3O78A

The structure of ca2+ sensor (case-12)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
415
structure length
402
Chain Sequence
b'GPGSSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNVEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSFQSVLSKDPNEKRDHMVLLEFVTAAGITLGGTGSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKLICTTGKLPVPWPTLVTTLLKCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIGFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, smooth muscle,Green fluorescent p
publication title The structure of Ca2+ sensor Case16 reveals the mechanism of reaction to low Ca2+ concentrations
pubmed doi rcsb
source organism Gallus gallus
molecule tags Fluorescent protein
total genus 116
structure length 402
sequence length 415
chains with identical sequence B
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2010-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3o78A02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3o78A01
3ZNIA 2RGIA 5DQMA 3FWBA 2M7NA 2O24A 2EGDA 3VGOA 1QY3A 4LQTA 2ZFDA 1B8LA 1WRLA 2KFFA 2QZ0A 1X02A 5F9GA 3QRXA 1W7IB 4DXIA 2L2EA 4M2OA 3SSLA 3VRPA 2G6YA 1SY9A 1S36A 4I5LB 2BKIB 5GQQC 2K0JA 2OTGB 1SCMB 1U5IB 3BQ3A 2B3QA 1FW4A 4ORNA 1ZGQA 1VRKA 1AP4A 2KDHA 3CGLA 1MOVA 1RROA 3TMRA 4PE0A 1ZGOA 1EMLA 2M0RA 4DIRA 1Q4AA 2KSPA 3BX9A 3CFAA 2CNPA 1J7RA 4KGEA 4NDBA 3U0KA 2V53A 3ST2A 3ZTFA 3I5HC 1F54A 1A4PA 3D0YB 2C9IA 1WRKA 4YGAA 2LMVA 2SASA 4PHMA 3NT9A 1OE9B 4QJ5B 3VK1A 3ZUJA 1EMAA 2FCDA 1S6JA 1SR6C 2P6BB 2F3YA 5HLOA 5BPJA 3DQ7A 3I5FC 3WXAA 2ZRSA 1BT6A 2AHAA 3A4UB 4MBEA 3E5WA 1C4FA 1YFPA 3TUYC 2G3OA 2LUCA 2V4EB 2VAEA 3TDUA 1YRUB 2KGRA 4OJ0A 5H89A 2VRGA 1QX5B 3PSRA 3EK4A 1TOPA 1ZFSA 3G9AA 2EMDA 2KI4B 3VROA 2KBMA 3I5GC 1YHHA 4PE1A 4KGFA 2DD7A 4XYNA 1DT7B 3O4YA 3SSYA 2VADA 5DQBA 1DJXA 5LTQA 1LVCD 1KK8B 4W7AA 4W69A 2LANA 2A50B 1RJVA 2IB6A 4C0JA 3LF4B 1A29A 2LM5A 2Q6PA 1FI5A 4ORAB 2HPWA 4GESB 5BT0A 2L4HA 2JOJA 2LCPA 5AERA 1RTP1 1YX8A 4Z4KA 1H8BA 2WC8A 4KF5A 1BR4B 3TS5B 2K7OA 2LLUA 4IZNA 2Q4UA 2Z6YA 1A2XA 1OMVA 1CM1A 4YGDB 3BOWA 3H1OA 2H61C 2QACA 4U2VA 1XA9A 3KEVA 2VVHA 3JTDC 4W6UA 3VHTB 5DU0A 2I7AA 2HCGA 2FJUB 2I2RE 3MSEB 4AOMA 1FI6A 3DQJA 2KAXA 2ARLA 5DPIA 1F4OA 1TTXA 4TNCA 4W6MA 4XL5A 2EHBA 4FTGA 5HYDA 2ZRTA 5LTPA 2D8NA 5DPJA 4Q7UA 1S26D 3VHTA 4HREE 4N5XA 1G4YR 1EH2A 2FCEA 4PPKA 2A54B 3DQ1A 1CFDA 4EULA 3GJ2A 1AHRA 4Q7RA 4OKHA 4JF9A 3AI4A 1PALA 1TCFA 1KQMB 2Q57A 2H2KA 5DRFA 4MN0A 1KSOA 5ER4X 3OP0A 5T3IA 4ORCB 4W75A 1BR1B 2HGYA 2DDDA 5HZTA 1YJ2A 1ZUXA 3NEZA 2Z1OA 3ED8A 2OPOA 5HZUA 1S3PA 1OOJA 4N1GA 1S1EA 1SNLA 3AAJA 1GGWA 1DJWA 1JFJA 3DQOA 3SSKA 4I5NB 3OX6A 1V1GA 2M9GA 3OB2B 4IK1A 1MHOA 2LVJA 3CBEA 4ZCUA 1K90D 2HQZA 1JFKA 4LJBA 5I8NA 1YUSA 5EHUA 1F55A 4N1FA 3P8UA 3SJSA 1CB1A 1WDCC 4MRXA 1CDMA 4H3MA 1J1DA 1Y1XA 1CFFA 1CDLA 1MYWA 1DJZA 2C9JA 2IOVA 4GNKB 1JWDA 4LJCA 2QLEA 3DQNA 4KPIA 4B30A 1RMOA 1MR8A 4I5JA 1QXPA 1OMRA 4ZF5A 5H88A 2KYCA 3WLCA 4HE4A 2JADA 3AI5A 3NF0A 2LLSA 2H6VA 3SVRA 4ZCVA 3LVDA 4QJ4B 3VRRA 4HSZA 3RM1A 3GK4X 1YHGA 3S05A 4HQ9A 4DCKA 2AUCA 1NX3A 2A52B 2IB5A 5EB6A 4W6NA 1G33A 4EDSA 4W7DA 1IWQA 4HRHA 1LKJA 2KHNA 4C0KA 4Q7TA 1CKKA 3GB3A 2BL0B 1JSAA 2LVIA 2WIQA 1CDNA 1XFUO 1M39A 3CR2A 3I5IB 4LW5A 2HFCA 2CXJA 1DJGA 3WHTB 2M29A 4OGSA 3PJ5A 3M22A 3LVCA 1UUSA 1YUTA 4GBAA 4JGEA 3BUNB 1G7KA 5CSFA 3DD4A 1UHJA 4YGBB 4M2QA 4YI8A 4W6TA 1RMPA 1IRJA 1L2OB 3A8RA 3E5TA 1J7PA 2LLTA 3DF0A 3CFFA 3PFVA 2K61A 4ZF3A 1OSAA 1Q4BA 1QYOA 2OKWA 1LXFC 1YX7A 1IH0A 1SL8A 3OHMB 3PM8A 3WHUB 2ZN9A 1XFYO 2M1KB 3EKJA 2OS8C 4WQ2A 2FZUA 4OHSA 1A75B 2A48A 1YURA 1KWOC 3AKAA 4MEWA 2M3WA 3CLNA 1EMGA 2Y1NA 3OGOA 4EN1A 5FHVA 1FF1A 4ZINA 2BECA 4DXOA 1HCJA 1BODA 1H4UA 3DQ5A 4CLNA 3LVAA 2M49B 3EKHA 2WCFA 1ZGPA 1S5GY 1NCXA 2A47A 3RLZA 4EDOA 4YI9A 1PK0D 1WY9A 1ALVA 1NUBA 2KBIA 2H9WA 4RYWA 2GGZA 1IJ6A 3VICA 1KCYA 3GL4A 1YTZC 4FQOA 5DTLA 4KAGA 3KPXA 4W6GA 1TNWA 4DS7A 1M63B 5HBDA 2TN4A 4RTCA 2HQ8A 3U8AA 4H48A 1JUOA 1KFUS 3SVDA 4XOWA 1SBJA 3SVNA 1ALWA 2Z6XA 2JXCA 3I5HB 4W7EA 1Y6WA 5DY6A 2I18A 2GW3A 1JF0A 2LMTA 2OJKA 1QATA 1S5GZ 2G5ZB 4HQCA 3PIBA 1J55A 4ICBA 3BXBA 5J2OA 3I5FB 1XK4C 2MLFC 5G08A 2JULA 1OZOA 2LVKA 4W74A 3SG7A 2PVBA 3F45A 1RWYA 4ZFSA 2BCBA 1DF0A 4JFGA 4PCWA 2OKYA 5HKYA 3EK7A 2QPTA 1OXEA 3O77A 1QVIY 1UURA 2LE9B 2L51A 1W7UA 3HCMA 3KF9A 3BUMB 3PLFB 5KU1A 2H5QA 4J88A 2JT8A 4ANJA 3SSPA 4WQ3A 1EMFA 1UHKA 3LK0A 3O2PA 4GGNA 3EVVA 3DQ3A 5EJUA 3GJ1A 2I94A 4ORBB 1QS7A 1SCMC 2B3PA 2F2PA 5DPGA 1KFUL 2M97A 4L1IA 2KYFA 1C7WA 2ZN8A 4W6KA 4W7FA 2KAYA 2O60A 1JF2A 2HJOA 4J8AA 1CLMA 1L7ZA 1QVIZ 1Y0VH 1M46A 3FS7A 1WLMA 3UG0A 4U8DA 4GGFC 4I2YA 4H47A 1ODBA 4KW8A 3FIAA 2AH8A 4TZAA 4YBHB 1IG5A 1KFXS 5I2QA 4R6BA 1ZUZA 3CR5X 3K21A 4GF6B 4XOVA 2QLGA 3CD1A 3ST4A 2R2IA 3LF3A 2WCBA 2ICRA 2L5XB 3JTDB 1IQ3A 3BOWB 1CTRA 2JRFA 2H5RA 1Q80A 5IBWA 1BG1A 2H61A 2COLB 2HQWA 4UPGA 1NIWA 1QV1A 4PE4A 4IK8A 1AVSA 2ZMUA 1BOCA 1JBAA 5ER5A 3DQ2A 3ICBA 1XSSA 2BCAA 4JWQA 5KTGA 3SVUA 1EG3A 2JXLA 4NDDA 2ZNEA 4W6LA 3U0NA 1GGZA 4DXNA 1AUIB 2HPSA 3U0LA 1KK8C 4AQIA 4MZLA 4PALA 2P4MA 2LC5A 1XMZA 1GJYA 1FBVA 4KF4A 3DQUA 2JPTA 4DXPA 3SG3A 4CIDA 3SG5A 4NQGA 1MXEA 1SMGA 1EMBA 1KFXL 3NSIA 1HQVA 2PXSA 4J89A 2GX2A 2LMUA 1PVAA 3DVMA 3TS5C 3SIAA 2EC6C 5K89A 1CNPA 4W6CA 2QT2A 2QLHA 1IGVA 4OV2A 1C07A 3NSOA 2WSOA 2KFHA 4A4BA 2PALA 1TRFA 1S6CA 2VZXA 2JC2A 3IQOA 2MBXA 5EXBA 1TCOB 4HRGA 2DD9A 2DUGA 1K8UA 2LP3A 3CGAA 1YVLA 2A53B 1CLLA 4W6BA 1F09A 1K94A 4HQ8A 2BE6A 3JVTB 4OVNF 2O5GA 1F70A 4LJDC 1TNXA 1KYSA 1IKUA 4DKMA 3IF7A 5JOLA 3DPZA 1NYAA 4BDUA 1TNQA 5TNCA 4B30B 1YJFA 1QLSA 5LK4A 2IE2A 1KQMC 1QASA 1GGXA 3OB1B 2AWKA 4GPLB 3GEXA 1ZOTB 3ZUFA 2O2BA 1XQMA 2K2FA 5DPHA 3GOFA 1J1EA 2VVJA 4ZF4A 1DTLA 3BXAA 1DMOA 3CWGA 2G6XA 1BMOA 4DXQA 2LUXA 1LA3A 4IK9A 1IJ5A 1QX2A 5BQLA 1N0YA 1BLQA 1RM9A 1CLBA 2DUEA 5CSNA 2KOTA 3A8SA 1YZWA 1NSHA 1K9PA 1CMFA 4P76A 3KCTA 4GFTA 4JRBA 5EBJA 3I19A 3AAKA 1XAEA 5H87A 4D1EA 1CV7A 4ZBLA 5FVIA 1QJTA 3PN7B 4OY4A 4YGCB 2DUIA 1JC1A 1DGUA 4R6DA 1N2DA 1JBYA 2WSNA 1CDPA 2G9BA 4PE7A 1KQVA 1TNPA 1EG4A 5CPVA 2AWMA 3KO0A 3DF0B 1J7QA 2JT0A 1XO5A 3LCPC 1DJYA 2ZKMX 1Z1PA 3H4SE 2KQYA 4QJ3B 3CS1A 5AANA 2AWJA 4F0ZB 1QX7A 5F6TA 2MAZA 1LA0A 3MGFA 1R2UA 4MRYA 5DKQA 4DRWA 4PHJA 2JTZA 2B1UA 1EMMA 3CTNA 4AR7A 4IK4A 5BTTA 4MLWA 1B7TY 2BL0C 1OXDA 3EVUA 1N65A 1K9UA 4XJKA 1QLKA 4TZGA 3D10A 1YVHA 1OMDA 3DVJA 3ZULA 3P28A 3DQ9A 3LA1A 4W6PA 3SVEA 5AXIA 3BUXB 1MQ1A 2FL1A 4PFEA 1AK8A 1K93D 3EVRA 3ST3A 1E8AA 4GUKA 3BXKA 2KNEA 2A56B 4YGEB 1A03A 1SL9A 3K1KA 3BUWB 1K95A 2PASA 1D1OA 1C7VA 1UHHA 3DQLA 4W7RA 5FYXA 1SK6D 2Y4QA 4RYSA 4MZKA 3PATA 2MJWB 1B7TZ 1JBZA 1XFXO 3DQ8A 2G16B 4W73A 4ZIOA 3RWAA 2LNKA 3LSAA 2G2BA 2JQ6A 3DQ6A 1H6RA 2JU0A 1B9CA 2WHUA 1K9KA 2NZ0A 4Q9XA 3ZWHA 4H3LA 1BF5A 1NCYA 1XK4A 5KSZA 2F33A 1YRTB 1TIZA 1DF0B 1Q4CA 5HKWA 4JEOA 2GGMA 2WOSA 1SR6B 1KYRA 3VRNA 3NT3A 1PSBA 2JNFA 2WHSA 1Q73A 1R6PA 1RRXA 1QIWA 2OTEA 3CR4X 2K7CA 3TUYB 4W7XA 1AJ4A 1DJHA 4Q9WA 4PPLA 2F2OA 3DQKA 2QU1A 2ZNDA 2CT9A 2YDZA 3BUOB 4IK3A 1IQ5A 3ST0A 1EL4A 3SSVA 1U5IA 1GFLA 2KI6C 1Y1AA 3I5GB 4LQUA 4JQ0D 1YHIA 3W1CA 4GAOA 3IQQA 1WRZA 2F8PA 1NX1A 3SVSA 2LVVA 2OTGC 2Y5IA 5JJGA 4W6SA 3SSTA 4DKNA 1Q4EA 4GGFA 2L98A 3D0YA 1KYPA 5I2OA 2H5OA 2FWQA 1S6IA 1QTXA 2IS9A 1NWDA 2QLGB 3DQMA 3V3DA 1G8IA 4NWSA 2NCPA 2NXQA 1F71A 4W6DA 4R1EA 2JZIA 2MHHA 1QIVA 3FWCA 1YUUA 4DXMA 1ZMZA 3DQFA 3WCKA 1B8RA 2A46A 1M45A 2G6EA 5DKNA 3SVBA 1K96A 5I2LA 3TDZA 3LS3A 2KI6D 5HW9A 2V4EA 1Y1UA 4N3DA 2OGRA 2PMYA 1M31A 4AS8A 1H4BA 3DVEA 2CTNA 2KAVA 5HGEA 1EMEA 3SRYA 2V4EC 2A4JA 3CZTX 5FVFA 3OSQA 1BFPA 2WORA 2Y1MA 4AQJA 5HZOA 3M0WA 4L9MA 2KI4C 1CM4A 1MUXA 1F4QA 5HLVA 2HRSA 1DVIA 2MA2A 1W7JB 4XVPA 4W6HA 2O29A 3GK1A 2JT3A 2FOTA 3VRQA 4CFQA 5DRGA 2H8QA 1EMKA 2NLNA 2EC6B 4OR9B 3NSLA 4UTSA 4Z4MA 3SVCA 4PDZA 1SRAA 1QXTA 2L50A 2Y0GA 3O78A 3PJ7A 3SVOA 3DPXA 4KF5C 2WNDA 2K7BA 5B8IB 1DJIA 3E3RA 3CFHA 1SPYA 2H5PA 1Q4DA 4JPZB 3EVPA 5HKZA 1UWOA 2M8UA 1PULA 4MSPA 3DQDA 5DTZA 1NPQA 4L13A 2HGDA 1NCZA 1BU3A 3NSKA 4B5YA 3LL8B 1V1FA 4E68A 1XFWO 2MLEC 2SCPA 3DQCA 1PRWA 4W77A 2CCMA 3CB9A 3SIBA 4W72A 1PSRA 2OTBA 3AKOA 1RFJA 2EMNA 3LK1A 2DUFA 2WISA 4PHKA 1HT9A 2AAOA 1GQMA 5EXUA 1GL4A 4LJDA 4OCIA 4CFRA 1JC2A 4A4CA 1WDCB 1CFCA 1XFZO 3E5VA 5EXCI 1OZSA 1K2HA 4WRIA 3NEDA 5CSIA 3DQ4A 3OSRA 2YE0A 3KHEA 2WCEA 1QV0A 1F0BA 1AJ5A 1NX2A 1BJFA 2PRUA 1LINA 5EB7A 1KP5A 4ETOA 2DUHA 5HZSA 3KCSA 5J3XA 2PXWA 4W6FA 5AEQA 3ADFA 1KSMA 3PALA 3SG4A 1B47A 3U0MA 2BBNA 3HX4A 5KTYA 1F8HA 2POXA 1DGVA 1RMMA 5DTXA 3OX5A 2Z6ZA 4W6JA 4OQWA 5D69A 1JC0A 3DQEA 5AQBB 2LHIA 1EMCA 2L0PA 4BY5A 4H3NA 4PHNA 4M2PA 1UP5A 1XYDA 3PJBA 4P5OE 3TDIA 4W6AA 3DPWA 3JVTC 2ISDA 4ZB1A 3DQIA 3RWTA 1SL7A 1EJ3A 4KW4A 2HF5A 2LHLA 3C1VA 1TN4A 1W7TA 3H1RA 2DDCA 4W6OA 3DQHA 1FPWA 3GK2A 4XGYA 2ZO7A 5AFPA 2JNXA 2F3ZA 1QYQA 1SW8A 2LAPA 4MVFA 4MZJA 4P1QA 2PSRA 5DTYA 2LV7A 2Q91A 1UHNA 4HVFA 1OXFA 2M7LA 1UHIA 1UISA 1W7SA 1EXRA 4PPJA 2E6WA 1NX0A 4GOBA 1B4CA 2HQKA 2QRFA 4W7CA 1ZACA 3DVKA 2GW4B 4Q04A 1NP8A 3IR8A 2AWLA 3UFZA 1YR5A 3TZ1A 1OQPA 5CSJA 3LLEA 2JWWA 4CPVA 4IK5A 1MF8B 2OS8B 3W1DA 3IP2A 3U8CA 3WNXB 3SSHA 1KWOB 4YRUA 4EMQA 5BTTB 2NCOA 4DUQA 2MRDA 2CBLA 1Z1QA 4L12A 3O6BA 1MXLC 5DKRA 2BBMA 1RK9A 2JTTA 4XJKB 4P2YB 2GV5A 5FVGA 1KK7Y 3BYAA 3PN7C 5D7FA 4NDCA 4BY4A 2DOQA 4IL1A 4USLA 4KW9A 1QYFA 2QLIA 2G2SB 3I5IC 1J7OA 4W6IA 2YE1A 3CD9A 3AKBA 2YFPA 1SCVA 2G3DB 3DQAA 3WLDA 2KFGA 3SV5A 1XA5A 2K8MB 1S6ZA 1XFVO 4KA9A 4JC2A 1CMGA 1SYMA 1MWNA 2WHTA 4W76A 2BE4A 4KEXA 2ZO6A 2M1UA 2BTJA 1RECA 5LTRA 2LP2A 3TMTA 1L2OC 2BKHB 2GX0A 1SKTA 5PALA 3U8PA 3SG2A 4W6RA 1PVBA 3SG6A 1KK7Z 1HUYA 2HETA 2KGBC 1A75A 3EK8A 2E30A 1XVJA 1B9AA 2VVIA 4I5KA 2L4IA 2EMOA 3BXCA 2K7DA 2AMIA 2BCXA 3SS0A 2KQ6A 1CFPA 1MOUA 2ZMWA 1B8CA 3NXAA 2RH7A 3M24A 1WLZA 1B1GA 4C0LA 2WURA 2K2AA
