3O7XA

Crystal structure of human hili paz domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
116
structure length
116
Chain Sequence
SNDCVLDVMHAIYQQNKEHFQDECTKLLVGNIVITRYNNRTYRIDDVDWNKTPKDSFTMSDGKEITFLEYYSKNYGITVKEEDQPLLIHRPSERQDNHGMLLKGEILLLPELSFMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Piwi-like protein 2
publication title Inaugural Article: Structural basis for piRNA 2'-O-methylated 3'-end recognition by Piwi PAZ (Piwi/Argonaute/Zwille) domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 27
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02170 PAZ PAZ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.260.10 Mainly Beta Beta Complex paz domain paz domain 3o7xA00
4W5TA 2L5CA 2QVWA 4NGCA 4W5QA 4Z4CA 4Z4HA 4F3TA 2FFLA 4W5OA 5JS2A 4OLAA 4NH5A 1T2SA 4KRFA 4NGGA 1R6ZA 4Z4EA 4NGFA 4NH3A 3O7XA 4Z4FA 1SI3A 4NH6A 3O3IX 4Z4IA 4Z4GA 4W5RA 4W5NA 1R4KA 1T2RA 5JS1A 4NHAA 4OLBA 1SI2A 4NGBA 3O7VX 1VYNA 4KREA 3O6EX 3MJ0A 2XFMA 3QIRA 2L5DA 5KI6A 4NGDA 5T7BA
chains in the Genus database with same CATH superfamily
3HO1A 4W5TA 2L5CA 3U1UA 3DLHA 2QVWA 4NGCA 4W5QA 4Z4CA 4Z4HA 3DLBA 2FFLA 3HK2A 4W5OA 4F3TA 5JS2A 4OLAA 4NH5A 2BZEA 2DB9A 1T2SA 4KRFA 4NGGA 1R6ZA 4Z4EA 4NGFA 4NH3A 3O7XA 3F73A 4Z4FA 1SI3A 1Z25A 3HJFA 1U04A 3DA5A 4NH6A 3O3IX 4Z4IA 4Z4GA 4W5RA 4W5NA 1R4KA 1T2RA 5JS1A 4NHAA 4OLBA 1SI2A 3HVRA 4NGBA 3O7VX 1VYNA 4KREA 4L1PA 3O6EX 3MJ0A 2XFMA 3QIRA 4L1UA 2L5DA 5KI6A 1Z26A 3HM9A 4NGDA 5T7BA
chains in the Genus database with same CATH topology
3HO1A 4W5TA 2L5CA 3U1UA 3DLHA 2QVWA 4NGCA 4W5QA 4Z4CA 4Z4HA 3DLBA 2FFLA 3HK2A 4W5OA 4F3TA 5JS2A 4OLAA 4NH5A 2BZEA 2DB9A 1T2SA 4KRFA 4NGGA 1R6ZA 4Z4EA 4NGFA 4NH3A 3O7XA 3F73A 4Z4FA 1SI3A 1Z25A 3HJFA 1U04A 3DA5A 4NH6A 3O3IX 4Z4IA 4Z4GA 4W5RA 4W5NA 1R4KA 1T2RA 5JS1A 4NHAA 4OLBA 1SI2A 3HVRA 4NGBA 3O7VX 1VYNA 4KREA 4L1PA 3O6EX 3MJ0A 2XFMA 3QIRA 4L1UA 2L5DA 5KI6A 1Z26A 3HM9A 4NGDA 5T7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W5T A;  2L5C A;  2QVW A;  4NGC A;  4W5Q A;  4Z4C A;  4Z4H A;  4F3T A;  2FFL A;  4W5O A;  5JS2 A;  4OLA A;  4NH5 A;  1T2S A;  4KRF A;  4NGG A;  1R6Z A;  4Z4E A;  4NGF A;  4NH3 A;  3O7X A;  4Z4F A;  1SI3 A;  4NH6 A;  3O3I X;  4Z4I A;  4Z4G A;  4W5R A;  4W5N A;  1R4K A;  1T2R A;  5JS1 A;  4NHA A;  4OLB A;  1SI2 A;  4NGB A;  3O7V X;  1VYN A;  4KRE A;  3O6E X;  3MJ0 A;  2XFM A;  3QIR A;  2L5D A;  5KI6 A;  4NGD A;  5T7B A; 
#chains in the Genus database with same CATH topology
 3HO1 A;  4W5T A;  2L5C A;  3U1U A;  3DLH A;  2QVW A;  4NGC A;  4W5Q A;  4Z4C A;  4Z4H A;  3DLB A;  2FFL A;  3HK2 A;  4W5O A;  4F3T A;  5JS2 A;  4OLA A;  4NH5 A;  2BZE A;  2DB9 A;  1T2S A;  4KRF A;  4NGG A;  1R6Z A;  4Z4E A;  4NGF A;  4NH3 A;  3O7X A;  3F73 A;  4Z4F A;  1SI3 A;  1Z25 A;  3HJF A;  1U04 A;  3DA5 A;  4NH6 A;  3O3I X;  4Z4I A;  4Z4G A;  4W5R A;  4W5N A;  1R4K A;  1T2R A;  5JS1 A;  4NHA A;  4OLB A;  1SI2 A;  3HVR A;  4NGB A;  3O7V X;  1VYN A;  4KRE A;  4L1P A;  3O6E X;  3MJ0 A;  2XFM A;  3QIR A;  4L1U A;  2L5D A;  5KI6 A;  1Z26 A;  3HM9 A;  4NGD A;  5T7B A; 
#chains in the Genus database with same CATH homology
 3HO1 A;  4W5T A;  2L5C A;  3U1U A;  3DLH A;  2QVW A;  4NGC A;  4W5Q A;  4Z4C A;  4Z4H A;  3DLB A;  2FFL A;  3HK2 A;  4W5O A;  4F3T A;  5JS2 A;  4OLA A;  4NH5 A;  2BZE A;  2DB9 A;  1T2S A;  4KRF A;  4NGG A;  1R6Z A;  4Z4E A;  4NGF A;  4NH3 A;  3O7X A;  3F73 A;  4Z4F A;  1SI3 A;  1Z25 A;  3HJF A;  1U04 A;  3DA5 A;  4NH6 A;  3O3I X;  4Z4I A;  4Z4G A;  4W5R A;  4W5N A;  1R4K A;  1T2R A;  5JS1 A;  4NHA A;  4OLB A;  1SI2 A;  3HVR A;  4NGB A;  3O7V X;  1VYN A;  4KRE A;  4L1P A;  3O6E X;  3MJ0 A;  2XFM A;  3QIR A;  4L1U A;  2L5D A;  5KI6 A;  1Z26 A;  3HM9 A;  4NGD A;  5T7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...