3O83A

Structure of base n-terminal domain from acinetobacter baumannii bound to 2-(4-n-dodecyl-1,2,3-triazol-1-yl)-5'-o-[n-(2-hydroxybenzoyl)sulfamoyl]adenosine
Total Genus 153
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
153
sequence length
435
structure length
433
Chain Sequence
KQLIEFVRWSPERAQHYRNKGYWIDQPLTRILTVGVQSHPHSLAIICGERQLSYIELDRLSTNLATRLAEKGLGKGDTALVQLPNVAEFYIVFFALLKAGVVVLNALYSHRQYELNAFIKQIQPKLLIGSRQHEVFSNNQFIDSLHDVNLSPEIILMLNHQATDFGLLDWIETPAETFVDFSSTPADEVAFFQLSGGGTPKLIPRTHNDYDYSVRASAEICGLNSNTRLLCALPAPHNFMLSSPGALGVLHAGGCVVMAPNPEPLNCFSIIQRHQVNMASLVPSAVIMWLEKAAQYKDQIQSLKLLQVGGASFPESLARQVPEVLNCKLQQVFGMAEGLVNYTRLDDSDEQIFTTQGRPISSDDEIKIVDEQYREVPEGEIGMLATRGPYTFCGYYQSPEHNSQVFDEDNYYYSGDLVQRTPDGNLRVVGRIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and structural characterization of bisubstrate inhibitors of BasE, the self-standing nonribosomal peptide synthetase adenylate-forming enzyme of acinetobactin synthesis.
pubmed doi rcsb
source organism Acinetobacter baumannii
molecule tags Ligase
molecule keywords Peptide arylation enzyme
total genus 153
structure length 433
sequence length 435
chains with identical sequence B
ec nomenclature ec 6.2.1.-:
pdb deposition date 2010-08-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12780 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3o83A00
4D4HA 4GXQA 2Y4OA 3IESA 3E7WA 3RIXA 3G7SA 4RVNA 5BSMA 3RG2A 5BSTA 1V26A 5DWVA 3EQ6A 3FCEA 5BSVA 4FUQA 3WVNA 2VZEA 5BSWA 4OXIA 4GR4A 4WV3A 2Y4NA 3LGXA 3WV4A 3E7XA 3O82A 5KEIA 4GXRA 3NI2A 3IPLA 3O84A 4LGCA 4D4IA 1ULTA 2Y27A 4R1LA 4D4GA 3T5BA 5BURA 4RVOA 3IVRA 2V7BA 3PBKA 3O83A 3R44A 5BSUA 5BUQA 3IEPA 4GR5A 3QYAA 4DG9A 2WD9A 3ETCA 3C5EA 3U16A 4E5DA 4M46A 4GS5A 4ISBA 3L8CA 5D6NA 5GTDA 5BUSA 3T5CA 4G37A 3VNSA 3NYRA 4IZ6A 3VNRA 3U17A 3TSYA 4R1MA 1V25A 3GPCA 4W8OA 3B7WA 4DG8A 3A9VA 3NYQA 3DAYA 3T5AA 5BSRA 4D57A 3ITEA 3VNQA 3WV5A 3E53A 4R0MA 3IERA 3DHVA 4D56A 4IR7A 4FUTA 4PZPA 5E7QA 3FCCA
