3O7WA

The crystal structure of human leucine carboxyl methyltransferase 1
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
282
structure length
282
Chain Sequence
TCEDASLCKRFAVSIGYWHDPYIQHFVRLSKERKAPEINRGYFARVHGVSQLIKAFLRKTECHCQIVNLGAGMDTTFWRLKDEDLLPSKYFEVDFPMIVTRKLHSIKCKPPLSSPILELHSEDTLQMDGHILDSKRYAVIGADLRDLSELEEKLKKCNMNTQLPTLLIAECVLVYMTPEQSANLLKWAANSFERAMFINYEQVNEGKSLESQKERLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKEITY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structure of human leucine carboxyl methyltransferase 1 that regulates protein phosphatase PP2A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Leucine carboxyl methyltransferase 1
total genus 101
structure length 282
sequence length 282
ec nomenclature ec 2.1.1.233: [Phosphatase 2A protein]-leucine-carboxy methyltransferase.
pdb deposition date 2010-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04072 LCM Leucine carboxyl methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3o7wA00
3FPJA 3UJCA 4BY9E 1RJGA 3T7TA 3RODA 5E1DA 5BP7A 9MHTA 2FK7A 2IIPA 5E9QA 3DUWA 1R6AA 4RYLA 3UJDA 4PYQA 5JUWA 3VSEA 2B78A 4R6XA 3TFWA 1JSXA 3LECA 2XVMA 3MCZA 4YUZA 1QAOA 2R3SA 2UYOA 1G38A 2NXCA 2OKCA 1X1AA 4IV0A 2G71A 1KPIA 3NWBA 7MHTA 3OE5A 4QVKA 1P91A 4M37A 3KU1A 5E1BA 1XDZA 3GRYA 3LCUA 3E7PA 4GF5A 2EJTA 3THRA 2JJQA 3C6MA 4RVHA 3GO4A 4LWPA 5DLYA 5FHQA 3TM4A 4CKBA 5LQNA 3TRKA 3EPPA 4CKCA 4RX1A 4OA8A 4PGHA 2PX2A 2OBFA 2YXLA 4FZVA 5K0CA 1ZKDA 4R6WA 2PGXA 4Z2YA 3I58A 4PINA 4O29A 4PNEA 5K03A 3MTIA 1JTEA 3QV2A 2QM3A 3KQVA 4R8RA 4GC5A 1RJEA 2PX8A 2ADMA 1ZHFA 3FPEA 4PCLA 5G02A 4E2WA 5IKMA 2UZ4A 4AZSA 5CCXA 1P1BA 3G2QA 2P7IA 2IH5A 4ZTBA 3G7UA 2XYRA 1HMYA 2YQZA 3EVGA 4AX8A 4X61A 2PX4A 1VIDA 3QOWA 4P7KA 4M7RA 1R18A 4X1OA 5EHIA 1RI2A 3BGIA 4FSXA 3C3PA 4MQ4A 3TOSA 2IBTA 3HCFA 4U7TB 5HOQA 1JQDA 4R05A 1T43A 5EMLA 1I9GA 4XUDA 2VDUE 4KW7A 3BKXA 3UJ8A 1NV8A 1BOOA 5U4XA 2IPXA 4RTMA 3DTNA 2IBSA 5GM2A 3R3HA 1YUBA 2QRVA 2VP3A 3LGAA 3UWPA 5K0JA 3T7RA 3P9NA 4LWOA 3LCVB 3HVIA 4MWZA 2ZLBA 5LQKA 5K0GA 2IDKA 5EG5A 1Q0TA 5GM1A 2OYRA 4BP1A 2HR1A 3NDJA 2O07A 5BW5A 2P7HA 3R9XB 2ERCA 4YUWA 3BGVA 3KR2A 3LCCA 4BP3A 2JHPA 1IY9A 4RVGA 2OB2A 4AUKA 4C05A 1O54A 4E33A 2ONZA 4V0RA 1ZGJA 4E2XA 2NXJA 3MCTA 3PFHA 4OX9Y 2PSSA 2IDJA 3ANXA 5FQOA 5KYGA 2ZVJA 3G8AA 2NYUA 5T64A 3ME5A 2E5WA 3PT9A 4BLWA 2PXAA 2PBFA 4EQZA 2WK1A 3NJRA 4EVIA 3AY0A 3E8SA 1R00A 5GP1A 8MHTA 5DTRA 2H00A 3MTEA 2Y1WA 1FBNA 2FRXA 2O0LA 3NMUF 3IV6A 5LQCA 1NW8A 1RI3A 2O06A 1D2GA 2ZWVA 3S68A 1JQEA 3P2IA 3BWCA 3R24A 3EVCA 3I53A 3FYCA 3B89A 3LBYA 3GCZA 4OBXA 2HV9A 2AOTA 2VDWA 2G1PA 2C7PA 1M0EA 4RWZA 5KS2A 3K6RA 4C08A 4DZRA 2CWWA 4RVDA 3A7EA 3ELWA 4IKPA 4KIFA 5ERGB 5FTWA 5CVVA 4AZVA 2IGTA 5BW4A 4HTFB 5K0EA 1VPTA 1YB2A 3TMAA 5DX1A 1JSZA 3GWZA 2R6ZA 2EX4A 3FTCA 4GBED 3KPYA 1SQFA 2ZFUA 3UA3A 1EAMA 3B3JA 3KQQA 2QY6A 1JQ3A 2FK8A 5HILA 4OA5A 3SSOA 3KPVA 3BWMA 1JG4A 1N7JA 3PS9A 1L3BA 1X1BA 1O9GA 2OXTA 3TM5A 2AN5A 5P8WA 1WS6A 2AOUA 2OZVA 1I4WA 5EEHA 3EEOA 2JH9A 5F2NA 3G89A 5ICEA 2ZWAA 3V97A 1AQIA 5DM1A 4NECA 3E23A 4V0QA 2EG5A 4HH4A 1QAQA 3AXSA 4M38A 1PRYA 2ZZKA 5LQJA 3B3FA 2XBMA 3GIWA 3P9IA 1R8XA 2Q41A 3HCDA 4PYKA 1EG2A 1QZZA 3FRIA 3EGEA 3FPFA 3KQPA 4P7FA 2GPYA 5D1NA 5K0LA 3KR9A 4C06A 3IHTA 3IEIA 5DX0A 5LQAA 2K4MA 4RVFA 1MHTA 2ZIGA 3ELDA 3HA3A 3GRUA 4QTTB 5CM2Z 3THSA 4UOEA 4CXMA 2FYTA 3I64A 5LR6A 5CVEA 3GDHA 5E2AA 4Y2HA 2GA9A 4E32A 2YX1A 5DXAA 3EVEA 1N2XA 5C1IA 1VL5A 2G72A 2ZTHA 1Z3CA 1ORHA 2AVNA 5DSXA 5GIOE 3EVAA 3VYWA 3EGIA 4EK9A 4POOA 3DH0A 3SM3A 1QYRA 5LQRA 3FYDA 3CBGA 3KKZA 4F86A 1FPQA 2YR0A 5EEGA 2ZZMA 3OZTA 1X1DA 2DPMA 2PY6A 1IM8A 3BWBA 4FT2A 1Q0SA 2N47A 3CJRA 2BR3A 5FWDA 5GIPE 3A7DA 2XVAA 1G6Q1 2AOTB 1NE2A 3FUTA 3P2KA 4YV0A 3Q87B 4BLVA 3DXZA 2ZBPA 1R8YA 3KHKA 2FCAA 3HCBA 2GLUA 2NNWB 5F2KA 4KVZA 4RSRA 3KPWA 2B3TA 5DRYA 3LDGA 1DL5A 1XTPA 3DMGA 3UJAA 4CTKA 2ZBRA 4DM3A 3DLCA 1L3IA 3KQMA 2B2CA 4EMSA 2PJDA 3OFKA 4RTQA 3AWIA 3CJQA 4KDRA 3LDFA 4KRGA 4PYIA 3HTXA 2GH1A 4KIGA 5K01A 3DMHA 2G70A 4C07A 3V8VA 1SUIA 5EPEA 5HEKA 5DT2A 3FTDA 5ICGA 1KPHA 1PJZA 1XCJA 2BZGA 3KQWA 4GEKA 4OQEA 3TQSA 4RV9A 2I7CA 2ZSUA 5EC8A 2OB1A 4F85A 2PLWA 5CD1A 1JG3A 3GRRA 3HCCA 2I6GA 5HFJA 4RTLA 2PVCA 3FUVA 1QAMA 1I1NA 3HM2A 4YV2A 3DMFA 3CVOA 4PCAA 3PX3A 4U7PB 1KR5A 3TR6A 1SG9A 1NKVA 4X63A 4CTJA 3RIEA 1RI4A 3B3GA 4CKEA 2HTEA 1MJFA 1YZHA 3D2LA 1NW6A 5FA5A 2ZW9A 2NXNA 4DQ0A 3OZRA 3G5LA 3NVMB 2Z6QA 4AZWA 1TPYA 1FP1D 2PT9A 3JWHA 4HRAA 1N7IA 2UYCA 4C03A 4BLUA 5EIWA 1FJXA 2V74B 3FPGA 3M70A 2GS9A 3Q7EA 1WXXA 3LL7A 4WVLA 4ER5A 3FUUA 1WXWA 3TKYA 1OR8A 1B42A 3FUXA 1VP9A 1FP2A 3EMDA 4QPPA 3CGGA 3ELUA 5DRTA 5GWXA 2C7OA 2CL5A 3HEMA 2VZ9A 4GOMD 1R74A 3VC2A 2P8JA 4LECA 3UA4A 2ESRA 4HC4A 5DM2A 2P35A 2VS1A 2YUIA 3KR1A 3O7WA 5GOZA 2WA2A 1XDSA 2O57A 3HVHA 3I5UA 3M33A 1KYWA 4Y30A 4G56A 1UWVA 4MTLA 2QRVB 5K0NA 3FTFA 1UIRA 2YVLA 4PYMA 3TKAA 3JWIA 3A4TA 3BGDA 3IYLW 4QQKA 3O4FA 1P39A 2DULA 5CVDA 1JG1A 1TW2A 3HCEA 3OU7A 1WG8A 5K8VA 1YFJA 2I9KA 3A25A 3B5IA 1NT2A 5EIFA 4MIKA 1VE3A 5FCDA 3BWYA 3CCFA 2IP2A 1BHJA 4P58A 1G8SA 3SXJA 4YUYA 4XUEA 5B1SA 1IXKA 