA 1CFCA 2DUHA 3BXAA 2KOTA 4W6MA 2EC6B 1WLZA 1FW4A 2OPOA 3I5GB 3PJ7A 5EB7A 3SVBA 3OP0A 1WY9A 3GK1A 3SRYA 1ZGOA 2QLGB 1SW8A 1BLQA 4GGFA 2M9GA 2WCEA 1EMMA 2DD9A 3OGOA 2BCBA 3V3DA 2Z1OA 2OKWA 1YURA 3NSIA 5LTPA 2DUIA 2VVHA 4JWQA 2LVKA 2G6EA 5DPHA 5HLOA 3E3RA 4U2VA 1SL7A 4W6UA 1QVIY 2KQYA 1IGVA 2ZFDA 2V53A 4OHSA 1F54A 1OZSA 1DF0A 2JT3A 4KW9A 4W72A 4DXMA 3SV5A 3E5TA 1CFDA 5HKZA 4ZF5A 1RRXA 4EN1A 3HCMA 3SVCA 5KTGA 3JTDB 1G8IA 3O2PA 2G3DB 3PN7C 4W6NA 4I5NB 2HGDA 1BR4B 5DPGA 5KU1A 3LF4B 2G16B 3M0WA 3DF0B 2WHSA 3DQLA 2CNPA 5EXBA 1NP8A 3PM8A 1S5GZ 4LJCA 2ARLA 1KFUS 1SK6D 1Q73A 4ORAB 1F55A 1TNWA 2LAPA 2VRGA 1EMFA 2M3WA 2A50B 2TN4A 5ER4X 1KFUL 2OS8B 3AKBA 1Q4AA 2VVJA 3ST2A 2M1KB 3SIBA 2HF5A 5HBDA 3NSOA 2H5OA 3OX6A 1CDPA 5H88A 4KGFA 4B30B 1IG5A 3VRQA 2F3YA 1OQPA 4F0ZB 3ED8A 1KQVA 3DQKA 1YHGA 1IH0A 4N5XA 3EVUA 1ZACA 2KI4B 3E5VA 1ZFSA 5BQLA 3SIAA 2LCPA 4I5KA 2Z6XA 4L9MA 3CD1A 2JZIA 1QYOA 2KI6D 2YFPA 1OMRA 1SR6B 4JF9A 1JBYA 1A75A 3CB9A 2LLTA 1G4YR 3JVTB 3GL4A 5DQBA 3KHEA 5DRGA 4MEWA 2L2EA 5EHUA 2JT0A 5PALA 4ZINA 4J89A 2BL0B 3CR2A 4HSZA 5FVIA 1XK4C 1BJFA 1AVSA 1XFVO 1AP4A 4MRYA 1YUSA 2K0JA 2HQ8A 1DGVA 2Q91A 1K9KA 2Q6PA 4W7AA 1QIVA 1OSAA 1GGWA 2V4EB 3EVVA 4W69A 2KQ6A 2FOTA 3I5HB 1NX0A 4Q7TA 4YGCB 3DVJA 4PDZA 2MBXA 4W6GA 1MF8B 2P4MA 3P8UA 3CFAA 2ZN9A 1R2UA 1PULA 3TMTA 4PHMA 3AKOA 4R6DA 1RJVA 3SVEA 1WRZA 1J7OA 1LVCD 1KCYA 1K93D 4KA9A 3DQ6A 4PPJA 4ETOA 3A8SA 4W6IA 1X02A 1DT7B 3U0KA 2PALA 1EMBA 5FHVA 4W77A 3FIAA 3TDIA 3W1DA 1J1DA 1IKUA 3VROA 4R1EA 2JXLA 3I5FB 4TZAA 1TNXA 3VRNA 3TZ1A 1K94A 1TRFA 4DIRA 5DTZA 4PE4A 1PRWA 2BKIB 2WCFA 4GPLB 3O78A 1S5GY 5AEQA 1MR8A 3BOWA 5CSNA 4W6JA 1TCOB 4DXQA 4XYNA 3U8AA 1KP5A 4W7FA 1YHHA 1DF0B 2FWQA 4W7XA 4KW4A 3S05A 2HPSA 2KAXA 4QJ5B 1UWOA 2BBNA 1BG1A 4YBHB 4AR7A 3M22A 1DJXA 5CSFA 2A53B 3DD4A 2O24A 2RH7A 2IS9A 2AWMA 1C7VA 3WHUB 1DJGA 3SSKA 5HKWA 1YX7A 5AFPA 4W7CA 1UHHA 1K9UA 1CTRA 1SL8A 5DRFA 1NCXA 4W6DA 5EB6A 1B8RA 3WNXB 1SRAA 3GK4X 1MXEA 4Q7UA 1QX2A 4GUKA 2H6VA 3VRPA 1JC2A 1OMVA 2HETA 2ZO6A 2MHHA 2DDDA 3NSLA 4KPIA 2K7DA 3U0MA 3SSHA 1PVAA 1XA9A 5DQMA 2KI6C 3PFVA 4GF6B 1AJ4A 3NEZA 4W7DA 1A03A 1NX3A 4KW8A 1MHOA 1UURA 1QTXA 2GX2A 1RFJA 1PALA 2JC2A 2WSNA 3RWTA 1NUBA 1XFYO 1TNQA 1MUXA 1OXEA 2QZ0A 3DQNA 1CV7A 1A75B 4ZFSA 1MQ1A 1KWOB 3UFZA 2AAOA 1Y1UA 4KGEA 2KSPA 2L4HA 1YJFA 1DJWA 2JXCA 1L7ZA 1WLMA 1CDNA 2LLSA 2KHNA 1Y6WA 4CIDA 3DQMA 4ICBA 4W7RA 1FBVA 3ST0A 1DTLA 3BUMB 3NF0A 2FJUB 1G7KA 3KF9A 3SG7A 2KFHA 4MSPA 4M2OA 3PJ5A 1S36A 2CBLA 4JQ0D 3SS0A 1EMLA 2LHIA 1J55A 3BUXB 1S6CA 1U5IA 4QJ4B 4FQOA 4PHJA 5TNCA 2K7BA 3O77A 1KK8C 4OKHA 2HPWA 2DUFA 2EMOA 5KTYA 2PVBA 4M2PA 1MXLC 5HGEA 4MZKA 1A2XA 3CGAA 3SSYA 1HQVA 5AXIA 5LK4A 3LF3A 4JGEA 3RM1A 2Y0GA 3TMRA 2POXA 2LHLA 3ZNIA 3TS5B 1JC0A 4H3MA 1RWYA 1LA3A 3PLFB 1BR1B 1W7SA 4MVFA 4W75A 1EH2A 2H5PA 1F4QA 1JF2A 5EBJA 1GGXA 1TOPA 4HRGA 1YX8A 1QLSA 3OX5A 3LCPC 4ZCUA 5DTXA 1Q80A 2CXJA 1CKKA 1XFWO 2PMYA 4J88A 1J7RA 2LNKA 4ORBB 5K89A 3GOFA 4JEOA 5FYXA 1CFFA 4EULA 1C4FA 1EMGA 3SG4A 2GX0A 2SASA 1ZMZA 4OY4A 4M2QA 3CFFA 1L2OC 4TNCA 2KFGA 2L98A 1F0BA 4WQ3A 1ZGQA 1YUUA 4L13A 1AUIB 2HRSA 1N65A 2H8QA 2K2AA 2LUCA 4GESB 1B4CA 1QASA 5DPIA 4LJDC 1Q4EA 1EG4A 5HZOA 4CLNA 4GOBA 4AQIA 3DQUA 1YVHA 2PRUA 4PHKA 2KGRA 1YR5A 3IR8A 1LXFC 2E6WA 1CLMA 4PPLA 2Y4QA 3WXAA 1SBJA 1BT6A 2O2BA 2ICRA 3DQ7A 2IB6A 1DMOA 2WOSA 4OR9B 1BFPA 4C0JA 2GW4B 2GV5A 2JTTA 1BODA 3SSLA 4MN0A 2Z6ZA 2DUGA 3EVRA 3DQHA 1GQMA 2ZN8A 2ZKMX 4IK5A 1MWNA 4P76A 1CM4A 4W74A 1GGZA 2JNXA 1PVBA 1K8UA 4W6BA 3VK1A 1W7JB 1NSHA 5DU0A 3LA1A 4DS7A 4W6PA 4ZF3A 4CFQA 1QXTA 4Q9WA 5T3IA 2K8MB 3TDUA 4RYSA 3AAKA 2BKHB 4W6LA 1HT9A 3EKJA 5ER5A 3KCTA 1YRUB 1A29A 2WIQA 2YE0A 2BTJA 2KAYA 1CM1A 1DJHA 2ZRSA 2HQKA 3CBEA 2KGBC 1YZWA 5HW9A 2I7AA 3DQ9A 4HVFA 2AWKA 4DKNA 3VHTA 2A56B 3LL8B 3SVNA 3PATA 1JBZA 3AI5A 2WURA 3D10A 1H6RA 1WDCB 1S6ZA 3O4YA 3OB2B 4MZJA 3TUYC 3LVAA 2D8NA 4I5JA 4PCWA 1RECA 1CLLA 1ZOTB 2SCPA 3WLCA 1K90D 3LVDA 2I18A 1Q4BA 3NT9A 4XOWA 5AERA 2IB5A 4OQWA 3CD9A 1M46A 5HLVA 2HGYA 2WC8A 2FCEA 3W1CA 4GBAA 4W6SA 3I5IB 1JF0A 3AKAA 2EC6C 3ZTFA 4XOVA 4JPZB 3I5GC 4ORNA 1XK4A 1CNPA 1NCZA 1KYPA 4Q04A 1EJ3A 1ZUXA 3AAJA 1KQMB 1OE9B 2Y5IA 3NXAA 1FPWA 4XVPA 1ALWA 2KYFA 3EKHA 3CWGA 3ZWHA 2P6BB 4EDSA 2JTZA 3DPZA 2DOQA 3DQOA 1RK9A 2EMDA 1LA0A 5DTLA 5JOLA 4KAGA 4GGNA 1LINA 1EG3A 3SVOA 3ST3A 1QX7A 3OHMB 5HZTA 5JJGA 3BX9A 1H8BA 2K61A 1XA5A 3DQ3A 3BYAA 1BU3A 1TNPA 2JRFA 1OXDA 2O29A 1W7TA 4P5OE 3BUOB 2COLB 2OKYA 3U8CA 1S26D 4W6KA 2G6YA 1JFKA 3JTDC 1OXFA 4HQCA 4DXNA 5J3XA 1CFPA 1M45A 3IQOA 5LTQA 3DQ4A 4USLA 2HQZA 2ZRTA 2H2KA 2VVIA 3GB3A 1IQ3A 4GNKB 3DQJA 1MOVA 4H3NA 5EJUA 2F2OA 1QS7A 1IJ5A 2G6XA 3CR5X 1L2OB 4W7EA 1B7TZ 4U8DA 3KPXA 1QV0A 2GGZA 2PXWA 2LMTA 5LTRA 2C9IA 2H61C 1SL9A 3DVMA 4OCIA 2BCXA 5FVFA 2A54B 2LMUA 4KF5C 2WSOA 2KI4C 1PSRA 2LP3A 1UHNA 2PSRA 2RGIA 5G08A 3DPXA 3DQEA 5I2LA 1MOUA 2A47A 5EXUA 1HCJA 4KEXA 3DQ5A 3BUWB 3PN7B 1RMOA 2F3ZA 3CFHA 4LJBA 1Z1QA 5CPVA 3OB1B 1SCMC 1B1GA 1J7QA 4JRBA 3SG6A 1F71A 1XYDA 3A8RA 3ADFA 1K96A 1K95A 3G9AA 4PE0A 2EHBA 4H47A 4P1QA 2BL0C 2QU1A 4IK4A 3AI4A 4Z4MA 3DQFA 4LW5A 3IP2A 1YFPA 5BTTA 4W6TA 2B3PA 2LC5A 1JWDA 3VRRA 3CTNA 4ZF4A 3VHTB 1BMOA 2NZ0A 1KSMA 2F2PA 2GW3A 4KF5A 1TCFA 3SG5A 3I5HC 2G9BA 2IE2A 2OGRA 1AK8A 1KYSA 1KYRA 2A46A 3BXCA 1YRTB 3SSVA 1NCYA 2K2FA 4YGDB 2VZXA 1MYWA 1XQMA 1SCVA 1DJZA 3LVCA 4L12A 2JADA 5DTYA 2OTGC 4XJKA 3DQ1A 5CSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RMP A;  5GQQ C;  3C1V A;  4PE7 A;  5DY6 A;  3VIC A;  2DD7 A;  2AH8 A;  2M97 A;  2MRD A;  1B9A A;  4QJ3 B;  1R6P A;  1QJT A;  2R2I A;  2M29 A;  3BXB A;  4C0L A;  1IWQ A;  3I5F C;  3BXK A;  4LQT A;  2JUL A;  2ZNE A;  2G2S B;  4W6F A;  2VAD A;  1DJI A;  4H3L A;  4P2Y B;  3EVP A;  1YJ2 A;  5DKR A;  1KFX S;  3K1K A;  2I2R E;  2NCP