chains in the Genus database with same CATH superfamily
3CF2A 4TYMA 4G67A 5AM2A 1SQ0A 2PD4A 1Z88A 1RLIA 4GI5A 2HDWA 2OL4A 4DJDC 1DZIA 3ONDA 2G77B 4IGAA 4B3BA 1LNZA 2XOKD 1JPNA 1T36B 1YDGA 1V2GA 1Y89A 1SHZA 3SKVA 3CEPB 3O3CA 3TL2A 3EQ6A 1G1MA 3OD5A 1A95A 2GEBA 5SICE 1LRLA 2R2GA 1IRIA 5HF8A 3RYIB 3KB6A 4E09A 2CUTA 2GA8A 2WUEA 1TU4A 3JZMA 2XCQA 4CMEA 2XUAA 2DKNA 4NFHA 1JHMA 1E3EA 2VJCA 4OO3A 4Q21A 2B7LA 5E3JA 4KMRA 2YWHA 1UPCA 2XUDA 3PF8A 3NHFA 4C7KA 2XB2A 2VOEA 1SWVA 3BMQB 1AKTA 1GGVA 1GZ6A 2C96A 2QTTA 3CEJA 3MS4A 3PJEA 4MCIA 4EHJA 1NUPA 2WEKA 2VS1A 4FYHA 2QPLA 4NF2A 4ZZ0A 2CHUA 1ND5A 2QV0A 1Q83A 3TZBA 4HR7A 1TJ3A 3AFNA 4OQMA 4HAUA 5CCDA 2PVPA 4L4YA 2F62A 4RJKA 1NE2A 3CH7A 4RO0A 5H4HA 5JNTA 3NTQA 1Y3CE 1DIBA 2WM9B 3NTUA 2QP3A 3CEHA 2AS0A 3IUJA 2ERCA 3O2SB 3KPUA 1RYMA 3G89A 4F1JA 1O6ZA 2EQAA 4HJXA 2HXYA 2OT3B 1TX4B 1IDN1 2DY0A 3O8DA 3VVCA 1YUNA 4AJHA 1K7FB 4GOOD 3TLAA 5KKAA 3ZW7A 5TSDA 2AMFA 3JASA 2P69A 3GVHA 3Q7QA 4B74A 2NU6A 1B43A 4P32A 1ODLA 4MCJA 4KMMA 4C22A 4WK4B 1EFHA 1EFLA 2QTVA 3I9V1 1QOPB 5CLGA 5D5PA 1CB7A 3EPKA 4A1OA 1E92A 1F6DA 3IOEA 5EWMB 3VTZA 4BAZA 4B2IA 4PYJA 1XDUA 2V45A 2VKTA 3LP6A 4G5QA 1JYFA 4ZODA 3I01A 4YAKA 4JSYA 3W5BA 2B36A 3PVSA 1RC8A 3ZZ1A 3FTFA 1MJGM 2IXFA 2LR0A 3JAWA 4WVFA 1PGQA 3R9IA 3GA7A 5BV1A 5EJ7A 2VUUA 4EHHA 4M8SA 1PR4A 3H97A 3KT6A 4Q93A 5EP4A 1SXJA 2RHLA 3FGOA 4WCFB 3WJ1A 3I30X 2J9RA 2SICE 3MPUA 4DDUA 1E3JA 4QKQA 4QXRA 2C0CA 3LX8A 1X8KA 1J5PA 1H2EA 4PLZA 1FS5A 4B6RA 3UAZA 4DV7B 1TTTA 4RL4A 4NBKA 1MEOA 3O4JA 5I7AA 1Z4QA 4YDQA 4J1NA 4GBJA 2P78A 4V0OA 3L43A 4WERA 4EPYA 5KWSA 5AI9A 1X1DA 3WR5A 1MAHA 2CB0A 5IYZF 1VLJA 2IXTA 3Q9UA 4TS1A 4L2IB 4TSKA 