chains in the Genus database with same CATH superfamily
3ZNIA 2RGIA 5DQMA 3FWBA 2M7NA 2O24A 2EGDA 3VGOA 1QY3A 4LQTA 2ZFDA 1B8LA 1WRLA 2KFFA 2QZ0A 1X02A 5F9GA 3QRXA 1W7IB 4DXIA 5HL1A 2L2EA 4M2OA 3SSLA 1TUZA 3VRPA 2G6YA 1SY9A 1S36A 4I5LB 2BKIB 5GQQC 2K0JA 2OTGB 1SCMB 1U5IB 2K60A 3BQ3A 2B3QA 1FW4A 4ORNA 1ZGQA 1VRKA 1AP4A 2KDHA 3CGLA 1MOVA 1RROA 3TMRA 4PE0A 1ZGOA 1EMLA 2M0RA 4DIRA 1Q4AA 2KSPA 3BX9A 3CFAA 2CNPA 1J7RA 4KGEA 4NDBA 3U0KA 2V53A 3ST2A 3ZTFA 3I5HC 1F54A 1A4PA 3D0YB 2C9IA 1WRKA 4YGAA 2LMVA 2SASA 4PHMA 3NT9A 1OE9B 4QJ5B 3VK1A 3ZUJA 1EMAA 2L5YA 2FCDA 1S6JA 1SR6C 2P6BB 2F3YA 5HLOA 5BPJA 3DQ7A 3I5FC 3PM2A 3WXAA 2ZRSA 1BT6A 2AHAA 3A4UB 4MBEA 3E5WA 1C4FA 3R1VA 1YFPA 3TUYC 2G3OA 2LUCA 4INWA 2V4EB 2VAEA 3TDUA 1YRUB 2KGRA 4OJ0A 5H89A 2VRGA 1QX5B 3PSRA 3EK4A 1TOPA 3D77A 1ZFSA 3G9AA 2EMDA 2KI4B 3VROA 3D75A 2KBMA 4JD9A 3I5GC 1YHHA 2WC5A 4PE1A 4KGFA 2DD7A 4XYNA 1DT7B 3O4YA 3SSYA 2VADA 5DQBA 1DJXA 5LTQA 3D74A 1LVCD 1KK8B 4W7AA 4W69A 2LANA 2A50B 1RJVA 2IB6A 4C0JA 3LF4B 1A29A 2LM5A 2Q6PA 1FI5A 4ORAB 2HPWA 4GESB 5BT0A 2L4HA 2JOJA 2LCPA 5AERA 1RTP1 1YX8A 5FI2A 4Z4KA 1H8BA 2WC8A 4KF5A 1BR4B 3TS5B 2K7OA 2LLUA 2Q4UA 4IZNA 2Z6YA 1A2XA 1OMVA 1CM1A 4YGDB 3CDNA 3BOWA 3H1OA 2H61C 2QACA 4U2VA 1XA9A 3KEVA 2VVHA 3JTDC 1OW4A 4W6UA 3VHTB 5DU0A 2I7AA 2HCGA 2FJUB 2I2RE 3MSEB 4AOMA 1FI6A 3DQJA 2KAXA 2ARLA 5DPIA 1F4OA 1TTXA 4TNCA 4W6MA 4XL5A 3QMEA 2EHBA 4FTGA 5HYDA 2ZRTA 5LTPA 2D8NA 5DPJA 4Q7UA 1S26D 3VHTA 4HREE 4N5XA 1G4YR 1EH2A 2FCEA 4PPKA 2A54B 3DQ1A 1CFDA 4EULA 3GJ2A 1AHRA 4Q7RA 4OKHA 4JF9A 3AI4A 1PALA 1TCFA 1KQMB 2Q57A 2H2KA 5DRFA 4MN0A 1KSOA 5ER4X 3OP0A 5T3IA 4ORCB 4W75A 1BR1B 2HGYA 2DDDA 5HZTA 3CZ1A 4JKTA 1YJ2A 1ZUXA 3NEZA 2Z1OA 3ED8A 2OPOA 5HZUA 1S3PA 1OOJA 4N1GA 1S1EA 1SNLA 3AAJA 1GGWA 3FE9A 1DJWA 1JFJA 3Q8IA 3DQOA 3SSKA 4I5NB 3OX6A 1V1GA 2M9GA 3OB2B 4IK1A 1MHOA 2LVJA 3CBEA 4ZCUA 1K90D 3UO9A 2HQZA 1JFKA 4LJBA 5I8NA 1YUSA 5EHUA 1F55A 4N1FA 3P8UA 3SJSA 1CB1A 1WDCC 4MRXA 1CDMA 4H3MA 1J1DA 1Y1XA 1CFFA 1CDLA 1MYWA 1DJZA 2C9JA 2IOVA 2JPOA 4GNKB 1JWDA 3RZSA 4LJCA 2QLEA 3DQNA 4KPIA 4B30A 1RMOA 1Z4HA 1MR8A 4I5JA 1QXPA 1OMRA 4ZF5A 5H88A 2KYCA 3WLCA 4HE4A 3BFAA 2JADA 3AI5A 3NF0A 2LLSA 2H6VA 3SVRA 4ZCVA 3LVDA 4QJ4B 3VRRA 1XFRA 4HSZA 3RM1A 3GK4X 1YHGA 4IJ7A 3S05A 4HQ9A 4DCKA 2AUCA 3D78A 1NX3A 2A52B 2IB5A 5EB6A 4W6NA 1G33A 4EDSA 4W7DA 1IWQA 4HRHA 1LKJA 2KHNA 4C0KA 4Q7TA 1CKKA 3GB3A 2BL0B 1JSAA 2LVIA 2WIQA 1CDNA 1XFUO 1M39A 2H8VA 3CR2A 2ERBA 3DY9A 3I5IB 4LW5A 2HFCA 2CXJA 1DJGA 3WHTB 2M29A 4OGSA 3PJ5A 3M22A 3LVCA 1UUSA 1YUTA 4GBAA 1W9ZA 4JGEA 3BUNB 1G7KA 5CSFA 3DD4A 1UHJA 3BFHA 4YGBB 4M2QA 4YI8A 4W6TA 1RMPA 1IRJA 1L2OB 3A8RA 1IIOA 5I94A 3E5TA 1J7PA 2LLTA 3DF0A 3CFFA 3PFVA 2K61A 4ZF3A 1OSAA 1Q4BA 1QYOA 2OKWA 1LXFC 1YX7A 2QEVA 1IH0A 1SL8A 3OHMB 2L2CA 3PM8A 3WHUB 2ZN9A 1OOIX 1XFYO 2M1KB 3EKJA 2OS8C 4WQ2A 2FZUA 4OHSA 1A75B 2A48A 1YURA 1KWOC 3AKAA 4MEWA 2M3WA 3CLNA 1EMGA 2Y1NA 3OGOA 4EN1A 5FHVA 1FF1A 4ZINA 2BECA 4DXOA 1HCJA 1BODA 1H4UA 3DQ5A 4CLNA 2WCMA 3L4AA 3LVAA 2M49B 3EKHA 2WCFA 1ZGPA 3CABA 1S5GY 1NCXA 2A47A 3RLZA 4EDOA 4YI9A 1PK0D 1WY9A 1ALVA 1NUBA 2KBIA 2H9WA 4RYWA 2GGZA 1IJ6A 3VICA 1KCYA 3GL4A 1YTZC 4FQOA 5DTLA 4KAGA 3KPXA 4W6GA 1TNWA 4DS7A 3UNWA 1M63B 5HBDA 2TN4A 4RTCA 2HQ8A 3U8AA 4H48A 1JUOA 1KFUS 3SVDA 4XOWA 1SBJA 3SVNA 1ALWA 2Z6XA 2P70A 2JXCA 3I5HB 3FE8A 4W7EA 1Y6WA 5DY6A 2I18A 2GW3A 1JF0A 2LMTA 2OJKA 1QATA 1S5GZ 2G5ZB 1OOFA 4HQCA 3PIBA 1J55A 4ICBA 3BXBA 5J2OA 3I5FB 1XK4C 2MLFC 5G08A 2JULA 1OZOA 2LVKA 4W74A 3SG7A 1P28A 2PVBA 3F45A 1RWYA 4ZFSA 2BCBA 1DF0A 4JFGA 4PCWA 2OKYA 5HKYA 3EK7A 2QPTA 1OXEA 3O77A 1QVIY 1UURA 2LE9B 2L51A 1W7UA 3HCMA 3KF9A 3BUMB 3PLFB 5KU1A 2H5QA 1T14A 3R1PA 2WCJA 4J88A 2JT8A 4ANJA 3SSPA 4WQ3A 1EMFA 1UHKA 3LK0A 3O2PA 4GGNA 3EVVA 3DQ3A 5EJUA 3GJ1A 2I94A 4ORBB 1QS7A 1SCMC 2B3PA 2F2PA 5DPGA 1KFUL 2M97A 4L1IA 2KYFA 1C7WA 2ZN8A 4W6KA 4W7FA 2KAYA 2O60A 1JF2A 2HJOA 4J8AA 1CLMA 1L7ZA 1QVIZ 1Y0VH 1M46A 2QDIA 3FS7A 1WLMA 3UG0A 1C3YA 4U8DA 4GGFC 4I2YA 4H47A 1ODBA 4KW8A 3FIAA 2AH8A 4TZAA 4YBHB 1IG5A 1KFXS 5I2QA 4R6BA 1ZUZA 3CR5X 3K21A 4GF6B 4XOVA 2QLGA 3CD1A 3ST4A 3K1EA 2PQLA 2R2IA 3LF3A 2WCBA 2ICRA 2L5XB 3JTDB 1IQ3A 3BOWB 1CTRA 2JRFA 2H5RA 1Q80A 5IBWA 1BG1A 2H61A 2COLB 2HQWA 4UPGA 1NIWA 1QV1A 4PE4A 1DELA 4IK8A 1AVSA 3L4LA 2ZMUA 1BOCA 1JBAA 2KLEA 1SSEB 5ER5A 3DQ2A 3ICBA 1XSSA 2BCAA 4JWQA 5KTGA 3SVUA 1EG3A 2JXLA 4NDDA 2ZNEA 4W6LA 3U0NA 1GGZA 4DXNA 1AUIB 2HPSA 3U0LA 3O4XA 1KK8C 2YGUA 4AQIA 4MZLA 4PALA 2P4MA 2LC5A 1XMZA 2KPHA 1GJYA 1FBVA 4KF4A 3DQUA 2JPTA 1DC1A 3D73A 4DXPA 3CYZA 3SG3A 3NGVA 4CIDA 3SG5A 4NQGA 1MXEA 1SMGA 1EMBA 1KFXL 3NSIA 1HQVA 2PXSA 4J89A 2GX2A 2LMUA 1PVAA 3DVMA 3TS5C 3SIAA 2EC6C 5K89A 1CNPA 4W6CA 3N7HA 2QT2A 2QLHA 3B7AA 1IGVA 4OV2A 1C07A 3NSOA 2WSOA 2KFHA 4A4BA 2PALA 3S0GA 1TRFA 1S6CA 2VZXA 2JC2A 3IQOA 2MBXA 2PYQA 5EXBA 1TCOB 4HRGA 2DD9A 2DUGA 1K8UA 2LP3A 3CGAA 1YVLA 2A53B 1CLLA 4W6BA 1F09A 1K94A 3S0FA 4HQ8A 2BE6A 3JVTB 4OVNF 2O5GA 1F70A 4LJDC 1TNXA 1KYSA 1IKUA 4DKMA 3B87A 3IF7A 1OOHA 5JOLA 3DPZA 1NYAA 4BDUA 1TNQA 5TNCA 4B30B 1YJFA 2BAPA 1QLSA 5LK4A 2IE2A 1KQMC 1QASA 1GGXA 3IVTA 2BNXA 3OB1B 2AWKA 4GPLB 3GEXA 1ZOTB 3ZUFA 2O2BA 1XQMA 1LS8A 2K2FA 5DPHA 3GOFA 1J1EA 2VVJA 5D3OA 1DTLA 4ZF4A 3BXAA 1DMOA 3CWGA 2G6XA 1BMOA 4DXQA 2LUXA 1LA3A 4IK9A 1IJ5A 1QX2A 5BQLA 1N0YA 1BLQA 1RM9A 1CLBA 2DUEA 5CSNA 2KOTA 3A8SA 1YZWA 1NSHA 1K9PA 1CMFA 4P76A 3KCTA 4GFTA 4JRBA 5EBJA 3I19A 3AAKA 1XAEA 5H87A 4D1EA 1CV7A 4ZBLA 5FVIA 1QJTA 3PN7B 4OY4A 4YGCB 2DUIA 1JC1A 1DGUA 5EL2A 4R6DA 1N2DA 1JBYA 2WSNA 1CDPA 1TWOA 2G9BA 4PE7A 1KQVA 1TNPA 3S0BA 1EG4A 5CPVA 4PT1A 2AWMA 3KO0A 3DF0B 1J7QA 2JT0A 1XO5A 3LCPC 1DJYA 2ZKMX 1Z1PA 3H4SE 2WC6A 2KQYA 4QJ3B 3CS1A 5AANA 2AWJA 4F0ZB 1QX7A 5F6TA 2MAZA 1LA0A 3MGFA 2WCHA 1R2UA 4MRYA 5DKQA 4DRWA 4PHJA 2JTZA 2B1UA 1EMMA 3CTNA 4AR7A 4IK4A 5BTTA 4MLWA 1B7TY 2BL0C 1OXDA 3EVUA 1N65A 1K9UA 4XJKA 1QLKA 4TZGA 3D10A 1YVHA 1OMDA 3DVJA 3S0DA 3ZULA 2KLDA 3P28A 3DQ9A 2FJYA 3LA1A 4W6PA 3SVEA 5AXIA 3BUXB 1MQ1A 2FL1A 3PJIA 2QEBA 4PFEA 1AK8A 1K93D 3EVRA 3ST3A 1E8AA 4GUKA 3BXKA 2KNEA 2A56B 4YGEB 1A03A 1SL9A 3K1KA 3BUWB 1K95A 2PASA 1D1OA 1C7VA 1UHHA 3DQLA 4W7RA 5FYXA 1SK6D 2Y4QA 4RYSA 4MZKA 3PATA 2MJWB 1B7TZ 3V2LA 1JBZA 1XFXO 3DQ8A 2G16B 4W73A 4ZIOA 2WCLA 3D76A 3BJHA 3RWAA 2LNKA 3LSAA 2G2BA 2JQ6A 3DQ6A 1H6RA 2JU0A 1B9CA 2WHUA 1K9KA 2GTEA 2NZ0A 4Q9XA 3ZWHA 4H3LA 3NHIA 1BF5A 1NCYA 1XK4A 5KSZA 2F33A 3CZ2A 1YRTB 1TIZA 1DF0B 1Q4CA 5HKWA 4JEOA 2GGMA 2WOSA 1SR6B 3B6XA 1KYRA 3VRNA 3NT3A 1PSBA 2JNFA 2WHSA 1Q73A 1R6PA 1RRXA 1QIWA 2OTEA 3CR4X 4FQTA 2K7CA 3TUYB 4W7XA 1AJ4A 1DJHA 4Q9WA 4PPLA 2F2OA 4OZDA 3DQKA 2QU1A 2ZNDA 2CT9A 2YDZA 3BUOB 4IK3A 1IQ5A 3ST0A 1EL4A 3SSVA 1U5IA 1GFLA 2KI6C 1Y1AA 3I5GB 4LQUA 4JQ0D 1YHIA 3W1CA 4GAOA 3IQQA 1WRZA 4KYNA 2F8PA 1NX1A 3SVSA 2LVVA 2OTGC 2Y5IA 5JJGA 4W6SA 3SSTA 4DKNA 1Q4EA 4GGFA 2L98A 3D0YA 1KYPA 5I2OA 2H5OA 2FWQA 1S6IA 1QTXA 2IS9A 1NWDA 3SS4A 2QLGB 3DQMA 3V3DA 1G8IA 4NWSA 2NCPA 2NXQA 1F71A 4W6DA 4R1EA 2JZIA 2MHHA 1QIVA 3FWCA 1YUUA 4DXMA 1ZMZA 3DQFA 3WCKA 1B8RA 2A46A 1M45A 2G6EA 5DKNA 3SVBA 1K96A 5I2LA 3TDZA 4F7FA 3LS3A 2KI6D 3DYEA 5HW9A 2V4EA 1Y1UA 4N3DA 2OGRA 2PMYA 1M31A 2QEOA 4AS8A 1H4BA 3NHTA 3DVEA 2CTNA 2KAVA 5HGEA 1EMEA 3OBVA 3SRYA 2V4EC 2A4JA 3CZTX 5FVFA 3OSQA 1BFPA 2WORA 2Y1MA 4AQJA 5HZOA 3M0WA 4L9MA 2KI4C 1CM4A 1MUXA 1F4QA 5HLVA 2HRSA 1DVIA 2MA2A 1W7JB 4XVPA 3R1OA 2QEHA 4W6HA 2O29A 3GK1A 2JT3A 2FOTA 3VRQA 4CFQA 5DRGA 3CZ0A 2H8QA 1EMKA 2NLNA 2EC6B 4OR9B 3NSLA 4UTSA 4Z4MA 3SVCA 4PDZA 1SRAA 