A;  4W76 A;  3I19 A;  1IJ6 A;  2JQ6 A;  1RRO A;  2H9W A;  4NQG A;  1KFX L;  5I8N A;  2LAN A;  2LE9 B;  1CDM A;  1XFX O;  2L0P A;  2LV7 A;  3U0N A;  3BOW B;  4JFG A;  1B7T Y;  3SVS A;  4CPV A;  3DPW A;  1UHJ A;  4I2Y A;  4DUQ A;  5KSZ A;  5CSJ A;  2BE4 A;  1C7W A;  1K9P A;  3EK8 A;  4IK1 A;  5HYD A;  4XL5 A;  4ZB1 A;  1UIS A;  4IL1 A;  3MSE B;  2GGM A;  2F8P A;  4IK9 A;  1CMG A;  1Y0V H;  2IOV A;  4YGE B;  1CLB A;  2L4I A;  1C07 A;  1UP5 A;  2OJK A;  2M0R A;  4DXI A;  1WRK A;  4YI9 A;  1UHI A;  2O5G A;  3RLZ A;  2Q4U A;  3H1R A;  2AWJ A;  1J1E A;  2LM5 A;  3DQ8 A;  3SVR A;  3CR4 X;  4DRW A;  1VRK A;  2QAC A;  1F70 A;  2AHA A;  1SYM A;  4YGB B;  4W73 A;  4MZL A;  2LMV A;  5H89 A;  3E5W A;  3GJ2 A;  1JFJ A;  5H87 A;  2LLU A;  5AAN A;  3OSR A;  1DJY A;  2B3Q A;  4Z4K A;  4HQ8 A;  1H4U A;  3SST A;  5F6T A;  3MGF A;  4PAL A;  4EMQ A;  2JU0 A;  3DQA A;  1EL4 A;  1XO5 A;  3TDZ A;  4LJD A;  1NX2 A;  2ZND A;  2LVI A;  4JC2 A;  1OMD A;  1KWO C;  2MLE C;  2ZMU A;  1CDL A;  3D0Y A;  4DXO A;  4ZIO A;  2VAE A;  3DQC A;  3CS1 A;  4OJ0 A;  1KSO A;  1NX1 A;  1LKJ A;  3IQQ A;  2HCG A;  5BTT B;  1OZO A;  2KDH A;  2G5Z B;  4J8A A;  3O6B A;  4YI8 A;  5B8I B;  2FZU A;  3A4U B;  3GK2 A;  1XAE A;  2AWL A;  3NSK A;  2A52 B;  1SMG A;  4I5L B;  5FVG A;  3DQI A;  1IRJ A;  2LVJ A;  3SG2 A;  5I2Q A;  3ZUJ A;  2MAZ A;  3PSR A;  4B5Y A;  2E30 A;  2WOR A;  3DVE A;  2H5R A;  1F8H A;  4W6O A;  2LP2 A;  2A48 A;  2WCB A;  1XSS A;  2L50 A;  2K7C A;  1SPY A;  1SCM B;  1F09 A;  1U5I B;  3ST4 A;  1S6J A;  1XFU O;  2BBM A;  3WHT B;  1N0Y A;  2EMN A;  1UUS A;  4W6C A;  2PXS A;  2JT8 A;  4XJK B;  1K2H A;  4WQ2 A;  3TS5 C;  5HZU A;  3LK1 A;  2B1U A;  1E8A A;  4ZBL A;  2M7L A;  3GEX A;  3SG3 A;  3WLD A;  2NCO A;  4D1E A;  1W7U A;  2L5X B;  1QIW A;  2AUC A;  1S3P A;  2BEC A;  1B47 A;  2G2B A;  4EDO A;  4DXP A;  4A4C A;  2I94 A;  3BQ3 A;  1CMF A;  1G33 A;  3P28 A;  4PE1 A;  3CZT X;  1RM9 A;  1XVJ A;  1D1O A;  4WRI A;  1RMM A;  1NIW A;  3FWC A;  2KAV A;  3M24 A;  2WND A;  4DCK A;  1XMZ A;  2YDZ A;  2BCA A;  3LLE A;  1S6I A;  5IBW A;  2FL1 A;  2MJW B;  4MLW A;  3LSA A;  4Q9X A;  1DVI A;  1ALV A;  2K7O A;  4N1F A;  4N3D A;  1A4P A;  2YE1 A;  2PAS A;  1KK8 B;  1NPQ A;  4DKM A;  2OTG B;  4KF4 A;  1NWD A;  4RYW A;  4R6B A;  3LS3 A;  2WHT A;  4BY5 A;  5DKQ A;  2O60 A;  2DDC A;  2A4J A;  2MLF C;  1UHK A;  3EK4 A;  2KBM A;  1QLK A;  1V1F A;  1B9C A;  4AS8 A;  1EXR A;  4W6A A;  3SVD A;  4IK3 A;  1ZUZ A;  2FCD A;  4NDD A;  1PK0 D;  1BF5 A;  1Z1P A;  3CGL A;  3KEV A;  4ORC B;  4A4B A;  3NED A;  4OGS A;  1QV1 A;  2QLG A;  2OTE A;  2M8U A;  1XFZ O;  3FS7 A;  1Y1A A;  2ZMW A;  1JSA A;  4BY4 A;  2HQW A;  1BOC A;  1W7I B;  4GFT A;  1S1E A;  1KK7 Z;  5EXC I;  1AHR A;  1M31 A;  2CT9 A;  1TN4 A;  4H48 A;  5F9G A;  1QX5 B;  1TTX A;  3HX4 A;  3PJB A;  4RTC A;  5DPJ A;  3SSP A;  4XGY A;  2OS8 C;  1GJY A;  2WIS A;  2HFC A;  2M7N A;  2Q57 A;  4TZG A;  1Q4D A;  4FTG A;  5BPJ A;  1JBA A;  4IZN A;  3SVU A;  1SY9 A;  4MRX A;  3EK7 A;  2C9J A;  1YVL A;  5AQB B;  3ZUL A;  1B8C A;  1TIZ A;  3QRX A;  3RWA A;  5HZS A;  4NDC A;  2Y1M A;  3LK0 A;  3DF0 A;  1YTZ C;  2QT2 A;  4HRE E;  3D0Y B;  4UPG A;  2LVV A;  1YHI A;  2H5Q A;  1GL4 A;  2EGD A;  4PHN A;  3SJS A;  5HKY A;  2Z6Y A;  1SR6 C;  2KYC A;  1QY3 A;  3WCK A;  1QYQ A;  2ISD A;  1QVI Z;  3JVT C;  2KNE A;  1EMC A;  2QLH A;  1ODB A;  1EME A;  2L51 A;  4PFE A;  2QLE A;  2WHU A;  4YRU A;  1J7P A;  1IQ5 A;  3H1O A;  1AJ5 A;  1CB1 A;  1WDC C;  1N2D A;  2H61 A;  1YUT A;  4Q7R A;  1RTP 1;  2JNF A;  2HJO A;  1EMA A;  4B30 A;  2M49 B;  3BUN B;  3IF7 A;  2V4E C;  1JC1 A;  1NYA A;  1QXP A;  2KBI A;  2AMI A;  1FF1 A;  1SKT A;  4OVN F;  3U0L A;  1V1G A;  2JPT A;  2F33 A;  3ZUF A;  4HQ9 A;  2OTB A;  3PIB A;  4CFR A;  3VGO A;  4L1I A;  3U8P A;  2NXQ A;  2CCM A;  3FWB A;  3PAL A;  3GJ1 A;  4C0K A;  1HUY A;  3DVK A;  4LQU A;  5D7F A;  5D69 A;  4MBE A;  1B8L A;  1QYF A;  2M1U A;  1SNL A;  4IK8 A;  3I5I C;  4HRH A;  2DUE A;  1F4O A;  3UG0 A;  2KFF A;  4HE4 A;  1M63 B;  4NWS A;  2QRF A;  3KO0 A;  2JWW A;  2ZO7 A;  3H4S E;  3DQ2 A;  2Y1N A;  1KQM C;  4UTS A;  4W6H A;  1QAT A;  2V4E A;  5BT0 A;  4E68 A;  4YGA A;  1DGU A;  4W6R A;  4AOM A;  1FI5 A;  2LUX A;  2G3O A;  3TUY B;  1WRL A;  3DQD A;  1PSB A;  3K21 A;  4N1G A;  4BDU A;  4GGF C;  3NT3 A;  3ICB A;  1OOJ A;  2QPT A;  5DKN A;  2JOJ A;  1ZGP A;  2NLN A;  3OSQ A;  4ANJ A;  3F45 A;  1EMK A;  4AQJ A;  1H4B A;  1Q4C A;  4NDB A;  5I2O A;  4PPK A;  2BE6 A;  4OV2 A;  5J2O A;  1JUO A;  1Y1X A;  2CTN A;  2MA2 A;  1GFL A;  3KCS A;  3CLN A;  1FI6 A;  1KK7 Y;  4ZCV A;  4GAO A;  1M39 A;  2QLI A;  1CFC A;  2DUH A;  3BXA A;  2KOT A;  4W6M A;  2EC6 B;  1WLZ A;  1FW4 A;  2OPO A;  3I5G B;  3PJ7 A;  5EB7 A;  3SVB A;  3OP0 A;  1WY9 A;  3GK1 A;  3SRY A;  1ZGO A;  2QLG B;  1SW8 A;  1BLQ A;  4GGF A;  2M9G A;  2WCE A;  1EMM A;  2DD9 A;  3OGO A;  2BCB A;  3V3D A;  2Z1O A;  2OKW A;  1YUR A;  3NSI A;  5LTP A;  2DUI A;  2VVH A;  4JWQ A;  2LVK A;  2G6E A;  5DPH A;  5HLO A;  3E3R A;  4U2V A;  1SL7 A;  4W6U A;  1QVI Y;  2KQY A;  1IGV A;  2ZFD A;  2V53 A;  4OHS A;  1F54 A;  1OZS A;  1DF0 A;  2JT3 A;  4KW9 A;  4W72 A;  4DXM A;  3SV5 A;  3E5T A;  1CFD A;  5HKZ A;  4ZF5 A;  1RRX A;  4EN1 A;  3HCM A;  3SVC A;  5KTG A;  3JTD B;  1G8I A;  3O2P A;  2G3D B;  3PN7 C;  4W6N A;  4I5N B;  2HGD A;  1BR4 B;  5DPG A;  5KU1 A;  3LF4 B;  2G16 B;  3M0W A;  3DF0 B;  2WHS A;  3DQL A;  2CNP A;  5EXB A;  1NP8 A;  3PM8 A;  1S5G Z;  4LJC A;  2ARL A;  1KFU S;  1SK6 D;  1Q73 A;  4ORA B;  1F55 A;  1TNW A;  2LAP A;  2VRG A;  1EMF A;  2M3W A;  2A50 B;  2TN4 A;  5ER4 X;  1KFU L;  2OS8 B;  3AKB A;  1Q4A A;  2VVJ A;  3ST2 A;  2M1K B;  3SIB A;  2HF5 A;  