1W4RA 5KTRA 2NN3C 3UJPA 4PG6A 4QU5A 3KQTA 2JH9A 8ADHA 1W4CA 1MX1A 2EHDA 3GD5A 2NU8B 4TT3D 5DWDA 3ZNPA 5HJ7A 3V4SA 4ARUA 1RACA 1RRPA 3FTQA 3KR2A 3N6XA 4E2YA 4DJFC 4JJ7A 4TTSA 3C43A 4RF2A 1G60A 2FG7C 2OGSA 4ND8A 3SOPA 5B3KA 1DX4A 4YJ2F 4TZ0A 1V16A 4EATA 2DKOA 3VVMA 4MW6A 1N0VC 1AQYA 1W29A 1XG5A 4M1ZA 2EZ8A 2EP7A 1LJUA 1T91A 1S6YA 2O50A 4HQFA 3JRXA 1MO3A 2ZQYA 1Z5PA 4FQ7A 4DA0A 1X38A 4MGEA 1NQVA 1WV1A 2IIVA 4G0PA 1XVLA 4ALKA 1XVTA 3E7PA 4IX1A 2FPWA 4OGFA 4WGGA 2C83A 2PT6A 2H5EA 1HQYE 2L18A 5HS6A 4E88A 2O5RA 1EWTA 3DAGA 4JI8B 2BBWA 1OHHD 1SKQA 2Q5HA 1A2BA 1C3JA 2Q3EA 3OZSA 4UAGA 1QZTA 3NUGA 3L6DA 1D7OA 1FTQA 4EJSB 4F4FA 2VWGA 4RDXA 2PIAA 3GA5A 3N74A 3DP9A 4WCVA 1Z39A 3M5DA 4A26A 5KTMA 1TAQA 4Y2GA 1NUQA 4RD2A 3VZCA 1X7ZB 4GQBA 2BL4A 3AL3A 1H8EA 1VHQA 2R5FA 3L93A 4DJTA 5LVAA 2W2NA 3K1AB 1PV2A 3RSCA 2OE2A 5FNVF 1QIEA 3QKIA 4MROA 1OX4B 4OFBA 4QO7A 4ER5A 3FYSA 5BYJA 2QN9A 1K9VF 2IY7A 2JLBA 3LGXA 5FXMA 1NN3A 2XQFA 1XTZA 3WV4A 3GO4A 4AURA 4BEBA 3WADA 4CF6A 2COKA 4WNYA 5DEIA 3C3CA 3TJRA 1FVOA 3RTAA 2JCXA 1QDLB 4RTMA 1OXBB 1JEAA 3IBGA 4UVIA 1UBGA 2BVNA 5IS2A 3SSAA 3AF3A 5CVUA 3DE6X 2I78A 1BN7A 5IFLA 3ROMA 3M33A 1P73A 4IOKA 2ZUBA 4O6VA 1K3FA 4DXDA 4AKGA 2C78A 1ORRA 3T7RA 3DVAB 1P4SA 1ID8A 3EC1A 3FR7A 1GARA 2GLXA 1EFCA 1FF9A 2BGJA 5DP1A 5FUVA 1JE0A 2LRHA 2Z8YA 1CQIB 1CZHA 2HSDA 3NC1C 2W2LA 3AV3A 3HDYA 2PTHA 4LISA 3TG2A 3CVXA 1G59A 1I2AA 2D1RA 3SZUA 2IDKA 1T4GA 2BGMA 1PFVA 2AI2A 5KYUA 1CY4A 3T1VA 5IKMA 3HDQA 4MVJP 3ZWWA 2R6ZA 5SV2A 2FX2A 1LC3A 4ZU1X 1J24A 4P3NA 4QBHA 2O59A 1U1CA 4D8YA 4K8RB 3TKYA 1YK0A 1LWOA 3H3XA 3AXSA 5A1TA 2AR9A 3B53X 5DLQC 4OKIA 4WESB 5BUZA 2X3FA 3O7WA 4IJWA 3OAAA 1TKAA 1JIJA 1UMCA 4QQKA 4D8UA 4EZEA 1S2OA 3KXPA 3RUIA 4QT4A 3U56A 5IUNC 3H05A 2RHDA 3L05A 4XRRA 3TBFA 3E9ZA 3SE0A 4I4TF 4JXXA 1JVSA 2HRBA 1A98A 5LOVB 2R68A 3C39A 1QQ5A 