1L1EA 2WA1A 2OY0A 3E05A 3M6XA 2B25A 3OU6A 4GOOD 4QVGA 4E70A 4E2YA 4YMGA 2AOUB 2P40A 3PB3A 4ER6A 3BKWA 1H1DA 3P97A 4HTFA 1RI1A 2YXEA 3NWEA 3HNRA 3L8DA 3BUSA 3R6TA 4PYOA 4X41A 1NW7A 1BC5A 5F2OA 1VQ1A 5DSTA 1HNNA 1KHHA 2PT6A 3DULA 5K05A 1NV9A 2HWKA 3AXTA 2FPOA 3R0QA 4YMHA 5M5BA 2ZIEA 5CUQA 4PGGA 2AR0A 2P41A 3FPHA 4M36A 4PYLA 5CVUA 5DM4A 4IWNA 3LKDA 4ISCA 4QDJA 3SMQA 4P7GA 3JWGA 2UYHA 1KP9A 3GRZA 3FRHA 4ATNA 3MHTA 1D2CA 4EKIA 2F8LA 2UYQA 4C4AA 3LBFA 1RI5A 2GAFA 4HGZA 3PX2A 1F3LA 3FZGA 1L3CA 5DXJA 2PWPA 1ORIA 5FULA 2QE6A 5ICCA 3OU2A 3SGLA 2EFJA 3NDIA 3M6WA 1SVUA 10MHA 3P8ZA 2CMGA 3DR5A 5E8JA 5FUBA 1F38A 1XCLA 4PIPA 4YV1A 3TLJA 2NXEA 3ELYA 3M4XA 5DM0A 4MHTA 4A6DA 2C7RA 5HZMA 1XVAA 3H2BA 3KQYA 1KXZA 3G88A 3BZBA 3LHDA 5EVJA 1NBHA 2KW5A 3SSMA 4OQDA 5EZSA 2PV0A 3OFJA 3MGGA 5FHRA 4DCGA 3DLIA 4RTPA 2P1DA 5DWQA 2LD4A 1KYZA 3UJBA 4IV8A 1YZ3A 4FSDA 1SQGA 2AOWA 2C7QA 1DCTA 3UJ9A 3NTVA 3G2MA 3F4KA 3DOUA 3EGVA 2ORED 3HA5A 3HVKA 2H1RA 3ORHA 3ER9A 2Z6UA 3KQTA 3LX6A 1X1CA 1ZGAA 4DCMA 1V39A 5JR3A 1EJ6A 3LPMA 2I62A 2OO3A 1TW3A 1X19A 1SUSA 1NW5A 1VP3A 4QQNA 3X0DA 4YUXA 3GNLA 2ZZNA 2NP6A 3KPUA 3JWJA 4EKGA 3NVKI 1D2HA 3GGDA 3KPJA 1NBIA 4DF3A 4PIMA 4QTUB 4WXHA 5C9ZA 5HIJA 3KQSA 3T7SA 3CJTA 2ZBQA 4E30A 1XDUA 5CIYA 1ZG3A 4GQBA 5ICFA 4RTJA 3PLAE 2ZIFA 2P3LA 3TPZA 4PYJA 2NP7A 1JTFA 3EEYA 5EMJA 5BXYA 5K09A 5KQRA 4RTSA 3PTAA 1Y8CA 2BR5A 1AF7A 3EVDA 2AS0A 5DTMA 4PONA 3P9KA 3EMBA 3M6VA 1G60A 5H02A 5HIKA 3G8BA 3PVCA 3C6KA 5EGSA 3T0IA 5DPMA 4AZTA 5HIIA 5EKXA 1M6EX 1YF3A 1EIZA 1VBFA 2IH4A 3MB5A 3SVZA 3GXOA 3MERA 3BT7A 2B9EA 3C0KA 4KDCA 4ER0A 5EMKA 5FWAA 2PWYA 4XUCA 4XCXA 2FHPA 4HG2A 1NW3A 5C0OE 3HP7A 1INLA 2IH2A 4YUVA 3MQ2A 2AOXA 5E9WA 1BKYA 3A27A 2Z6AA 1RJFA 1U2ZA 4KWCA 3FTEA 5CVJA 5K0FA 4RTOA 3K0BA 3O31A 4ER7A 4DA4A 1RJDA 5EMMA 3VC1A 3DXYA 1XXLA 2G8NA 2HMYB 2PXXA 5KVAA 3QOXA 5EQJB 4RTNA 3OE4A 3LKZA 2IFTA 3DP7A 3I9FA 2Y1XA 2V7EA 3EVZA 4GOND 1L9KA 5HIMA 4JXJA 5FADA 2CMHA 2P3QA 4CWAA 2AN4A 3P71T 3REOA 3C3YA 2BH2A 2BR4A 4B17A 3HCAA 4GUAA 5E9JA 5MHTA 4K6MA 1G8AA 2JH8A 3OZSA 5EOVA 3CC8A 5E1MA 3MAGA 2BM9A 2AOVA 3PFGA 1VLMA 4X60A 3LDUA 2ZULA 3GU3A 4R8SA 2BM8A 1EQAA 1UFKA 2A14A 4FP9A 3ER8A 4DMGA 5EKUA 3SR4A 4E31A 2AZTA 3G5TA 3BXOA 3OPNA 4PWYA 5K0BA 3NW9A 3KQOA 5D1HA 5KQSA 3KR0A 3WSTA 4RTRA 5GINE 2PXCA 4RTKA 1YFLA 4DKJA 2CKDA 2XYVA 2HNKA 5DTQA 4F84A 5EZQA 2JG3A 3U81A 1DUSA 2PX5A 5IH3A 1AQJA 1JR4A 1P1CA 5EHGA 1ZQ9A 4HSGA 2ZCJA 2P3OA 3UFBA 2EJUA 3UBTA 3GJYA 3HVJA 1AV6A 2YTZA 3G2PA 3A26A 5LQUA 5FQNA 5LSAA 1KIAA 3UJ7A 3AJDA 4FS8A 1M6YA 4GOLD 4HGYA 5E8RA 4GC9A 3UZUA 3P2EA 3G2OA 5T67A 3OCJA 2H11A 3CKKA 3RW9A 4OBWA 3P9CA 4FT4A 1JG2A 2YXDA 2PKWA 3SX0A 3ERCA 1WZNA 2VDVE 3FUWA 1QANA 4FGZA 2OPBA 2ONYA 4LG1A 4PYNA 5E1OA 3UJ6A 3DXXA 3ID6C 3M6UA 3GRVA 2GB4A 4A6EA 4FR0A 2XYQA 4P7JA 4C04A 1XJ5A 3LSTA 1KPGA 5FA8A 4QPNA 5T6BA 3EVFA 4H0NA 5CCBA 2AVDA 2QYOA 3B7PA 4E2ZA 2O05A 1G55A 4L7VA 4QDKA 2JHCA 3EVBA 5E2BA 3HA7A 5DX8A 1SKMA 1O9HA 1WY7A 2JHAA 3SSNA 2AN3A 1EJ0A 4ER3A
chains in the Genus database with same CATH superfamily
2F6RA 3M5WA 1RJGA 2ANBA 3FDZA 1L8LA 1YHNA 2ZB3A 3L02A 3N28A 4P08A 5CVCA 1K4MA 2NM0A 3WHLA 5ALIA 3VU3A 3CLTC 2QM7A 3KV3O 4ND8B 3KV1A 5JJLA 3ND8A 1XEWX 5A3VA 2Q27A 3LF2A 4ZVMA 1LS6A 1LLQA 1YH3A 4YT2A 2CJWB 3E9RA 4RVOA 1YRLA 3GRYA 3QVJA 3LT0A 5B12A 1WCV1 2IZ0A 5JLAA 1E2BA 3RSSA 1JBKA 1IEWA 1AGPA 1P3JA 2G09A 2XX3A 3QKSB 4RX1A 2AC4A 5EP2A 3WK9A 1GGJA 3WK5A 3LHKA 5BN4B 3T3GA 2JI4A 2IYLD 2BIFA 4IIJF 3M0EA 3ZJTA 4YAKA 4MS3A 1QQ6A 4AXXA 1ND6A 4O2BF 4OJNA 4Y8VA 3ZV3A 1LRLA 2VUHB 5DJ5A 4KQXA 4PM4A 2J67A 1SXGA 2ZT7A 1ZH0A 1SPXA 3E1SA 3G2QA 1TIKA 5CAEA 3KKLA 1AKUA 1KI4A 2I99A 2VJYA 4WOCA 1SA0B 2WP8J 1RBZA 3FUCA 2GEVA 2IHVA 5KTRA 1PV1A 2EKPA 3O75A 5ITZA 1A7JA 4ZVUA 4YP7A 2PQ0A 3CEHA 4RGQA 5EWJB 4EUHA 4HDQB 2B99A 4NBSA 4C14A 5JNTA 1QYCA 1V8PA 1T4DA 2XYGA 2O5RA 3HU5A 3I8SA 2WVHA 1WQ3A 2PGOA 2B98A 2WWFA 1Z0KA 2HHAA 2P78A 4EHAA 4C2TA 1XEXA 1KI2A 2QIPA 4G2NA 3GAMA 5EA2A 1M34E 1QG2A 2BGGA 5FUVA 5AVZA 2A9QA 4U7GA 2WIGA 2QOEA 3I76A 3QEBZ 4FHCA 2V4MA 3P9NA 1LF5A 5EE9A 3S2GA 3ZTWA 4A26A 1F2TB 1TGVA 2PH5A 1OH8A 5C35A 2YZMA 4KXUA 5FP0A 2O07A 4EGQA 4CI9A 2YJ6A 4MS3B 1PW7A 2ERCA 2YS6A 2R4TA 1FRNA 3O1IC 1JU4A 4KPFC 5B5SA 3NDRA 3WWCA 2OB2A 3RYCB 3U56A 3FCUB 2II6A 2PGDA 1E2MA 3DEFA 5BWOA 1P7VA 4G0UA 2JA2A 1GZ3A 2Q21A 1QQTA 1I7LA 3OA2A 3O4GA 2MDTA 5ICSA 4WXPA 4H59A 2HWUA 4XW2A 5KTSA 3OSZA 2JKYA 1US8A 2V9ZA 4H60A 4M98A 4C5BA 1BFDA 2Q5FA 2RDMA 3BQNB 3HO8A 2OV8A 4RL4A 4XGQA 4XE5A 3NJRA 3T3HA 3HXQA 1XC7A 3W2FA 1ZNYA 5GZ1A 3H86A 4DR4B 1RYDA 3E5NA 4YCDA 1V6SA 2GI4A 3MRSA 2GHIA 1XTIA 2XXJA 3HM9A 5CK4A 4NJEA 3AL3A 3L04A 1BQ3A 4QLAA 1C1XB 2Q07A 1R0YA 4AY6A 3I53A 1NPYA 1QYIA 2O54A 1Y3FE 2R0QC 1G66A 3LXUX 2C7PA 5K3CA 3LPNA 3IODA 4YQEA 3WO1A 2GCOA 5FWYA 1KO1A 1Q5PA 3NRBA 4RVDA 3W9YA 2PSDA 1KH1A 1ZIOA 3L7OA 4KIFA 5A7HA 3ZHZA 4Q37A 1DJNA 1TJ3A 2QPAA 2X1HA 4Z51A 1T9CA 3SS8A 2V7VA 4A9AA 5LNK6 5E4FA 3IRUA 1GG2A 4G24A 1EK2A 5COQA 2XZDA 4GI1A 2ZT5A 1CVLA 2QY6A 1JQ3A 5TRTA 5I7RA 3EGCA 2VHQA 4B3BA 3OM8A 2BKUA 1TF2A 2VYND 5F2EA 1X1BA 1E5XA 1O9GA 1VKHA 2ATXA 2E4VA 3MIIA 1RP1A 3F2VA 