5HBD A;  3NSO A;  2H5O A;  3OX6 A;  1CDP A;  5H88 A;  4KGF A;  4B30 B;  1IG5 A;  3VRQ A;  2F3Y A;  1OQP A;  4F0Z B;  3ED8 A;  1KQV A;  3DQK A;  1YHG A;  1IH0 A;  4N5X A;  3EVU A;  1ZAC A;  2KI4 B;  3E5V A;  1ZFS A;  5BQL A;  3SIA A;  2LCP A;  4I5K A;  2Z6X A;  4L9M A;  3CD1 A;  2JZI A;  1QYO A;  2KI6 D;  2YFP A;  1OMR A;  1SR6 B;  4JF9 A;  1JBY A;  1A75 A;  3CB9 A;  2LLT A;  1G4Y R;  3JVT B;  3GL4 A;  5DQB A;  3KHE A;  5DRG A;  4MEW A;  2L2E A;  5EHU A;  2JT0 A;  5PAL A;  4ZIN A;  4J89 A;  2BL0 B;  3CR2 A;  4HSZ A;  5FVI A;  1XK4 C;  1BJF A;  1AVS A;  1XFV O;  1AP4 A;  4MRY A;  1YUS A;  2K0J A;  2HQ8 A;  1DGV A;  2Q91 A;  1K9K A;  2Q6P A;  4W7A A;  1QIV A;  1OSA A;  1GGW A;  2V4E B;  3EVV A;  4W69 A;  2KQ6 A;  2FOT A;  3I5H B;  1NX0 A;  4Q7T A;  4YGC B;  3DVJ A;  4PDZ A;  2MBX A;  4W6G A;  1MF8 B;  2P4M A;  3P8U A;  3CFA A;  2ZN9 A;  1R2U A;  1PUL A;  3TMT A;  4PHM A;  3AKO A;  4R6D A;  1RJV A;  3SVE A;  1WRZ A;  1J7O A;  1LVC D;  1KCY A;  1K93 D;  4KA9 A;  3DQ6 A;  4PPJ A;  4ETO A;  3A8S A;  4W6I A;  1X02 A;  1DT7 B;  3U0K A;  2PAL A;  1EMB A;  5FHV A;  4W77 A;  3FIA A;  3TDI A;  3W1D A;  1J1D A;  1IKU A;  3VRO A;  4R1E A;  2JXL A;  3I5F B;  4TZA A;  1TNX A;  3VRN A;  3TZ1 A;  1K94 A;  1TRF A;  4DIR A;  5DTZ A;  4PE4 A;  1PRW A;  2BKI B;  2WCF A;  4GPL B;  3O78 A;  1S5G Y;  5AEQ A;  1MR8 A;  3BOW A;  5CSN A;  4W6J A;  1TCO B;  4DXQ A;  4XYN A;  3U8A A;  1KP5 A;  4W7F A;  1YHH A;  1DF0 B;  2FWQ A;  4W7X A;  4KW4 A;  3S05 A;  2HPS A;  2KAX A;  4QJ5 B;  1UWO A;  2BBN A;  1BG1 A;  4YBH B;  4AR7 A;  3M22 A;  1DJX A;  5CSF A;  2A53 B;  3DD4 A;  2O24 A;  2RH7 A;  2IS9 A;  2AWM A;  1C7V A;  3WHU B;  1DJG A;  3SSK A;  5HKW A;  1YX7 A;  5AFP A;  4W7C A;  1UHH A;  1K9U A;  1CTR A;  1SL8 A;  5DRF A;  1NCX A;  4W6D A;  5EB6 A;  1B8R A;  3WNX B;  1SRA A;  3GK4 X;  1MXE A;  4Q7U A;  1QX2 A;  4GUK A;  2H6V A;  3VRP A;  1JC2 A;  1OMV A;  2HET A;  2ZO6 A;  2MHH A;  2DDD A;  3NSL A;  4KPI A;  2K7D A;  3U0M A;  3SSH A;  1PVA A;  1XA9 A;  5DQM A;  2KI6 C;  3PFV A;  4GF6 B;  1AJ4 A;  3NEZ A;  4W7D A;  1A03 A;  1NX3 A;  4KW8 A;  1MHO A;  1UUR A;  1QTX A;  2GX2 A;  1RFJ A;  1PAL A;  2JC2 A;  2WSN A;  3RWT A;  1NUB A;  1XFY O;  1TNQ A;  1MUX A;  1OXE A;  2QZ0 A;  3DQN A;  1CV7 A;  1A75 B;  4ZFS A;  1MQ1 A;  1KWO B;  3UFZ A;  2AAO A;  1Y1U A;  4KGE A;  2KSP A;  2L4H A;  1YJF A;  1DJW A;  2JXC A;  1L7Z A;  1WLM A;  1CDN A;  2LLS A;  2KHN A;  1Y6W A;  4CID A;  3DQM A;  4ICB A;  4W7R A;  1FBV A;  3ST0 A;  1DTL A;  3BUM B;  3NF0 A;  2FJU B;  1G7K A;  3KF9 A;  3SG7 A;  2KFH A;  4MSP A;  4M2O A;  3PJ5 A;  1S36 A;  2CBL A;  4JQ0 D;  3SS0 A;  1EML A;  2LHI A;  1J55 A;  3BUX B;  1S6C A;  1U5I A;  4QJ4 B;  4FQO A;  4PHJ A;  5TNC A;  2K7B A;  3O77 A;  1KK8 C;  4OKH A;  2HPW A;  2DUF A;  2EMO A;  5KTY A;  2PVB A;  4M2P A;  1MXL C;  5HGE A;  4MZK A;  1A2X A;  3CGA A;  3SSY A;  1HQV A;  5AXI A;  5LK4 A;  3LF3 A;  4JGE A;  3RM1 A;  2Y0G A;  3TMR A;  2POX A;  2LHL A;  3ZNI A;  3TS5 B;  1JC0 A;  4H3M A;  1RWY A;  1LA3 A;  3PLF B;  1BR1 B;  1W7S A;  4MVF A;  4W75 A;  1EH2 A;  2H5P A;  1F4Q A;  1JF2 A;  5EBJ A;  1GGX A;  1TOP A;  4HRG A;  1YX8 A;  1QLS A;  3OX5 A;  3LCP C;  4ZCU A;  5DTX A;  1Q80 A;  2CXJ A;  1CKK A;  1XFW O;  2PMY A;  4J88 A;  1J7R A;  2LNK A;  4ORB B;  5K89 A;  3GOF A;  4JEO A;  5FYX A;  1CFF A;  4EUL A;  1C4F A;  1EMG A;  3SG4 A;  2GX0 A;  2SAS A;  1ZMZ A;  4OY4 A;  4M2Q A;  3CFF A;  1L2O C;  4TNC A;  2KFG A;  2L98 A;  1F0B A;  4WQ3 A;  1ZGQ A;  1YUU A;  4L13 A;  1AUI B;  2HRS A;  1N65 A;  2H8Q A;  2K2A A;  2LUC A;  4GES B;  1B4C A;  1QAS A;  5DPI A;  4LJD C;  1Q4E A;  1EG4 A;  5HZO A;  4CLN A;  4GOB A;  4AQI A;  3DQU A;  1YVH A;  2PRU A;  4PHK A;  2KGR A;  1YR5 A;  3IR8 A;  1LXF C;  2E6W A;  1CLM A;  4PPL A;  2Y4Q A;  3WXA A;  1SBJ A;  1BT6 A;  2O2B A;  2ICR A;  3DQ7 A;  2IB6 A;  1DMO A;  2WOS A;  4OR9 B;  1BFP A;  4C0J A;  2GW4 B;  2GV5 A;  2JTT A;  1BOD A;  3SSL A;  4MN0 A;  2Z6Z A;  2DUG A;  3EVR A;  3DQH A;  1GQM A;  2ZN8 A;  2ZKM X;  4IK5 A;  1MWN A;  4P76 A;  1CM4 A;  4W74 A;  1GGZ A;  2JNX A;  1PVB A;  1K8U A;  4W6B A;  3VK1 A;  1W7J B;  1NSH A;  5DU0 A;  3LA1 A;  4DS7 A;  4W6P A;  4ZF3 A;  4CFQ A;  1QXT A;  4Q9W A;  5T3I A;  2K8M B;  3TDU A;  4RYS A;  3AAK A;  2BKH B;  4W6L A;  1HT9 A;  3EKJ A;  5ER5 A;  3KCT A;  1YRU B;  1A29 A;  2WIQ A;  2YE0 A;  2BTJ A;  2KAY A;  1CM1 A;  1DJH A;  2ZRS A;  2HQK A;  3CBE A;  2KGB C;  1YZW A;  5HW9 A;  2I7A A;  3DQ9 A;  4HVF A;  2AWK A;  4DKN A;  3VHT A;  2A56 B;  3LL8 B;  3SVN A;  3PAT A;  1JBZ A;  3AI5 A;  2WUR A;  3D10 A;  1H6R A;  1WDC B;  1S6Z A;  3O4Y A;  3OB2 B;  4MZJ A;  3TUY C;  3LVA A;  2D8N A;  4I5J A;  4PCW A;  1REC A;  1CLL A;  1ZOT B;  2SCP A;  3WLC A;  1K90 D;  3LVD A;  2I18 A;  1Q4B A;  3NT9 A;  4XOW A;  5AER A;  2IB5 A;  4OQW A;  3CD9 A;  1M46 A;  5HLV A;  2HGY A;  2WC8 A;  2FCE A;  3W1C A;  4GBA A;  4W6S A;  3I5I B;  1JF0 A;  3AKA A;  2EC6 C;  3ZTF A;  4XOV A;  4JPZ B;  3I5G C;  4ORN A;  1XK4 A;  1CNP A;  1NCZ A;  1KYP A;  4Q04 A;  1EJ3 A;  1ZUX A;  3AAJ A;  1KQM B;  1OE9 B;  2Y5I A;  3NXA A;  1FPW A;  4XVP A;  1ALW A;  2KYF A;  3EKH A;  3CWG A;  3ZWH A;  2P6B B;  4EDS A;  2JTZ A;  3DPZ A;  2DOQ A;  3DQO A;  1RK9 A;  2EMD A;  1LA0 A;  5DTL A;  5JOL A;  4KAG A;  4GGN A;  1LIN A;  1EG3 A;  3SVO A;  3ST3 A;  1QX7 A;  3OHM B;  5HZT A;  5JJG A;  3BX9 A;  1H8B A;  2K61 A;  1XA5 A;  3DQ3 A;  3BYA A;  1BU3 A;  1TNP A;  2JRF A;  1OXD A;  2O29 A;  1W7T A;  4P5O E;  3BUO B;  2COL B;  2OKY A;  3U8C A;  1S26 D;  4W6K A;  2G6Y A;  1JFK A;  3JTD C;  1OXF A;  4HQC A;  4DXN A;  5J3X A;  1CFP A;  1M45 A;  3IQO A;  5LTQ A;  3DQ4 A;  4USL A;  2HQZ A;  2ZRT A;  2H2K A;  2VVI