3OIUA 4QC2A 2QM0A 5EZYA 3S2ZA 3PNQA 4QPZA 4IUCS 1EDOA 2FHSA 4ZKEA 2Z6VA 3IOCA 3OQJA 1GPDG 4FFLA 1B23P 3T3NA 1GCAA 4RZUA 2Q41A 4ZV4A 5EMMA 1DO0A 3ED1A 3NVKI 3AG5A 3A1WA 3CZ9A 1S3SA 2OR3A 4TLCA 3GN2A 4BFZA 1BCRA 1PYGA 4TMTA 4BXOB 1FFGA 2WJ6A 5F2NA 2NNLD 3SJUA 3OKPA 1DL5A 2Q6KA 1G5TA 4KN9S 5BSGA 3CN9A 3HL4A 4BMOB 4JFRA 2H7VA 4WKPA 3TLZA 4ETWA 1GXSA 4BO1A 2C59A 2M2IA 1G7TA 1JX6A 1NSTA 1ZC4A 3QFFA 1U8YA 1YIAA 2NAFA 3IYLW 4PCLA 2DC1A 1QGDA 2NO5A 3RRBA 1CSEE 1HDZA 1IG0A 3G68A 1XJWA 4H31A 1R0ZA 3TCXB 4NAVA 3FFAA 4PZAA 5DN6D 3ZKWA 4BVEA 2Z95A 1EUCB 1Y98A 1CT9A 1ZH2A 1V7QA 3H86A 2DWUA 3H5OA 3HGMA 4JWKA 3WRXC 1Q0QA 2OMEA 4KQWA 4XVRA 1UJNA 5H82A 4Q3DA 4DQKA 4BGEA 4CTOA 1PNQA 5ERGB 3WMEA 2WABA 2WP0A 1ZM7A 5IXSA 1BXKA 3PR2B 4NL4H 2JI9A 3DF7A 5GWXA 5B3JC 4OBWA 3K9BA 3ZVMA 3DLBA 3C3YA 2NSHA 4NU6A 4RXUA 3EFOA 2E6KA 1L9XA 2VPPA 2WA1A 3V5NA 5BW8A 4TN1A 5K0FA 1XTKA 3MUNA 1Z4PX 2JW5A 2ZVDA 1XRQA 2E6UX 3PT9A 4IMRA 3GDWA 2OYCA 1FZQA 3PJFA 3K8OE 4OU5A 2NNWB 5ES3A 1GFIA 4AN0A 2XRMA 3M9LA 4OHKA 3B9QA 4J7XA 3G9UA 1PNTA 2VEOA 3WYFA 3QXGA 3ERCA 4EGJA 4H3HB 2DQ4A 5IC4A 1J1ZA 2CC2A 4KQ2A 4WBXC 4E1AA 1DXQA 3D3WA 4F86A 2PKYX 2A1UB 4HOYA 3RFCA 3H83A 3UBTA 1IWPB 3KHKA 3WYEA 4Q4AB 5F3RA 2O07A 3FWKA 3ZG6A 2J0UB 3G23A 3K9LA 4WKCA 4Y2XA 1JAYA 3L7JA 3CVUA 1Z74A 3RREA 4JXKA 1FLNA 1E32A 1HEIA 4NAHA 5J2TA 2HA2A 1PFUA 2PAAA 1HMPA 1WG8A 5JJIA 5AJYA 1JLLB 2TRSB 4LY9A 3ZCRA 4R2IA 1T6ZA 1QF7A 2QG9A 3E1GA 2HTFA 1KVQA 3ENWA 4UVHA 5EG5A 3ZLUA 4CU2A 1KS9A 1OAAA 4R2KA 2A3NA 3SBDA 1TPYA 1DSSG 1DV1A 4OIFA 1BWQA 1OX5A 1YJCA 3DEFA 2HPVA 4XD7D 4DJJA 3LUHA 4L5JA 4Y9TA 5EVJA 4BLPA 3ZUPA 1NR1A 4B1FA 1PTKA 4WIAA 5JALA 1K86A 1U3UA 5IBPA 4Y1RB 4CJXA 3KTAB 5C80A 4WVLA 1O94D 2H1IA 2JFZA 3C5EA 3FGPA 4J03A 4KAXA 3NANA 1DEKA 4FLFA 3K2BA 1G6Q1 4GLLA 2FMTA 3NKVA 2PSSA 3GP5A 4PHCA 3R5HA 5H3CA 1MDBA 