2I2DA 1OLSB 2Q6KA 3A1WA 3I1IA 4JQZA 3PQ4A 3GLQA 1K4YA 2PEZA 1UC8A 1ISRA 1TB4A 3QI2A 1H1LB 4EY6A 2D2IA 1L7AA 5CURA 3TSWA 4QEZA 2IU3A 1N77A 4HH4A 3DMYA 3VR0A 3OQMA 1ISGA 4FHZA 1RLMA 1Z16A 4I19A 1H05A 1JLLB 3KXPA 3O38A 1EFPA 1CWUA 1FEZA 5JS7A 1ZH8A 4ZQHA 2BHNA 5ED4A 5D3QA 3OY7A 4LGMA 1UKVY 4UZEA 2AC7A 5CG2A 3BTOA 1V5WA 5M34A 1YQDA 4UJ5A 1CF4A 3BREA 4W5WA 5JHGB 5LR6A 3DBRA 1VM6A 3I45A 3QH4A 1ZNZA 5DXAA 5B7NA 3A6ZA 3V4RA 4L9AA 2GJSA 1H6DA 2G72A 3HN7A 4H77A 2XF2A 3IP7A 1P45A 2JLQA 2C03A 3GIDA 4XVUA 5FNVA 3BHNA 3OOJA 5JXHA 4F4CA 4MI6A 5HA5A 1SZCA 2HJ9A 1FDOA 3BWBA 3WLEA 4CR8A 3OM0A 1XCPA 1G6Q1 3CLRD 1DO2A 1VHWA 1BDMA 1RPAA 2H5EA 5K2OA 2XODA 1QVVA 4LDRA 3C8MA 4EIWA 3K9BA 3GZ4A 4N82A 5K6AA 1ZM9A 1K1EA 3E8MA 4GXNA 2IHYA 2BH9A 5F2KA 2J6HA 5SZIA 3IAS1 2DPGA 4N7MA 3DAYA 4KQCA 3UJAA 1R50A 1CERA 1X1SA 1ZWKA 4HMOA 1VBKA 1L1QA 1PIWA 3TD6A 2ZITA 3T1YB 2XUIA 4NS4A 5C5DA 3BRWD 3W2TA 4DGSA 1N5LA 5KMGB 4JXKA 5DYYA 1JHUA 2BDTA 4LOLA 5HK8A 4ZZ3A 3O8CA 4OJKA 5LA6B 2HA4A 4RJTA 4WK2B 2GR9A 5GJWC 1PJZA 4D9FA 3A9SA 1LRJA 1NJSA 1Q0ZA 2O2HA 3DB2A 2ZSUA 3QKRA 5EKSA 1QTNA 4AF8A 4FBGA 4DBLE 4P53A 5K5EA 3JARB 1JEQA 3SY8A 4XJSA 1DQRA 1XEWY 4B31A 2PAFA 3HKCA 1IUOA 2NT3A 4L2IB 4X1YB 3VXKA 2X0EA 2I66A 3U4CA 4GRDA 3B8HA 1S7CA 3X1WA 4D9GA 1CDDA 3LBNA 1RYNA 4RIFA 1RR6A 2O8DB 3KVYA 1NJ8A 1KEPA 4G1BA 3T0FA 3KLPX 1XZFA 3SIRA 1QXSA 2PT9A 2WAAA 2VR1A 1FQWA 4YFVA 3SEQA 2CNLA 5LQDA 3F3KA 2XOKA 4BB0A 4PVCA 3WWYA 1EE2A 2FU5C 4CLHA 3T41A 5EI5A 5FAXA 4G0MA 1N6NA 5GWXA 3HJTA 1BDIA 1TEXA 2LKDA 2ZSEA 4LECA 3ZGVA 1YQ9A 1QSGA 2BY4A 3KP1A 2FMUA 1TYDE 4KTVE 4KXVA 1ZJ4A 5KTMA 2R8OA 1MENA 2Y2UA 3HY6A 3M33A 3GYGA 1KQ3A 1GLNA 2K2WA 4XX0B 5K0NA 4N03A 1L9XA 2Z2IA 3TKAA 2ZUTA 3THXB 3VOSA 1JDVA 2WJZB 3O4FA 1JJBA 3E9NA 4W9RA 3T12A 4S1VA 2DTXA 5K8VA 4Q3AA 1EFPB 1M5TA 3IQIX 2P4QA 3PHBE 1XDWA 4OQXA 4J1SA 1DV1A 3FOWA 1RWPA 2W4MA 3NOXA 4HYQA 4J76A 3ROEA 3V8BA 4B7XA 4IZHA 5BN5A 4OJYA 4EB8A 1M8GA 3KZMA 2GAAA 1IZ7A 3NXSA 1I3NA 3MTJA 4Z8XA 4LJYA 4BKMA 4CQMB 3EX7C 2FPUA 2G88A 2H2IA 2YMLA 3I8XA 1EINA 2XI4A 2BCEA 2V0CA 4JLNA 2CXNA 3CA8A 5DLQC 1E18A 4BU0A 4F7DA 3BWVA 3AKCA 4HX5A 3ZWVA 4CCYA 1BGVA 2X1MA 4M1YA 3DT6A 4R8MA 4DV4B 3FHTA 3O2QB 1IWBB 1KORA 4MWCA 1V7QA 1EVIA 3EHEA 3HKDB 3I92A 4ZP1A 3SC6A 2C3UA 1IN6A 4PWZA 4PRYA 5EUQB 3SMQA 2WM3A 3U1VA 4IF4A 4XWOA 2X8WA 4D4GA 1I7DA 1OZ0A 2PUDA 2JIRA 5B3JA 4LFBB 2OCLA 1D2CA 4HV4A 5CDYA 3P0FA 3DDHA 3E1GA 1Z2PX 1Y9AA 2H4ZA 4Y2RA 3TFWA 5ALUA 2RGGA 1SULA 4G0QA 3FZGA 4GLJA 3TINA 1A5AB 2POQX 1V96A 1L3CA 1XIVA 2YW9A 3P4YA 4ZCLA 2GJ4A 3NLLA 3T54A 3HSSA 4B34A 5ARBA 3CF4G 4FYHA 3LGSA 4GE0A 3OQ1A 4JL6A 4K86A 3FNGA 2C2ZA 4RKQA 1HYBA 4LDJA 4PIPA 5EN4A 5K8JB 3MWEB 1U0OC 4ZJUA 2Q7OE 1BN7A 1OI7A 1Z4IA 2RIRA 2Z9CA 3B2EA 3V80A 3LSYA 2VDOB 1SN7A 2WHQA 1OTHA 2FW6A 3DMDA 5KX5B 1HO3A 3GFSA 3ML1A 1ZGGA 4UTRA 1CZLA 4X71A 4DV1B 5LLTA 1WSAA 1QQAA 4ZQBA 2O50A 3SYNA 2ZR8A 4U8GA 1E6LA 4DCGA 2C4NA 2IXEA 4OMUA 3TFOA 3TZQA 4HWRA 3RUEA 2FPXA 2ARKA 1K3TA 2QXYA 3L1IA 4POAA 4WNAB 2CUZA 5LD2C 2C7QA 2VOEA 3EA5A 3EGVA 1IJBA 2H1RA 1SUAA 3KELA 3ZXIA 2C83A 4D99A 1YI0A 2B1IA 2OO3A 2VUUA 4A0FA 3LP5A 2LR0A 4MDEA 1XZGA 4DF3A 3KT6A 1O87A 1G3IA 2VJLA 3QPWA 4M88A 3T7SA 7YASA 3SXPA 2IDMA 8ATCA 2CDNA 3L7YA 3STWA 1WUJS 4NE2A 3TUZC 3NBYC 5AQ1A 1IPEA 4KQHA 1A4IA 2WUFA 3UNXA 4CMIB 3HXPA 1P4GA 2GO7A 2X4LA 2EP8A 4IO0A 1UDWA 3COWA 4HZUA 5JZ9A 1NVGA 1QFJA 3P5BA 2ZP1A 4IIGA 1O08A 3PPWA 3EIXA 3FTPA 3UJNA 3SJ7A 4PONA 3QEAZ 3GN2A 5H02A 1N2CE 4QDTA 3AVXA 1W87A 5J4LA 4IVPA 5I7HA 3VR5H 1XVIA 3ND5A 3OE7A 5IVIA 4EQ6A 4QOIA 1GA4A 2YNMD 2W9XA 4MQ5A 1JEDA 3QMVA 2YWCA 4E3ZA 1GNPA 4Y0VA 1JG7A 5HG0A 1SMKA 1MNAA 1BW9A 4Y6LA 2YRWA 4OHRA 1MB2A 3VTKA 1PVVA 4L74A 2D00A 3RYIB 1S4QA 4AJIA 4DNQA 1CUBA 3KX2A 5ELMA 1AKTA 5TLSA 2RGRA 2Y93A 4MMXB 3FFBA 4QATA 3SC3A 1NIPA 2ECPA 1DX9A 4Z3OA 1GAXA 1ODLA 2AXQA 3R7BA 3K31A 1Q2XA 1ZI6A 1Y1QA 2HWWA 3TQIA 2IFTA 4B4VA 4CDGA 2W90A 1JYEA 3CTMA 1N5OX 1X8JA 1REQA 4IQ4A 3OZXA 4JP1A 4AO6A 1Y6QA 1CD5A 5NLLA 4MUNA 5THKA 3HC7A 2QA5A 3DBIA 2CZQA 3DBLB 5DLPA 1G8AA 2G4CA 1VI2A 2WLSA 3NKLA 1FJGB 4Q02A 3LDUA 4C0WA 3M3PA 4K87A 5FWXA 1G2OA 1LJ8A 3PF9A 4JQOA 1HM5A 3TD2A 3I5YA 3CUTA 2OOKA 4I6JA 1P7PA 3UYKA 5ADWA 2F3TA 2GEFA 4BNVA 3OQNA 1WETA 4F8JA 5K0BA 2BFBA 2V55B 4PU0A 4JLMA 4TV8B 3AJAA 3GYBA 2QLMA 1J33A 1XGKA 4I66A 4LCBA 4U02A 2Y6VA 4AICA 1TI7A 2RG1A 4CG1A 2WZBA 1KYTA 5JNVA 1IJKA 3LUHA 4F84A 3LQFA 2FX3A 2BKAA 1Z5PA 2XMBA 4RFSB 4EEXA 3ZS9A 4OH7A 2FP3A 2FE4A 3OKAA 4GKAA 3OJOA 4IYRA 3ZHCA 3D3QA 3WMRA 1X77A 1P61B 2IWRA 1G64A 2C59A 3RABA 1K7XB 2B1GA 2GZDA 4LRYA 3FOCA 3STUA 3TZLA 1AQNA 2BFNA 1DSSG 4KN9S 4KQEA 3R8FA 3CURA 3W7VA 4FEYA 4YQFA 3P0RA 3AR4A 1GQSA 2GN4A 3UJ7A 3ZHVA 3RSGA 2NUAA 4JXXA 1S02A 2AUTA 1M6VB 1OFVA 1SXJC 1PBNA 4HDSA 1PSZA 2V4ZA 4HMQA 3OCJA 1F3OA 3AYXB 4OHCA 4EM6A 4UE6A 3QJYA 4KAFA 1R6DA 3OPXA 4TMVA 3MRXA 4FT4A 1SHZA 3CSSA 4UM9B 4OAQA 3U4IA 5JJBA 1I1OA 1EM6A 3PGLA 4TXLA 1QIFA 1QP7A 3G9TA 4LF8B 1B8UA 2W8BB 1RM5A 4IOMA 3SHOA 1E2PA 1TO6A 3NWOA 1PJRA 2B92A 5CX1B 3M83A 1DXQA 1XK7A 2VP0A 4WKNA 1UBCA 4EG6A 3AB8A 3DMTC 1PCXA 3FR7A 3JWPA 2GUWA 4RK7A 3SDBA 3EULA 4BKUA 5K2MA 1X1QA 3C3EA 