A;  3GB3 A;  1IQ3 A;  4GNK B;  3DQJ A;  1MOV A;  4H3N A;  5EJU A;  2F2O A;  1QS7 A;  1IJ5 A;  2G6X A;  3CR5 X;  1L2O B;  4W7E A;  1B7T Z;  4U8D A;  3KPX A;  1QV0 A;  2GGZ A;  2PXW A;  2LMT A;  5LTR A;  2C9I A;  2H61 C;  1SL9 A;  3DVM A;  4OCI A;  2BCX A;  5FVF A;  2A54 B;  2LMU A;  4KF5 C;  2WSO A;  2KI4 C;  1PSR A;  2LP3 A;  1UHN A;  2PSR A;  2RGI A;  5G08 A;  3DPX A;  3DQE A;  5I2L A;  1MOU A;  2A47 A;  5EXU A;  1HCJ A;  4KEX A;  3DQ5 A;  3BUW B;  3PN7 B;  1RMO A;  2F3Z A;  3CFH A;  4LJB A;  1Z1Q A;  5CPV A;  3OB1 B;  1SCM C;  1B1G A;  1J7Q A;  4JRB A;  3SG6 A;  1F71 A;  1XYD A;  3A8R A;  3ADF A;  1K96 A;  1K95 A;  3G9A A;  4PE0 A;  2EHB A;  4H47 A;  4P1Q A;  2BL0 C;  2QU1 A;  4IK4 A;  3AI4 A;  4Z4M A;  3DQF A;  4LW5 A;  3IP2 A;  1YFP A;  5BTT A;  4W6T A;  2B3P A;  2LC5 A;  1JWD A;  3VRR A;  3CTN A;  4ZF4 A;  3VHT B;  1BMO A;  2NZ0 A;  1KSM A;  2F2P A;  2GW3 A;  4KF5 A;  1TCF A;  3SG5 A;  3I5H C;  2G9B A;  2IE2 A;  2OGR A;  1AK8 A;  1KYS A;  1KYR A;  2A46 A;  3BXC A;  1YRT B;  3SSV A;  1NCY A;  2K2F A;  4YGD B;  2VZX A;  1MYW A;  1XQM A;  1SCV A;  1DJZ A;  3LVC A;  4L12 A;  2JAD A;  5DTY A;  2OTG C;  4XJK A;  3DQ1 A;  5CSI A; 
#chains in the Genus database with same CATH topology
 1RMP A;  5GQQ C;  3C1V A;  4PE7 A;  5DY6 A;  3VIC A;  2DD7 A;  2AH8 A;  2M97 A;  2MRD A;  2JPO A;  1B9A A;  4QJ3 B;  1R6P A;  4INW A;  1QJT A;  2R2I A;  2M29 A;  3NHT A;  3BXB A;  4C0L A;  1IWQ A;  3I5F C;  3BXK A;  1DQE A;  4LQT A;  2JUL A;  2ZNE A;  2G2S B;  5FI7 A;  4W6F A;  2VAD A;  1DJI A;  4H3L A;  4P2Y B;  3B86 A;  3EVP A;  1YJ2 A;  5DKR A;  1KFX S;  3K1K A;  2I2R E;  2NCP A;  4W76 A;  3I19 A;  1XFR A;  1IJ6 A;  2JQ6 A;  1RRO A;  2H9W A;  4NQG A;  1KFX L;  5I8N A;  2LAN A;  2LE9 B;  1CDM A;  1XFX O;  2L0P A;  2LV7 A;  3U0N A;  3BOW B;  4JFG A;  1B7T Y;  1QWV A;  3SVS A;  4CPV A;  2QEB A;  3DPW A;  1UHJ A;  1GM0 A;  4I2Y A;  4DUQ A;  5KSZ A;  5CSJ A;  2BE4 A;  1C7W A;  1K9P A;  3EK8 A;  4IK1 A;  5HYD A;  5HL1 A;  4XL5 A;  4ZB1 A;  1UIS A;  4IL1 A;  2H8V A;  3NGV A;  3MSE B;  2GGM A;  2F8P A;  4IK9 A;  1CMG A;  1Y0V H;  2IOV A;  4YGE B;  1CLB A;  2L4I A;  1C07 A;  1UP5 A;  2OJK A;  2M0R A;  4DXI A;  1WRK A;  3PJI A;  4YI9 A;  1UHI A;  2O5G A;  3RLZ A;  2Q4U A;  3H1R A;  2AWJ A;  3R1V A;  1J1E A;  2KLE A;  2LM5 A;  3DQ8 A;  3SVR A;  3CR4 X;  4DRW A;  1VRK A;  2QAC A;  1F70 A;  2AHA A;  1SYM A;  4YGB B;  4W73 A;  4MZL A;  2LMV A;  5H89 A;  3E5W A;  3GJ2 A;  1JFJ A;  5H87 A;  3S0D A;  2LLU A;  5AAN A;  3OSR A;  1DJY A;  2B3Q A;  1TUJ A;  4Z4K A;  4HQ8 A;  1H4U A;  3SST A;  5F6T A;  3MGF A;  4PAL A;  4EMQ A;  2JU0 A;  3DQA A;  1EL4 A;  1XO5 A;  3TDZ A;  4LJD A;  1NX2 A;  2ZND A;  2LVI A;  4JC2 A;  1OMD A;  1KWO C;  2MLE C;  2ZMU A;  1CDL A;  3D0Y A;  4DXO A;  4ZIO A;  2VAE A;  3PM2 A;  3DQC A;  3CS1 A;  4OJ0 A;  1KSO A;  1NX1 A;  1LKJ A;  3IQQ A;  2HCG A;  5BTT B;  1OZO A;  2KDH A;  2G5Z B;  4J8A A;  3O6B A;  4YI8 A;  5B8I B;  2FZU A;  3A4U B;  3GK2 A;  1XAE A;  2AWL A;  3NSK A;  2A52 B;  1SMG A;  4I5L B;  5FVG A;  3DQI A;  1IRJ A;  2LVJ A;  3SG2 A;  5I2Q A;  3ZUJ A;  2MAZ A;  3PSR A;  4B5Y A;  2E30 A;  2WOR A;  3DVE A;  2H5R A;  1F8H A;  4W6O A;  2LP2 A;  2A48 A;  2WCB A;  1XSS A;  2L50 A;  2K7C A;  1SPY A;  1SCM B;  1F09 A;  1U5I B;  1C3Y A;  3ST4 A;  3B88 A;  1S6J A;  1XFU O;  2BBM A;  3WHT B;  1N0Y A;  2EMN A;  1UUS A;  4W6C A;  2PXS A;  2JT8 A;  4XJK B;  1K2H A;  4WQ2 A;  3TS5 C;  5HZU A;  3LK1 A;  2B1U A;  1E8A A;  4ZBL A;  2M7L A;  3GEX A;  3SG3 A;  3WLD A;  2NCO A;  4D1E A;  1W7U A;  2L5X B;  1QIW A;  2AUC A;  1S3P A;  2BEC A;  1B47 A;  2G2B A;  4EDO A;  4DXP A;  4A4C A;  2I94 A;  3BQ3 A;  1CMF A;  1G33 A;  3P28 A;  4PE1 A;  3CZT X;  3SS5 A;  1RM9 A;  1XVJ A;  1D1O A;  4WRI A;  1RMM A;  1NIW A;  3FWC A;  2KAV A;  3M24 A;  2WND A;  4DCK A;  1XMZ A;  2YDZ A;  2BCA A;  3LLE A;  1S6I A;  5IBW A;  2FL1 A;  2MJW B;  4MLW A;  3LSA A;  1DVI A;  3O4X A;  1ALV A;  4Q9X A;  2K7O A;  4N1F A;  3B7A A;  4N3D A;  1A4P A;  2YE1 A;  2PAS A;  2WC5 A;  1KK8 B;  1NPQ A;  4DKM A;  2OTG B;  4KF4 A;  1NWD A;  4RYW A;  4R6B A;  3CYZ A;  3L4L A;  3LS3 A;  2WHT A;  4BY5 A;  5DKQ A;  2O60 A;  2DDC A;  3D77 A;  2A4J A;  2MLF C;  1UHK A;  3EK4 A;  2KBM A;  1QLK A;  1V1F A;  1B9C A;  4AS8 A;  1EXR A;  2GTE A;  4W6A A;  3SVD A;  4IK3 A;  3V2L A;  1ZUZ A;  2FCD A;  4NDD A;  1PK0 D;  1BF5 A;  1Z1P A;  3CGL A;  3KEV A;  4ORC B;  4A4B A;  3NED A;  4OGS A;  1QV1 A;  2QLG A;  2OTE A;  2M8U A;  1XFZ O;  3FS7 A;  1Y1A A;  2ZMW A;  1Z4H A;  1JSA A;  4BY4 A;  2HQW A;  1BOC A;  1W7I B;  3DZT A;  4GFT A;  1S1E A;  1KK7 Z;  5EXC I;  1AHR A;  1M31 A;  2CT9 A;  3D74 A;  1TN4 A;  4H48 A;  5F9G A;  2ERB A;  1QX5 B;  1TTX A;  3HX4 A;  3PJB A;  4RTC A;  5DPJ A;  3SSP A;  4XGY A;  2OS8 C;  1GJY A;  2WIS A;  2HFC A;  2M7N A;  2Q57 A;  4TZG A;  1Q4D A;  4FTG A;  5BPJ A;  1JBA A;  4IZN A;  3SVU A;  1SY9 A;  4MRX A;  3EK7 A;  2C9J A;  1YVL A;  5AQB B;  3BFB A;  3ZUL A;  1B8C A;  1TIZ A;  3QRX A;  3RWA A;  5HZS A;  4NDC A;  2Y1M A;  3LK0 A;  3DF0 A;  1YTZ C;  2QT2 A;  4HRE E;  3S0G A;  3D0Y B;  4UPG A;  2LVV A;  1YHI A;  2H5Q A;  1GL4 A;  2EGD A;  4PHN A;  3SJS A;  1OOI X;  5HKY A;  2Z6Y A;  1SR6 C;  3B87 A;  2KYC A;  1QY3 A;  3WCK A;  1QYQ A;  2ISD A;  1QVI Z;  5EL2 A;  3JVT C;  2KNE A;  1EMC A;  2QLH A;  1ODB A;  1EME A;  2L51 A;  4PFE A;  2QLE A;  2WHU A;  4YRU A;  1J7P A;  1IQ5 A;  3H1O A;  1AJ5 A;  1CB1 A;  1WDC C;  1N2D A;  2H61 A;  1YUT A;  4Q7R A;  1RTP 1;  2JNF A;  2HJO A;  1EMA A;  4B30 A;  2M49 B;  3BUN B;  3IF7 A;  2V4E C;  1JC1 A;  1NYA A;  1QXP A;  2KBI A;  2AMI A;  1FF1 A;  1SKT A;  2P70 A;  4OVN F;  3U0L A;  1V1G A;  2JPT A;  2F33 A;  3ZUF A;  