2PU5A 4X84A 1G5QA 3PQ7A 1US8B 2VAVA 2YWJA 2QTZA 5AOVA 2CXSA 4FNGA 2YW2A 3UGQA 3W79A 5HWSA 4PPFA 4XX0A 3FRIA 4UHBA 5T4HA 4GZ6A 3NWPA 3R0JA 2J4FA 1NR5A 1HNZB 1L2TA 4KZKA 3IE2A 3MF4A 5H80A 3BSFA 3OCWA 4QRDA 5H3LA 2QXUA 1YDEA 2BUBA 5JZSA 5F64A 4I08A 1F9AA 1GUAA 3B3GA 3KEFA 5HS4A 4D9NA 3U7HB 4TZ6A 1TQ4A 3ZC3A 4UFPA 1G3IA 2B92A 3NATA 2FZCA 2Q8PA 3AVOA 3LUKA 4XSHA 3H2HA 4ZT6A 1JB9A 2GYVA 4C01A 1J20A 2Z57A 3DTYA 3PFNA 1Z36A 2Q3HA 4NOLA 4NYIQ 3TJMA 3MJVA 1RYBA 1LDNA 3EC7A 5CB0A 4W5QA 1F8YA 2OHOA 2VZLA 1ZCFA 1L5NA 3DJYA 3OO0A 4CWAA 1YR1A 2YYZA 4TWAA 2ODBA 2YRXA 1JR2A 4FGWA 4HRVA 5BR8B 1U0BB 1XX6A 2RKWA 2XYVA 1IVNA 1PSZA 1T25A 4MMYB 4Y6RA 4BUZA 4DCSA 2BUAA 4M8KA 4NPCA 1URPA 4J90A 1KTVA 3CCFA 5DM70 4HYEA 3DCYA 4RM3A 2OWDA 4LECA 2GPBA 3EPRA 4G89A 2QX7A 4O4JA 1O58A 3M49A 4Y7CA 2IZ6A 3L0IB 1EUQA 4XB2A 3WFJA 5AW1A 2R7AA 4EA8A 1ZKDA 4LPSA 2ZPAA 2EJBA 1QIFA 3NBZC 2OHFA 2RJ3A 4KUGA 3D2CA 4S35A 2RCNA 5ESRA 4LMAA 3M1AA 5EEHA 3RBZA 3K9NA 1JAIA 3IUQA 2ICAA 1F7UA 3OOYA 5ALZA 1RAAA 4DVGA 2RG7A 4NCJA 4PS0A 4F6LA 4N6GA 2BSAA 1XZIA 4PVCA 3G5AA 3VNAA 3BPSA 4NULA 3KQKA 1VG8A 2Q4OA 3EODA 2JFQA 4GUDA 3FTCA 1I7NA 3CX4A 1DOHA 2HWYA 1BDHA 1KPIA 2NADA 1EAYA 2GXQA 3CO0S 2BFNA 4HGOA 3HRIA 1KZ4A 3NOOA 5ADUS 4GIBA 1E2HA 1L8LA 2J3LA 3PWSA 1RC0A 4QG3A 3PF9A 2H51A 1J8FA 2PRJA 4TUYF 5TS2A 5LZ5A 4WBNA 2PUJA 3AR4A 3DB1A 4JNKA 4L9WA 1XLVA 4PC6A 5C3MA 4YRBA 2VG8A 4R2MA 5EGNA 7MHTA 3DHEA 3HP4A 5CB4A 4M8IA 4R7GA 4BRWA 4HDNB 3VVBA 5TPZD 1NQTA 3LC2O 3WQQA 2XQVA 4XVCA 1L4YA 3A4NA 4TKUA 1WVIA 2NWQA 2GZAA 1U65A 2AEEA 2QUAA 5CD1A 4EF4A 3RJ5A 4V0RA 2LP4Y 2ZGVA 3MMPA 4B85A 4E4YA 3NQ41 5CEEA 3THOA 1YJBA 2DETA 3FLAA 1VJGA 1RMYA 2LNDA 4BZXA 1KEWA 1PVVA 3FOAA 5JYCA 1M6VA 3QEKA 2WHPB 4NEGA 4UTNA 1TQ2A 2VPIA 2EU8A 2JD0A 1M8JA 4YXWA 2J4CA 3OE7A 3WLJA 1TT5B 1N7IA 2VNAA 4DMUB 1FRFS 5C1BA 1NJGA 2NZYA 