1EGHA 5EE3A 4INOA 3U7QB 2H57A 1BE1A 2P9BA 4JJFA 1WZIA 3I52A 1R6AA 3O91A 1QGDA 2ZIWB 3CR7A 4UOQA 4ENPA 3CNBA 3CX3A 1H0HA 3DMRA 4M0EA 4MRVA 5IKOA 3N2NA 3VO2A 4A91A 1BMTA 1KKUA 1IFXA 1SBZA 1PR0A 4MX8A 1M2JA 3HR8A 4BOYA 1BMDA 1J0BA 4Q3BA 4JL5A 2G71A 3PYMA 4BNKA 4C4RA 4F1KA 1QK4A 3UHPA 1PNRA 4M37A 3M4NA 4GZ6A 4P84A 3H75A 4DWOA 5BUSA 1MX9A 2HF9A 2VF4X 4Q1DA 5LUBA 1YT5A 5FHQA 3FMGA 2EZUA 1WAMA 3Q4GA 1ZDMA 3DMNA 2YVUA 1PZEA 3FZYA 2PX2A 4L0MA 1T6NA 2Q46A 5AHXA 4D3YA 3WAJA 4HVTA 1A04A 2H51A 1VMAA 1NJ6A 3V42A 5CFMA 1KAEA 2H1OA 2A5FA 1JXAA 1W4ZA 4PCLA 1TEVA 3IQDB 1F8YA 3NVDA 3GFGA 1HMPA 1Y48E 1HMYA 3L8EA 3PXUA 1CXZA 2I76A 2J5KA 4OQZA 1NMZA 3HB9A 1BDBA 3WFZA 3CQ9A 2N3ZA 3PR1A 4HNAB 1AGYA 2QX8A 4Y9TA 3EE6A 1JUDA 1L4NA 4K40A 2XUKA 4PSAA 1MABB 3BZWA 3D3EA 2FWNA 4MCJA 4KQ2A 4KPUA 5JDIC 1BJKA 1DO0A 5TX7A 3BKXA 4D98A 5CLHA 1GG8A 3CPEA 1UMCA 2F59A 3CE6A 3AI1A 3PGMA 1KZ6A 3K1AB 4IDHA 3RTEA 2IBSA 4R1PA 1V4VA 5AQEA 3NUGA 4GXQA 4YX9A 3AZOA 1K68A 4H2DA 2VXYA 3F3SA 2OYRA 3NGMA 2HR1A 4R84A 2J33A 3LX8A 4RPIA 3VI4B 4QELA 4WCFB 3I3SR 4PX5A 4U2BA 2XQJA 3CVUA 1Z35A 4RVGA 2DCUA 4G5QA 1FSSA 1HT2E 4DR2B 1BH6A 5AKKA 4LHZA 4X7PA 2F9LA 2HA3A 3GJQA 4AS1A 1SBCA 3DC2A 3ANXA 3IAHA 5EYPB 4AJLA 2XB8A 3SF8A 4XKJA 4Q39A 3M5PA 4CLRB 2J32A 4JBIA 4KLCA 5JADA 5FT9A 3EPKA 3NEAA 1YJXA 2GASA 2A5YB 4UNIA 2H54A 2JAQA 2H00A 3DZCA 5D5HA 5CDGA 4JSTA 1O57A 4X93A 3IEVA 1Q7GA 1P4JA 4LQDA 4EUNA 2ACWA 1NBOA 3NMUF 1SQ5A 1C7EA 4Z1MA 3HSYA 4BGVA 1ZRHA 2JBAA 3MS2A 1AZLA 1NC3A 1ZLYA 2NVUB 2OCYC 4IUDS 4F5EA 1IAVA 4RNDB 2OPHA 4IIJB 3B1WA 3P9SA 4QU9A 1LCIA 2JFVA 2CWWA 4EENA 3ZLJA 3QVUA 3ORFA 4NICA 1VPTA 3TMAA 2WQ7A 3DVAB 3DWGA 4IG9A 3PL1A 5DX1A 3FTCA 3SQXA 1M2OA 3SE7A 2VUIB 5H8WA 1BE8A 1PUIA 3DV9A 1B2LA 2BJWA 1QS0B 4JD5A 1DMRA 1LBIA 1WMAA 5HE8A 1KMHB 1KFJB 3H9CA 4A1FA 2VEDA 4X3CA 3N1UA 1Q12A 3OZIA 5EJIA 1ILWA 4OP1A 3T1TA 1DEHA 4WESA 1J20A 2X86A 3DL2A 4H0FA 4UCFA 2YUTA 1UBGA 4W99A 4IJKA 3B7GA 2XXAB 4RKYA 1FYEA 2ZUUA 3AY6A 4R2WA 4CG2A 4IVRA 5DGXA 4W5RA 2PX0A 1KBQA 2BOVA 1P6QA 1VSUA 3LVFO 3PJDA 1NG1A 1EGQA 4RCZA 1FX0B 2D74A 4F45A 1JEEA 4Z54A 2C20A 3W77A 4C06A 3TEFA 3W5VA 2FFBA 2CHGA 3WHPA 4DA8A 8LDHA 5IF9A 1NUTA 2DGDA 3UOWA 4NMXB 1XD2B 1Q83A 1CYDA 2WWTA 5CXXA 2WAMA 4CXMA 2FYTA 2G7MC 2G25A 3SBOA 1MXFA 4TVOA 4YLGA 1I2AA 4LN1A 3NDBB 4DJJA 3LDHA 2WIDA 5JSZB 5GIOE 2H06A 4MWGA 1KEEB 4J0QA 4R81A 1E3SA 2JVIA 2ECKA 4WLNA 5COBA 5F1OA 3ESZA 4MUJA 1APBA 3PNPA 1OJLA 2VSOA 1LQ2A 4BTEA 5L3QB 3OTGA 4BO0A 3NH9A 4EHKA 4JB3A 4LTMA 4KQKA 1GPWB 2QJRA 4TLAA 5JV5A 1DTEA 1LZKA 2NIPA 4DUGA 4E4TA 5KO2A 2UUAB 3DTVB 4ML3A 3NPAA 1V1RA 1YDWA 1F0NA 4WZBE 1PQWA 4FEAA 4I3GA 2JGJA 1KJWA 4H1HA 1M6NA 1CZOA 1F5SA 3D2BA 3IDQA 2GF9A 2F1OA 1ZITA 5BVGA 3WAGA 4PYIA 3V9PA 1TKRA 4ZODA 4CMBA 4D82A 5HF8A 2Z2ZA 1RABA 1ESZA 2HSJA 3TZCA 1NI4A 4CEHB 1S9HA 4WK6A 4WNCA 1SUIA 5CB6A 5CXUA 1NPTO 3SU8A 3ASUA 2OAQ1 3QG1A 5H1YA 1YS7A 3OOSA 1E1RA 2QTVA 2YFKA 4OQEA 4UPEA 2XA9A 2HLDD 4ZHQF 2HDWA 5DCLA 2XCLA 2BGNA 3P52A 4ZI5A 5DGTA 1EM8B 3VAYA 4JQCA 4UVHA 2JVKA 2EWWA 1WW8A 4ITUA 1SC6A 4XIGS 3OZFA 4RIIA 2OECA 1UJ6A 2C96A 2HIAA 4WZAB 1HQDA 3IDFA 5A6VA 4YWJA 2OBYA 1WA5A 4XB2A 2MWMA 4UXJA 3TQCA 1SG9A 4CTJA 4EI9A 3EGWA 3AZPA 3DNMA 3B3GA 3U19A 4FWTA 2RJNA 5FXMA 1NNEA 1J5EB 4TTQA 1KKLA 2ZW9A 3NOOA 1GTZA 4L7QA 3NVMB 4Z4GA 4P54A 1TTHA 2RB5A 1ADCA 4HNSA 3IEKA 1L6IA 1W6UA 2XECA 1CQIA 3Q3EA 4UFPA 3FMPB 3M70A 3IGFA 2FLKA 3MHPA 3FUUA 4HFMA 2X8LA 4M1KA 2F4VB 1DC4A 4QU0A 5DRTA 2AIRA 3K5HA 1IEXA 2BEVA 2HDOA 3BD7A 3OEHA 4OFZA 4R2IA 3VC2A 4CLEA 4IOKA 2ZSAA 3QBTA 4OK5A 4WEQA 4BS9A 5BNWA 4MR7B 2NO0A 1GYRA 1US8B 1Z0IA 2I4LA 2JBWA 5COAA 3KQLA 4I14A 3W2HA 2XQFA 4TMYA 4QRDA 5GGYA 1FSGA 3CH7A 3L8MA 4R9NA 1H4TA 4GQIA 4QUBA 1W44A 2NO9A 2VRNA 3QY0A 3BGOS 5CVDA 2AE2A 4JA2A 4NOMA 3KZKA 3RVOA 4U00A 1B0UA 1KIFA 4WZAA 1A9XB 3QQPA 3HFRA 3N5CA 2OBNA 3QG5A 3QLEA 4N7JA 3WBFA 2VJOA 3CCFA 4GI2A 2RKBA 4O2BB 1G8SA 1U3DA 5LQMA 4O4HA 3VNAA 221PA 3TLEA 1RZRD 3OU6A 3I0NA 4N8SA 2W8ZA 2IEIA 4MCHA 1CZRA 4NK4A 5IJ9B 1V71A 2FN4A 4MW9A 1XRLA 4G0ZA 1M0WA 4CE6A 2BEWA 2PJZA 3KSZO 4MV5A 3BE6A 4ZDIA 4JUBA 5TMDA 2XA2A 2GPJA 1L7NA 3R3XA 1T9HA 3DULA 3HJAA 1PGNA 4FU0A 2QROA 5JJ5A 5M5BA 4CT4B 1ZR4A 4EUSA 4M36A 5IM4A 2LCIA 4JS0A 1IXYA 3MZ0A 5LC1A 4EW6A 3QELA 5KJFA 1GAQA 4EEZA 2PU7A 4QUDA 1AURA 3K0AB 5GVRA 1PFWA 4RSHA 3CLVA 4WKCA 5AM5A 3IRVA 3EF1A 2UVDA 1N6RA 5BNTA 5B30A 3QYPA 1AQ6A 5JDCA 1IN8A 2AR9A 2CC2A 2V5UA 1WP9A 3F78A 2CMGA 1GKIA 5JXWA 2XE7A 3LTEA 5E8JA 2HSEA 1BCRA 3SJCA 1XCLA 1FUYB 2FB9A 2CDAA 5ALGA 5KTOA 4QTZA 1PJCA 2UZIR 4GBMA 5KCZA 3N3AC 2G07A 1XTSA 1U9CA 2C7RA 1R5JA 4MTCA 2PWBA 2JARA 3J7AC 4DA6A 3FJYA 3ZE1B 3WGJA 3L8GA 3G88A 3BZBA 4DLTA 4E6PA 4CEIA 3KTAB 4DBZA 3UHAA 3JQ7B 4QFBA 3QPUA 3MGGA 2C5EA 2OHOA 4IHJA 4TS3A 3LP8A 2GNAA 5DHAA 5CW1A 2ZRFA 4JJ7A 1A95A 1V3TA 3AB3A 2VSYA 3N87A 4WDQA 2Z6UA 3N2KB 4YRPA 1A8PA 1C3LA 2FEOA 3GJ0A 2YC2C 1KY2A 3SZRA 1E1QA 4UC0A 3WLHA 3T3OA 3UJHA 2DAPA 2I62A 4EVIA 8MHTA 4U63A 3EF3A 4YUXA 4D9BA 1XHEA 3C16C 5JRZA 4Z53A 2ZUBA 3EAGA 3W9SA 4QA9A 5EXSA 2ZBQA 1OX4A 2I0FA 4EABA 1K89A 2TECE 4GQBA 4Y2SA 2HRQA 5ALQA 1DKUA 4H15A 1KDTA 3QU2A 1T9ZA 4FFLA 