4HQ9 A;  3S0E A;  2OTB A;  3PIB A;  4CFR A;  3D78 A;  3VGO A;  4L1I A;  3U8P A;  2NXQ A;  2CCM A;  3FWB A;  3PAL A;  3GJ1 A;  4C0K A;  3BFH A;  1HUY A;  3DVK A;  4LQU A;  5D7F A;  5D69 A;  4MBE A;  1B8L A;  3SS4 A;  1QYF A;  1OOF A;  2M1U A;  1SNL A;  4IK8 A;  3I5I C;  4HRH A;  2DUE A;  1F4O A;  3UG0 A;  4KYN A;  2KFF A;  4HE4 A;  1M63 B;  4NWS A;  2QRF A;  3KO0 A;  2JWW A;  2ZO7 A;  2WCJ A;  3H4S E;  3DQ2 A;  2Y1N A;  1KQM C;  4UTS A;  4W6H A;  1QAT A;  2QEH A;  2V4E A;  5BT0 A;  4E68 A;  4YGA A;  1DGU A;  4W6R A;  4AOM A;  1FI5 A;  2LUX A;  2G3O A;  3TUY B;  1WRL A;  3DQD A;  1PSB A;  3K21 A;  4N1G A;  4BDU A;  4GGF C;  3NT3 A;  3ICB A;  1OOG A;  3OGN A;  1OOJ A;  2QPT A;  5DKN A;  2JOJ A;  1ZGP A;  3S0F A;  2NLN A;  3OSQ A;  4ANJ A;  3F45 A;  1EMK A;  4AQJ A;  1H4B A;  1Q4C A;  4NDB A;  5I2O A;  4PPK A;  3R1P A;  2BE6 A;  4OV2 A;  5J2O A;  1JUO A;  1Y1X A;  2CTN A;  2MA2 A;  1GFL A;  3KCS A;  3CLN A;  1FI6 A;  3FE9 A;  1KK7 Y;  4ZCV A;  4GAO A;  1M39 A;  2QLI A;  1CFC A;  2DUH A;  3BXA A;  2KOT A;  4W6M A;  2EC6 B;  1WLZ A;  2BAP A;  1FW4 A;  2OPO A;  2QEO A;  3I5G B;  3PJ7 A;  5EB7 A;  3SVB A;  3OP0 A;  1WY9 A;  3GK1 A;  3SRY A;  1ZGO A;  2QLG B;  1SW8 A;  1BLQ A;  2YGU A;  4GGF A;  2M9G A;  2WCE A;  1EMM A;  2DD9 A;  3OGO A;  2BCB A;  3V3D A;  2Z1O A;  2OKW A;  1YUR A;  3NSI A;  5LTP A;  2DUI A;  2VVH A;  4JWQ A;  2LVK A;  2G6E A;  5DPH A;  5HLO A;  3E3R A;  1DC1 A;  4U2V A;  1SL7 A;  4W6U A;  1QVI Y;  2KQY A;  1IGV A;  2ZFD A;  2V53 A;  4OHS A;  1F54 A;  3CZ1 A;  1OZS A;  1DF0 A;  2JT3 A;  4KW9 A;  4W72 A;  4DXM A;  3SV5 A;  3L47 A;  3E5T A;  1CFD A;  5HKZ A;  4ZF5 A;  1RRX A;  4EN1 A;  3HCM A;  3SVC A;  5KTG A;  3JTD B;  1G8I A;  3O2P A;  2G3D B;  3PN7 C;  4W6N A;  4I5N B;  2HGD A;  1BR4 B;  5DPG A;  5KU1 A;  3LF4 B;  2G16 B;  3BFA A;  3DF0 B;  3M0W A;  2WHS A;  3DQL A;  2CNP A;  5EXB A;  1NP8 A;  3PM8 A;  1S5G Z;  4LJC A;  2ARL A;  1KFU S;  1SK6 D;  1Q73 A;  4ORA B;  1F55 A;  1TNW A;  2LAP A;  2VRG A;  1EMF A;  2M3W A;  2A50 B;  2TN4 A;  5ER4 X;  1KFU L;  2OS8 B;  1DEL A;  3AKB A;  1Q4A A;  2VVJ A;  5FI6 A;  3ST2 A;  2M1K B;  3SIB A;  2HF5 A;  5HBD A;  3NSO A;  2H5O A;  3OX6 A;  1CDP A;  5H88 A;  4KGF A;  4B30 B;  3VRQ A;  1IG5 A;  2F3Y A;  1OQP A;  4F0Z B;  3ED8 A;  1KQV A;  3DQK A;  1YHG A;  3K1E A;  1IH0 A;  4N5X A;  1ORG A;  3EVU A;  1ZAC A;  2KI4 B;  3E5V A;  1ZFS A;  5BQL A;  3SIA A;  2LCP A;  4I5K A;  2Z6X A;  4L9M A;  3CD1 A;  2JZI A;  1QYO A;  2KI6 D;  2YFP A;  1OMR A;  1SR6 B;  4JF9 A;  1JBY A;  1A75 A;  3CB9 A;  2LLT A;  1G4Y R;  5FI2 A;  1C3Z A;  3JVT B;  3D73 A;  3GL4 A;  5DQB A;  3KHE A;  5DRG A;  4MEW A;  2L2E A;  5EHU A;  2JT0 A;  5PAL A;  4ZIN A;  4J89 A;  2BL0 B;  3CR2 A;  4HSZ A;  5FVI A;  1XK4 C;  1BJF A;  1AVS A;  1XFV O;  1AP4 A;  4MRY A;  1YUS A;  2K0J A;  2HQ8 A;  1DGV A;  2Q91 A;  3FE6 A;  1K9K A;  2Q6P A;  4W7A A;  1QIV A;  1OSA A;  2WC6 A;  1GGW A;  2V4E B;  3EVV A;  4W69 A;  2KQ6 A;  2FOT A;  3I5H B;  1NX0 A;  4Q7T A;  4YGC B;  3DVJ A;  4PDZ A;  2MBX A;  4W6G A;  1MF8 B;  2P4M A;  3P8U A;  3CFA A;  2ZN9 A;  1TUZ A;  1R2U A;  1PUL A;  5D3O A;  3TMT A;  3Q8I A;  4PHM A;  3AKO A;  4R6D A;  1RJV A;  3SVE A;  1WRZ A;  1J7O A;  1LVC D;  1KCY A;  1K93 D;  4KA9 A;  3DQ6 A;  4PPJ A;  2K60 A;  4ETO A;  3A8S A;  4W6I A;  1X02 A;  1DT7 B;  3U0K A;  2PAL A;  1EMB A;  5FHV A;  4W77 A;  3FIA A;  3TDI A;  3W1D A;  1J1D A;  1IKU A;  1P28 A;  3VRO A;  4R1E A;  2JXL A;  3I5F B;  4TZA A;  1SSE B;  1TNX A;  3VRN A;  3TZ1 A;  1K94 A;  1TRF A;  4DIR A;  5DTZ A;  4PE4 A;  1PRW A;  2BKI B;  2WCF A;  4GPL B;  2KPH A;  3O78 A;  1S5G Y;  5AEQ A;  1MR8 A;  3BOW A;  4OZD A;  5CSN A;  4W6J A;  1TCO B;  4DXQ A;  4XYN A;  3U8A A;  1KP5 A;  4W7F A;  1YHH A;  1OW4 A;  1DF0 B;  2FWQ A;  4W7X A;  4KW4 A;  3N7H A;  3S05 A;  2HPS A;  2KAX A;  4QJ5 B;  1UWO A;  1BG1 A;  2BBN A;  3BJH A;  4YBH B;  4AR7 A;  3M22 A;  1OOH A;  1DJX A;  5CSF A;  2A53 B;  3DD4 A;  2O24 A;  2RH7 A;  2IS9 A;  2AWM A;  1C7V A;  3WHU B;  1DJG A;  3SSK A;  5HKW A;  1YX7 A;  5AFP A;  4W7C A;  1UHH A;  1K9U A;  1CTR A;  1SL8 A;  5DRF A;  1NCX A;  4W6D A;  5EB6 A;  1B8R A;  3WNX B;  1SRA A;  3GK4 X;  1LS8 A;  1MXE A;  4Q7U A;  1QX2 A;  4GUK A;  2H6V A;  3VRP A;  1JC2 A;  1OMV A;  2HET A;  2ZO6 A;  2MHH A;  2DDD A;  3NSL A;  4KPI A;  2K7D A;  3U0M A;  3QME A;  3SSH A;  1PVA A;  2WCL A;  1XA9 A;  5DQM A;  2KI6 C;  3PFV A;  3CAB A;  4GF6 B;  1AJ4 A;  3NEZ A;  4W7D A;  1A03 A;  1NX3 A;  4KW8 A;  1MHO A;  1UUR A;  1QTX A;  2GX2 A;  1RFJ A;  1PAL A;  2JC2 A;  2BNX A;  2WSN A;  3RWT A;  1NUB A;  1XFY O;  1TNQ A;  1MUX A;  1OXE A;  2QZ0 A;  3DQN A;  1CV7 A;  1A75 B;  4ZFS A;  1MQ1 A;  1KWO B;  3UFZ A;  3VB1 A;  2AAO A;  1Y1U A;  4KGE A;  2KSP A;  2L4H A;  1YJF A;  1DJW A;  2JXC A;  1L7Z A;  1WLM A;  1CDN A;  2LLS A;  2KHN A;  1Y6W A;  4CID A;  3DQM A;  4ICB A;  4W7R A;  1FBV A;  3ST0 A;  1DTL A;  3BUM B;  3NF0 A;  2FJU B;  1G7K A;  3KF9 A;  3SG7 A;  2KFH A;  4MSP A;  4M2O A;  4PT1 A;  3PJ5 A;  1S36 A;  3CZ2 A;  5I94 A;  2CBL A;  4JQ0 D;  3SS0 A;  1EML A;  2LHI A;  1J55 A;  3BUX B;  1S6C A;  1U5I A;  4QJ4 B;  4FQO A;  4PHJ A;  5TNC A;  2K7B A;  3O77 A;  1KK8 C;  4OKH A;  2HPW A;  2DUF A;  2EMO A;  5KTY A;  4JD9 A;  2PVB A;  4M2P A;  1MXL C;  5HGE A;  4MZK A;  1A2X A;  3CGA A;  3SSY A;  1HQV A;  5AXI A;  5LK4 A;  3LF3 A;  4JGE A;  3RM1 A;  2Y0G A;  3TMR A;  1W9Z A;  2POX A;  2LHL A;  4INX A;  3ZNI A;  3TS5 B;  1JC0 A;  4H3M A;  1RWY A;  1LA3 A;  3PLF B;  1BR1 B;  2PQL A;  1W7S A;  4MVF A;  4W75 A;  1EH2 A;  2H5P A;  1F4Q A;  1JF2 A;  5EBJ A;  1GGX A;  1TOP A;  4HRG A;  1YX8 A;  1QLS A;  3OX5 A;  3LCP C;  3D76 A;  4ZCU A;  5DTX A;  1Q80 