1QXTA 2L50A 2Y0GA 3SS3A 3O78A 3PJ7A 3SVOA 3DPXA 4KF5C 2WNDA 2K7BA 5B8IB 1DJIA 3E3RA 3CFHA 1SPYA 2H5PA 1Q4DA 4JPZB 3EVPA 5HKZA 1UWOA 2M8UA 1PULA 4MSPA 3DQDA 1QWVA 5DTZA 1NPQA 4L13A 1DEKA 2HGDA 1NCZA 1BU3A 3SS5A 3NSKA 4B5YA 3LL8B 1V1FA 4E68A 1XFWO 3VB1A 2MLEC 2SCPA 3DQCA 1PRWA 4W77A 2CCMA 3CB9A 3SIBA 4W72A 1PSRA 2OTBA 3AKOA 1RFJA 2EMNA 3LK1A 2DUFA 2WISA 4PHKA 1HT9A 2AAOA 1GQMA 5EXUA 1GL4A 4LJDA 4OCIA 3DXLA 4CFRA 1JC2A 4A4CA 3EG5B 1WDCB 1CFCA 1XFZO 3E5VA 5EXCI 1OZSA 1K2HA 4WRIA 3NEDA 5CSIA 1Z2CB 3DQ4A 3OSRA 4INXA 2YE0A 3KHEA 2WCEA 1QV0A 1F0BA 1AJ5A 1NX2A 1BJFA 2PRUA 1LINA 5EB7A 1KP5A 4ETOA 2DUHA 5HZSA 2WCKA 3KCSA 5J3XA 2PXWA 4W6FA 5AEQA 3ADFA 3FE6A 1KSMA 3S0EA 5DICA 3PALA 3SG4A 1B47A 3U0MA 2BBNA 1C3ZA 3L47A 3BFBA 3HX4A 5KTYA 1F8HA 2POXA 1DGVA 1RMMA 5DTXA 3OX5A 2Z6ZA 4W6JA 4OQWA 5D69A 1JC0A 3DQEA 5AQBB 2LHIA 1EMCA 2L0PA 4BY5A 4H3NA 4PHNA 4M2PA 1UP5A 1XYDA 3PJBA 4P5OE 3TDIA 4W6AA 3DPWA 3JVTC 2ISDA 4ZB1A 3DQIA 3RWTA 1SL7A 1EJ3A 4KW4A 2HF5A 2LHLA 3C1VA 1TN4A 1W7TA 3H1RA 2DDCA 4W6OA 3DQHA 1FPWA 3GK2A 4XGYA 2ZO7A 5AFPA 2JNXA 2F3ZA 1QYQA 1SW8A 2LAPA 4MVFA 4MZJA 4P1QA 2PSRA 5DTYA 2LV7A 2Q91A 3B88A 1UHNA 4HVFA 1OXFA 2M7LA 1UHIA 1UISA 1W7SA 1TUJA 1EXRA 4PPJA 2P71A 2E6WA 1NX0A 4GOBA 1B4CA 2HQKA 2QRFA 4W7CA 1ZACA 3DVKA 2GW4B 4Q04A 1NP8A 3IR8A 2AWLA 3UFZA 1YR5A 3TZ1A 1OQPA 5CSJA 3LLEA 2JWWA 4CPVA 4IK5A 1MF8B 2OS8B 3W1DA 3IP2A 3U8CA 3WNXB 3SSHA 5FI6A 1KWOB 4YRUA 4EMQA 5BTTB 2NCOA 4DUQA 2MRDA 2CBLA 1Z1QA 4L12A 3O6BA 1MXLC 5DKRA 3R72A 2BBMA 1RK9A 2JTTA 4XJKB 1DQEA 4P2YB 2GV5A 5FVGA 1OOGA 1KK7Y 3BYAA 3PN7C 5D7FA 4NDCA 4BY4A 2DOQA 4IL1A 4USLA 4KW9A 1QYFA 2QLIA 2G2SB 3I5IC 1J7OA 4W6IA 2YE1A 3CD9A 3AKBA 2YFPA 1SCVA 2G3DB 3DQAA 3WLDA 1GM0A 3B86A 2KFGA 3SV5A 1XA5A 2K8MB 3OGNA 1S6ZA 1XFVO 4KA9A 4JC2A 1CMGA 1SYMA 1MWNA 2WHTA 4W76A 2BE4A 4KEXA 2ZO6A 2M1UA 2BTJA 1RECA 5LTRA 2LP2A 3TMTA 1L2OC 2BKHB 2GX0A 1SKTA 5PALA 3U8PA 3SG2A 4W6RA 1PVBA 1ORGA 1KK7Z 3SG6A 1HUYA 2HETA 2KGBC 1A75A 3DZTA 3EK8A 2E30A 1XVJA 1B9AA 3S0AA 2VVIA 4I5KA 2L4IA 2EMOA 3BXCA 2K7DA 2AMIA 2BCXA 3SS0A 2KQ6A 1CFPA 1MOUA 2ZMWA 1B8CA 3NXAA 2RH7A 3M24A 1WLZA 1B1GA 4C0LA 2WURA 5FI7A 2K2AA
chains in the Genus database with same CATH topology
3ZNIA 2RGIA 5DQMA 3FWBA 2M7NA 2O24A 2EGDA 3VGOA 1QY3A 4LQTA 2ZFDA 1B8LA 1WRLA 2KFFA 2QZ0A 1X02A 5F9GA 3QRXA 1W7IB 4DXIA 2L2EA 4M2OA 3SSLA 3VRPA 2G6YA 1SY9A 1S36A 4I5LB 2BKIB 5GQQC 2K0JA 2OTGB 1SCMB 1U5IB 3BQ3A 2B3QA 1FW4A 4ORNA 1ZGQA 1VRKA 1AP4A 2KDHA 3CGLA 1MOVA 1RROA 3TMRA 4PE0A 1ZGOA 1EMLA 2M0RA 4DIRA 1Q4AA 2KSPA 3BX9A 3CFAA 2CNPA 1J7RA 4KGEA 4NDBA 3U0KA 2V53A 3ST2A 3ZTFA 3I5HC 1F54A 1A4PA 3D0YB 2C9IA 1WRKA 4YGAA 2LMVA 2SASA 4PHMA 3NT9A 1OE9B 4QJ5B 3VK1A 3ZUJA 1EMAA 2FCDA 1S6JA 1SR6C 2P6BB 2F3YA 5HLOA 5BPJA 3DQ7A 3I5FC 3WXAA 2ZRSA 1BT6A 2AHAA 3A4UB 4MBEA 3E5WA 1C4FA 1YFPA 3TUYC 2G3OA 2LUCA 2V4EB 2VAEA 3TDUA 1YRUB 2KGRA 4OJ0A 5H89A 2VRGA 1QX5B 3PSRA 3EK4A 1TOPA 1ZFSA 3G9AA 2EMDA 2KI4B 3VROA 2KBMA 3I5GC 1YHHA 4PE1A 4KGFA 2DD7A 4XYNA 1DT7B 3O4YA 3SSYA 2VADA 5DQBA 1DJXA 5LTQA 1LVCD 1KK8B 4W7AA 4W69A 2LANA 2A50B 1RJVA 2IB6A 4C0JA 3LF4B 1A29A 2LM5A 2Q6PA 1FI5A 4ORAB 2HPWA 4GESB 5BT0A 2L4HA 2JOJA 2LCPA 5AERA 1RTP1 1YX8A 4Z4KA 1H8BA 2WC8A 4KF5A 1BR4B 3TS5B 2K7OA 2LLUA 4IZNA 2Q4UA 2Z6YA 1A2XA 1OMVA 1CM1A 4YGDB 3BOWA 3H1OA 2H61C 2QACA 4U2VA 1XA9A 3KEVA 2VVHA 3JTDC 4W6UA 3VHTB 5DU0A 2I7AA 2HCGA 2FJUB 2I2RE 3MSEB 4AOMA 1FI6A 3DQJA 2KAXA 2ARLA 5DPIA 1F4OA 1TTXA 4TNCA 4W6MA 4XL5A 2EHBA 4FTGA 5HYDA 2ZRTA 5LTPA 2D8NA 5DPJA 4Q7UA 1S26D 3VHTA 4HREE 4N5XA 1G4YR 1EH2A 2FCEA 4PPKA 2A54B 3DQ1A 1CFDA 4EULA 3GJ2A 1AHRA 4Q7RA 4OKHA 4JF9A 3AI4A 1PALA 1TCFA 1KQMB 2Q57A 2H2KA 5DRFA 4MN0A 1KSOA 5ER4X 3OP0A 5T3IA 4ORCB 4W75A 1BR1B 2HGYA 2DDDA 5HZTA 1YJ2A 1ZUXA 3NEZA 2Z1OA 3ED8A 2OPOA 5HZUA 1S3PA 1OOJA 4N1GA 1S1EA 1SNLA 3AAJA 1GGWA 1DJWA 1JFJA 3DQOA 3SSKA 4I5NB 3OX6A 1V1GA 2M9GA 3OB2B 4IK1A 1MHOA 2LVJA 3CBEA 4ZCUA 1K90D 2HQZA 1JFKA 4LJBA 5I8NA 1YUSA 5EHUA 1F55A 4N1FA 3P8UA 3SJSA 1CB1A 1WDCC 4MRXA 1CDMA 4H3MA 1J1DA 1Y1XA 1CFFA 1CDLA 1MYWA 1DJZA 2C9JA 2IOVA 4GNKB 1JWDA 4LJCA 2QLEA 3DQNA 4KPIA 4B30A 1RMOA 1MR8A 4I5JA 1QXPA 1OMRA 4ZF5A 5H88A 2KYCA 3WLCA 4HE4A 2JADA 3AI5A 3NF0A 2LLSA 2H6VA 3SVRA 4ZCVA 3LVDA 4QJ4B 3VRRA 4HSZA 3RM1A 3GK4X 1YHGA 3S05A 4HQ9A 4DCKA 2AUCA 1NX3A 2A52B 2IB5A 5EB6A 4W6NA 1G33A 4EDSA 4W7DA 1IWQA 4HRHA 1LKJA 2KHNA 4C0KA 4Q7TA 1CKKA 3GB3A 2BL0B 1JSAA 2LVIA 2WIQA 1CDNA 1XFUO 1M39A 3CR2A 3I5IB 4LW5A 2HFCA 2CXJA 1DJGA 3WHTB 2M29A 4OGSA 3PJ5A 3M22A 3LVCA 1UUSA 1YUTA 4GBAA 4JGEA 3BUNB 1G7KA 5CSFA 3DD4A 1UHJA 4YGBB 4M2QA 4YI8A 4W6TA 1RMPA 1IRJA 1L2OB 3A8RA 3E5TA 1J7PA 2LLTA 3DF0A 3CFFA 3PFVA 2K61A 4ZF3A 1OSAA 1Q4BA 1QYOA 2OKWA 1LXFC 1YX7A 1IH0A 1SL8A 3OHMB 3PM8A 3WHUB 2ZN9A 1XFYO 2M1KB 3EKJA 2OS8C 4WQ2A 2FZUA 4OHSA 1A75B 2A48A 1YURA 1KWOC 3AKAA 4MEWA 2M3WA 3CLNA 1EMGA 2Y1NA 3OGOA 4EN1A 5FHVA 1FF1A 4ZINA 2BECA 4DXOA 1HCJA 1BODA 1H4UA 3DQ5A 4CLNA 3LVAA 2M49B 3EKHA 2WCFA 1ZGPA 1S5GY 1NCXA 2A47A 3RLZA 4EDOA 4YI9A 1PK0D 1WY9A 1ALVA 1NUBA 2KBIA 2H9WA 4RYWA 2GGZA 1IJ6A 3VICA 1KCYA 3GL4A 1YTZC 4FQOA 5DTLA 4KAGA 3KPXA 4W6GA 1TNWA 4DS7A 1M63B 5HBDA 2TN4A 4RTCA 2HQ8A 3U8AA 4H48A 1JUOA 1KFUS 3SVDA 4XOWA 1SBJA 3SVNA 1ALWA 2Z6XA 2JXCA 3I5HB 4W7EA 1Y6WA 5DY6A 2I18A 2GW3A 1JF0A 2LMTA 2OJKA 1QATA 1S5GZ 2G5ZB 4HQCA 3PIBA 1J55A 4ICBA 3BXBA 5J2OA 3I5FB 1XK4C 2MLFC 5G08A 2JULA 1OZOA 2LVKA 4W74A 3SG7A 2PVBA 3F45A 1RWYA 4ZFSA 2BCBA 1DF0A 4JFGA 4PCWA 2OKYA 5HKYA 3EK7A 2QPTA 1OXEA 3O77A 1QVIY 1UURA 2LE9B 2L51A 1W7UA 3HCMA 3KF9A 3BUMB 3PLFB 5KU1A 2H5QA 4J88A 2JT8A 4ANJA 3SSPA 4WQ3A 1EMFA 1UHKA 3LK0A 3O2PA 4GGNA 3EVVA 3DQ3A 5EJUA 3GJ1A 2I94A 4ORBB 1QS7A 1SCMC 2B3PA 2F2PA 5DPGA 1KFUL 2M97A 4L1IA 2KYFA 1C7WA 2ZN8A 4W6KA 4W7FA 2KAYA 2O60A 1JF2A 2HJOA 4J8AA 1CLMA 1L7ZA 1QVIZ 1Y0VH 1M46A 3FS7A 1WLMA 3UG0A 4U8DA 4GGFC 4I2YA 4H47A 1ODBA 4KW8A 3FIAA 2AH8A 4TZAA 4YBHB 1IG5A 1KFXS 5I2QA 4R6BA 1ZUZA 3CR5X 3K21A 4GF6B 4XOVA 2QLGA 3CD1A 3ST4A 2R2IA 3LF3A 2WCBA 2ICRA 2L5XB 3JTDB 1IQ3A 3BOWB 1CTRA 2JRFA 2H5RA 1Q80A 5IBWA 1BG1A 2H61A 2COLB 2HQWA 4UPGA 1NIWA 1QV1A 4PE4A 4IK8A 1AVSA 2ZMUA 1BOCA 1JBAA 5ER5A 3DQ2A 3ICBA 1XSSA 2BCAA 4JWQA 5KTGA 3SVUA 1EG3A 2JXLA 4NDDA 2ZNEA 4W6LA 3U0NA 1GGZA 4DXNA 1AUIB 2HPSA 3U0LA 1KK8C 4AQIA 4MZLA 4PALA 2P4MA 2LC5A 1XMZA 1GJYA 1FBVA 4KF4A 3DQUA 2JPTA 4DXPA 3SG3A 4CIDA 3SG5A 4NQGA 1MXEA 1SMGA 1EMBA 1KFXL 3NSIA 1HQVA 2PXSA 4J89A 2GX2A 2LMUA 1PVAA 3DVMA 3TS5C 3SIAA 2EC6C 5K89A 1CNPA 4W6CA 2QT2A 2QLHA 1IGVA 4OV2A 1C07A 3NSOA 2WSOA 2KFHA 4A4BA 2PALA 1TRFA 1S6CA 2VZXA 2JC2A 3IQOA 2MBXA 5EXBA 1TCOB 4HRGA 2DD9A 2DUGA 1K8UA 2LP3A 3CGAA 1YVLA 2A53B 1CLLA 4W6BA 1F09A 1K94A 4HQ8A 2BE6A 3JVTB 4OVNF 2O5GA 1F70A 4LJDC 1TNXA 1KYSA 1IKUA 4DKMA 3IF7A 5JOLA 3DPZA 1NYAA 4BDUA 1TNQA 5TNCA 4B30B 1YJFA 1QLSA 5LK4A 2IE2A 1KQMC 1QASA 1GGXA 3OB1B 2AWKA 4GPLB 3GEXA 1ZOTB 3ZUFA 2O2BA 1XQMA 2K2FA 5DPHA 3GOFA 1J1EA 2VVJA 4ZF4A 1DTLA 3BXAA 1DMOA 3CWGA 2G6XA 1BMOA 4DXQA 2LUXA 1LA3A 4IK9A 1IJ5A 1QX2A 5BQLA 1N0YA 1BLQA 1RM9A 1CLBA 2DUEA 5CSNA 2KOTA 3A8SA 1YZWA 1NSHA 1K9PA 1CMFA 4P76A 3KCTA 4GFTA 4JRBA 5EBJA 3I19A 3AAKA 1XAEA 5H87A 4D1EA 1CV7A 4ZBLA 5FVIA 1QJTA 3PN7B 4OY4A 4YGCB 2DUIA 1JC1A 1DGUA 4R6DA 1N2DA 1JBYA 2WSNA 1CDPA 2G9BA 4PE7A 1KQVA 1TNPA 1EG4A 5CPVA 2AWMA 3KO0A 3DF0B 1J7QA 2JT0A 1XO5A 3LCPC 1DJYA 2ZKMX 1Z1PA 3H4SE 2KQYA 4QJ3B 3CS1A 5AANA 2AWJA 4F0ZB 1QX7A 5F6TA 2MAZA 1LA0A 3MGFA 1R2UA 4MRYA 5DKQA 4DRWA 4PHJA 2JTZA 2B1UA 1EMMA 3CTNA 4AR7A 4IK4A 5BTTA 4MLWA 1B7TY 2BL0C 1OXDA 3EVUA 1N65A 1K9UA 4XJKA 1QLKA 4TZGA 3D10A 1YVHA 1OMDA 3DVJA 3ZULA 3P28A 3DQ9A 3LA1A 4W6PA 3SVEA 5AXIA 3BUXB 1MQ1A 2FL1A 4PFEA 1AK8A 1K93D 3EVRA 3ST3A 1E8AA 4GUKA 3BXKA 2KNEA 2A56B 4YGEB 1A03A 1SL9A 3K1KA 3BUWB 1K95A 2PASA 1D1OA 1C7VA 1UHHA 3DQLA 4W7RA 5FYXA 1SK6D 2Y4QA 4RYSA 4MZKA 3PATA 2MJWB 1B7TZ 1JBZA 1XFXO 3DQ8A 2G16B 4W73A 4ZIOA 3RWAA 2LNKA 3LSAA 2G2BA 2JQ6A 3DQ6A 1H6RA 2JU0A 1B9CA 2WHUA 1K9KA 2NZ0A 4Q9XA 3ZWHA 4H3LA 1BF5A 1NCYA 1XK4A 5KSZA 2F33A 1YRTB 1TIZA 1DF0B 1Q4CA 5HKWA 4JEOA 2GGMA 2WOSA 1SR6B 1KYRA 3VRNA 3NT3A 1PSBA 2JNFA 2WHSA 1Q73A 1R6PA 1RRXA 1QIWA 2OTEA 3CR4X 2K7CA 3TUYB 4W7XA 1AJ4A 1DJHA 4Q9WA 4PPLA 2F2OA 3DQKA 2QU1A 2ZNDA 2CT9A 2YDZA 3BUOB 4IK3A 1IQ5A 3ST0A 1EL4A 3SSVA 1U5IA 1GFLA 2KI6C 1Y1AA 3I5GB 4LQUA 4JQ0D 1YHIA 3W1CA 4GAOA 3IQQA 1WRZA 2F8PA 1NX1A 3SVSA 2LVVA 2OTGC 2Y5IA 5JJGA 4W6SA 3SSTA 4DKNA 1Q4EA 4GGFA 2L98A 3D0YA 1KYPA 5I2OA 2H5OA 2FWQA 1S6IA 1QTXA 2IS9A 1NWDA 2QLGB 3DQMA 3V3DA 1G8IA 4NWSA 2NCPA 2NXQA 1F71A 4W6DA 4R1EA 2JZIA 2MHHA 1QIVA 3FWCA 1YUUA 4DXMA 1ZMZA 3DQFA 3WCKA 1B8RA 2A46A 1M45A 2G6EA 5DKNA 3SVBA 1K96A 5I2LA 3TDZA 3LS3A 2KI6D 5HW9A 