4MW6A 1Q1NA 3DT8A 4F2DA 5AESA 1VPDA 1VMIA 2IELA 3HV0A 4EKYA 4NV1A 4OGFA 2QDKA 4RDCA 4BVLA 1YS4A 4LE0A 3TDKA 2ATEA 5LBUA 2XV1A 5BQ3A 3L4KA 2VDPB 4II3A 1OKKD 3PVCA 4M1MA 4B47A 2WKWA 2Z0MA 3DJFA 4DWWA 1VIVA 1N2JA 3FNHA 3VR1A 4ARVA 4CTMA 3PD1A 2DHQA 2QRZA 4HQLA 1BG6A 3SVZA 2Z09A 3W8RA 3VI3B 4DANA 4ZOAA 4FFDA 1POWA 2CLKB 4OAPA 4WAUA 1CNMA 1ZBDA 4HG2A 4HWOA 3A6EA 3PUYA 4JCOA 2Q9CA 4MB0A 2DQ4A 5IDWA 3SQMA 4QGSA 2IH2A 2PH3A 3AHCA 3TYXA 5M7EA 4KMSA 3D3JA 1P8AA 2CD7A 3A27A 2ABWA 3LC7O 3CVXA 4P0PB 4BNTA 3FOAA 2GZMA 3D7RA 1SVSA 3K8ZA 5TVGA 3CNNA 2AXNA 3O31A 2WJAA 3FOFC 3UW1A 4P82A 4AY2A 1EDBA 1YQTA 5KVAA 4G5FA 4OL9A 1KR2A 1N4DA 2HFJA 5AI0A 2Q1XA 2P9JA 3DP7A 4GOND 3KYDB 4R0NA 1J99A 2XE4A 2A9OA 4CR7A 2H1VA 5JH7B 3REOA 2ID8A 5K3OA 1C30B 3Q0IA 3OTHA 3ZE8A 5JFOA 3VBEA 3TSCA 4NEHB 5JPDA 2XTNA 2R87A 1P5ZB 4NDAA 3VHXA 4X60A 1JWLA 3CKLA 3GCDA 3TLYA 2VQDA 3PPYA 2Z5GA 3CLSC 1W34A 2PLNA 3GEPA 2H16A 1O58A 3LY7A 4NU5A 2EGHA 3AWDA 2DWPA 5B37A 1ECBA 2QZPA 3KAKA 2J3MA 2NU6A 4NU6A 5EMNA 3LWDA 4QASA 4WFKA 1UFVA 2NO6A 1DIOB 4HAOA 2FPWA 3K0AA 3KQOA 4D96A 4PSUA 1YR7A 1DAOA 4RTRA 4XDGA 2YJNA 4BU1A 1LLDA 2ZXUA 2HNKA 5I8WA 3D8UA 3ECAA 1WIWA 3G79A 2ZJ0A 2AJDA 1K08A 1XJWA 4KPGA 3SIWA 3C3AA 5EHGA 4PN3A 2HA0A 4NAVA 1M0TA 2VHEA 1FLDA 1JJ7A 5HMLA 4DQKA 2HHHB 1OH6A 3LFUA 3SLKA 3LOPA 1N0HA 3LZCA 4GVPA 3FWPA 3DE4X 4Y1RB 3SBEA 1JQJC 5TXGA 2UUBB 4FPXA 4FS8A 1M6YA 2FFQA 3P19A 4HGYA 1BQEA 5E8RA 3PENA 3UOGA 3VTAA 4JOQA 1I6LA 4I55F 4W9NC 3NI2A 4HDNB 3L6CA 4LDPA 3WQSB 2P5TB 1LX7A 3FJOA 4LDAA 4DRZA 3ZX5A 2WSIA 2L82A 2DH5A 5EIOA 1PR9A 1O96A 4A4DA 1XU7A 4YRGA 4CM5A 3B8EA 4OJQA 4NC9A 5MN6A 2BMVA 1TM1E 1L7OA 1IUPA 4P7JA 1L7QA 1QB8A 3NIWA 3OWOA 3UMMA 4L5AA 5T6BA 1M66A 2REQA 4DEXA 2WMDA 2OGSA 1O95A 2WHPA 2O05A 2ZPUA 3F9CA 2O7SA 2AN9A 5C8YF 1C5KA 3AUKA 2ZIUB 3E6AA 3HRKA 1OC2A 3MT0A 4ID3A 2VL7A 5JH7A 1DX6A 1N6KA 2C8LA 2AFHA 3QPDA 1Z2EA 1IVSA 4UDXX 1Z4NA 2CNNA 3ELBA 4YJFA 4UDOA 1W8DA 3LQKA 4FUTA 4PTLA 1A9PA 1GPDG 1Z08A 2PNFA 2CXPA 1DRKA 2GBCA 3IBCA 3PC8C 5I8ZA 4H4CA 3MCZA 5EUMA 1QAOA 2IPLA 2AQIA 3AEQB 5CFPA 1MW9X 3H5WA 7MHTA 5DGDA 4N0EA 1VBNA 2FJPA 1HE4A 1P91A 1UC9A 5LYJF 3P20A 4LKRA 1PLLA 3UCFA 1G98A 3E7PA 3H5AA 3FWYA 1LU9A 4RD4A 2EJTA 2HPAA 2IYPA 4K9LA 4MUGA 5EJAA 4OJTA 3RRFA 1BJTA 5KJ6A 3QSYA 4I36A 2DTDA 3SSAA 2J09A 2Q2QA 1IMJA 4Z4CA 4O59O 4MR8B 4UASA 3JAKA 4XYBA 3KEOA 1YR3A 3I58A 4BZWA 3PDCA 4C6TA 4B4DA 1YR2A 1ORWA 4DJDC 5DISB 2GZ1A 3VJRA 2JZCA 3RFVA 1EFRA 4JFRA 4IDQA 3Q9UA 4L3OA 4YCJA 3WYFA 3GJZA 1XFAA 3R8XA 3GJ5A 5F9FA 1GN9A 4J0DA 5FLXA 4LYGA 2H92A 1RWMA 1U90A 1FRZA 1Z4PX 1X8KA 2HUNA 5THXA 1THZA 1P72A 2W2LD 1WM1A 5EHIA 4IZIA 1KY5A 2G7ZA 4F4JA 4QJ3A 2CLEB 3VR4A 4LDZA 2DH6A 5HOQA 2OLJA 1M1YB 1GNQA 5HX7A 5JAHA 1UKCA 2NN3C 3EC1A 1M10A 3AKEA 2RHTA 5CDFA 3SC4A 4F3CA 4I9GA 5HZHA 1UJ2A 5CK5A 3DZJA 3WWEA 3MUOA 1ESEA 4YRNA 1MAHA 1YUBA 1I3OA 4BFCA 1QH8B 3QYAA 5AUOB 2W2QA 2NGRA 3LQ2A 3ZLUA 4B4UA 3HJFA 1MJHA 1XSEA 2Y1CA 2ZLBA 4R0VA 3IEXA 2FWJA 1DG1G 4DIUA 1DRVA 4OP2A 1MP0A 4M9UA 4W63A 2WUWE 2ZSHA 3T5TA 4E0BA 5BUCA 4CL8A 5CFRA 3FGNA 2QRMA 2WSBA 2H7XA 4NE9A 1HQKA 3G23A 2QNBA 2C9OA 3I1JA 2CSUA 1EXNA 4CMEA 5GONA 3PQCA 2FMKA 4TWJA 4H3VA 4JBHA 2DUJA 4EZBA 3KQUA 3QP9A 1PTJC 1AN9A 2F7SA 2NQ8A 3LPAA 2A94A 2BWJA 1EFVB 2X8JB 3GW8A 3MTEA 3W7AA 3A6DA 2XVXA 1WMEA 3LY5A 4FYKA 2CNDA 3JYNA 3BIOA 1DKLA 2VJDA 4KZKA 4HNRA 3STYA 1E2HA 1GRCA 2AFIB 3BWCA 1Z8DA 3FHOA 5BO5A 2WPDD 1Q7TA 1D09A 5JD3A 3SOPA 4EL5A 1BU8A 1YCHA 2BFEA 2R7KA 1MZVA 1PSDA 4LXUA 3MBKA 1VMDA 2JK1A 3FCOA 3K6RA 3QXSA 1ICEA 3LUAA 4E5NA 1U4NA 4Q48A 1Q0HA 4RJKA 3UEOA 2JFHA 1XA4A 1FJHA 4CKCB 1OFTA 2GOYA 5DNCA 1Y1RA 2F1HA 1N7GA 1Z13A 3G8CA 3C8DA 4XIIA 5BN4A 1U7ZA 3CGWA 1QRSA 2DSTA 2R6ZA 4U5XA 1Y6JA 3HYSA 4Y6GB 2AF3C 1UBOS 1BD4A 1BWQA 4DVJA 4NCNA 5C3UA 1N7JA 1R4NB 2W2MA 3OURA 2GXQA 3V2UA 1K63A 2B69A 2RG7A 2EFGA 4JKOA 2ZAOA 1ONOA 1WULS 3T5GA 2AN5A 2YOHA 4KH1A 5FFFA 4EO7A 5BWCA 4IX9A 1D2EA 3W5AA 4WA8A 1E2NA 1BNCA 1NF9A 1O94A 1Z6XA 4F9FA 1GYPA 3N6XA 2JI8A 3PVSA 2XKJE 3EHDA 3K9HA 4M9XA 3TIXB 1UMDB 3RIXA 5K7SA 1FSZA 4Y2UA 1D2AA 1LNQA 1PRYA 2EERA 2I33A 4LTDA 4U2CA 4W5JA 5EJEA 1YOVA 2Q41A 3DV0A 1TQ4A 4HH1A 2AI3A 3SYTA 4BNUA 2PDAA 1V6CA 1TD9A 2BMFA 2R00C 3IHTA 3NAMA 4UAVA 5CX1A 2OXCA 4JJ8A 3IC5A 3HA3A 2ZKIA 3EW9A 2R48A 3ONNA 2IODA 2EGUA 2Z95A 4ZCQA 1DO8A 5IKXA 3K9CA 1RLJA 1C7RA 4RZSA 3THWB 4CF3A 5TY0A 2YDXA 5E3HA 4FR5A 1PJLA 2GA9A 4Z99A 3I9NA 2NAFA 3DFFA 4WWHA 4G0YA 3MMSA 2COEA 4UQOA 1VPEA 1MO5A 4QOSA 1OPRA 5CJPA 5T4EA 1XQXA 3NT2A 2WJ3A 3LE8A 2XADA 2GAIA 4CUJA 4EGSA 4NXNB 3KKZA 2FPPB 1BXGA 3UMFA 2XZPA 1TYBE 1XRMA 3PE3A 4AMYA 3PYLA 4ZGGA 2BR3A 1CZKA 2XVAA 4G23A 2ZSJA 3K32A 4TMKA 4B1FA 3UAWA 1YK1A 4QUEA 5KVCA 1X38A 4A03A 2VA8A 4HYYA 5DHSA 3KHKA 2PUCA 4C88A 3H04A 2FCAA 3EW7A 4L02A 4OYYA 3ASVA 4TROA 3WWOA 2ADFA 2OK7A 4CCAA 4DGQA 2GLUA 4Z9XA 3RHFA 1QOPB 3ORQA 3VC3A 1AU9A 2CLHB 1XF1A 3MTGA 4O1IA 1BMFA 4CTKA 2PO7A 4WASA 3R74A 3DLHA 4F1JA 4DM3A 2QUKA 1L3IA 1AQUA 1M34A 3I04A 4GDMA 2GCIA 4NG4A 5J4VA 2QQFA 3K0FA 3FFTA 1QRUA 1H5NA 3CJQA 1ADBA 5JJCA 3B6MA 3U3DA 4D3FA 1NXPA 5HDBB 5HJEA 4G86A 2OCIA 4QE3A 1UKEA 3NGXA 5EPEA 1MQSA 2GJ8A 1CUSA 