A;  2CXJ A;  1CKK A;  1XFW O;  2PMY A;  4J88 A;  1J7R A;  2LNK A;  2L2C A;  4ORB B;  5K89 A;  3GOF A;  4JEO A;  5FYX A;  1CFF A;  4EUL A;  1C4F A;  2WCM A;  1EMG A;  3SG4 A;  2GX0 A;  2SAS A;  1ZMZ A;  4OY4 A;  4M2Q A;  3CFF A;  1L2O C;  4TNC A;  2KFG A;  2L98 A;  1F0B A;  4WQ3 A;  1ZGQ A;  1YUU A;  4L13 A;  1AUI B;  2HRS A;  1N65 A;  5DIC A;  1Z2C B;  2H8Q A;  2K2A A;  2LUC A;  4GES B;  1B4C A;  1QAS A;  5DPI A;  4LJD C;  1Q4E A;  1EG4 A;  2QDI A;  5HZO A;  4CLN A;  4GOB A;  4AQI A;  3DQU A;  3R1O A;  1YVH A;  2PRU A;  4PHK A;  2KGR A;  1YR5 A;  3IR8 A;  2FJY A;  1LXF C;  3DYE A;  2E6W A;  1CLM A;  4PPL A;  2Y4Q A;  3WXA A;  1SBJ A;  1BT6 A;  2O2B A;  2ICR A;  3DQ7 A;  2IB6 A;  1DMO A;  3B6X A;  3DXL A;  2WOS A;  4OR9 B;  1BFP A;  4C0J A;  2GW4 B;  2GV5 A;  2JTT A;  3NHI A;  1BOD A;  3SSL A;  4MN0 A;  2Z6Z A;  2DUG A;  3EVR A;  3DQH A;  1GQM A;  3L4A A;  2ZN8 A;  2ZKM X;  4IK5 A;  3OBV A;  1MWN A;  4P76 A;  1CM4 A;  4W74 A;  1GGZ A;  2JNX A;  1PVB A;  1K8U A;  4W6B A;  3VK1 A;  1W7J B;  1NSH A;  5DU0 A;  3LA1 A;  4DS7 A;  2KLD A;  4W6P A;  4ZF3 A;  4CFQ A;  1QXT A;  4Q9W A;  5T3I A;  2K8M B;  3TDU A;  4RYS A;  3AAK A;  2BKH B;  4W6L A;  1HT9 A;  3EKJ A;  5ER5 A;  3KCT A;  1YRU B;  1A29 A;  2WIQ A;  2YE0 A;  2BTJ A;  2KAY A;  1CM1 A;  1DJH A;  2ZRS A;  2HQK A;  3CBE A;  2KGB C;  1YZW A;  5HW9 A;  2I7A A;  3DQ9 A;  3CZ0 A;  4HVF A;  2AWK A;  3R72 A;  4DKN A;  3VHT A;  2PYQ A;  2A56 B;  3LL8 B;  3SVN A;  3PAT A;  3UNW A;  1JBZ A;  3AI5 A;  2WUR A;  3D10 A;  3UO9 A;  1H6R A;  1WDC B;  1S6Z A;  3O4Y A;  3OB2 B;  4MZJ A;  3TUY C;  3LVA A;  2D8N A;  4I5J A;  4PCW A;  1REC A;  1CLL A;  1ZOT B;  2SCP A;  3WLC A;  1K90 D;  3LVD A;  2I18 A;  1Q4B A;  3NT9 A;  2QEV A;  4XOW A;  5AER A;  1IIO A;  2IB5 A;  4OQW A;  3CD9 A;  1M46 A;  5HLV A;  2HGY A;  4F7F A;  2WC8 A;  2FCE A;  3W1C A;  4GBA A;  4W6S A;  4JKT A;  3I5I B;  1JF0 A;  3AKA A;  2EC6 C;  3ZTF A;  4XOV A;  4JPZ B;  3I5G C;  4ORN A;  1XK4 A;  1CNP A;  1NCZ A;  1KYP A;  4Q04 A;  1TWO A;  1EJ3 A;  1ZUX A;  3AAJ A;  1KQM B;  1OE9 B;  2Y5I A;  3NXA A;  1FPW A;  4XVP A;  1ALW A;  2KYF A;  3EKH A;  3CWG A;  3FE8 A;  3ZWH A;  2P6B B;  4EDS A;  2JTZ A;  3DPZ A;  1DEK A;  2DOQ A;  3DQO A;  1RK9 A;  2EMD A;  1LA0 A;  5DTL A;  5JOL A;  4KAG A;  4GGN A;  1LIN A;  1EG3 A;  3SVO A;  3ST3 A;  1QX7 A;  3OHM B;  5HZT A;  5JJG A;  3BX9 A;  1H8B A;  2K61 A;  1XA5 A;  2WCK A;  3DQ3 A;  3BYA A;  1BU3 A;  1TNP A;  2JRF A;  1OXD A;  2O29 A;  1W7T A;  4P5O E;  3BUO B;  2COL B;  2OKY A;  3U8C A;  1S26 D;  4W6K A;  2G6Y A;  1JFK A;  3JTD C;  1OXF A;  4HQC A;  4DXN A;  5J3X A;  1CFP A;  1M45 A;  3IQO A;  3IVT A;  5LTQ A;  3DQ4 A;  4USL A;  2HQZ A;  2ZRT A;  2H2K A;  2VVI A;  3GB3 A;  3DY9 A;  1IQ3 A;  4GNK B;  3DQJ A;  1MOV A;  3RZS A;  4H3N A;  5EJU A;  2F2O A;  1QS7 A;  1IJ5 A;  2G6X A;  3SS3 A;  3CR5 X;  1L2O B;  4W7E A;  1T14 A;  1B7T Z;  4U8D A;  3KPX A;  1QV0 A;  2L5Y A;  2GGZ A;  2PXW A;  2LMT A;  5LTR A;  2C9I A;  2H61 C;  1SL9 A;  3DVM A;  4OCI A;  2BCX A;  5FVF A;  2A54 B;  2LMU A;  4KF5 C;  2WSO A;  2KI4 C;  1PSR A;  2LP3 A;  1UHN A;  2PSR A;  2RGI A;  5G08 A;  3DPX A;  3DQE A;  5I2L A;  1MOU A;  2A47 A;  5EXU A;  1HCJ A;  4KEX A;  3DQ5 A;  3BUW B;  3PN7 B;  1RMO A;  2F3Z A;  2WCH A;  3CFH A;  4LJB A;  1Z1Q A;  5CPV A;  3OB1 B;  1SCM C;  1B1G A;  1J7Q A;  4JRB A;  3SG6 A;  1F71 A;  1XYD A;  3A8R A;  3ADF A;  1K96 A;  4FQT A;  1K95 A;  3G9A A;  4PE0 A;  2EHB A;  4H47 A;  4P1Q A;  2BL0 C;  2QU1 A;  4IK4 A;  3S0B A;  3AI4 A;  4Z4M A;  3DQF A;  4LW5 A;  3IP2 A;  3D75 A;  1YFP A;  5BTT A;  4W6T A;  2B3P A;  2LC5 A;  4IJ7 A;  1JWD A;  3VRR A;  3CTN A;  4ZF4 A;  3VHT B;  1BMO A;  2NZ0 A;  1KSM A;  2P71 A;  2F2P A;  3EG5 B;  2GW3 A;  4KF5 A;  1TCF A;  3SG5 A;  3I5H C;  2G9B A;  2IE2 A;  2OGR A;  1AK8 A;  1KYS A;  1KYR A;  2A46 A;  3BXC A;  1YRT B;  3SSV A;  1NCY A;  2K2F A;  4YGD B;  2VZX A;  1MYW A;  1XQM A;  1SCV A;  1DJZ A;  3LVC A;  4L12 A;  2JAD A;  5DTY A;  2OTG C;  4XJK A;  3DQ1 A;  3S0A A;  3CDN A;  5CSI A; 
#chains in the Genus database with same CATH homology
 1RMP A;  5GQQ C;  3C1V A;  4PE7 A;  5DY6 A;  3VIC A;  2DD7 A;  2AH8 A;  2M97 A;  2MRD A;  1B9A A;  4QJ3 B;  1R6P A;  1QJT A;  2R2I A;  2M29 A;  3BXB A;  4C0L A;  1IWQ A;  3I5F C;  3BXK A;  4LQT A;  2JUL A;  2ZNE A;  2G2S B;  4W6F A;  2VAD A;  1DJI A;  4H3L A;  4P2Y B;  3EVP A;  1YJ2 A;  5DKR A;  1KFX S;  3K1K A;  2I2R E;  2NCP A;  4W76 A;  3I19 A;  1IJ6 A;  2JQ6 A;  1RRO A;  2H9W A;  4NQG A;  1KFX L;  5I8N A;  2LAN A;  2LE9 B;  1CDM A;  1XFX O;  2L0P A;  2LV7 A;  3U0N A;  3BOW B;  4JFG A;  1B7T Y;  3SVS A;  4CPV A;  3DPW A;  1UHJ A;  4I2Y A;  4DUQ A;  5KSZ A;  5CSJ A;  2BE4 A;  1C7W A;  1K9P A;  3EK8 A;  4IK1 A;  5HYD A;  4XL5 A;  4ZB1 A;  1UIS A;  4IL1 A;  3MSE B;  2GGM A;  2F8P A;  4IK9 A;  1CMG A;  1Y0V H;  2IOV A;  4YGE B;  1CLB A;  2L4I A;  1C07 A;  1UP5 A;  2OJK A;  2M0R A;  4DXI A;  1WRK A;  4YI9 A;  1UHI A;  2O5G A;  3RLZ A;  2Q4U A;  3H1R A;  2AWJ A;  1J1E A;  2LM5 A;  3DQ8 A;  3SVR A;  3CR4 X;  4DRW A;  1VRK A;  2QAC A;  1F70 A;  2AHA A;  1SYM A;  4YGB B;  4W73 A;  4MZL A;  2LMV A;  5H89 A;  3E5W A;  3GJ2 A;  1JFJ A;  5H87 A;  2LLU A;  5AAN A;  3OSR A;  1DJY A;  2B3Q A;  4Z4K A;  4HQ8 A;  1H4U A;  3SST A;  5F6T A;  3MGF A;  4PAL A;  4EMQ A;  2JU0 A;  3DQA A;  1EL4 A;  1XO5 A;  3TDZ A;  4LJD A;  1NX2 A;  2ZND A;  2LVI A;  4JC2 A;  1OMD A;  1KWO C;  2MLE C;  2ZMU A;  1CDL A;  3D0Y A;  4DXO A;  4ZIO A;  2VAE A;  3DQC A;  3CS1 A;  4OJ0 A;  1KSO A;  1NX1 A;  1LKJ A;  3IQQ A;  2HCG A;  5BTT B;  1OZO A;  2KDH A;  2G5Z B;  4J8A A;  3O6B A;  4YI8 A;  5B8I B;  2FZU A;  3A4U B;  3GK2 A;  1XAE A;  2AWL