3O7XA

Crystal structure of human hili paz domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
SNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Inaugural Article: Structural basis for piRNA 2'-O-methylated 3'-end recognition by Piwi PAZ (Piwi/Argonaute/Zwille) domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Piwi-like protein 2
total genus 27
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 3o7xA00
4NGDA 5T7BA 3O7XA 2XFMA 4Z4FA 4NH5A 2L5DA 4NGGA 2QVWA 3O3IX 1R4KA 1T2RA 4W5QA 4NGBA 3MJ0A 5JS2A 1T2SA 5JS1A 2L5CA 4NGCA 3O6EX 4Z4EA 4NHAA 4W5OA 4Z4HA 4OLAA 4OLBA 3O7VX 2FFLA 5KI6A 4Z4IA 3QIRA 4Z4CA 4NH6A 4F3TA 4KRFA 1SI3A 4W5NA 4Z4GA 1VYNA 1R6ZA 4W5TA 4W5RA 4NGFA 4KREA 1SI2A 4NH3A
chains in the Genus database with same CATH superfamily
1Z26A 4NGDA 5T7BA 3O7XA 2XFMA 4Z4FA 4NH5A 2L5DA 4NGGA 2QVWA 3O3IX 1R4KA 1T2RA 4W5QA 4NGBA 3MJ0A 5JS2A 1T2SA 5JS1A 2L5CA 4NGCA 3DLBA 1U04A 3DA5A 3O6EX 4Z4EA 4NHAA 2BZEA 3HVRA 4W5OA 4Z4HA 4OLAA 3HO1A 3U1UA 4OLBA 3O7VX 2FFLA 5KI6A 3DLHA 3HM9A 4Z4IA 3HJFA 3QIRA 4Z4CA 4NH6A 4F3TA 4KRFA 1SI3A 4W5NA 4Z4GA 2DB9A 1VYNA 3F73A 4L1UA 1Z25A 4L1PA 1R6ZA 4W5TA 4W5RA 3HK2A 4NGFA 4KREA 1SI2A 4NH3A
chains in the Genus database with same CATH topology
1Z26A 4NGDA 5T7BA 3O7XA 2XFMA 4Z4FA 4NH5A 2L5DA 4NGGA 2QVWA 3O3IX 1R4KA 1T2RA 4W5QA 4NGBA 3MJ0A 5JS2A 1T2SA 5JS1A 2L5CA 4NGCA 3DLBA 1U04A 3DA5A 3O6EX 4Z4EA 4NHAA 2BZEA 3HVRA 4W5OA 4Z4HA 4OLAA 3HO1A 3U1UA 4OLBA 3O7VX 2FFLA 5KI6A 3DLHA 3HM9A 4Z4IA 3HJFA 3QIRA 4Z4CA 4NH6A 4F3TA 4KRFA 1SI3A 4W5NA 4Z4GA 2DB9A 1VYNA 3F73A 4L1UA 1Z25A 4L1PA 1R6ZA 4W5TA 4W5RA 3HK2A 4NGFA 4KREA 1SI2A 4NH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NGD A;  5T7B A;  3O7X A;  2XFM A;  4Z4F A;  4NH5 A;  2L5D A;  4NGG A;  2QVW A;  3O3I X;  1R4K A;  1T2R A;  4W5Q A;  4NGB A;  3MJ0 A;  5JS2 A;  1T2S A;  5JS1 A;  2L5C A;  4NGC A;  3O6E X;  4Z4E A;  4NHA A;  4W5O A;  4Z4H A;  4OLA A;  4OLB A;  3O7V X;  2FFL A;  5KI6 A;  4Z4I A;  3QIR A;  4Z4C A;  4NH6 A;  4F3T A;  4KRF A;  1SI3 A;  4W5N A;  4Z4G A;  1VYN A;  1R6Z A;  4W5T A;  4W5R A;  4NGF A;  4KRE A;  1SI2 A;  4NH3 A; 
#chains in the Genus database with same CATH topology
 1Z26 A;  4NGD A;  5T7B A;  3O7X A;  2XFM A;  4Z4F A;  4NH5 A;  2L5D A;  4NGG A;  2QVW A;  3O3I X;  1R4K A;  1T2R A;  4W5Q A;  4NGB A;  3MJ0 A;  5JS2 A;  1T2S A;  5JS1 A;  2L5C A;  4NGC A;  3DLB A;  1U04 A;  3DA5 A;  3O6E X;  4Z4E A;  4NHA A;  2BZE A;  3HVR A;  4W5O A;  4Z4H A;  4OLA A;  3HO1 A;  3U1U A;  4OLB A;  3O7V X;  2FFL A;  5KI6 A;  3DLH A;  3HM9 A;  4Z4I A;  3HJF A;  3QIR A;  4Z4C A;  4NH6 A;  4F3T A;  4KRF A;  1SI3 A;  4W5N A;  4Z4G A;  2DB9 A;  1VYN A;  3F73 A;  4L1U A;  1Z25 A;  4L1P A;  1R6Z A;  4W5T A;  4W5R A;  3HK2 A;  4NGF A;  4KRE A;  1SI2 A;  4NH3 A; 
#chains in the Genus database with same CATH homology
 1Z26 A;  4NGD A;  5T7B A;  3O7X A;  2XFM A;  4Z4F A;  4NH5 A;  2L5D A;  4NGG A;  2QVW A;  3O3I X;  1R4K A;  1T2R A;  4W5Q A;  4NGB A;  3MJ0 A;  5JS2 A;  1T2S A;  5JS1 A;  2L5C A;  4NGC A;  3DLB A;  1U04 A;  3DA5 A;  3O6E X;  4Z4E A;  4NHA A;  2BZE A;  3HVR A;  4W5O A;  4Z4H A;  4OLA A;  3HO1 A;  3U1U A;  4OLB A;  3O7V X;  2FFL A;  5KI6 A;  3DLH A;  3HM9 A;  4Z4I A;  3HJF A;  3QIR A;  4Z4C A;  4NH6 A;  4F3T A;  4KRF A;  1SI3 A;  4W5N A;  4Z4G A;  2DB9 A;  1VYN A;  3F73 A;  4L1U A;  1Z25 A;  4L1P A;  1R6Z A;  4W5T A;  4W5R A;  3HK2 A;  4NGF A;  4KRE A;  1SI2 A;  4NH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...