2V4EA 1Y1UA 4N3DA 2OGRA 2PMYA 1M31A 4AS8A 1H4BA 3DVEA 2CTNA 2KAVA 5HGEA 1EMEA 3SRYA 2V4EC 2A4JA 3CZTX 5FVFA 3OSQA 1BFPA 2WORA 2Y1MA 4AQJA 5HZOA 3M0WA 4L9MA 2KI4C 1CM4A 1MUXA 1F4QA 5HLVA 2HRSA 1DVIA 2MA2A 1W7JB 4XVPA 4W6HA 2O29A 3GK1A 2JT3A 2FOTA 3VRQA 4CFQA 5DRGA 2H8QA 1EMKA 2NLNA 2EC6B 4OR9B 3NSLA 4UTSA 4Z4MA 3SVCA 4PDZA 1SRAA 1QXTA 2L50A 2Y0GA 3O78A 3PJ7A 3SVOA 3DPXA 4KF5C 2WNDA 2K7BA 5B8IB 1DJIA 3E3RA 3CFHA 1SPYA 2H5PA 1Q4DA 4JPZB 3EVPA 5HKZA 1UWOA 2M8UA 1PULA 4MSPA 3DQDA 5DTZA 1NPQA 4L13A 2HGDA 1NCZA 1BU3A 3NSKA 4B5YA 3LL8B 1V1FA 4E68A 1XFWO 2MLEC 2SCPA 3DQCA 1PRWA 4W77A 2CCMA 3CB9A 3SIBA 4W72A 1PSRA 2OTBA 3AKOA 1RFJA 2EMNA 3LK1A 2DUFA 2WISA 4PHKA 1HT9A 2AAOA 1GQMA 5EXUA 1GL4A 4LJDA 4OCIA 4CFRA 1JC2A 4A4CA 1WDCB 1CFCA 1XFZO 3E5VA 5EXCI 1OZSA 1K2HA 4WRIA 3NEDA 5CSIA 3DQ4A 3OSRA 2YE0A 3KHEA 2WCEA 1QV0A 1F0BA 1AJ5A 1NX2A 1BJFA 2PRUA 1LINA 5EB7A 1KP5A 4ETOA 2DUHA 5HZSA 3KCSA 5J3XA 2PXWA 4W6FA 5AEQA 3ADFA 1KSMA 3PALA 3SG4A 1B47A 3U0MA 2BBNA 3HX4A 5KTYA 1F8HA 2POXA 1DGVA 1RMMA 5DTXA 3OX5A 2Z6ZA 4W6JA 4OQWA 5D69A 1JC0A 3DQEA 5AQBB 2LHIA 1EMCA 2L0PA 4BY5A 4H3NA 4PHNA 4M2PA 1UP5A 1XYDA 3PJBA 4P5OE 3TDIA 4W6AA 3DPWA 3JVTC 2ISDA 4ZB1A 3DQIA 3RWTA 1SL7A 1EJ3A 4KW4A 2HF5A 2LHLA 3C1VA 1TN4A 1W7TA 3H1RA 2DDCA 4W6OA 3DQHA 1FPWA 3GK2A 4XGYA 2ZO7A 5AFPA 2JNXA 2F3ZA 1QYQA 1SW8A 2LAPA 4MVFA 4MZJA 4P1QA 2PSRA 5DTYA 2LV7A 2Q91A 1UHNA 4HVFA 1OXFA 2M7LA 1UHIA 1UISA 1W7SA 1EXRA 4PPJA 2E6WA 1NX0A 4GOBA 1B4CA 2HQKA 2QRFA 4W7CA 1ZACA 3DVKA 2GW4B 4Q04A 1NP8A 3IR8A 2AWLA 3UFZA 1YR5A 3TZ1A 1OQPA 5CSJA 3LLEA 2JWWA 4CPVA 4IK5A 1MF8B 2OS8B 3W1DA 3IP2A 3U8CA 3WNXB 3SSHA 1KWOB 4YRUA 4EMQA 5BTTB 2NCOA 4DUQA 2MRDA 2CBLA 1Z1QA 4L12A 3O6BA 1MXLC 5DKRA 2BBMA 1RK9A 2JTTA 4XJKB 4P2YB 2GV5A 5FVGA 1KK7Y 3BYAA 3PN7C 5D7FA 4NDCA 4BY4A 2DOQA 4IL1A 4USLA 4KW9A 1QYFA 2QLIA 2G2SB 3I5IC 1J7OA 4W6IA 2YE1A 3CD9A 3AKBA 2YFPA 1SCVA 2G3DB 3DQAA 3WLDA 2KFGA 3SV5A 1XA5A 2K8MB 1S6ZA 1XFVO 4KA9A 4JC2A 1CMGA 1SYMA 1MWNA 2WHTA 4W76A 2BE4A 4KEXA 2ZO6A 2M1UA 2BTJA 1RECA 5LTRA 2LP2A 3TMTA 1L2OC 2BKHB 2GX0A 1SKTA 5PALA 3U8PA 3SG2A 4W6RA 1PVBA 3SG6A 1KK7Z 1HUYA 2HETA 2KGBC 1A75A 3EK8A 2E30A 1XVJA 1B9AA 2VVIA 4I5KA 2L4IA 2EMOA 3BXCA 2K7DA 2AMIA 2BCXA 3SS0A 2KQ6A 1CFPA 1MOUA 2ZMWA 1B8CA 3NXAA 2RH7A 3M24A 1WLZA 1B1GA 4C0LA 2WURA 2K2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNI A;  2RGI A;  5DQM A;  3FWB A;  2M7N A;  2O24 A;  2EGD A;  3VGO A;  1QY3 A;  4LQT A;  2ZFD A;  1B8L A;  1WRL A;  2KFF A;  2QZ0 A;  1X02 A;  5F9G A;  3QRX A;  1W7I B;  4DXI A;  2L2E A;  4M2O A;  3SSL A;  3VRP A;  2G6Y A;  1SY9 A;  1S36 A;  4I5L B;  2BKI B;  5GQQ C;  2K0J A;  2OTG B;  1SCM B;  1U5I B;  3BQ3 A;  2B3Q A;  1FW4 A;  4ORN A;  1ZGQ A;  1VRK A;  1AP4 A;  2KDH A;  3CGL A;  1MOV A;  1RRO A;  3TMR A;  4PE0 A;  1ZGO A;  1EML A;  2M0R A;  4DIR A;  1Q4A A;  2KSP A;  3BX9 A;  3CFA A;  2CNP A;  1J7R A;  4KGE A;  4NDB A;  3U0K A;  2V53 A;  3ST2 A;  3ZTF A;  3I5H C;  1F54 A;  1A4P A;  3D0Y B;  2C9I A;  1WRK A;  4YGA A;  2LMV A;  2SAS A;  4PHM A;  3NT9 A;  1OE9 B;  4QJ5 B;  3VK1 A;  3ZUJ A;  1EMA A;  2FCD A;  1S6J A;  1SR6 C;  2P6B B;  2F3Y A;  5HLO A;  5BPJ A;  3DQ7 A;  3I5F C;  3WXA A;  2ZRS A;  1BT6 A;  2AHA A;  3A4U B;  4MBE A;  3E5W A;  1C4F A;  1YFP A;  3TUY C;  2G3O A;  2LUC A;  2V4E B;  2VAE A;  3TDU A;  1YRU B;  2KGR A;  4OJ0 A;  5H89 A;  2VRG A;  1QX5 B;  3PSR A;  3EK4 A;  1TOP A;  1ZFS A;  3G9A A;  2EMD A;  2KI4 B;  3VRO A;  2KBM A;  3I5G C;  1YHH A;  4PE1 A;  4KGF A;  2DD7 A;  4XYN A;  1DT7 B;  3O4Y A;  3SSY A;  2VAD A;  5DQB A;  1DJX A;  5LTQ A;  1LVC D;  1KK8 B;  4W7A A;  4W69 A;  2LAN A;  2A50 B;  1RJV A;  2IB6 A;  4C0J A;  3LF4 B;  1A29 A;  2LM5 A;  2Q6P A;  1FI5 A;  4ORA B;  2HPW A;  4GES B;  5BT0 A;  2L4H A;  2JOJ A;  2LCP A;  5AER A;  1RTP 1;  1YX8 A;  4Z4K A;  1H8B A;  2WC8 A;  4KF5 A;  1BR4 B;  3TS5 B;  2K7O A;  2LLU A;  4IZN A;  2Q4U A;  2Z6Y A;  1A2X A;  1OMV A;  1CM1 A;  4YGD B;  3BOW A;  3H1O A;  2H61 C;  2QAC A;  4U2V A;  1XA9 A;  3KEV A;  2VVH A;  3JTD C;  4W6U A;  3VHT B;  5DU0 A;  2I7A A;  2HCG A;  2FJU B;  2I2R E;  3MSE B;  4AOM A;  1FI6 A;  3DQJ A;  2KAX A;  2ARL A;  5DPI A;  1F4O A;  1TTX A;  4TNC A;  4W6M A;  4XL5 A;  2EHB A;  4FTG A;  5HYD A;  2ZRT A;  5LTP A;  2D8N A;  5DPJ A;  4Q7U A;  1S26 D;  3VHT A;  4HRE E;  4N5X A;  1G4Y R;  1EH2 A;  2FCE A;  4PPK A;  2A54 B;  3DQ1 A;  1CFD A;  4EUL A;  3GJ2 A;  1AHR A;  4Q7R A;  4OKH A;  4JF9 A;  3AI4 A;  1PAL A;  1TCF A;  1KQM B;  2Q57 A;  2H2K A;  5DRF A;  4MN0 A;  1KSO A;  5ER4 X;  3OP0 A;  5T3I A;  4ORC B;  4W75 A;  1BR1 B;  2HGY A;  2DDD A;  5HZT A;  1YJ2 A;  1ZUX A;  3NEZ A;  2Z1O A;  3ED8 A;  2OPO A;  5HZU A;  1S3P A;  1OOJ A;  4N1G A;  1S1E A;  1SNL A;  3AAJ A;  1GGW A;  1DJW A;  1JFJ A;  3DQO A;  3SSK A;  4I5N B;  3OX6 A;  1V1G A;  2M9G A;  3OB2 B;  4IK1 A;  1MHO A;  2LVJ A;  3CBE A;  4ZCU A;  1K90 D;  2HQZ A;  1JFK A;  4LJB A;  5I8N A;  1YUS A;  5EHU A;  1F55 A;  4N1F A;  3P8U A;  3SJS A;  1CB1 A;  1WDC C;  4MRX A;  1CDM A;  4H3M A;  1J1D A;  1Y1X A;  1CFF A;  1CDL A;  1MYW A;  1DJZ A;  2C9J A;  2IOV A;  4GNK B;  1JWD A;  4LJC A;  2QLE A;  3DQN A;  4KPI A;  4B30 A;  1RMO A;  1MR8 A;  4I5J A;  1QXP A;  1OMR A;  4ZF5 A;  5H88 A;  2KYC A;  3WLC A;  4HE4 A;  2JAD A;  3AI5 A;  3NF0 A;  2LLS A;  2H6V A;  3SVR A;  4ZCV A;  3LVD A;  4QJ4 B;  3VRR A;  4HSZ A;  3RM1 A;  3GK4 X;  1YHG A;  3S05 A;  4HQ9 A;  4DCK A;  2AUC A;  1NX3 A;  2A52 B;  2IB5 A;  5EB6 A;  4W6N A;  1G33 A;  4EDS A;  4W7D A;  1IWQ A;  4HRH A;  1LKJ A;  2KHN A;  4C0K A;  4Q7T A;  1CKK A;  3GB3 A;  2BL0 B;  1JSA A;  2LVI A;  2WIQ A;  1CDN A;  1XFU O;  1M39 A;  3CR2 A;  3I5I B;  4LW5 A;  2HFC A;  2CXJ A;  1DJG A;  3WHT B;  2M29 A;  4OGS A;  3PJ5 A;  3M22 A;  3LVC A;  1UUS A;  1YUT A;  4GBA A;  4JGE A;  3BUN B;  1G7K A;  5CSF A;  3DD4 A;  1UHJ A;  4YGB B;  4M2Q A;  4YI8 A;  4W6T A;  1RMP A;  1IRJ A;  1L2O B;  3A8R A;  3E5T A;  1J7P A;  2LLT A;  3DF0 A;  3CFF A;  3PFV A;  2K61 A;  4ZF3 A;  1OSA A;  1Q4B A;  1QYO A;  2OKW A;  1LXF C;  1YX7 A;  1IH0 A;  1SL8 A;  3OHM B;  3PM8 A;  3WHU B;  2ZN9 A;  1XFY O;  2M1K B;  3EKJ A;  2OS8 C;  4WQ2 A;  2FZU A;  4OHS A;  1A75 B;  2A48 A;  1YUR A;  1KWO C;  3AKA A;  4MEW A;  2M3W A;  3CLN A;  1EMG A;  2Y1N A;  3OGO A;  4EN1 A;  5FHV A;  1FF1 A;  4ZIN A;  2BEC A;  4DXO A;  1HCJ A;  1BOD A;  1H4U A;  3DQ5 A;  4CLN A;  3LVA A;  2M49 B;  3EKH A;  2WCF A;  1ZGP A;  1S5G Y;  1NCX A;  2A47 A;  3RLZ A;  4EDO A;  4YI9 A;  1PK0 D;  1WY9 A;  1ALV A;  1NUB A;  2KBI A;  2H9W A;  4RYW A;  2GGZ A;  1IJ6 A;  3VIC A;  1KCY A;  3GL4 A;  1YTZ C;  4FQO A;  5DTL A;  4KAG A;  3KPX A;  4W6G A;  1TNW A;  4DS7 A;  1M63 B;  5HBD A;  2TN4 A;  4RTC A;  2HQ8 A;  3U8A A;  4H48 A;  1JUO A;  1KFU S;  3SVD A;  4XOW A;  1SBJ A;  3SVN A;  1ALW A;  2Z6X A;  2JXC A;  3I5H B;  4W7E A;  1Y6W A;  5DY6 A;  2I18 A;  2GW3 A;  1JF0 A;  2LMT A;  2OJK A;  1QAT A;  1S5G Z;  2G5Z B;  4HQC A;  3PIB A;  1J55 A;  4ICB A;  3BXB A;  5J2O A;  3I5F B;  1XK4 C;  2MLF C;  5G08 A;  2JUL A;  1OZO A;  2LVK A;  4W74 A;  3SG7 A;  2PVB A;  3F45 A;  1RWY A;  4ZFS A;  2BCB A;  1DF0 A;  4JFG A;  4PCW A;  2OKY A;  5HKY A;  3EK7 A;  2QPT A;  1OXE A;  3O77 A;  1QVI Y;  1UUR A;  2LE9 B;  2L51 A;  1W7U A;  3HCM A;  3KF9 A;  3BUM B;  3PLF B;  5KU1 A;  2H5Q A;  4J88 A;  2JT8 A;  4ANJ A;  3SSP A;  4WQ3 A;  1EMF A;  1UHK A;  3LK0 A;  3O2P A;  4GGN A;  3EVV A;  3DQ3 A;  5EJU A;  3GJ1 A;  2I94 A;  4ORB B;  1QS7 A;  1SCM C;  2B3P A;  2F2P A;  5DPG A;  1KFU L;  2M97 A;  4L1I A;  2KYF A;  1C7W A;  2ZN8 A;  4W6K A;  4W7F A;  2KAY A;  2O60 A;  1JF2 A;  2HJO A;  4J8A A;  1CLM A;  1L7Z A;  1QVI Z;  1Y0V H;  1M46 A;  3FS7 A;  1WLM A;  3UG0 A;  4U8D A;  4GGF C;  4I2Y A;  4H47 A;  1ODB A;  4KW8 A;  3FIA A;  2AH8 A;  4TZA A;  4YBH B;  1IG5 A;  1KFX S;  5I2Q A;  4R6B A;  1ZUZ A;  3CR5 X;  3K21 A;  4GF6 B;  4XOV A;  2QLG A;  3CD1 A;  3ST4 A;  2R2I A;  3LF3 A;  2WCB A;  2ICR A;  2L5X B;  3JTD B;  1IQ3 A;  3BOW B;  1CTR A;  2JRF A;  2H5R A;  1Q80 A;  5IBW A;  1BG1 A;  2H61 A;  2COL B;  2HQW A;  4UPG A;  1NIW A;  1QV1 A;  4PE4 A;  4IK8 A;  1AVS A;  2ZMU A;  1BOC A;  1JBA A;  5ER5 A;  3DQ2 A;  3ICB A;  1XSS A;  2BCA A;  4JWQ A;  5KTG A;  3SVU A;  1EG3 A;  2JXL A;  4NDD A;  2ZNE A;  4W6L A;  3U0N A;  1GGZ A;  4DXN A;  1AUI B;  2HPS A;  3U0L A;  1KK8 C;  4AQI A;  4MZL A;  4PAL A;  2P4M A;  2LC5 A;  1XMZ A;  1GJY A;  1FBV A;  4KF4 A;  3DQU A;  2JPT A;  4DXP A;  3SG3 A;  4CID A;  3SG5 A;  4NQG A;  1MXE A;  1SMG A;  1EMB A;  1KFX L;  3NSI A;  1HQV A;  2PXS A;  4J89 