3O7VX

Crystal structure of human hiwi1 (v361m) paz domain (residues 277-399) in complex with 14-mer rna (12-bp + 2-nt overhang) containing 2'-och3 at its 3'-end
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
117
structure length
107
Chain Sequence
ETVLDFMFNFYHQTEEHKFQEQVSKELIGLVVLTKYNNKTYRVDDIDWDQNPKSTFKKADGSEVSFLEYYRKQYNQEITDLKQPMLVSQPKGPAMLIPELCYLTGLT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Piwi-like protein 1
publication title Inaugural Article: Structural basis for piRNA 2'-O-methylated 3'-end recognition by Piwi PAZ (Piwi/Argonaute/Zwille) domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein/rna
total genus 22
structure length 107
sequence length 117
ec nomenclature
pdb deposition date 2010-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 3o7vX00
4NHAA 4NGBA 4NGDA 2L5DA 1T2SA 5KI6A 4W5OA 3QIRA 1T2RA 4OLBA 4Z4IA 4Z4EA 2FFLA 1VYNA 4Z4CA 4NH6A 3O7XA 4NH5A 5JS1A 4OLAA 3O7VX 4F3TA 4W5TA 4NGGA 4W5NA 4Z4FA 2XFMA 1SI2A 4W5QA 4NH3A 3O6EX 4Z4HA 4KRFA 1R4KA 3MJ0A 4KREA 2L5CA 1SI3A 4Z4GA 1R6ZA 4W5RA 4NGCA 2QVWA 3O3IX 5JS2A 5T7BA 4NGFA
chains in the Genus database with same CATH superfamily
3DLBA 4NHAA 4NGBA 4NGDA 2L5DA 1T2SA 5KI6A 4W5OA 3QIRA 3HVRA 1T2RA 4OLBA 4Z4IA 4Z4EA 2FFLA 1VYNA 4Z4CA 3DA5A 3O7XA 3F73A 3DLHA 4NH6A 3O7VX 4F3TA 4W5TA 4NGGA 4OLAA 3HO1A 5JS1A 4W5NA 4Z4FA 2BZEA 3HJFA 2DB9A 1Z26A 2XFMA 1SI2A 1Z25A 4W5QA 4NH3A 3O6EX 4Z4HA 4KRFA 1U04A 1R4KA 4NH5A 3MJ0A 4KREA 3HM9A 2L5CA 1SI3A 4L1PA 4L1UA 3U1UA 1R6ZA 4W5RA 4Z4GA 3HK2A 4NGCA 2QVWA 3O3IX 5JS2A 5T7BA 4NGFA
chains in the Genus database with same CATH topology
3DLBA 4NHAA 4NGBA 4NGDA 2L5DA 1T2SA 5KI6A 4W5OA 3QIRA 3HVRA 1T2RA 4OLBA 4Z4IA 4Z4EA 2FFLA 1VYNA 4Z4CA 3DA5A 3O7XA 3F73A 3DLHA 4NH6A 3O7VX 4F3TA 4W5TA 4NGGA 4OLAA 3HO1A 5JS1A 4W5NA 4Z4FA 2BZEA 3HJFA 2DB9A 1Z26A 2XFMA 1SI2A 1Z25A 4W5QA 4NH3A 3O6EX 4Z4HA 4KRFA 1U04A 1R4KA 4NH5A 3MJ0A 4KREA 3HM9A 2L5CA 1SI3A 4L1PA 4L1UA 3U1UA 1R6ZA 4W5RA 4Z4GA 3HK2A 4NGCA 2QVWA 3O3IX 5JS2A 5T7BA 4NGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NHA A;  4NGB A;  4NGD A;  2L5D A;  1T2S A;  5KI6 A;  4W5O A;  3QIR A;  1T2R A;  4OLB A;  4Z4I A;  4Z4E A;  2FFL A;  1VYN A;  4Z4C A;  4NH6 A;  3O7X A;  4NH5 A;  5JS1 A;  4OLA A;  3O7V X;  4F3T A;  4W5T A;  4NGG A;  4W5N A;  4Z4F A;  2XFM A;  1SI2 A;  4W5Q A;  4NH3 A;  3O6E X;  4Z4H A;  4KRF A;  1R4K A;  3MJ0 A;  4KRE A;  2L5C A;  1SI3 A;  4Z4G A;  1R6Z A;  4W5R A;  4NGC A;  2QVW A;  3O3I X;  5JS2 A;  5T7B A;  4NGF A; 
#chains in the Genus database with same CATH topology
 3DLB A;  4NHA A;  4NGB A;  4NGD A;  2L5D A;  1T2S A;  5KI6 A;  4W5O A;  3QIR A;  3HVR A;  1T2R A;  4OLB A;  4Z4I A;  4Z4E A;  2FFL A;  1VYN A;  4Z4C A;  3DA5 A;  3O7X A;  3F73 A;  3DLH A;  4NH6 A;  3O7V X;  4F3T A;  4W5T A;  4NGG A;  4OLA A;  3HO1 A;  5JS1 A;  4W5N A;  4Z4F A;  2BZE A;  3HJF A;  2DB9 A;  1Z26 A;  2XFM A;  1SI2 A;  1Z25 A;  4W5Q A;  4NH3 A;  3O6E X;  4Z4H A;  4KRF A;  1U04 A;  1R4K A;  4NH5 A;  3MJ0 A;  4KRE A;  3HM9 A;  2L5C A;  1SI3 A;  4L1P A;  4L1U A;  3U1U A;  1R6Z A;  4W5R A;  4Z4G A;  3HK2 A;  4NGC A;  2QVW A;  3O3I X;  5JS2 A;  5T7B A;  4NGF A; 
#chains in the Genus database with same CATH homology
 3DLB A;  4NHA A;  4NGB A;  4NGD A;  2L5D A;  1T2S A;  5KI6 A;  4W5O A;  3QIR A;  3HVR A;  1T2R A;  4OLB A;  4Z4I A;  4Z4E A;  2FFL A;  1VYN A;  4Z4C A;  3DA5 A;  3O7X A;  3F73 A;  3DLH A;  4NH6 A;  3O7V X;  4F3T A;  4W5T A;  4NGG A;  4OLA A;  3HO1 A;  5JS1 A;  4W5N A;  4Z4F A;  2BZE A;  3HJF A;  2DB9 A;  1Z26 A;  2XFM A;  1SI2 A;  1Z25 A;  4W5Q A;  4NH3 A;  3O6E X;  4Z4H A;  4KRF A;  1U04 A;  1R4K A;  4NH5 A;  3MJ0 A;  4KRE A;  3HM9 A;  2L5C A;  1SI3 A;  4L1P A;  4L1U A;  3U1U A;  1R6Z A;  4W5R A;  4Z4G A;  3HK2 A;  4NGC A;  2QVW A;  3O3I X;  5JS2 A;  5T7B A;  4NGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...