A;  3NSK A;  2A52 B;  1SMG A;  4I5L B;  5FVG A;  3DQI A;  1IRJ A;  2LVJ A;  3SG2 A;  5I2Q A;  3ZUJ A;  2MAZ A;  3PSR A;  4B5Y A;  2E30 A;  2WOR A;  3DVE A;  2H5R A;  1F8H A;  4W6O A;  2LP2 A;  2A48 A;  2WCB A;  1XSS A;  2L50 A;  2K7C A;  1SPY A;  1SCM B;  1F09 A;  1U5I B;  3ST4 A;  1S6J A;  1XFU O;  2BBM A;  3WHT B;  1N0Y A;  2EMN A;  1UUS A;  4W6C A;  2PXS A;  2JT8 A;  4XJK B;  1K2H A;  4WQ2 A;  3TS5 C;  5HZU A;  3LK1 A;  2B1U A;  1E8A A;  4ZBL A;  2M7L A;  3GEX A;  3SG3 A;  3WLD A;  2NCO A;  4D1E A;  1W7U A;  2L5X B;  1QIW A;  2AUC A;  1S3P A;  2BEC A;  1B47 A;  2G2B A;  4EDO A;  4DXP A;  4A4C A;  2I94 A;  3BQ3 A;  1CMF A;  1G33 A;  3P28 A;  4PE1 A;  3CZT X;  1RM9 A;  1XVJ A;  1D1O A;  4WRI A;  1RMM A;  1NIW A;  3FWC A;  2KAV A;  3M24 A;  2WND A;  4DCK A;  1XMZ A;  2YDZ A;  2BCA A;  3LLE A;  1S6I A;  5IBW A;  2FL1 A;  2MJW B;  4MLW A;  3LSA A;  4Q9X A;  1DVI A;  1ALV A;  2K7O A;  4N1F A;  4N3D A;  1A4P A;  2YE1 A;  2PAS A;  1KK8 B;  1NPQ A;  4DKM A;  2OTG B;  4KF4 A;  1NWD A;  4RYW A;  4R6B A;  3LS3 A;  2WHT A;  4BY5 A;  5DKQ A;  2O60 A;  2DDC A;  2A4J A;  2MLF C;  1UHK A;  3EK4 A;  2KBM A;  1QLK A;  1V1F A;  1B9C A;  4AS8 A;  1EXR A;  4W6A A;  3SVD A;  4IK3 A;  1ZUZ A;  2FCD A;  4NDD A;  1PK0 D;  1BF5 A;  1Z1P A;  3CGL A;  3KEV A;  4ORC B;  4A4B A;  3NED A;  4OGS A;  1QV1 A;  2QLG A;  2OTE A;  2M8U A;  1XFZ O;  3FS7 A;  1Y1A A;  2ZMW A;  1JSA A;  4BY4 A;  2HQW A;  1BOC A;  1W7I B;  4GFT A;  1S1E A;  1KK7 Z;  5EXC I;  1AHR A;  1M31 A;  2CT9 A;  1TN4 A;  4H48 A;  5F9G A;  1QX5 B;  1TTX A;  3HX4 A;  3PJB A;  4RTC A;  5DPJ A;  3SSP A;  4XGY A;  2OS8 C;  1GJY A;  2WIS A;  2HFC A;  2M7N A;  2Q57 A;  4TZG A;  1Q4D A;  4FTG A;  5BPJ A;  1JBA A;  4IZN A;  3SVU A;  1SY9 A;  4MRX A;  3EK7 A;  2C9J A;  1YVL A;  5AQB B;  3ZUL A;  1B8C A;  1TIZ A;  3QRX A;  3RWA A;  5HZS A;  4NDC A;  2Y1M A;  3LK0 A;  3DF0 A;  1YTZ C;  2QT2 A;  4HRE E;  3D0Y B;  4UPG A;  2LVV A;  1YHI A;  2H5Q A;  1GL4 A;  2EGD A;  4PHN A;  3SJS A;  5HKY A;  2Z6Y A;  1SR6 C;  2KYC A;  1QY3 A;  3WCK A;  1QYQ A;  2ISD A;  1QVI Z;  3JVT C;  2KNE A;  1EMC A;  2QLH A;  1ODB A;  1EME A;  2L51 A;  4PFE A;  2QLE A;  2WHU A;  4YRU A;  1J7P A;  1IQ5 A;  3H1O A;  1AJ5 A;  1CB1 A;  1WDC C;  1N2D A;  2H61 A;  1YUT A;  4Q7R A;  1RTP 1;  2JNF A;  2HJO A;  1EMA A;  4B30 A;  2M49 B;  3BUN B;  3IF7 A;  2V4E C;  1JC1 A;  1NYA A;  1QXP A;  2KBI A;  2AMI A;  1FF1 A;  1SKT A;  4OVN F;  3U0L A;  1V1G A;  2JPT A;  2F33 A;  3ZUF A;  4HQ9 A;  2OTB A;  3PIB A;  4CFR A;  3VGO A;  4L1I A;  3U8P A;  2NXQ A;  2CCM A;  3FWB A;  3PAL A;  3GJ1 A;  4C0K A;  1HUY A;  3DVK A;  4LQU A;  5D7F A;  5D69 A;  4MBE A;  1B8L A;  1QYF A;  2M1U A;  1SNL A;  4IK8 A;  3I5I C;  4HRH A;  2DUE A;  1F4O A;  3UG0 A;  2KFF A;  4HE4 A;  1M63 B;  4NWS A;  2QRF A;  3KO0 A;  2JWW A;  2ZO7 A;  3H4S E;  3DQ2 A;  2Y1N A;  1KQM C;  4UTS A;  4W6H A;  1QAT A;  2V4E A;  5BT0 A;  4E68 A;  4YGA A;  1DGU A;  4W6R A;  4AOM A;  1FI5 A;  2LUX A;  2G3O A;  3TUY B;  1WRL A;  3DQD A;  1PSB A;  3K21 A;  4N1G A;  4BDU A;  4GGF C;  3NT3 A;  3ICB A;  1OOJ A;  2QPT A;  5DKN A;  2JOJ A;  1ZGP A;  2NLN A;  3OSQ A;  4ANJ A;  3F45 A;  1EMK A;  4AQJ A;  1H4B A;  1Q4C A;  4NDB A;  5I2O A;  4PPK A;  2BE6 A;  4OV2 A;  5J2O A;  1JUO A;  1Y1X A;  2CTN A;  2MA2 A;  1GFL A;  3KCS A;  3CLN A;  1FI6 A;  1KK7 Y;  4ZCV A;  4GAO A;  1M39 A;  2QLI A;  1CFC A;  2DUH A;  3BXA A;  2KOT A;  4W6M A;  2EC6 B;  1WLZ A;  1FW4 A;  2OPO A;  3I5G B;  3PJ7 A;  5EB7 A;  3SVB A;  3OP0 A;  1WY9 A;  3GK1 A;  3SRY A;  1ZGO A;  2QLG B;  1SW8 A;  1BLQ A;  4GGF A;  2M9G A;  2WCE A;  1EMM A;  2DD9 A;  3OGO A;  2BCB A;  3V3D A;  2Z1O A;  2OKW A;  1YUR A;  3NSI A;  5LTP A;  2DUI A;  2VVH A;  4JWQ A;  2LVK A;  2G6E A;  5DPH A;  5HLO A;  3E3R A;  4U2V A;  1SL7 A;  4W6U A;  1QVI Y;  2KQY A;  1IGV A;  2ZFD A;  2V53 A;  4OHS A;  1F54 A;  1OZS A;  1DF0 A;  2JT3 A;  4KW9 A;  4W72 A;  4DXM A;  3SV5 A;  3E5T A;  1CFD A;  5HKZ A;  4ZF5 A;  1RRX A;  4EN1 A;  3HCM A;  3SVC A;  5KTG A;  3JTD B;  1G8I A;  3O2P A;  2G3D B;  3PN7 C;  4W6N A;  4I5N B;  2HGD A;  1BR4 B;  5DPG A;  5KU1 A;  3LF4 B;  2G16 B;  3M0W A;  3DF0 B;  2WHS A;  3DQL A;  2CNP A;  5EXB A;  1NP8 A;  3PM8 A;  1S5G Z;  4LJC A;  2ARL A;  1KFU S;  1SK6 D;  1Q73 A;  4ORA B;  1F55 A;  1TNW A;  2LAP A;  2VRG A;  1EMF A;  2M3W A;  2A50 B;  2TN4 A;  5ER4 X;  1KFU L;  2OS8 B;  3AKB A;  1Q4A A;  2VVJ A;  3ST2 A;  2M1K B;  3SIB A;  2HF5 A;  5HBD A;  3NSO A;  2H5O A;  3OX6 A;  1CDP A;  5H88 A;  4KGF A;  4B30 B;  1IG5 A;  3VRQ A;  2F3Y A;  1OQP A;  4F0Z B;  3ED8 A;  1KQV A;  3DQK A;  1YHG A;  1IH0 A;  4N5X A;  3EVU A;  1ZAC A;  2KI4 B;  3E5V A;  1ZFS A;  5BQL A;  3SIA A;  2LCP A;  4I5K A;  2Z6X A;  4L9M A;  3CD1 A;  2JZI A;  1QYO A;  2KI6 D;  2YFP A;  1OMR A;  1SR6 B;  4JF9 A;  1JBY A;  1A75 A;  3CB9 A;  2LLT A;  1G4Y R;  3JVT B;  3GL4 A;  5DQB A;  3KHE A;  5DRG A;  4MEW A;  2L2E A;  5EHU A;  2JT0 A;  5PAL A;  4ZIN A;  4J89 A;  2BL0 B;  3CR2 A;  4HSZ A;  5FVI A;  1XK4 C;  1BJF A;  1AVS A;  1XFV O;  1AP4 A;  4MRY A;  1YUS A;  2K0J A;  2HQ8 A;  1DGV A;  2Q91 A;  1K9K A;  2Q6P A;  4W7A A;  1QIV A;  1OSA A;  1GGW A;  2V4E B;  3EVV A;  4W69 A;  2KQ6 A;  2FOT A;  3I5H B;  1NX0 A;  4Q7T A;  4YGC B;  3DVJ A;  4PDZ A;  2MBX A;  4W6G A;  1MF8 B;  2P4M A;  3P8U A;  3CFA A;  2ZN9 A;  1R2U A;  1PUL A;  3TMT A;  4PHM A;  3AKO A;  4R6D A;  1RJV A;  3SVE A;  1WRZ A;  1J7O A;  1LVC D;  1KCY A;  1K93 D;  4KA9 A;  3DQ6 A;  4PPJ A;  4ETO A;  3A8S A;  4W6I A;  1X02 A;  1DT7 B;  3U0K A;  2PAL A;  1EMB A;  5FHV A;  4W77 A;  3FIA A;  3TDI A;  3W1D A;  1J1D A;  1IKU A;  3VRO A;  4R1E A;  2JXL A;  3I5F B;  4TZA A;  1TNX A;  3VRN A;  3TZ1 A;  