1U2PA 1WBBA 4I5EA 2ONJA 1IRIA 3MM4A 1O94C 3TNDA 1XYYA 3D64A 4DV2B 2J5QA 2IZZA 3AVTA 5EC8A 4EPVA 4ZRMA 2GYYA 5E0KB 1PWEA 3N0VA 2PKYX 1Z6PA 4DLUA 4KG7A 4BMXA 2FKNA 4BNDA 4QJ5A 2EDAA 4LHEA 5JNRA 1I1NA 5ED0A 3RNOA 4IFIA 4HQRA 5EXPA 3T15A 3G17A 3O2SB 4DKJA 1QCDA 3KKNA 3M4ZA 5IAOA 3ND7A 3GGSA 1QCZA 1NXOA 4MPRA 2V03A 1WLSA 3QBJA 2F43A 5G3YA 4WZZA 3EWSA 3Q8LA 1Q17A 2GEKA 2X0KA 1ULTA 2G28A 1R4MA 2VBIA 5KQMA 2ZYTX 3SIPA 1YR8A 1GZDA 1N5JA 1PFVA 3K6JA 2ORIA 4NMLA 4C87A 1WHSB 1U2RA 2PZGA 3G02A 4OMCA 4RO0A 5L4NA 3UAYA 5GAJA 2YV3A 4XVRA 3RC1A 4DB4A 1LSJA 2QP3A 4PFJA 3RQIA 2JI7A 1YI8A 3BMNA 2P8JA 4LJ7A 3WRWA 4MR9B 2I4RA 4ARSA 1K7FB 5J5AA 2YY7A 5DVZA 3TIIA 3BE5A 3MFYA 4OOFA 1YV9A 2ORWA 3N2EA 1UK9A 5FF9A 3PQFA 1NAHA 3CBQA 4BO2A 3CUSA 1SG0A 1MLDA 2AC2A 3O3OB 2O8DA 4RY9A 5ULLA 4C20A 4BMDA 5AJTA 1VJDA 5BN1A 2GERA 2P8SA 4LF4B 2W6ZA 4QEDA 2YWHA 5B1IA 4EL0A 1R7RA 5E3IA 3B5IA 4IFBA 3WWDA 4A2PA 4US0R 3V48A 3OZUA 2C5LA 3GA0A 3CH6A 4H7DA 3D3KA 3OX2A 3KVRA 1H2XA 4K9PA 4EX7A 5B53A 3AF2A 2F00A 3PNBA 4WFIA 1I5OA 1I01A 2VUTA 4RK6A 3RRYA 4BTLA 2P40A 1RJ9A 2ZJ2A 3TE7A 1L5NA 3BKWA 1VYUA 5JU6A 1YA4A 1EHIA 1F60A 1IQPA 1KU6A 4Y6OA 4QUGA 2ZT8A 4E5PA 3WP1B 3O93A 4OCZA 1AKYA 1WHSA 2ZTLA 3TTTA 2PGAA 3OCWA 5KYYB 2HJWA 1D5WA 1SWVA 2PT6A 3SFTA 3DZKA 1TQ2A 5G0SA 4H6WA 4RCYA 2H59A 5ICMA 3QEKA 4FFSA 5LU9A 1FNSA 1OW3B 3QA9A 4KWEA 2KMLA 4XCVA 2ZM6B 2UYHA 4KHZA 1C4WA 4E6EA 3UWKA 4UNNA 4PQRA 2XIQA 4B8ZA 5DI3A 2OHVA 1GP2A 1SXQA 1PHRA 4IMJB 4MW0A 3HDYA 4C4AA 3JQ8B 4WXMA 3O8BA 4KUGA 3T1QA 4P38A 4AJ4A 2WYHA 4P5EA 4FQ7A 3SYRA 1Y0BA 1U2DC 3OQJA 4DNXA 5FBVB 5CHEA 1T2NA 4XQ9A 1J1ZA 3NDIA 2IS6A 1L5LA 3PJRA 2DT8A 3M6WA 10MHA 1MA0A 3S1SA 5IAAA 1NVTA 1CFJA 4XB1A 5B1HA 3W6NA 4ETMA 3ZZ1A 2EOAA 1WD5A 3WGKA 4DLYA 1HOTA 1VHLA 4BFTA 1PT9A 4Q1VA 4K2AA 1HZJA 2HGSA 1QM5A 4IXDA 1NATA 3GP8A 2P9GA 3DR3A 2X41A 3H5TA 4ZQFA 4CJXA 1YE8A 3NWJA 3FMVA 4NI5A 2YV4A 1NA5A 3WJ2A 1UR5A 3ZLTA 2GJKA 3F7MA 4KRFA 1X94A 4W5QA 3DFZA 1T5TA 3IP9A 4HYTA 3JQQA 1AE1A 2QMUA 3DLIA 1SFRA 4HXYA 3ZQ4A 4Z7QB 3JR3A 1YZ3A 1R0BA 4CQLB 3RB8A 4C21A 4KHPB 3UICA 2YMMA 4ZICA 1KJJA 4AZ0B 4D9EA 3E7FA 1P5JA 4GRAA 1LDGA 3R7WA 1WCIA 1ZGAA 4WXYB 2R9VA 4G8BA 4QQNA 1MT3A 1LGYA 2AGVA 4B35A 4UUBA 1T36A 3NP7A 4L8FA 1NBIA 2XKKA 2ZANA 3LIIA 4QVIA 4JUDX 3COYA 4IICA 4UM7A 3PI6A 1XDUA 3ROGA 3WLMA 3DOIA 1I4DD 1N2BA 2ZIFA 2QNIA 2QUHA 3I2KA 4UBNA 5F7OA 1K2VN 1M75A 3VU9A 1RCTE 4JT4A 5AM2A 2HU7A 3QMPA 1LKZA 4BTVA 2DYKA 3PQ6A 1P8JA 3VVMA 1Z5VA 3P9KA 2ZB8A 4MKIA 4WECA 5HIKA 4LY3A 4A6XA 4C0BA 2QVZX 5EIXA 1UKBA 3T7JA 1WXGA 4M1OA 3MCUA 3S2IA 3S2YA 1QOZA 4J43A 3NVAA 2B9EA 5FBHA 3DE7X 1Z4LA 1JVBA 5FWAA 3UPTA 4TRMA 4KIJA 4B87A 1D7OA 3IUPA 1PX0A 13PKA 2YH2A 4RMJA 5AW6A 2DLDA 1Q15A 2E4YA 1NVMB 1IPFA 2AK3A 2CWDA 3TOCA 4E5VA 5JVDA 5L53A 4M46A 3L7JA 3N7UA 5F4ZA 3RS4A 4KE9A 2YJZA 1QDLB 1RKBA 2G8NA 2ID9A 2PXXA 4L5JA 4XIFA 5ALFA 4ZD6A 3TX2A 5K4HA 1RJ9B 2Y3IA 3OE4A 1XTZA 1SU4A 1T8WA 4I1VA 2V7EA 2VCYA 5ENDA 2YVAA 5ERXA 2WJ4A 1IU9A 1D1SA 4J7CA 4JT8A 4ND3A 3TE6A 2ETXA 3LCMA 1K7YA 4HLUA 3UY4A 2BH2A 6REQA 4PNZA 2RHHA 2QT1A 4FKBA 4RF5A 4CMIA 4LJKA 4AKIA 2VT3A 2XUOA 2QYSA 4DMLA 3RG2A 3FSGA 5E1MA 2XEXA 4F4FA 1JKJB 1NFRA 4TQ9A 1VLHA 5H81A 4C0AC 2A14A 1GLVA 1U8EA 3AC0A 2GF2A 1NMEA 4KRYA 1U3UA 4DLRA 3WLJA 4IKEA 3U3ZA 1U1IA 1Q7RA 1YQGA 4Q47A 2GPSA 3HS3A 4QX6A 3FI9A 4RZIA 4AIIA 4ERNA 2AZTA 1Y4SA 1CQWA 1M2HA 3OPNA 4HF7A 4PWYA 4UM8B 5AK4A 2YS7A 3A37A 2Z57A 3BWXA 4J9UE 3RT1A 3ZBUA 4Q4JB 4HJXA 3KR0A 3QLVC 3WSTA 1YQWA 3ZY4A 5K20A 3H87A 3JATA 2BAGA 5JPIA 3MGBA 3RF7A 3WLSA 3S2ZA 3U81A 1RCUA 4FEEA 1IDOA 5L51A 3ZUGA 2ZBUA 1Z2DA 5KWJA 3UBTA 3IMFA 2X5KO 1EWQA 4ZK6A 1ISPA 4J75A 4PAMA 3W8EA 3WB2A 5LSAA 3EXEA 5J23A 3A6HA 3I01M 1J8YF 4IJWA 2I2FA 2AWNA 3ZVKA 1QBGA 4ARZA 1GVHA 3HR4A 1T15A 2VA9A 3QVMA 4MUXA 2OAEA 3JYLA 4KACA 5DFAA 3D7LA 1WDMA 4XPIA 1XKQA 3AIKA 3GAFA 1L4YA 3WSWA 2GNOA 3X2EA 1E96A 1E62A 2OPBA 3S8MA 4I6GA 2ASVA 3QKIA 1IJEA 1UWLA 2J4DA 1UOOA 5EIHA 5TE9A 5JIBA 4Y0NA 5KOHB 3BK2A 1TAGA 4S05A 3COZA 3LSTA 3EEBA 5KNBA 1UJBA 1WXIA 2ZROA 4XOUA 5AVTA 3B7PA 4D9HA 2PSEA 1NONA 2Q3EA 4QDKA 1UOPA 3FSGD 1TM3E 5D86A 1YDHA 2C92A 5D3MA 1NSTA 1XYVA 3HJCA 3OMXA 3UUGA 3VAZA 4E03A 3T7TA 7REQB 1REQB 2ZVPX 9MHTA 1MR3F 2FK7A 1FU4A 5E9QA 5H3HA 5DHPA 3IBGA 3CUYA 4U9UA 4MAAA 4W5NA 7AT1A 2WI8A 3PQEA 3ABOB 3Q1LA 2C2HA 5HP4A 4L9WA 4B6GA 1DWPA 1RKVA 3KVVA 1T2CA 1KPIA 4H08A 4IV0A 5BQ5A 5KYXB 2Y99A 5IT0A 1DQSA 5ER6A 4MGEA 5B3KA 3WGZA 4EG4A 2ZE6A 1DAEA 2FE1A 4FMDF 5KNCD 1ENZA 2QTVB 4RY2A 1ISFA 3D1VA 2AMFA 4CKBA 2NV6A 2CW5A 2MSNA 2ZRQA 2PJUA 3GFTA 2QXTA 3IOCA 3QVGA 4HWKA 1XNGA 3MS4A 1P1KA 1Y6ZA 4IO1A 4J16C 1ETUA 3ZQUA 2IITA 5BPHA 4O4LA 2QSJA 1KAQA 1KERA 3HU1A 2A9JA 4C7JA 3R9XA 4JBLA 1HH4A 4HB4A 1PD1A 3CNQS 2B4KA 3HXLA 4G01B 121PA 1AGXA 2HA7A 4I9HA 1ZHFA 2C5FA 3C4VA 1SPBS 1UXHA 4CMKA 1Q57A 4ZQGA 3NBXX 5FDFA 2PRSA 2W6JD 3I2GA 1BAPA 2QTMA 5CM9C 5KX5F 4IPTA 4DR5B 2GD1O 1IJFA 2OBBA 2SBTA 3N07A 2C95A 1OX4B 3CT4A 2J8ZA 3GJ6A 3L18A 1X6VA 1XK6A 1UBHS 2J45A 3SN6A 3ZU4A 1NXXA 1QMGA 1LBQA 1W8IA 4WFQA 5TGDA 4EO9A 5DU2A 5KYTA 1CUZA 2IZ7A 1OFUX 5HTOA 3RYHB 2RHBA 4U7TB 2XUGA 3ZGXA 4BVHA 3F4LA 3HB5X 