A;  2GX2 A;  2LMU A;  1PVA A;  3DVM A;  3TS5 C;  3SIA A;  2EC6 C;  5K89 A;  1CNP A;  4W6C A;  2QT2 A;  2QLH A;  1IGV A;  4OV2 A;  1C07 A;  3NSO A;  2WSO A;  2KFH A;  4A4B A;  2PAL A;  1TRF A;  1S6C A;  2VZX A;  2JC2 A;  3IQO A;  2MBX A;  5EXB A;  1TCO B;  4HRG A;  2DD9 A;  2DUG A;  1K8U A;  2LP3 A;  3CGA A;  1YVL A;  2A53 B;  1CLL A;  4W6B A;  1F09 A;  1K94 A;  4HQ8 A;  2BE6 A;  3JVT B;  4OVN F;  2O5G A;  1F70 A;  4LJD C;  1TNX A;  1KYS A;  1IKU A;  4DKM A;  3IF7 A;  5JOL A;  3DPZ A;  1NYA A;  4BDU A;  1TNQ A;  5TNC A;  4B30 B;  1YJF A;  1QLS A;  5LK4 A;  2IE2 A;  1KQM C;  1QAS A;  1GGX A;  3OB1 B;  2AWK A;  4GPL B;  3GEX A;  1ZOT B;  3ZUF A;  2O2B A;  1XQM A;  2K2F A;  5DPH A;  3GOF A;  1J1E A;  2VVJ A;  4ZF4 A;  1DTL A;  3BXA A;  1DMO A;  3CWG A;  2G6X A;  1BMO A;  4DXQ A;  2LUX A;  1LA3 A;  4IK9 A;  1IJ5 A;  1QX2 A;  5BQL A;  1N0Y A;  1BLQ A;  1RM9 A;  1CLB A;  2DUE A;  5CSN A;  2KOT A;  3A8S A;  1YZW A;  1NSH A;  1K9P A;  1CMF A;  4P76 A;  3KCT A;  4GFT A;  4JRB A;  5EBJ A;  3I19 A;  3AAK A;  1XAE A;  5H87 A;  4D1E A;  1CV7 A;  4ZBL A;  5FVI A;  1QJT A;  3PN7 B;  4OY4 A;  4YGC B;  2DUI A;  1JC1 A;  1DGU A;  4R6D A;  1N2D A;  1JBY A;  2WSN A;  1CDP A;  2G9B A;  4PE7 A;  1KQV A;  1TNP A;  1EG4 A;  5CPV A;  2AWM A;  3KO0 A;  3DF0 B;  1J7Q A;  2JT0 A;  1XO5 A;  3LCP C;  1DJY A;  2ZKM X;  1Z1P A;  3H4S E;  2KQY A;  4QJ3 B;  3CS1 A;  5AAN A;  2AWJ A;  4F0Z B;  1QX7 A;  5F6T A;  2MAZ A;  1LA0 A;  3MGF A;  1R2U A;  4MRY A;  5DKQ A;  4DRW A;  4PHJ A;  2JTZ A;  2B1U A;  1EMM A;  3CTN A;  4AR7 A;  4IK4 A;  5BTT A;  4MLW A;  1B7T Y;  2BL0 C;  1OXD A;  3EVU A;  1N65 A;  1K9U A;  4XJK A;  1QLK A;  4TZG A;  3D10 A;  1YVH A;  1OMD A;  3DVJ A;  3ZUL A;  3P28 A;  3DQ9 A;  3LA1 A;  4W6P A;  3SVE A;  5AXI A;  3BUX B;  1MQ1 A;  2FL1 A;  4PFE A;  1AK8 A;  1K93 D;  3EVR A;  3ST3 A;  1E8A A;  4GUK A;  3BXK A;  2KNE A;  2A56 B;  4YGE B;  1A03 A;  1SL9 A;  3K1K A;  3BUW B;  1K95 A;  2PAS A;  1D1O A;  1C7V A;  1UHH A;  3DQL A;  4W7R A;  5FYX A;  1SK6 D;  2Y4Q A;  4RYS A;  4MZK A;  3PAT A;  2MJW B;  1B7T Z;  1JBZ A;  1XFX O;  3DQ8 A;  2G16 B;  4W73 A;  4ZIO A;  3RWA A;  2LNK A;  3LSA A;  2G2B A;  2JQ6 A;  3DQ6 A;  1H6R A;  2JU0 A;  1B9C A;  2WHU A;  1K9K A;  2NZ0 A;  4Q9X A;  3ZWH A;  4H3L A;  1BF5 A;  1NCY A;  1XK4 A;  5KSZ A;  2F33 A;  1YRT B;  1TIZ A;  1DF0 B;  1Q4C A;  5HKW A;  4JEO A;  2GGM A;  2WOS A;  1SR6 B;  1KYR A;  3VRN A;  3NT3 A;  1PSB A;  2JNF A;  2WHS A;  1Q73 A;  1R6P A;  1RRX A;  1QIW A;  2OTE A;  3CR4 X;  2K7C A;  3TUY B;  4W7X A;  1AJ4 A;  1DJH A;  4Q9W A;  4PPL A;  2F2O A;  3DQK A;  2QU1 A;  2ZND A;  2CT9 A;  2YDZ A;  3BUO B;  4IK3 A;  1IQ5 A;  3ST0 A;  1EL4 A;  3SSV A;  1U5I A;  1GFL A;  2KI6 C;  1Y1A A;  3I5G B;  4LQU A;  4JQ0 D;  1YHI A;  3W1C A;  4GAO A;  3IQQ A;  1WRZ A;  2F8P A;  1NX1 A;  3SVS A;  2LVV A;  2OTG C;  2Y5I A;  5JJG A;  4W6S A;  3SST A;  4DKN A;  1Q4E A;  4GGF A;  2L98 A;  3D0Y A;  1KYP A;  5I2O A;  2H5O A;  2FWQ A;  1S6I A;  1QTX A;  2IS9 A;  1NWD A;  2QLG B;  3DQM A;  3V3D A;  1G8I A;  4NWS A;  2NCP A;  2NXQ A;  1F71 A;  4W6D A;  4R1E A;  2JZI A;  2MHH A;  1QIV A;  3FWC A;  1YUU A;  4DXM A;  1ZMZ A;  3DQF A;  3WCK A;  1B8R A;  2A46 A;  1M45 A;  2G6E A;  5DKN A;  3SVB A;  1K96 A;  5I2L A;  3TDZ A;  3LS3 A;  2KI6 D;  5HW9 A;  2V4E A;  1Y1U A;  4N3D A;  2OGR A;  2PMY A;  1M31 A;  4AS8 A;  1H4B A;  3DVE A;  2CTN A;  2KAV A;  5HGE A;  1EME A;  3SRY A;  2V4E C;  2A4J A;  3CZT X;  5FVF A;  3OSQ A;  1BFP A;  2WOR A;  2Y1M A;  4AQJ A;  5HZO A;  3M0W A;  4L9M A;  2KI4 C;  1CM4 A;  1MUX A;  1F4Q A;  5HLV A;  2HRS A;  1DVI A;  2MA2 A;  1W7J B;  4XVP A;  4W6H A;  2O29 A;  3GK1 A;  2JT3 A;  2FOT A;  3VRQ A;  4CFQ A;  5DRG A;  2H8Q A;  1EMK A;  2NLN A;  2EC6 B;  4OR9 B;  3NSL A;  4UTS A;  4Z4M A;  3SVC A;  4PDZ A;  1SRA A;  1QXT A;  2L50 A;  2Y0G A;  3O78 A;  3PJ7 A;  3SVO A;  3DPX A;  4KF5 C;  2WND A;  2K7B A;  5B8I B;  1DJI A;  3E3R A;  3CFH A;  1SPY A;  2H5P A;  1Q4D A;  4JPZ B;  3EVP A;  5HKZ A;  1UWO A;  2M8U A;  1PUL A;  4MSP A;  3DQD A;  5DTZ A;  1NPQ A;  4L13 A;  2HGD A;  1NCZ A;  1BU3 A;  3NSK A;  4B5Y A;  3LL8 B;  1V1F A;  4E68 A;  1XFW O;  2MLE C;  2SCP A;  3DQC A;  1PRW A;  4W77 A;  2CCM A;  3CB9 A;  3SIB A;  4W72 A;  1PSR A;  2OTB A;  3AKO A;  1RFJ A;  2EMN A;  3LK1 A;  2DUF A;  2WIS A;  4PHK A;  1HT9 A;  2AAO A;  1GQM A;  5EXU A;  1GL4 A;  4LJD A;  4OCI A;  4CFR A;  1JC2 A;  4A4C A;  1WDC B;  1CFC A;  1XFZ O;  3E5V A;  5EXC I;  1OZS A;  1K2H A;  4WRI A;  3NED A;  5CSI A;  3DQ4 A;  3OSR A;  2YE0 A;  3KHE A;  2WCE A;  1QV0 A;  1F0B A;  1AJ5 A;  1NX2 A;  1BJF A;  2PRU A;  1LIN A;  5EB7 A;  1KP5 A;  4ETO A;  2DUH A;  5HZS A;  3KCS A;  5J3X A;  2PXW A;  4W6F A;  5AEQ A;  3ADF A;  1KSM A;  3PAL A;  3SG4 A;  1B47 A;  3U0M A;  2BBN A;  3HX4 A;  5KTY A;  1F8H A;  2POX A;  1DGV A;  1RMM A;  5DTX A;  3OX5 A;  2Z6Z A;  4W6J A;  4OQW A;  5D69 A;  1JC0 A;  3DQE A;  5AQB B;  2LHI A;  1EMC A;  2L0P A;  4BY5 A;  4H3N A;  4PHN A;  4M2P A;  1UP5 A;  1XYD A;  3PJB A;  4P5O E;  3TDI A;  4W6A A;  3DPW A;  3JVT C;  2ISD A;  4ZB1 A;  3DQI A;  3RWT A;  1SL7 A;  1EJ3 A;  4KW4 A;  2HF5 A;  2LHL A;  3C1V A;  1TN4 A;  1W7T A;  3H1R A;  2DDC A;  4W6O A;  3DQH A;  1FPW A;  3GK2 A;  4XGY A;  2ZO7 A;  5AFP A;  2JNX A;  2F3Z A;  1QYQ A;  1SW8 A;  2LAP A;  4MVF A;  4MZJ A;  4P1Q A;  2PSR A;  5DTY A;  2LV7 A;  2Q91 A;  1UHN A;  4HVF A;  1OXF A;  2M7L A;  1UHI A;  1UIS A;  1W7S A;  1EXR A;  4PPJ A;  2E6W A;  1NX0 A;  4GOB A;  1B4C A;  2HQK A;  2QRF A;  4W7C A;  1ZAC A;  3DVK A;  2GW4 B;  4Q04 A;  1NP8 A;  3IR8 A;  2AWL A;  3UFZ A;  1YR5 A;  3TZ1 A;  1OQP A;  5CSJ A;  3LLE A;  2JWW A;  4CPV A;  4IK5 A;  1MF8 B;  2OS8 B;  3W1D A;  3IP2 A;  3U8C A;  3WNX B;  3SSH A;  1KWO B;  4YRU A;  4EMQ A;  5BTT B;  2NCO A;  4DUQ A;  2MRD A;  2CBL A;  1Z1Q A;  4L12 A;  3O6B A;  1MXL C;  5DKR A;  2BBM A;  1RK9 A;  2JTT A;  4XJK B;  4P2Y B;  2GV5 A;  5FVG A;  1KK7 Y;  3BYA A;  3PN7 C;  5D7F A;  4NDC A;  4BY4 A;  2DOQ A;  4IL1 A;  4USL A;  4KW9 A;  1QYF A;  2QLI A;  2G2S B;  3I5I C;  1J7O A;  4W6I A;  2YE1 A;  3CD9 A;  3AKB A;  2YFP A;  1SCV A;  2G3D B;  3DQA A;  3WLD A;  2KFG A;  3SV5 A;  1XA5 A;  2K8M B;  1S6Z A;  1XFV O;  4KA9 A;  4JC2 A;  1CMG A;  1SYM A;  1MWN A;  2WHT A;  4W76 A;  2BE4 A;  4KEX A;  2ZO6 A;  2M1U A;  2BTJ A;  1REC A;  5LTR A;  2LP2 A;  3TMT A;  1L2O C;  2BKH B;  2GX0 A;  1SKT A;  5PAL A;  3U8P A;  3SG2 A;  4W6R A;  1PVB A;  3SG6 A;  1KK7 Z;  1HUY A;  2HET A;  2KGB C;  1A75 A;  3EK8 A;  2E30 A;  1XVJ A;  1B9A A;  2VVI A;  4I5K A;  2L4I A;  2EMO A;  3BXC A;  2K7D A;  2AMI A;  2BCX A;  3SS0 A;  2KQ6 A;  1CFP A;  1MOU A;  2ZMW A;  1B8C A;  3NXA A;  2RH7 A;  3M24 A;  1WLZ A;  1B1G A;  4C0L A;  2WUR A;  2K2A A; 
#chains in the Genus database with same CATH topology
 3ZNI A;  2RGI A;  5DQM A;  3FWB A;  2M7N A;  2O24 A;  2EGD A;  3VGO A;  1QY3 A;  4LQT A;  2ZFD A;  1B8L A;  1WRL A;  2KFF A;  2QZ0 A;  1X02 A;  5F9G A;  3QRX A;  1W7I B;  4DXI A;  5HL1 A;  2L2E A;  4M2O A;  3SSL A;  1TUZ A;  3VRP A;  2G6Y A;  1SY9 A;  1S36 A;  4I5L B;  2BKI B;  5GQQ C;  2K0J A;  2OTG B;  1SCM B;  1U5I B;  2K60 A;  3BQ3 A;  2B3Q A;  1FW4 A;  4ORN A;  1ZGQ A;  1VRK A;  1AP4 A;  2KDH A;  3CGL A;  1MOV A;  1RRO A;  3TMR A;  4PE0 A;  1ZGO A;  1EML A;  2M0R A;  4DIR A;  1Q4A A;  2KSP A;  3BX9 A;  3CFA A;  2CNP A;  1J7R A;  4KGE A;  4NDB A;  3U0K A;  2V53 A;  3ST2 A;  3ZTF A;  3I5H C;  1F54 A;  1A4P A;  3D0Y B;  2C9I A;  1WRK A;  4YGA A;  2LMV A;  2SAS A;  4PHM A;  3NT9 A;  1OE9 B;  4QJ5 B;  3VK1 A;  3ZUJ A;  1EMA A;  2L5Y A;  2FCD A;  1S6J A;  1SR6 C;  2P6B B;  2F3Y A;  5HLO A;  5BPJ A;  3DQ7 A;  3I5F C;  3PM2 A;  3WXA A;  2ZRS A;  1BT6 A;  2AHA A;  3A4U B;  4MBE A;  3E5W A;  1C4F A;  3R1V A;  1YFP A;  3TUY C;  2G3O A;  2LUC A;  4INW A;  2V4E B;  2VAE A;  3TDU A;  1YRU B;  2KGR A;  4OJ0 A;  5H89 A;  2VRG A;  1QX5 B;  3PSR A;  3EK4 A;  1TOP A;  3D77 A;  1ZFS A;  3G9A A;  2EMD A;  2KI4 B;  3VRO A;  3D75 A;  2KBM A;  4JD9 A;  3I5G C;  1YHH A;  2WC5 A;  4PE1 A;  4KGF A;  2DD7 A;  4XYN A;  1DT7 B;  3O4Y A;  3SSY A;  2VAD A;  5DQB A;  1DJX A;  5LTQ A;  3D74 A;  1LVC D;  1KK8 B;  4W7A A;  4W69 A;  2LAN A;  2A50 B;  1RJV A;  2IB6 A;  4C0J A;  3LF4 B;  1A29 A;  2LM5 A;  2Q6P A;  1FI5 A;  4ORA B;  2HPW A;  4GES B;  5BT0 A;  2L4H A;  2JOJ A;  2LCP A;  5AER A;  1RTP 1;  1YX8 A;  5FI2 A;  4Z4K A;  1H8B A;  2WC8 A;  4KF5 A;  1BR4 B;  3TS5 B;  2K7O A;  2LLU A;  2Q4U A;  4IZN A;  2Z6Y A;  1A2X A;  1OMV A;  1CM1 A;  4YGD