1K94 A;  1TRF A;  4DIR A;  5DTZ A;  4PE4 A;  1PRW A;  2BKI B;  2WCF A;  4GPL B;  3O78 A;  1S5G Y;  5AEQ A;  1MR8 A;  3BOW A;  5CSN A;  4W6J A;  1TCO B;  4DXQ A;  4XYN A;  3U8A A;  1KP5 A;  4W7F A;  1YHH A;  1DF0 B;  2FWQ A;  4W7X A;  4KW4 A;  3S05 A;  2HPS A;  2KAX A;  4QJ5 B;  1UWO A;  2BBN A;  1BG1 A;  4YBH B;  4AR7 A;  3M22 A;  1DJX A;  5CSF A;  2A53 B;  3DD4 A;  2O24 A;  2RH7 A;  2IS9 A;  2AWM A;  1C7V A;  3WHU B;  1DJG A;  3SSK A;  5HKW A;  1YX7 A;  5AFP A;  4W7C A;  1UHH A;  1K9U A;  1CTR A;  1SL8 A;  5DRF A;  1NCX A;  4W6D A;  5EB6 A;  1B8R A;  3WNX B;  1SRA A;  3GK4 X;  1MXE A;  4Q7U A;  1QX2 A;  4GUK A;  2H6V A;  3VRP A;  1JC2 A;  1OMV A;  2HET A;  2ZO6 A;  2MHH A;  2DDD A;  3NSL A;  4KPI A;  2K7D A;  3U0M A;  3SSH A;  1PVA A;  1XA9 A;  5DQM A;  2KI6 C;  3PFV A;  4GF6 B;  1AJ4 A;  3NEZ A;  4W7D A;  1A03 A;  1NX3 A;  4KW8 A;  1MHO A;  1UUR A;  1QTX A;  2GX2 A;  1RFJ A;  1PAL A;  2JC2 A;  2WSN A;  3RWT A;  1NUB A;  1XFY O;  1TNQ A;  1MUX A;  1OXE A;  2QZ0 A;  3DQN A;  1CV7 A;  1A75 B;  4ZFS A;  1MQ1 A;  1KWO B;  3UFZ A;  2AAO A;  1Y1U A;  4KGE A;  2KSP A;  2L4H A;  1YJF A;  1DJW A;  2JXC A;  1L7Z A;  1WLM A;  1CDN A;  2LLS A;  2KHN A;  1Y6W A;  4CID A;  3DQM A;  4ICB A;  4W7R A;  1FBV A;  3ST0 A;  1DTL A;  3BUM B;  3NF0 A;  2FJU B;  1G7K A;  3KF9 A;  3SG7 A;  2KFH A;  4MSP A;  4M2O A;  3PJ5 A;  1S36 A;  2CBL A;  4JQ0 D;  3SS0 A;  1EML A;  2LHI A;  1J55 A;  3BUX B;  1S6C A;  1U5I A;  4QJ4 B;  4FQO A;  4PHJ A;  5TNC A;  2K7B A;  3O77 A;  1KK8 C;  4OKH A;  2HPW A;  2DUF A;  2EMO A;  5KTY A;  2PVB A;  4M2P A;  1MXL C;  5HGE A;  4MZK A;  1A2X A;  3CGA A;  3SSY A;  1HQV A;  5AXI A;  5LK4 A;  3LF3 A;  4JGE A;  3RM1 A;  2Y0G A;  3TMR A;  2POX A;  2LHL A;  3ZNI A;  3TS5 B;  1JC0 A;  4H3M A;  1RWY A;  1LA3 A;  3PLF B;  1BR1 B;  1W7S A;  4MVF A;  4W75 A;  1EH2 A;  2H5P A;  1F4Q A;  1JF2 A;  5EBJ A;  1GGX A;  1TOP A;  4HRG A;  1YX8 A;  1QLS A;  3OX5 A;  3LCP C;  4ZCU A;  5DTX A;  1Q80 A;  2CXJ A;  1CKK A;  1XFW O;  2PMY A;  4J88 A;  1J7R A;  2LNK A;  4ORB B;  5K89 A;  3GOF A;  4JEO A;  5FYX A;  1CFF A;  4EUL A;  1C4F A;  1EMG A;  3SG4 A;  2GX0 A;  2SAS A;  1ZMZ A;  4OY4 A;  4M2Q A;  3CFF A;  1L2O C;  4TNC A;  2KFG A;  2L98 A;  1F0B A;  4WQ3 A;  1ZGQ A;  1YUU A;  4L13 A;  1AUI B;  2HRS A;  1N65 A;  2H8Q A;  2K2A A;  2LUC A;  4GES B;  1B4C A;  1QAS A;  5DPI A;  4LJD C;  1Q4E A;  1EG4 A;  5HZO A;  4CLN A;  4GOB A;  4AQI A;  3DQU A;  1YVH A;  2PRU A;  4PHK A;  2KGR A;  1YR5 A;  3IR8 A;  1LXF C;  2E6W A;  1CLM A;  4PPL A;  2Y4Q A;  3WXA A;  1SBJ A;  1BT6 A;  2O2B A;  2ICR A;  3DQ7 A;  2IB6 A;  1DMO A;  2WOS A;  4OR9 B;  1BFP A;  4C0J A;  2GW4 B;  2GV5 A;  2JTT A;  1BOD A;  3SSL A;  4MN0 A;  2Z6Z A;  2DUG A;  3EVR A;  3DQH A;  1GQM A;  2ZN8 A;  2ZKM X;  4IK5 A;  1MWN A;  4P76 A;  1CM4 A;  4W74 A;  1GGZ A;  2JNX A;  1PVB A;  1K8U A;  4W6B A;  3VK1 A;  1W7J B;  1NSH A;  5DU0 A;  3LA1 A;  4DS7 A;  4W6P A;  4ZF3 A;  4CFQ A;  1QXT A;  4Q9W A;  5T3I A;  2K8M B;  3TDU A;  4RYS A;  3AAK A;  2BKH B;  4W6L A;  1HT9 A;  3EKJ A;  5ER5 A;  3KCT A;  1YRU B;  1A29 A;  2WIQ A;  2YE0 A;  2BTJ A;  2KAY A;  1CM1 A;  1DJH A;  2ZRS A;  2HQK A;  3CBE A;  2KGB C;  1YZW A;  5HW9 A;  2I7A A;  3DQ9 A;  4HVF A;  2AWK A;  4DKN A;  3VHT A;  2A56 B;  3LL8 B;  3SVN A;  3PAT A;  1JBZ A;  3AI5 A;  2WUR A;  3D10 A;  1H6R A;  1WDC B;  1S6Z A;  3O4Y A;  3OB2 B;  4MZJ A;  3TUY C;  3LVA A;  2D8N A;  4I5J A;  4PCW A;  1REC A;  1CLL A;  1ZOT B;  2SCP A;  3WLC A;  1K90 D;  3LVD A;  2I18 A;  1Q4B A;  3NT9 A;  4XOW A;  5AER A;  2IB5 A;  4OQW A;  3CD9 A;  1M46 A;  5HLV A;  2HGY A;  2WC8 A;  2FCE A;  3W1C A;  4GBA A;  4W6S A;  3I5I B;  1JF0 A;  3AKA A;  2EC6 C;  3ZTF A;  4XOV A;  4JPZ B;  3I5G C;  4ORN A;  1XK4 A;  1CNP A;  1NCZ A;  1KYP A;  4Q04 A;  1EJ3 A;  1ZUX A;  3AAJ A;  1KQM B;  1OE9 B;  2Y5I A;  3NXA A;  1FPW A;  4XVP A;  1ALW A;  2KYF A;  3EKH A;  3CWG A;  3ZWH A;  2P6B B;  4EDS A;  2JTZ A;  3DPZ A;  2DOQ A;  3DQO A;  1RK9 A;  2EMD A;  1LA0 A;  5DTL A;  5JOL A;  4KAG A;  4GGN A;  1LIN A;  1EG3 A;  3SVO A;  3ST3 A;  1QX7 A;  3OHM B;  5HZT A;  5JJG A;  3BX9 A;  1H8B A;  2K61 A;  1XA5 A;  3DQ3 A;  3BYA A;  1BU3 A;  1TNP A;  2JRF A;  1OXD A;  2O29 A;  1W7T A;  4P5O E;  3BUO B;  2COL B;  2OKY A;  3U8C A;  1S26 D;  4W6K A;  2G6Y A;  1JFK A;  3JTD C;  1OXF A;  4HQC A;  4DXN A;  5J3X A;  1CFP A;  1M45 A;  3IQO A;  5LTQ A;  3DQ4 A;  4USL A;  2HQZ A;  2ZRT A;  2H2K A;  2VVI A;  3GB3 A;  1IQ3 A;  4GNK B;  3DQJ A;  1MOV A;  4H3N A;  5EJU A;  2F2O A;  1QS7 A;  1IJ5 A;  2G6X A;  3CR5 X;  1L2O B;  4W7E A;  1B7T Z;  4U8D A;  3KPX A;  1QV0 A;  2GGZ A;  2PXW A;  2LMT A;  5LTR A;  2C9I A;  2H61 C;  1SL9 A;  3DVM A;  4OCI A;  2BCX A;  5FVF A;  2A54 B;  2LMU A;  4KF5 C;  2WSO A;  2KI4 C;  1PSR A;  2LP3 A;  1UHN A;  2PSR A;  2RGI A;  5G08 A;  3DPX A;  3DQE A;  5I2L A;  1MOU A;  2A47 A;  5EXU A;  1HCJ A;  4KEX A;  3DQ5 A;  3BUW B;  3PN7 B;  1RMO A;  2F3Z A;  3CFH A;  4LJB A;  1Z1Q A;  5CPV A;  3OB1 B;  1SCM C;  1B1G A;  1J7Q A;  4JRB A;  3SG6 A;  1F71 A;  1XYD A;  3A8R A;  3ADF A;  1K96 A;  1K95 A;  3G9A A;  4PE0 A;  2EHB A;  4H47 A;  4P1Q A;  2BL0 C;  2QU1 A;  4IK4 A;  3AI4 A;  4Z4M A;  3DQF A;  4LW5 A;  3IP2 A;  1YFP A;  5BTT A;  4W6T A;  2B3P A;  2LC5 A;  1JWD A;  3VRR A;  3CTN A;  4ZF4 A;  3VHT B;  1BMO A;  2NZ0 A;  1KSM A;  2F2P A;  2GW3 A;  4KF5 A;  1TCF A;  3SG5 A;  3I5H C;  2G9B A;  2IE2 A;  2OGR A;  1AK8 A;  1KYS A;  1KYR A;  2A46 A;  3BXC A;  1YRT B;  3SSV A;  1NCY A;  2K2F A;  4YGD B;  2VZX A;  1MYW A;  1XQM A;  1SCV A;  1DJZ A;  3LVC A;  4L12 A;  2JAD A;  5DTY A;  2OTG C;  4XJK A;  3DQ1 A;  5CSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...