3RKRA 3CPHA 1U63A 3N2KA 4QZVA 1YZFA 2EATA 2IHJA 2Y1GA 3PHLA 1BOOA 4BAGA 1CQPA 3ZWOA 5H9WA 3CEMA 2GLTA 1OIWA 1R5BA 1XP5A 1RTTA 3G0DA 3LPLA 3PFIA 3NXKA 4P22A 4C89A 4F4UA 1U02A 1XEFA 3I32A 2FW7A 2B1QA 4MV3A 3WGIA 2EFEB 3PVZA 4MWZA 3E70C 5BN3B 4U6QA 4JT2A 1BVRA 5LQKA 2IDKA 2QU8A 5IKPA 1B6GA 2CEAA 5GM1A 2QT0A 5TEVA 1XXHB 2HPVA 2O5EA 4OUDB 3QE0A 4JIGA 3V33A 3ZCSA 2WFZA 3AUAA 3PSHA 2I3ZA 4FNAA 2WYUA 1LC0A 2JHPA 2V7XA 2ZPTX 4WJZA 3ETGA 4YGYA 3ZY3A 4G3XA 5DYGA 1TTPB 4V0LA 3K9WA 2QMQA 3CINA 5FUMA 3DXFA 3QVWA 4OL0A 2IU6A 1PKEA 4DNPA 4TTSA 1SVMA 2FXVA 3JD0A 2QL9A 3FPBA 4HR7A 4O4IF 3RHTA 3V4LA 3QSGA 2O8FB 4D5GA 3FZQA 1NJ1A 1PKXA 3ME5A 4QFDA 2ZTUA 3O5AA 1UPAA 2QS9A 1V47A 4IEEA 5CPBA 1EEXB 1I4TD 3RUPA 1AMNA 1J09A 1CT9A 3H5IA 3MT8A 1E59A 2IT1A 1V16A 4QGBA 1DJQA 4I81A 3TF5A 3BXHA 4LWZA 4KR6A 1CJKC 4FGSA 5J5VA 1S2MA 1NW8A 1PYDA 2EL9A 2FKAA 2FPIB 3KEMA 3QKTA 4L95C 3U7EB 1WRBA 2IHUA 3U5ZB 1JPNA 4LMBA 1JJIA 5AKGA 1AS0A 1YS6A 3WNVA 4QXRA 3N8GA 4O0MA 2FUCA 4TSRA 5JLJA 1P9LA 1NQAO 3L1UA 2HM7A 3OLQA 3E15A 4PS0A 4BNJA 1A2BA 2PZ8A 1JSZA 2OGUA 1FXWA 1WVGA 1LTKA 1O6FA 1S7GA 3GWZA 4NFYA 4OUDA 4JJZA 4TS4A 5EWMA 4YXWA 3VVCA 3RC7A 3GLIB 4WKOA 4LBYA 2VAWA 4ZTZB 3HGQA 2VWQA 1SKQA 2QN9A 3G13A 2QPLA 3UK1A 3CUEF 3HH8A 4YO8A 2Z4RA 3ZI4A 3D8HA 4X92A 1PGOA 1ULUA 1XAIA 1ZO8A 2V7UA 3EDMA 1XT6A 2PYDA 3BF7A 2QGZA 3IMGA 4DCCA 5EEHA 2A7XA 3G89A 4MGKR 3T7IA 5JSHA 4F60A 4MKZA 1MO3A 4QDXA 1KFKB 2J3EA 3R5JA 3V1YA 5B3JC 3B6JA 16PKA 5JXJA 3WIEA 2R7MA 4IXTA 5CA0A 4YFYA 2ZYDA 4KR0A 2ZUFA 1A0OA 1YKFA 3B3FA 5A06A 4YK7A 1GILA 1QHSA 5KSYA 1ULBA 1U04A 3HCDA 2D4AA 2GK3A 2QZ4A 2QTWB 3OTQA 5TNXA 2DY0A 4JJEA 3JX9A 3R7WB 4Z0PA 5BNIA 5DX0A 4QM6A 4AVYA 1O95C 1J1IA 5LP6C 2C58A 3OKPA 3OPMA 1QF6A 1WPXA 3OO0A 3Q72A 1Z0UA 1PJ4A 4TVSA 1VE9A 3RD5A 4DIMA 2NADA 2X40A 4GIBA 3VKWA 5JXGA 4I4LA 1TD1A 5BSHA 4Q7MB 1BKSB 1CUJA 3N2ZB 4KQIA 5IYZB 2QV7A 5KNBD 3KYCA 2DFTA 3LL4A 1U8XX 2IYRA 3OJEA 1M1YA 3CBGA 4YQZA 4YDSA 3CZAA 4BLSA 4H3HB 2VQ3A 3O83A 1KYYA 1MB4A 3OZTA 3UGTA 3LJKA 1FFSA 1QG0A 3VZRA 4LC0A 2FR8A 2QD2A 2VWPA 3CFYA 4H35A 3A7DA 3REQA 1K06A 4EJ6A 3EPHA 3ICQB 3BXZA 2YINC 4YMUA 1Z63A 1Z5GA 1I30A 5KAMA 4NPHA 5DV9A 4CNQA 2EJCA 2QBYB 1FZTA 5HWSA 3M34A 1M67A 4JJAA 2FXIA 1MD9A 1HE8B 4RSRA 2VNKA 3KPWA 1K4KA 4YAOA 1ABBA 3UT5B 1JPUA 1Z75A 4XWTA 3QUSA 5AVUA 5CTJA 4TS1A 3KJIA 3FNQA 4Q3CA 3MGAA 3UF0A 2VNIA 1M7GA 1FDSA 4ZU6X 3FZNA 1VPLA 3I30X 3HTXA 2X2FA 1G8YA 4UULA 4HYEA 4ENQA 1ZXXA 1GPNA 2IS4A 2H9IA 4X45A 1BMFD 3U3MA 3FTDA 4YRBA 4Q93A 3OHMA 3U16A 4RD6A 1W5SA 3IKJA 1QHXA 3JRWA 3WGGA 1UBJS 1ZCJA 5E6RA 3ZKWB 2IW1A 1JXOA 4NKRA 3K5IA 5ES3A 2W58A 4EHIA 3IT1A 4RTLA 3AR9A 3TVTA 3LUCA 4KJZA 3PKZA 3HM2A 3DMFA 4WY8A 2XPCA 2VN8A 2W70A 3EVTA 1UEIA 3ROZA 4JC8A 5L6MB 4ITVA 5P21A 2NTJA 4DV0B 1RRPA 1TYEB 2OM6A 1GQYA 3ICVA 3NRCA 5AK0A 4MH0R 5JRJA 3OFVA 3NONA 3BMCB 4ZO6A 3PC2A 4UBJA 1RMTA 3DHWC 3E82A 3D6VA 4WIAA 4QDUA 3UG6A 1R0WA 3ZS8A 4K6CA 3A1NA 3DOFA 3A6GA 2V74B 4RPKA 1N32B 2GS9A 3S1AB 2O6HA 3UT5A 4ZZ1A 2MYPA 4F2PA 2P77A 4B76A 1VIAA 3EMDA 1V4NA 4EHBA 1DFGA 5E9AA 3OEWA 4QUKA 3WLTA 3RSFA 5I7VA 1I2BA 1MX1A 2C2GA 2QLNA 3KWJA 1OF1A 1KI1A 3DVRX 3O7WA 3A1VA 3UQZA 5JARA 3Q6NA 4TYNA 2BKEA 4O33A 4YRLA 2D6FA 2UUOA 3KB2A 1GNRA 1NRIA 4YHHB 2QRVB 3G9QA 4OU5A 4Q7LA 5F5LA 4UTVA 2G1JA 2ZWOA 4KXYA 4RH1A 3Q6IA 4XD7D 1P39A 3H9BA 1XEAA 2EFYA 4KIWA 5EXTA 3ENVA 2D4HA 3DOCA 1YFJA 4TLMB 3QZUA 5EIFA 1V3QE 4F91B 3P9XA 5DGHA 5KB3A 1YVPA 2BM1A 1I14A 3BPSA 4MIOA 4QAQA 2I55A 1BHJA 2ZBDA 2X22A 2C31A 1JR3D 1QLJA 2XUQA 2B20A 3B6KA 3OZVA 1KIMA 3RJ5A 3R0IA 3FCEA 4XAQA 1KSHA 1WE2A 4EB6A 3SC2B 1O1YA 2J9ZB 4HTFA 4N0PA 1XNHA 3TW4A 4BJ1A 3E3AA 2JEYA 1Z7YA 4IINA 4J3JA 1YIDA 2OM2A 3L8DA 5JASA 2AUNA 3ROPA 1KH3A 3I9MA 4OI1A 3GDGA 3N7TA 5ESDA 5CNMA 1KHHA 3JV7A 4JBGA 3HZHA 1QMPA 1Y6RA 1OB5A 2FPOA 1E4EB 1S2NA 3SNHA 4BN0A 5CUQA 1HKHA 1AIPA 3A2NA 3CH4B 3EUFA 3IT2A 4D3ZA 5E7IA 4CVNA 2A0WA 1PP4A 2GT1A 2JNWA 3A4YA 3GWGA 2V54A 4GS5A 3RTCA 1KI9A 2ZRLA 3WNZA 1J0EA 3X1MA 3LXXA 4UVEA 4B82A 3PRHA 1W76A 4JR2A 1J8FA 2VNHA 5TS3A 1A9OA 4ABYA 4EI8A 1RI5A 3K0HA 4DDVA 4HNVA 3E5HA 1NQ5A 2QRPA 2Y0PA 5IASA 1NDHA 2DR2A 1GUAA 1EZZA 4PNPA 4RFLA 4X1IA 1DWUA 1JGTA 3DE5X 1D3AA 1IN7A 1QWSA 4PFKA 3SGLA 1IVNA 1P44A 2W6OA 1E7MA 4HCJA 2P75A 3P2OA 3QGMA 1F38A 3V7FA 4FBMA 2BEKA 1HL3A 1GUBA 1AKMA 3V9AA 3K53A 4TKUB 3TLJA 3PNOA 4ZOLA 4D8WA 4D81A 3A1FA 4ZDJA 5JQGB 4MHTA 1CULC 5ILGA 1B74A 1GRVA 4BLTA 1AO3A 4C4SA 5CEEA 3O1JC 2DWCA 3PJFA 3L40A 4PC7A 1T4CB 4PF1A 1M5UA 3HJNA 4EG1A 2PIDA 1XPOA 3AX6A 2LD4A 4B79A 4PPQA 1R6UA 3FBGA 3P32A 4CQLA 4EGAA 1V1MB 4FONA 1Y37A 5TGTA 3V3TA 3K8YA 1G2PA 1P1JA 1UJNA 3DOUA 2ORED 4WINA 5BSTA 3FTQA 2DUUA 2YZ7A 3TNFA 2VDRB 5CA0F 4FMCB 1L5FA 4AMGA 1KC1A 1FTGA 4R9UC 4GLFA 2PGNA 4KJXA 4QGGA 3MPUA 3RSLA 2WHPB 3KPUA 2IOFA 2H1FA 4TLBA 1D2HA 2ZI5A 4YIKA 5J4KA 1I0ZA 3KKEA 2YXNA 1CR0A 5JCOA 1JBEA 1YK0A 5CT6A 2OG1A 3DL0A 4YVFA 2DRIA 5DLDA 2XMCA 3F8WA 1L7PA 1ZI8A 4P86A 5EGNA 3CU5A 4PLPA 2OCKA 4RGVA 5ABPA 5B7QA 5IT4A 3OPVA 1IY0A 1NQWA 2ACEA 1SQ6A 3U9TA 3ZJYA 1EFRD 2GVNA 4P33A 4ZVPA 5BQFA 3GG2A 1QV9A 3K73O 4GLOA 5DBEX 4D9IA 1XEXB 2BMJA 3BIJA 5D00A 3RFCA 3K5PA 