B;  3CDN A;  3BOW A;  3H1O A;  2H61 C;  2QAC A;  4U2V A;  1XA9 A;  3KEV A;  2VVH A;  3JTD C;  1OW4 A;  4W6U A;  3VHT B;  5DU0 A;  2I7A A;  2HCG A;  2FJU B;  2I2R E;  3MSE B;  4AOM A;  1FI6 A;  3DQJ A;  2KAX A;  2ARL A;  5DPI A;  1F4O A;  1TTX A;  4TNC A;  4W6M A;  4XL5 A;  3QME A;  2EHB A;  4FTG A;  5HYD A;  2ZRT A;  5LTP A;  2D8N A;  5DPJ A;  4Q7U A;  1S26 D;  3VHT A;  4HRE E;  4N5X A;  1G4Y R;  1EH2 A;  2FCE A;  4PPK A;  2A54 B;  3DQ1 A;  1CFD A;  4EUL A;  3GJ2 A;  1AHR A;  4Q7R A;  4OKH A;  4JF9 A;  3AI4 A;  1PAL A;  1TCF A;  1KQM B;  2Q57 A;  2H2K A;  5DRF A;  4MN0 A;  1KSO A;  5ER4 X;  3OP0 A;  5T3I A;  4ORC B;  4W75 A;  1BR1 B;  2HGY A;  2DDD A;  5HZT A;  3CZ1 A;  4JKT A;  1YJ2 A;  1ZUX A;  3NEZ A;  2Z1O A;  3ED8 A;  2OPO A;  5HZU A;  1S3P A;  1OOJ A;  4N1G A;  1S1E A;  1SNL A;  3AAJ A;  1GGW A;  3FE9 A;  1DJW A;  1JFJ A;  3Q8I A;  3DQO A;  3SSK A;  4I5N B;  3OX6 A;  1V1G A;  2M9G A;  3OB2 B;  4IK1 A;  1MHO A;  2LVJ A;  3CBE A;  4ZCU A;  1K90 D;  3UO9 A;  2HQZ A;  1JFK A;  4LJB A;  5I8N A;  1YUS A;  5EHU A;  1F55 A;  4N1F A;  3P8U A;  3SJS A;  1CB1 A;  1WDC C;  4MRX A;  1CDM A;  4H3M A;  1J1D A;  1Y1X A;  1CFF A;  1CDL A;  1MYW A;  1DJZ A;  2C9J A;  2IOV A;  2JPO A;  4GNK B;  1JWD A;  3RZS A;  4LJC A;  2QLE A;  3DQN A;  4KPI A;  4B30 A;  1RMO A;  1Z4H A;  1MR8 A;  4I5J A;  1QXP A;  1OMR A;  4ZF5 A;  5H88 A;  2KYC A;  3WLC A;  4HE4 A;  3BFA A;  2JAD A;  3AI5 A;  3NF0 A;  2LLS A;  2H6V A;  3SVR A;  4ZCV A;  3LVD A;  4QJ4 B;  3VRR A;  1XFR A;  4HSZ A;  3RM1 A;  3GK4 X;  1YHG A;  4IJ7 A;  3S05 A;  4HQ9 A;  4DCK A;  2AUC A;  3D78 A;  1NX3 A;  2A52 B;  2IB5 A;  5EB6 A;  4W6N A;  1G33 A;  4EDS A;  4W7D A;  1IWQ A;  4HRH A;  1LKJ A;  2KHN A;  4C0K A;  4Q7T A;  1CKK A;  3GB3 A;  2BL0 B;  1JSA A;  2LVI A;  2WIQ A;  1CDN A;  1XFU O;  1M39 A;  2H8V A;  3CR2 A;  2ERB A;  3DY9 A;  3I5I B;  4LW5 A;  2HFC A;  2CXJ A;  1DJG A;  3WHT B;  2M29 A;  4OGS A;  3PJ5 A;  3M22 A;  3LVC A;  1UUS A;  1YUT A;  4GBA A;  1W9Z A;  4JGE A;  3BUN B;  1G7K A;  5CSF A;  3DD4 A;  1UHJ A;  3BFH A;  4YGB B;  4M2Q A;  4YI8 A;  4W6T A;  1RMP A;  1IRJ A;  1L2O B;  3A8R A;  1IIO A;  5I94 A;  3E5T A;  1J7P A;  2LLT A;  3DF0 A;  3CFF A;  3PFV A;  2K61 A;  4ZF3 A;  1OSA A;  1Q4B A;  1QYO A;  2OKW A;  1LXF C;  1YX7 A;  2QEV A;  1IH0 A;  1SL8 A;  3OHM B;  2L2C A;  3PM8 A;  3WHU B;  2ZN9 A;  1OOI X;  1XFY O;  2M1K B;  3EKJ A;  2OS8 C;  4WQ2 A;  2FZU A;  4OHS A;  1A75 B;  2A48 A;  1YUR A;  1KWO C;  3AKA A;  4MEW A;  2M3W A;  3CLN A;  1EMG A;  2Y1N A;  3OGO A;  4EN1 A;  5FHV A;  1FF1 A;  4ZIN A;  2BEC A;  4DXO A;  1HCJ A;  1BOD A;  1H4U A;  3DQ5 A;  4CLN A;  2WCM A;  3L4A A;  3LVA A;  2M49 B;  3EKH A;  2WCF A;  1ZGP A;  3CAB A;  1S5G Y;  1NCX A;  2A47 A;  3RLZ A;  4EDO A;  4YI9 A;  1PK0 D;  1WY9 A;  1ALV A;  1NUB A;  2KBI A;  2H9W A;  4RYW A;  2GGZ A;  1IJ6 A;  3VIC A;  1KCY A;  3GL4 A;  1YTZ C;  4FQO A;  5DTL A;  4KAG A;  3KPX A;  4W6G A;  1TNW A;  4DS7 A;  3UNW A;  1M63 B;  5HBD A;  2TN4 A;  4RTC A;  2HQ8 A;  3U8A A;  4H48 A;  1JUO A;  1KFU S;  3SVD A;  4XOW A;  1SBJ A;  3SVN A;  1ALW A;  2Z6X A;  2P70 A;  2JXC A;  3I5H B;  3FE8 A;  4W7E A;  1Y6W A;  5DY6 A;  2I18 A;  2GW3 A;  1JF0 A;  2LMT A;  2OJK A;  1QAT A;  1S5G Z;  2G5Z B;  1OOF A;  4HQC A;  3PIB A;  1J55 A;  4ICB A;  3BXB A;  5J2O A;  3I5F B;  1XK4 C;  2MLF C;  5G08 A;  2JUL A;  1OZO A;  2LVK A;  4W74 A;  3SG7 A;  1P28 A;  2PVB A;  3F45 A;  1RWY A;  4ZFS A;  2BCB A;  1DF0 A;  4JFG A;  4PCW A;  2OKY A;  5HKY A;  3EK7 A;  2QPT A;  1OXE A;  3O77 A;  1QVI Y;  1UUR A;  2LE9 B;  2L51 A;  1W7U A;  3HCM A;  3KF9 A;  3BUM B;  3PLF B;  5KU1 A;  2H5Q A;  1T14 A;  3R1P A;  2WCJ A;  4J88 A;  2JT8 A;  4ANJ A;  3SSP A;  4WQ3 A;  1EMF A;  1UHK A;  3LK0 A;  3O2P A;  4GGN A;  3EVV A;  3DQ3 A;  5EJU A;  3GJ1 A;  2I94 A;  4ORB B;  1QS7 A;  1SCM C;  2B3P A;  2F2P A;  5DPG A;  1KFU L;  2M97 A;  4L1I A;  2KYF A;  1C7W A;  2ZN8 A;  4W6K A;  4W7F A;  2KAY A;  2O60 A;  1JF2 A;  2HJO A;  4J8A A;  1CLM A;  1L7Z A;  1QVI Z;  1Y0V H;  1M46 A;  2QDI A;  3FS7 A;  1WLM A;  3UG0 A;  1C3Y A;  4U8D A;  4GGF C;  4I2Y A;  4H47 A;  1ODB A;  4KW8 A;  3FIA A;  2AH8 A;  4TZA A;  4YBH B;  1IG5 A;  1KFX S;  5I2Q A;  4R6B A;  1ZUZ A;  3CR5 X;  3K21 A;  4GF6 B;  4XOV A;  2QLG A;  3CD1 A;  3ST4 A;  3K1E A;  2PQL A;  2R2I A;  3LF3 A;  2WCB A;  2ICR A;  2L5X B;  3JTD B;  1IQ3 A;  3BOW B;  1CTR A;  2JRF A;  2H5R A;  1Q80 A;  5IBW A;  1BG1 A;  2H61 A;  2COL B;  2HQW A;  4UPG A;  1NIW A;  1QV1 A;  4PE4 A;  1DEL A;  4IK8 A;  1AVS A;  3L4L A;  2ZMU A;  1BOC A;  1JBA A;  2KLE A;  1SSE B;  5ER5 A;  3DQ2 A;  3ICB A;  1XSS A;  2BCA A;  4JWQ A;  5KTG A;  3SVU A;  1EG3 A;  2JXL A;  4NDD A;  2ZNE A;  4W6L A;  3U0N A;  1GGZ A;  4DXN A;  1AUI B;  2HPS A;  3U0L A;  3O4X A;  1KK8 C;  2YGU A;  4AQI A;  4MZL A;  4PAL A;  2P4M A;  2LC5 A;  1XMZ A;  2KPH A;  1GJY A;  1FBV A;  4KF4 A;  3DQU A;  2JPT A;  1DC1 A;  3D73 A;  4DXP A;  3CYZ A;  3SG3 A;  3NGV A;  4CID A;  3SG5 A;  4NQG A;  1MXE A;  1SMG A;  1EMB A;  1KFX L;  3NSI A;  1HQV A;  2PXS A;  4J89 A;  2GX2 A;  2LMU A;  1PVA A;  3DVM A;  3TS5 C;  3SIA A;  2EC6 C;  5K89 A;  1CNP A;  4W6C A;  3N7H A;  2QT2 A;  2QLH A;  3B7A A;  1IGV A;  4OV2 A;  1C07 A;  3NSO A;  2WSO A;  2KFH A;  4A4B A;  2PAL A;  3S0G A;  1TRF A;  1S6C A;  2VZX A;  2JC2 A;  3IQO A;  2MBX A;  2PYQ A;  5EXB A;  1TCO B;  4HRG A;  2DD9 A;  2DUG A;  1K8U A;  2LP3 A;  3CGA A;  1YVL A;  2A53 B;  1CLL A;  4W6B A;  1F09 A;  1K94 A;  3S0F A;  4HQ8 A;  2BE6 A;  3JVT B;  4OVN F;  2O5G A;  1F70 A;  4LJD C;  1TNX A;  1KYS A;  1IKU A;  4DKM A;  3B87 A;  3IF7 A;  1OOH A;  5JOL A;  3DPZ A;  1NYA A;  4BDU A;  1TNQ A;  5TNC A;  4B30 B;  1YJF A;  2BAP A;  1QLS A;  5LK4 A;  2IE2 A;  1KQM C;  1QAS A;  1GGX A;  3IVT A;  2BNX A;  3OB1 B;  2AWK A;  4GPL B;  3GEX A;  1ZOT B;  3ZUF A;  2O2B A;  1XQM A;  1LS8 A;  2K2F A;  5DPH A;  3GOF A;  1J1E A;  2VVJ A;  5D3O A;  1DTL A;  4ZF4 A;  3BXA A;  1DMO A;  3CWG A;  2G6X A;  1BMO A;  4DXQ A;  2LUX A;  1LA3 A;  4IK9 A;  1IJ5 A;  1QX2 A;  5BQL A;  1N0Y A;  1BLQ A;  1RM9 A;  1CLB A;  2DUE A;  5CSN A;  2KOT A;  3A8S A;  1YZW A;  1NSH A;  1K9P A;  1CMF A;  4P76 A;  3KCT A;  4GFT A;  4JRB A;  5EBJ A;  3I19 A;  3AAK A;  1XAE A;  5H87 A;  4D1E A;  1CV7 A;  4ZBL A;  5FVI A;  1QJT A;  3PN7 B;  4OY4 A;  4YGC B;  2DUI A;  1JC1 A;  1DGU A;  5EL2 A;  4R6D A;  1N2D A;  1JBY A;  2WSN A;  1CDP A;  1TWO A;  2G9B A;  4PE7 A;  1KQV A;  1TNP A;  3S0B A;  1EG4 A;  5CPV A;  4PT1 A;  2AWM A;  3KO0 A;  3DF0 B;  1J7Q A;  2JT0 A;  1XO5 A;  3LCP C;  1DJY A;  2ZKM X;  1Z1P A;  3H4S E;  2WC6 A;  2KQY A;  4QJ3 B;  3CS1 A;  5AAN A;  2AWJ A;  4F0Z B;  1QX7 A;  5F6T A;  2MAZ A;  1LA0 A;  3MGF A;  2WCH A;  1R2U A;  4MRY A;  5DKQ A;  4DRW A;  4PHJ A;  2JTZ A;  2B1U A;  1EMM A;  3CTN A;  4AR7 A;  4IK4 A;  5BTT A;  4MLW A;  1B7T Y;  2BL0 C;  1OXD A;  3EVU A;  1N65 A;  1K9U A;  4XJK A;  1QLK A;  4TZG A;  3D10 A;  1YVH A;  1OMD A;  3DVJ A;  3S0D A;  3ZUL A;  2KLD A;  3P28 A;  3DQ9 A;  2FJY A;  3LA1 A;  4W6P A;  3SVE A;  5AXI A;  3BUX B;  1MQ1 A;  2FL1 A;  3PJI A;  2QEB A;  4PFE A;  1AK8 A;  1K93 D;  3EVR A;  3ST3 A;  1E8A A;  4GUK A;  3BXK A;  2KNE A;  2A56 B;  4YGE B;  1A03 A;  1SL9 A;  3K1K A;  3BUW B;  1K95 A;  2PAS A;  1D1O A;  1C7V A;  1UHH A;  3DQL A;  4W7R A;  5FYX A;  1SK6 D;  2Y4Q A;  4RYS A;  4MZK A;  3PAT A;  2MJW B;  1B7T Z;  3V2L A;  1JBZ A;  1XFX O;  3DQ8 A;  2G16 B;  4W73 A;  4ZIO A;  2WCL A;  3D76 A;  3BJH A;  3RWA A;  2LNK A;  3LSA A;  2G2B A;  2JQ6 A;  3DQ6 A;  1H6R A;  2JU0 A;  1B9C A;  2WHU A;  1K9K A;  2GTE A;  2NZ0 A;  4Q9X A;  3ZWH A;  4H3L A;  3NHI A;  1BF5 A;  1NCY A;  1XK4 A;  5KSZ A;  2F33 A;  3CZ2 A;  1YRT B;  1TIZ A;  1DF0 B;  1Q4C A;  5HKW A;  4JEO A;  2GGM A;  2WOS A;  1SR6 B;  3B6X A;  1KYR A;  3VRN A;  3NT3 A;  1PSB A;  2JNF A;  2WHS A;  1Q73 A;  1R6P A;  1RRX A;  1QIW A;  2OTE A;  3CR4 X;  4FQT A;  2K7C A;  3TUY B;  4W7X A;  1AJ4 A;  1DJH A;  4Q9W A;  4PPL A;  2F2O A;  4OZD A;  3DQK A;  2QU1 A;  2ZND A;  2CT9 A;  2YDZ A;  3BUO B;  4IK3 A;  1IQ5 A;  3ST0 A;  1EL4 A;  3SSV A;  1U5I A;  1GFL A;  2KI6 C;  1Y1A A;  3I5G B;  4LQU A;  4JQ0 D;  1YHI A;  3W1C A;  4GAO A;  3IQQ A;  1WRZ A;  4KYN A;  2F8P A;  1NX1 A;  3SVS A;  2LVV A;  2OTG C;  2Y5I A;  5JJG A;  4W6S A;  3SST A;  4DKN A;  1Q4E A;  4GGF A;  2L98 A;  3D0Y A;  1KYP A;  5I2O A;  2H5O A;  2FWQ A;  1S6I A;  1QTX A;  2IS9 A;  1NWD A;  3SS4 A;  2QLG B;  3DQM A;  3V3D A;  1G8I A;  4NWS A;  2NCP A;  2NXQ A;  1F71 A;  4W6D A;  4R1E