5F98A 3KDSE 1LBTA 4V02A 4ZT3A 1RWWA 4O5OA 5EKXA 4N41A 4BV2A 1I7SB 3OY2A 2IKSA 2ZCVA 1R6VA 3DS8A 3DVQX 3EK2A 1JB9A 1JYFA 3VUEA 1SXIA 3A1SA 3I3OA 2XIJA 2AG6A 2QMEA 1MKYA 1INLA 3FYSA 5TARA 2FPIA 3SXUB 5IABA 1YHZA 3UQYS 2CXQA 2AOXA 1PZMA 2JGDB 4M0UA 1OVMA 4YWHA 4JZKA 1D0SA 5K0FA 1L8AA 3GMTA 4IH4A 1AKRA 4HDMA 3QU4A 1XRPA 3A1TA 3MCAA 2H7YA 3STVA 3USCS 3VKFA 3DE0X 4J90A 4JC5A 5BXQC 1L5GB 2A5LA 5IF3A 1BA3A 1LS1A 4KMOA 4BQOA 4IXNA 3MXOA 1VJTA 5HIMA 2NUTA 4JXJA 3H5RA 3JD1A 1N2CB 2D0PB 4GYWA 2J9RA 4XSGA 5FADA 2FN7A 1ICIA 1T6YA 1U0TA 2QQ0A 1XMJA 2Z8YA 4LYEA 5GOTA 1VKRA 1F4LA 1Z6GA 3DAFA 3R3VA 5TQ0B 4ALIA 1NBWB 1XO1A 4BVFA 4BWGA 3O8OA 3NP9A 1FU7A 4M89A 3SG0A 4E5MA 1G3UA 2O14A 3NAZA 2XCIA 4HX2A 2EW8A 1STOA 1MCZA 4E08A 3BXOA 3O7MA 4CQMA 1Y3DE 5PGMA 3GLTA 1H9BA 1GPUA 4JOCA 4QGFA 5EUBA 2QVCA 3R0VA 4GO1A 4NCKA 1IUKA 3RO7A 4BRWA 1URPA 1PT7A 1U7OA 5DTQA 3PZBA 2QG9A 1SC1A 3GVPA 4JNKA 4J7UA 2R5NA 4NQZA 4O1HA 1CUXA 3RJZA 1ZYUA 3VYUB 5KOJB 3PI7A 3PHCA 1WL8A 3PTLA 1LTHR 4MYRA 3G2NA 1E1NA 1Q1BA 3O3CA 4M7WA 1EGAA 3NHFA 3MT7A 1LW7A 3CO0S 3E03A 4CHGA 3ND9A 4LF9B 2C57A 4MICA 4DNOA 4H4EA 2WJHA 2YNMC 1AVTA 2EKDA 4AS3A 1P9OA 2XWSA 5CEJA 1C0EA 3ENKA 3OM1A 1N5KA 3K0CC 3PYXA 3TZHA 4GC9A 4RIGA 5JEEA 3JPYA 4UPVA 4BMNA 5B4TA 5FAKA 3HUTA 3NHWA 5IBCA 4JHXA 3RW9A 1AQYA 3SEZA 5ESXA 1P0QA 2QAGC 3IUNA 4NBWA 4ZOEA 3N2YA 4OF4A 1U28A 3KUKA 4I2NA 3P26A 2VDMB 3RVKA 3UVEA 3M1LA 4KKVA 3BYZA 4A6EA 2CFOA 1I6MA 3K94A 2MYUA 1H3NA 3WKAA 3LQRA 3PFBA 1U2QA 2DX7A 2OZLB 2DKOA 3EB9A 4ZYLA 1GGVA 4NPAA 1ILEA 3S8YA 1XTTA 2QYOA 2VZ8A 1V8FA 3PD0A 4OHXA 1G55A 4PZ9A 4ZVVA 2JHCA 4D4JA 2R5WA 3X44A 2OFWA 5EJ6A 4X6LA 4GKBA 2EXXA 3B9QA 4IM7A 4GM1A 4ER3A 5EJFA 2JLXA 1EZ1A 4BY9E 1LSSA 2VP9A 1L4UA 1HTWA 1R9MA 3C5VA 5EFOA 3DUWA 1VJ5A 5HE9A 6ADHA 2WKPA 4EWLA 1L5VA 2HIMA 3N6VA 2X2EA 1IVYA 2ACVA 1GYQA 3O0DA 4C5CA 3EDYA 3LECA 1L5RA 1NU6A 4LXIA 5DBGA 4KO4S 1ZXLA 3JSAA 1AZTA 1MOQA 5KHLB 3ICEA 4EW2A 3D3WA 3IPRA 4KN6A 2VJPA 1ZD4A 2MSDB 4CLDA 4UUAA 1EFLA 1UEXC 3RT9A 3WNQA 1JFTA 3F90A 1FF9A 3V8NA 4LI0A 3U1TA 3HUEA 2Q4RA 1U0SY 5IUNC 4AYXA 1ODFA 4D6PA 5IVKA 3BJZA 4BO5A 3LPCA 3L6EA 1ZM3A 1LBEA 2IIBA 1HT3A 2YIMA 1BXRA 2JAPA 1TT7A 5C52B 3A1CA 4O29A 4RU1A 4BEWA 2G9VA 3Q3HA 3EA4A 2XQIA 4B71A 5IKMA 2ADMA 4UEKA 2KBFA 4AZSA 2GWRA 3KLOA 3C3DA 4JL8A 1WZ2A 5JMPA 3F4BA 3CM0A 1W1WA 4AD8A 2GVDC 2Y4OA 2FOIA 4DLPA 1GXSB 2ROQA 4MLPA 4X97A 2WSLA 5CNIA 2K6GA 4LI3X 1X7ZA 2OAGA 2LGJA 4JJKA 2X5XA 3L9WA 2JC3A 1WXEA 1JB1A 4WGGA 2VQEB 3A3KA 1VHDA 2DE0X 2AH5A 2CHEA 3B48A 4G4JA 2PLAA 4B2IA 5BMVA 5DM60 1AX9A 1Y1PA 4K9SA 3SZGA 4F2GA 4B3CA 4C76A 1LK0A 2ONKA 5AOAA 2E1RA 1CY1A 1UBSB 1WR8A 1XLTA 1UL1X 4K81B 1BFKA 2G4LA 3MOGA 3O9ZA 1B8OA 4RTMA 1RKQA 2WD7A 4LAFA 3F5MA 5F9MA 3R3HA 2I78A 2R79A 3UWPA 5LL6P 4IG4A 3RWOA 1KS9A 3LBIA 3H9QA 2HLNA 1DKQA 1EUCB 2DUMA 2OGZA 3AV3A 1NRJB 3GQVA 1OB2A 3NM6B 1ZL2A 2FQYA 2RGXA 1KFCB 5AWFC 3RYFB 1TZCA 4BBPA 4GP6A 4JMLA 3IDZA 1JFVA 4L4XA 5FOVA 4S1NA 2IYZA 4DIDA 1TZJA 4O4JA 2ACKA 2OZPA 3ET4A 4P0TA 5CP8A 5KTPA 1T3SA 3JQRA 4MV6A 3DLAA 3WHIA 4CF7A 2C2XA 3RROA 3QFCA 4I4TB 4HUTA 5JJKA 2IDJA 5GY7A 3TQHA 3WZ2A 5I4KA 1FFWA 2NQ2C 3AEKA 3G8AA 5C8ZA 2XXAA 3FCYA 4KNWA 1IEVA 1RQXA 1P6UA 1XAJA 2C2KA 3ZBQA 2A1TS 2LWIA 3IOEA 3BBLA 3UG7A 5BSVA 3SQWA 4M9ZA 4NH0A 4BRSA 1M7HA 4F4DA 1I0LA 1V25A 1LF0A 3A28A 4KODA 1E2FA 4OTZA 3T5AA 1Q44A 2L42A 3DZGA 3KU4A 4FXOA 4NMHA 3L0BA 2BLNA 1EVEA 3TB6A 3NORA 4I7EA 1C2YA 4RJIA 3LTNC 1EFUA 1ZGBA 3A9UA 2VDWA 3DD5A 5KKCA 1K0UA 4KNYA 1Q6YA 4I4TF 1JEOA 4RF2A 3O0TA 4FYWA 1ODKA 1U9YA 1VE1A 2VBCA 3MLBA 1RQLA 2WG2A 4K9NA 4EUEA 1RRCA 1Z28A 1POXA 3OTIA 4XSHA 4O2AA 1TCVA 2EX4A 3WRYC 3L6RA 2EX1A 5JRDS 3T5PA 1DEAA 2JEOA 3KJZA 3BB4A 4XX1A 4FEGA 3VX4A 2Q1TA 3NTRA 4HGPA 3ZW7A 1T9GR 2J0EA 1XALA 2HW8A 2LIVA 5AVXA 3BMOB 1U0RA 2D2EA 4K6KA 3A8TA 5HM8A 3EEOA 2QNRA 1KYVA 1W52X 1NSFA 5L8VA 2ZWAA 1VHQA 4FK8A 5KNCH 1CE8B 3KM0A 1S2DA 2CE2X 2WDPA 3AKYA 4MARA 3M5DA 1QAQA 1Q0UA 4X7BA 4Q4HA 2EZTA 1A8QA 2GUGA 3AFGA 3ROKA 3KCQA 4ZIRA 5CXSA 4KI0A 1NWCA 3NNNA 5BSEA 4LEIA 1X13A 2IYEA 1JECA 2QX9A 3FROA 4ZCPA 5K0LA 1NM5C 5AUNB 4YJ3F 3KR9A 4UW9A 1ZMRA 1RYYA 5JWRA 5DOZA 2XMDA 3IOMA 4QTTB 4HOYA 2G40A 4HXFB 4UOEA 1Y7LA 3VPCA 5TJ9A 1H6BA 3L8FA 1QLWA 3OPQA 3I64A 3CIFA 4TMZA 1NXTA 1RS0A 1VCMA 2BHSA 1E6KA 2N75A 2Q3BA 3E5MA 3MMPA 1DMSA 1SVIA 4LJ8A 4TYQA 2PL3A 4WE3A 3FYHA 5IVDA 4C6RA 3DGFC 1T0UA 1NQTA 4YRTA 5AHRA 2JASA 3KFXA 2DY1A 1NDUA 3K05A 4WL0A 5AM1A 4KQ1A 3ZNQA 5C18A 2PS3A 5HCUA 4LJSA 3NHLA 3GLFA 2WUGA 1YXMA 3GMIA 2WC1A 1SVWA 4JEHA 3VYVA 1JS1X 1GOTA 1IHUA 4BQIA 3AHHA 3LZDA 3WNDA 1UBLS 4Y1RA 3Q3JB 3U09A 5JTUA 2X8AA 2W42A 1Q0SA 4OREX 4L8VA 3I39X 3M7IA 1O5TA 3TEJA 4CNBA 4EPRA 4YV0A 4DMFA 3Q11A 1R8YA 4QUAA 2AQKA 2WHXA 4MWOA 4F12A 5JQGF 4XWYA 4JYZA 3BFVA 1L5QA 5AVOA 2XY4A 1QP0A 3GB9A 3WWZA 2DLNA 5TS2A 1A88A 2NNWB 3KOUA 4KVZA 2EGGA 2XAAA 1MBZA 5LWHA 1V8BA 1JDTA 2AFHB 1TLTA 3B1FA 1DT5A 4CEJA 1IXSB 3DEIA 4UHEA 3CZCA 3MIZA 5CM8B 1E1YA 1XV5A 4TXJA 4ABTA 1GADO 1GSAA 1YAHA 3D6FA 4FJ1A 4NYIR 1Z4JA 1VL1A 3O8DA 5BSMA 1JILA 4B2PA 2LCFA 4NOLA 5K01A 4V2UA 3W1VA 2OCBA 1NVVR 5DT2A 1CNEA 2H4WA 4GEKA 2IUUA 4XQGA 4FE3A 1PV4A 2I7CA