A;  2JZI A;  2MHH A;  1QIV A;  3FWC A;  1YUU A;  4DXM A;  1ZMZ A;  3DQF A;  3WCK A;  1B8R A;  2A46 A;  1M45 A;  2G6E A;  5DKN A;  3SVB A;  1K96 A;  5I2L A;  3TDZ A;  4F7F A;  3LS3 A;  2KI6 D;  3DYE A;  5HW9 A;  2V4E A;  1Y1U A;  4N3D A;  2OGR A;  2PMY A;  1M31 A;  2QEO A;  4AS8 A;  1H4B A;  3NHT A;  3DVE A;  2CTN A;  2KAV A;  5HGE A;  1EME A;  3OBV A;  3SRY A;  2V4E C;  2A4J A;  3CZT X;  5FVF A;  3OSQ A;  1BFP A;  2WOR A;  2Y1M A;  4AQJ A;  5HZO A;  3M0W A;  4L9M A;  2KI4 C;  1CM4 A;  1MUX A;  1F4Q A;  5HLV A;  2HRS A;  1DVI A;  2MA2 A;  1W7J B;  4XVP A;  3R1O A;  2QEH A;  4W6H A;  2O29 A;  3GK1 A;  2JT3 A;  2FOT A;  3VRQ A;  4CFQ A;  5DRG A;  3CZ0 A;  2H8Q A;  1EMK A;  2NLN A;  2EC6 B;  4OR9 B;  3NSL A;  4UTS A;  4Z4M A;  3SVC A;  4PDZ A;  1SRA A;  1QXT A;  2L50 A;  2Y0G A;  3SS3 A;  3O78 A;  3PJ7 A;  3SVO A;  3DPX A;  4KF5 C;  2WND A;  2K7B A;  5B8I B;  1DJI A;  3E3R A;  3CFH A;  1SPY A;  2H5P A;  1Q4D A;  4JPZ B;  3EVP A;  5HKZ A;  1UWO A;  2M8U A;  1PUL A;  4MSP A;  3DQD A;  1QWV A;  5DTZ A;  1NPQ A;  4L13 A;  1DEK A;  2HGD A;  1NCZ A;  1BU3 A;  3SS5 A;  3NSK A;  4B5Y A;  3LL8 B;  1V1F A;  4E68 A;  1XFW O;  3VB1 A;  2MLE C;  2SCP A;  3DQC A;  1PRW A;  4W77 A;  2CCM A;  3CB9 A;  3SIB A;  4W72 A;  1PSR A;  2OTB A;  3AKO A;  1RFJ A;  2EMN A;  3LK1 A;  2DUF A;  2WIS A;  4PHK A;  1HT9 A;  2AAO A;  1GQM A;  5EXU A;  1GL4 A;  4LJD A;  4OCI A;  3DXL A;  4CFR A;  1JC2 A;  4A4C A;  3EG5 B;  1WDC B;  1CFC A;  1XFZ O;  3E5V A;  5EXC I;  1OZS A;  1K2H A;  4WRI A;  3NED A;  5CSI A;  1Z2C B;  3DQ4 A;  3OSR A;  4INX A;  2YE0 A;  3KHE A;  2WCE A;  1QV0 A;  1F0B A;  1AJ5 A;  1NX2 A;  1BJF A;  2PRU A;  1LIN A;  5EB7 A;  1KP5 A;  4ETO A;  2DUH A;  5HZS A;  2WCK A;  3KCS A;  5J3X A;  2PXW A;  4W6F A;  5AEQ A;  3ADF A;  3FE6 A;  1KSM A;  3S0E A;  5DIC A;  3PAL A;  3SG4 A;  1B47 A;  3U0M A;  2BBN A;  1C3Z A;  3L47 A;  3BFB A;  3HX4 A;  5KTY A;  1F8H A;  2POX A;  1DGV A;  1RMM A;  5DTX A;  3OX5 A;  2Z6Z A;  4W6J A;  4OQW A;  5D69 A;  1JC0 A;  3DQE A;  5AQB B;  2LHI A;  1EMC A;  2L0P A;  4BY5 A;  4H3N A;  4PHN A;  4M2P A;  1UP5 A;  1XYD A;  3PJB A;  4P5O E;  3TDI A;  4W6A A;  3DPW A;  3JVT C;  2ISD A;  4ZB1 A;  3DQI A;  3RWT A;  1SL7 A;  1EJ3 A;  4KW4 A;  2HF5 A;  2LHL A;  3C1V A;  1TN4 A;  1W7T A;  3H1R A;  2DDC A;  4W6O A;  3DQH A;  1FPW A;  3GK2 A;  4XGY A;  2ZO7 A;  5AFP A;  2JNX A;  2F3Z A;  1QYQ A;  1SW8 A;  2LAP A;  4MVF A;  4MZJ A;  4P1Q A;  2PSR A;  5DTY A;  2LV7 A;  2Q91 A;  3B88 A;  1UHN A;  4HVF A;  1OXF A;  2M7L A;  1UHI A;  1UIS A;  1W7S A;  1TUJ A;  1EXR A;  4PPJ A;  2P71 A;  2E6W A;  1NX0 A;  4GOB A;  1B4C A;  2HQK A;  2QRF A;  4W7C A;  1ZAC A;  3DVK A;  2GW4 B;  4Q04 A;  1NP8 A;  3IR8 A;  2AWL A;  3UFZ A;  1YR5 A;  3TZ1 A;  1OQP A;  5CSJ A;  3LLE A;  2JWW A;  4CPV A;  4IK5 A;  1MF8 B;  2OS8 B;  3W1D A;  3IP2 A;  3U8C A;  3WNX B;  3SSH A;  5FI6 A;  1KWO B;  4YRU A;  4EMQ A;  5BTT B;  2NCO A;  4DUQ A;  2MRD A;  2CBL A;  1Z1Q A;  4L12 A;  3O6B A;  1MXL C;  5DKR A;  3R72 A;  2BBM A;  1RK9 A;  2JTT A;  4XJK B;  1DQE A;  4P2Y B;  2GV5 A;  5FVG A;  1OOG A;  1KK7 Y;  3BYA A;  3PN7 C;  5D7F A;  4NDC A;  4BY4 A;  2DOQ A;  4IL1 A;  4USL A;  4KW9 A;  1QYF A;  2QLI A;  2G2S B;  3I5I C;  1J7O A;  4W6I A;  2YE1 A;  3CD9 A;  3AKB A;  2YFP A;  1SCV A;  2G3D B;  3DQA A;  3WLD A;  1GM0 A;  3B86 A;  2KFG A;  3SV5 A;  1XA5 A;  2K8M B;  3OGN A;  1S6Z A;  1XFV O;  4KA9 A;  4JC2 A;  1CMG A;  1SYM A;  1MWN A;  2WHT A;  4W76 A;  2BE4 A;  4KEX A;  2ZO6 A;  2M1U A;  2BTJ A;  1REC A;  5LTR A;  2LP2 A;  3TMT A;  1L2O C;  2BKH B;  2GX0 A;  1SKT A;  5PAL A;  3U8P A;  3SG2 A;  4W6R A;  1PVB A;  1ORG A;  1KK7 Z;  3SG6 A;  1HUY A;  2HET A;  2KGB C;  1A75 A;  3DZT A;  3EK8 A;  2E30 A;  1XVJ A;  1B9A A;  3S0A A;  2VVI A;  4I5K A;  2L4I A;  2EMO A;  3BXC A;  2K7D A;  2AMI A;  2BCX A;  3SS0 A;  2KQ6 A;  1CFP A;  1MOU A;  2ZMW A;  1B8C A;  3NXA A;  2RH7 A;  3M24 A;  1WLZ A;  1B1G A;  4C0L A;  2WUR A;  5FI7 A;  2K2A A; 
#chains in the Genus database with same CATH homology
 3ZNI A;  2RGI A;  5DQM A;  3FWB A;  2M7N A;  2O24 A;  2EGD A;  3VGO A;  1QY3 A;  4LQT A;  2ZFD A;  1B8L A;  1WRL A;  2KFF A;  2QZ0 A;  1X02 A;  5F9G A;  3QRX A;  1W7I B;  4DXI A;  2L2E A;  4M2O A;  3SSL A;  3VRP A;  2G6Y A;  1SY9 A;  1S36 A;  4I5L B;  2BKI B;  5GQQ C;  2K0J A;  2OTG B;  1SCM B;  1U5I B;  3BQ3 A;  2B3Q A;  1FW4 A;  4ORN A;  1ZGQ A;  1VRK A;  1AP4 A;  2KDH A;  3CGL A;  1MOV A;  1RRO A;  3TMR A;  4PE0 A;  1ZGO A;  1EML A;  2M0R A;  4DIR A;  1Q4A A;  2KSP A;  3BX9 A;  3CFA A;  2CNP A;  1J7R A;  4KGE A;  4NDB A;  3U0K A;  2V53 A;  3ST2 A;  3ZTF A;  3I5H C;  1F54 A;  1A4P A;  3D0Y B;  2C9I A;  1WRK A;  4YGA A;  2LMV A;  2SAS A;  4PHM A;  3NT9 A;  1OE9 B;  4QJ5 B;  3VK1 A;  3ZUJ A;  1EMA A;  2FCD A;  1S6J A;  1SR6 C;  2P6B B;  2F3Y A;  5HLO A;  5BPJ A;  3DQ7 A;  3I5F C;  3WXA A;  2ZRS A;  1BT6 A;  2AHA A;  3A4U B;  4MBE A;  3E5W A;  1C4F A;  1YFP A;  3TUY C;  2G3O A;  2LUC A;  2V4E B;  2VAE A;  3TDU A;  1YRU B;  2KGR A;  4OJ0 A;  5H89 A;  2VRG A;  1QX5 B;  3PSR A;  3EK4 A;  1TOP A;  1ZFS A;  3G9A A;  2EMD A;  2KI4 B;  3VRO A;  2KBM A;  3I5G C;  1YHH A;  4PE1 A;  4KGF A;  2DD7 A;  4XYN A;  1DT7 B;  3O4Y A;  3SSY A;  2VAD A;  5DQB A;  1DJX A;  5LTQ A;  1LVC D;  1KK8 B;  4W7A A;  4W69 A;  2LAN A;  2A50 B;  1RJV A;  2IB6 A;  4C0J A;  3LF4 B;  1A29 A;  2LM5 A;  2Q6P A;  1FI5 A;  4ORA B;  2HPW A;  4GES B;  5BT0 A;  2L4H A;  2JOJ A;  2LCP A;  5AER A;  1RTP 1;  1YX8 A;  4Z4K A;  1H8B A;  2WC8 A;  4KF5 A;  1BR4 B;  3TS5 B;  2K7O A;  2LLU A;  4IZN A;  2Q4U A;  2Z6Y A;  1A2X A;  1OMV A;  1CM1 A;  4YGD B;  3BOW A;  3H1O A;  2H61 C;  2QAC A;  4U2V A;  1XA9 A;  3KEV A;  2VVH A;  3JTD C;  4W6U A;  3VHT B;  5DU0 A;  2I7A A;  2HCG A;  2FJU B;  2I2R E;  3MSE B;  4AOM A;  1FI6 A;  3DQJ A;  2KAX A;  2ARL A;  5DPI A;  1F4O A;  1TTX A;  4TNC A;  4W6M A;  4XL5 A;  2EHB A;  4FTG A;  5HYD A;  2ZRT A;  5LTP A;  2D8N A;  5DPJ A;  4Q7U A;  1S26 D;  3VHT A;  4HRE E;  4N5X A;  1G4Y R;  1EH2 A;  2FCE A;  4PPK A;  2A54 B;  3DQ1 A;  1CFD A;  4EUL A;  3GJ2 A;  1AHR A;  4Q7R A;  4OKH A;  4JF9 A;  3AI4 A;  1PAL A;  1TCF A;  1KQM B;  2Q57 A;  2H2K A;  5DRF A;  4MN0 A;  1KSO A;  5ER4 X;  3OP0 A;  5T3I A;  4ORC B;  4W75 A;  1BR1 B;  2HGY A;  2DDD A;  5HZT A;  1YJ2 A;  1ZUX A;  3NEZ A;  2Z1O A;  3ED8 A;  2OPO A;  5HZU A;  1S3P A;  1OOJ A;  4N1G A;  1S1E A;  1SNL A;  3AAJ A;  1GGW A;  1DJW A;  1JFJ A;  3DQO A;  3SSK A;  4I5N B;  3OX6 A;  1V1G A;  2M9G A;  3OB2 B;  4IK1 A;  1MHO A;  2LVJ A;  3CBE A;  4ZCU A;  1K90 D;  2HQZ A;  1JFK A;  4LJB A;  5I8N A;  1YUS A;  5EHU A;  1F55 A;  4N1F A;  3P8U A;  3SJS A;  1CB1 A;  1WDC C;  4MRX A;  1CDM A;  4H3M A;  1J1D A;  1Y1X A;  1CFF A;  1CDL A;  1MYW A;  1DJZ A;  2C9J A;  2IOV A;  4GNK B;  1JWD A;  4LJC A;  2QLE A;  3DQN A;  4KPI A;  4B30 A;  1RMO A;  1MR8 A;  4I5J A;  1QXP A;  1OMR A;  4ZF5 A;  5H88 A;  2KYC A;  3WLC A;  4HE4 A;  2JAD A;  3AI5 A;  3NF0 A;  2LLS A;  2H6V A;  3SVR A;  4ZCV A;  3LVD A;  4QJ4 B;  3VRR A;  4HSZ A;  3RM1 A;  3GK4 X;  1YHG A;  3S05 A;  4HQ9 A;  4DCK A;  2AUC A;  1NX3 A;  2A52 B;  2IB5 A;  5EB6 A;  4W6N A;  1G33 A;  4EDS A;  4W7D A;  1IWQ A;  4HRH A;  1LKJ A;  2KHN A;  4C0K A;  4Q7T A;  1CKK A;  3GB3 A;  2BL0 B;  1JSA A;  2LVI A;  2WIQ A;  1CDN A;  1XFU O;  1M39 A;  3CR2 A;  3I5I B;  4LW5 A;  2HFC A;  2CXJ A;  1DJG A;  3WHT B;  2M29 A;  4OGS A;  3PJ5 A;  3M22 A;  3LVC A;  1UUS A;  1YUT A;  4GBA A;  4JGE A;  3BUN B;  1G7K A;  5CSF A;  3DD4 A;  1UHJ A;  4YGB B;  4M2Q A;  4YI8 A;  4W6T A;  1RMP A;  1IRJ A;  1L2O B;  3A8R A;  3E5T A;  1J7P A;  2LLT A;  3DF0 A;  3CFF A;  3PFV A;  2K61 A;  4ZF3 A;  1OSA A;  1Q4B A;  1QYO A;  2OKW A;  1LXF C;  1YX7 A;  1IH0 A;  1SL8 A;  3OHM B;  3PM8 A;  3WHU B;  2ZN9 A;  1XFY O;  2M1K B;  3EKJ A;  2OS8 C;  4WQ2 A;  2FZU A;  4OHS A;  1A75 B;  2A48 A;  1YUR A;  1KWO C;  3AKA A;  4MEW A;  2M3W A;  3CLN A;  1EMG A;  2Y1N A;  3OGO A;  4EN1 A;  5FHV A;  1FF1 A;  4ZIN A;  2BEC A;  4DXO A;  1HCJ A;  1BOD A;  1H4U A;  3DQ5 A;  4CLN A;  3LVA A;  2M49 B;  3EKH A;  2WCF A;  1ZGP A;  1S5G Y;  1NCX A;  2A47 A;  3RLZ A;  4EDO A;  4YI9 A;  1PK0 D;  1WY9 A;  1ALV A;  1NUB A;  2KBI A;  2H9W A;  4RYW A;  2GGZ A;  1IJ6 A;  3VIC A;  1KCY A;  3GL4 A;  1YTZ C;  4FQO A;  5DTL A;  4KAG A;  3KPX A;  4W6G A;  1TNW A;  4DS7 A;  1M63 B;  5HBD A;  2TN4 A;  4RTC A;  2HQ8 A;  3U8A A;  4H48 A;  1JUO A;  1KFU S;  3SVD A;  4XOW A;  1SBJ A;  3SVN A;  1ALW A;  2Z6X A;  2JXC A;  3I5H B;  4W7E A;  1Y6W A;  5DY6 A;  2I18 A;  2GW3 A;  1JF0 A;  2LMT A;  2OJK A;  1QAT A;  1S5G Z;  2G5Z B;  4HQC A;  3PIB A;  1J55 A;  4ICB A;  3BXB A;  5J2O A;  3I5F B;  1XK4 C;  2MLF C;  5G08 A;  2JUL A;  1OZO A;  2LVK A;  4W74 A;  3SG7 A;  2PVB A;  3F45 A;  1RWY A;  4ZFS A;  2BCB A;  1DF0 A;  4JFG A;  4PCW A;  2OKY A;  5HKY A;  3EK7 A;  2QPT A;  1OXE A;  3O77 A;  1QVI Y;  1UUR A;  2LE9 B;  2L51 A;  1W7U A;  3HCM A;  3KF9 A;  3BUM B;  3PLF B;  5KU1 A;  2H5Q A;  4J88 A;  2JT8 A;  4ANJ A;  3SSP A;  4WQ3 A;  1EMF A;  1UHK A;  3LK0 A;  3O2P A;  4GGN A;  3EVV A;  3DQ3 A;  5EJU A;  3GJ1 A;  2I94 A;  4ORB B;  1QS7 A;  1SCM C;  2B3P A;  2F2P A;  5DPG A;  1KFU L;  2M97 A;  4L1I A;  2KYF A;  1C7W A;  2ZN8 A;  4W6K A;  4W7F A;  2KAY A;  2O60 A;  1JF2 A;  2HJO A;  4J8A A;  1CLM A;  1L7Z A;  1QVI Z;  1Y0V H;  1M46 A;  3FS7 A;  1WLM A;  3UG0 A;  4U8D A;  4GGF C;  4I2Y A;  4H47 A;  1ODB A;  4KW8 A;  3FIA A;  2AH8 A;  4TZA A;  4YBH B;  1IG5 A;  1KFX S;  5I2Q A;  4R6B A;  1ZUZ A;  3CR5 X;  3K21 A;  4GF6 B;  4XOV A;  2QLG A;  3CD1 A;  3ST4 A;  2R2I A;  3LF3 A;  2WCB A;  2ICR A;  2L5X B;  3JTD B;  1IQ3 A;  3BOW B;  1CTR A;  2JRF A;  2H5R A;  1Q80 A;  5IBW A;  1BG1 A;  2H61 A;  2COL B;  2HQW A;  4UPG A;  1NIW A;  1QV1 A;  4PE4 A;  4IK8 A;  1AVS A;  2ZMU A;  1BOC A;  1JBA A;  5ER5 A;  3DQ2 A;  3ICB A;  1XSS A;  2BCA A;  4JWQ A;  5KTG A;  3SVU A;  1EG3 A;  2JXL A;  4NDD A;  2ZNE A;  4W6L A;  3U0N A;  1GGZ A;  4DXN A;  1AUI B;  2HPS A;  3U0L A;  1KK8 C;  4AQI A;  4MZL A;  4PAL A;  2P4M A;  2LC5 A;  1XMZ A;  1GJY A;  1FBV A;  4KF4 A;  3DQU A;  2JPT A;  4DXP A;  3SG3 A;  4CID A;  3SG5 A;  4NQG A;  1MXE A;  1SMG A;  1EMB A;  1KFX L;  3NSI A;  1HQV A;  2PXS A;  4J89 A;  2GX2 A;  2LMU A;  1PVA A;  3DVM A;  3TS5 C;  3SIA A;  2EC6 C;  5K89 A;  1CNP A;  4W6C A;  2QT2 A;  2QLH A;  1IGV A;  4OV2 A;  1C07 A;  3NSO A;  2WSO A;  2KFH A;  4A4B A;  2PAL A;  1TRF A;  1S6C A;  2VZX A;  2JC2 A;  3IQO A;  2MBX A;  5EXB A;  1TCO B;  4HRG A;  2DD9 A;  2DUG A;  1K8U A;  2LP3 A;  3CGA A;  1YVL A;  2A53 B;  1CLL A;  4W6B A;  1F09 A;  1K94 A;  4HQ8 A;  2BE6 A;  3JVT B;  4OVN F;  2O5G A;  1F70 A;  4LJD C;  1TNX A;  1KYS A;  1IKU A;  4DKM A;  3IF7 A;  5JOL A;  3DPZ A;  1NYA A;  4BDU A;  1TNQ A;  5TNC A;  4B30 B;  1YJF A;  1QLS A;  5LK4 A;  2IE2 A;  1KQM C;  1QAS A;  1GGX A;  3OB1 B;  2AWK A;  4GPL B;  3GEX A;  1ZOT B;  3ZUF A;  2O2B A;  1XQM A;  2K2F A;  5DPH A;  3GOF A;  1J1E A;  2VVJ A;  4ZF4 A;  1DTL A;  3BXA A;  1DMO A;  3CWG A;  2G6X A;  1BMO A;  4DXQ A;  2LUX A;  1LA3 A;  4IK9 A;  1IJ5 A;  1QX2 A;  5BQL A;  1N0Y A;  1BLQ A;  1RM9 A;  1CLB A;  2DUE A;  5CSN A;  2KOT A;  3A8S A;  1YZW A;  1NSH A;  1K9P A;  1CMF A;  4P76 A;  3KCT A;  4GFT A;  4JRB A;  5EBJ A;  3I19 A;  3AAK A;  1XAE A;  5H87 A;  4D1E A;  1CV7 A;  4ZBL A;  5FVI A;  1QJT A;  3PN7 B;  4OY4 A;  4YGC B;  2DUI A;  1JC1 A;  1DGU A;  4R6D A;  1N2D A;  1JBY A;  2WSN A;  1CDP A;  2G9B A;  4PE7 A;  1KQV A;  1TNP A;  1EG4 A;  5CPV A;  2AWM A;  3KO0 A;  3DF0 B;  1J7Q A;  2JT0 A;  1XO5 A;  3LCP C;  1DJY A;  2ZKM X;  1Z1P A;  3H4S E;  2KQY A;  4QJ3 B;  3CS1 A;  5AAN A;  2AWJ A;  4F0Z B;  1QX7 A;  5F6T A;  2MAZ A;  1LA0 A;  3MGF A;  1R2U A;  4MRY A;  5DKQ A;  4DRW A;  4PHJ A;  2JTZ A;  2B1U A;  1EMM A;  3CTN A;  4AR7 A;  4IK4 A;  5BTT A;  4MLW A;  1B7T Y;  2BL0 C;  1OXD A;  3EVU A;  1N65 A;  1K9U A;  4XJK A;  1QLK A;  4TZG A;  3D10 A;  1YVH A;  1OMD A;  3DVJ A;  3ZUL A;  3P28 A;  3DQ9 A;  3LA1 A;  4W6P A;  3SVE A;  5AXI A;  3BUX B;  1MQ1 A;  2FL1 A;  4PFE A;  1AK8 A;  1K93 D;  3EVR A;  3ST3 A;  1E8A A;  4GUK A;  3BXK A;  2KNE A;  2A56 B;  4YGE B;  1A03 A;  1SL9 A;  3K1K A;  3BUW B;  1K95 A;  2PAS A;  1D1O A;  1C7V A;  1UHH A;  3DQL A;  4W7R A;  5FYX A;  1SK6 D;  2Y4Q A;  4RYS A;  4MZK A;  3PAT A;  2MJW B;  1B7T Z;  1JBZ A;  1XFX O;  3DQ8 A;  2G16 B;  4W73 A;  4ZIO A;  3RWA A;  2LNK A;  3LSA A;  2G2B A;  2JQ6 A;  3DQ6 A;  1H6R A;  2JU0 A;  1B9C A;  2WHU A;  1K9K A;  2NZ0 A;  4Q9X A;  3ZWH A;  4H3L A;  1BF5 A;  1NCY A;  1XK4 A;  5KSZ A;  2F33 A;  1YRT B;  1TIZ A;  1DF0 B;  1Q4C A;  5HKW A;  4JEO A;  2GGM A;  2WOS A;  1SR6 B;  1KYR A;  3VRN A;  3NT3 A;  1PSB A;  2JNF A;  2WHS A;  1Q73 A;  1R6P A;  1RRX A;  1QIW A;  2OTE A;  3CR4 X;  2K7C A;  3TUY B;  4W7X A;  1AJ4 A;  1DJH A;  4Q9W A;  4PPL A;  2F2O A;  3DQK A;  2QU1 A;  2ZND A;  2CT9 A;  2YDZ A;  3BUO B;  4IK3 A;  1IQ5 A;  3ST0 A;  1EL4 A;  3SSV A;  1U5I A;  1GFL A;  2KI6 C;  1Y1A A;  3I5G B;  4LQU A;  4JQ0 D;  1YHI A;  3W1C A;  4GAO A;  3IQQ A;  1WRZ A;  2F8P A;  1NX1 A;  3SVS A;  2LVV A;  2OTG C;  2Y5I A;  5JJG A;  4W6S A;  3SST A;  4DKN A;  1Q4E A;  4GGF A;  2L98 A;  3D0Y A;  1KYP A;  5I2O A;  2H5O A;  2FWQ A;  1S6I A;  1QTX A;  2IS9 A;  1NWD A;  2QLG B;  3DQM A;  3V3D A;  1G8I A;  4NWS A;  2NCP A;  2NXQ A;  1F71 A;  4W6D A;  4R1E A;  2JZI A;  2MHH A;  1QIV A;  3FWC A;  1YUU A;  4DXM A;  1ZMZ A;  3DQF A;  3WCK A;  1B8R A;  2A46 A;  1M45 A;  2G6E A;  5DKN A;  3SVB A;  1K96 A;  5I2L A;  3TDZ A;  3LS3 A;  2KI6 D;  5HW9 A;  2V4E A;  1Y1U A;  4N3D A;  2OGR A;  2PMY A;  1M31 A;  4AS8 A;  1H4B A;  3DVE A;  2CTN A;  2KAV A;  5HGE A;  1EME A;  3SRY A;  2V4E C;  2A4J A;  3CZT X;  5FVF A;  3OSQ A;  1BFP A;  2WOR A;  2Y1M A;  4AQJ A;  5HZO A;  3M0W A;  4L9M A;  2KI4 C;  1CM4 A;  1MUX A;  1F4Q A;  5HLV A;  2HRS A;  1DVI A;  2MA2 A;  1W7J B;  4XVP A;  4W6H A;  2O29 A;  3GK1 A;  2JT3 A;  2FOT A;  3VRQ A;  4CFQ A;  5DRG A;  2H8Q A;  1EMK A;  2NLN A;  2EC6 B;  4OR9 B;  3NSL A;  4UTS A;  4Z4M A;  3SVC A;  4PDZ A;  1SRA A;  1QXT A;  2L50 A;  2Y0G A;  3O78 A;  3PJ7 A;  3SVO A;  3DPX A;  4KF5 C;  2WND A;  2K7B A;  5B8I B;  1DJI A;  3E3R A;  3CFH A;  1SPY A;  2H5P A;  1Q4D A;  4JPZ B;  3EVP A;  5HKZ A;  1UWO A;  2M8U A;  1PUL A;  4MSP A;  3DQD A;  5DTZ A;  1NPQ A;  4L13 A;  2HGD A;  1NCZ A;  1BU3 A;  3NSK A;  4B5Y A;  3LL8 B;  1V1F A;  4E68 A;  1XFW O;  2MLE C;  2SCP A;  3DQC A;  1PRW A;  4W77 A;  2CCM A;  3CB9 A;  3SIB A;  4W72 A;  1PSR A;  2OTB A;  3AKO A;  1RFJ A;  2EMN A;  3LK1 A;  2DUF A;  2WIS A;  4PHK A;  1HT9 A;  2AAO A;  1GQM A;  5EXU A;  1GL4 A;  4LJD A;  4OCI A;  4CFR A;  1JC2 A;  4A4C A;  1WDC B;  1CFC A;  1XFZ O;  3E5V A;  5EXC I;  1OZS A;  1K2H A;  4WRI A;  3NED A;  5CSI A;  3DQ4 A;  3OSR A;  2YE0 A;  3KHE A;  2WCE A;  1QV0 A;  1F0B A;  1AJ5 A;  1NX2 A;  1BJF A;  2PRU A;  1LIN A;  5EB7 A;  1KP5 A;  4ETO A;  2DUH A;  5HZS A;  3KCS A;  5J3X A;  2PXW A;  4W6F A;  5AEQ A;  3ADF A;  1KSM A;  3PAL A;  3SG4 A;  1B47 A;  3U0M A;  2BBN A;  3HX4 A;  5KTY A;  1F8H A;  2POX A;  1DGV A;  1RMM A;  5DTX A;  3OX5 A;  2Z6Z A;  4W6J A;  4OQW A;  5D69 A;  1JC0 A;  3DQE A;  5AQB B;  2LHI A;  1EMC A;  2L0P A;  4BY5 A;  4H3N A;  4PHN A;  4M2P A;  1UP5 A;  1XYD A;  3PJB A;  4P5O E;  3TDI A;  4W6A A;  3DPW A;  3JVT C;  2ISD A;  4ZB1 A;  3DQI A;  3RWT A;  1SL7 A;  1EJ3 A;  4KW4 A;  2HF5 A;  2LHL A;  3C1V A;  1TN4 A;  1W7T A;  3H1R A;  2DDC A;  4W6O A;  3DQH A;  1FPW A;  3GK2 A;  4XGY A;  2ZO7 A;  5AFP A;  2JNX A;  2F3Z A;  1QYQ A;  1SW8 A;  2LAP A;  4MVF A;  4MZJ A;  4P1Q A;  2PSR A;  5DTY A;  2LV7 A;  2Q91 A;  1UHN A;  4HVF A;  1OXF A;  2M7L A;  1UHI A;  1UIS A;  1W7S A;  1EXR A;  4PPJ A;  2E6W A;  1NX0 A;  4GOB A;  1B4C A;  2HQK A;  2QRF A;  4W7C A;  1ZAC A;  3DVK A;  2GW4 B;  4Q04 A;  1NP8 A;  3IR8 A;  2AWL A;  3UFZ A;  1YR5 A;  3TZ1 A;  1OQP A;  5CSJ A;  3LLE A;  2JWW A;  4CPV A;  4IK5 A;  1MF8 B;  2OS8 B;  3W1D A;  3IP2 A;  3U8C A;  3WNX B;  3SSH A;  1KWO B;  4YRU A;  4EMQ A;  5BTT B;  2NCO A;  4DUQ A;  2MRD A;  2CBL A;  1Z1Q A;  4L12 A;  3O6B A;  1MXL C;  5DKR A;  2BBM A;  1RK9 A;  2JTT A;  4XJK B;  4P2Y B;  2GV5 A;  5FVG A;  1KK7 Y;  3BYA A;  3PN7 C;  5D7F A;  4NDC A;  4BY4 A;  2DOQ A;  4IL1 A;  4USL A;  4KW9 A;  1QYF A;  2QLI A;  2G2S B;  3I5I C;  1J7O A;  4W6I A;  2YE1 A;  3CD9 A;  3AKB A;  2YFP A;  1SCV A;  2G3D B;  3DQA A;  3WLD A;  2KFG A;  3SV5 A;  1XA5 A;  2K8M B;  1S6Z A;  1XFV O;  4KA9 A;  4JC2 A;  1CMG A;  1SYM A;  1MWN A;  2WHT A;  4W76 A;  2BE4 A;  4KEX A;  2ZO6 A;  2M1U A;  2BTJ A;  1REC A;  5LTR A;  2LP2 A;  3TMT A;  1L2O C;  2BKH B;  2GX0 A;  1SKT A;  5PAL A;  3U8P A;  3SG2 A;  4W6R A;  1PVB A;  3SG6 A;  1KK7 Z;  1HUY A;  2HET A;  2KGB C;  1A75 A;  3EK8 A;  2E30 A;  1XVJ A;  1B9A A;  2VVI A;  4I5K A;  2L4I A;  2EMO A;  3BXC A;  2K7D A;  2AMI A;  2BCX A;  3SS0 A;  2KQ6 A;  1CFP A;  1MOU A;  2ZMW A;  1B8C A;  3NXA A;  2RH7 A;  3M24 A;  1WLZ A;  1B1G A;  4C0L A;  2WUR A;  2K2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...