4M55A 5EXSA 2ZT6A 3QA3E 4GGMX 2MSLA 5TC4A 1N77A 3I58A 3GLHE 2XHEA 2PFGA 2C00A 2X14A 3OQHA 4L3OA 4BEWA 1NW3A 1TIBA 4L6CA 1H22A 2QWXA 2BFFA 3MK31 1O1YA 3CLRD 1H69A 1A97A 3FVRA 4R7TA 1IJEA 3AEKB 2ZITA 4GL4A 2XOEA 4INZA 1RWKA 3V3TA 3K32A 2AZ4A 1TRHA 3QVGA 4EO9A 3RIMA 1D8TA 3ZLJA 4W7IA 3IVGA 4Q4CA 2AVDA 2KB0A 3G8CA 2UU9B 3U1VA 1ZA2A 2XMRA 5LSAA 2XUHA 2KMLA 3KYDA 1QRUA 4DQXA 3GQVA 4CTJA 2K6GA 3F1LA 3OEHD 3ZS8A 2C5LA 1XHFA 2G5PA 4R2JA 5COBA 3RS7A 1XE3A 1Z2PX 1AUPA 4FX2A 4KACA 3VNQA 1WUIS 3G2JA 1RRKA 2CEAA 2OO5C 1YBMA 4BKRA 1ICEA 2XZTA 3IV6A 4NICA 5BQFA 5I7VA 4WY2A 3F2VA 3HCRA 4BYMA 4FDTA 2V1UA 2YQZA 1T9AA 3R4CA 3H1TA 4LC0A 1X77A 1E2BA 2L19A 4B3JA 5LQJA 4J43A 5FUXA 2MYNA 3FB4A 5A5DA 4DLSA 1GTL1 5KCMA 3KKOA 4RPGA 2XXJA 1OA1A 4PZYA 5I4KA 2J33A 1BWRA 3G2OA 4P4SB 2OVFA 1AOXA 1E9VA 2Z56A 3AETA 3G9ZA 3U7GA 1NU6A 1KF0A 4G3XA 2GD6A 3Q6IA 1ABEA 3FPGA 3ILSA 3W2HA 4B2PA 5C5EA 3CF6R 3SIWA 3PR1A 1M6NA 3EXFA 3F1KA 3QLVA 1KC1A 1RE1A 3NBXX 3DNPA 5DYWA 1ODIA 4E21A 3T5GA 4PEVA 1CE8A 2BI4A 1SVSA 1OC2A 2EYUA 5AK5A 3EIEA 1ONOA 4FGJA 4I9GA 4WW0A 4DDHA 1DXOA 2AOTA 3T38A 3UMFA 1NBMA 3ZH2A 2XE6A 3L0YA 4IQGA 3BHJA 3R76A 1QIGA 1V35A 2R62A 3V1NA 1QRRA 2PKRA 3DKRA 3IKMB 4UXHA 3D8HA 1CFJA 3HEMA 2EWWA 4UPEA 3N86A 4BGDA 1DC7A 1G5FA 4P0QB 3QP9A 1W75A 2JGDB 4IXDA 4B4WA 1Z2DA 3OC6A 2Y0BA 1JIXA 3FVQA 3H2SA 3HB9A 4F6CA 1JLHA 3X2SA 3JWPA 2ZBVA 4E4TA 1K6MA 1SVLA 1XL1A 4JI5B 1BW9B 5A05A 1W85B 4EUEA 1Z5ZA 3HJRA 1QTIA 5DU2A 4TXNA 2OQRA 1FOEB 1AKUA 1KL7A 2HQOA 1N2IA 2Y1WA 4E5VA 4QQFA 1NMQA 4JIGA 3I04A 3AM4A 1Z7WA 4OXYA 1TMYA 3Q1LA 5IARA 2Z1NA 4ETNA 4LWZA 1GD1O 4YJHA 3OZFA 4GM0A 4EA7A 5JO0A 4MARA 5EJGA 1BVHA 1ZHHA 3LCMA 1F7VA 1YU9A 4LUCA 4C3ZA 3VYRB 1JECA 1ZIPA 1YL7A 1P62B 2DBQA 3JWHA 4GP7A 5JJCA 4BV9A 4UPDA 3ZQ4A 2AEJA 1AQNA 3L0DA 2LE0A 2JBHA 1VE3A 3U4QB 2YZ7A 4TV9B 4MR9B 4DR6B 1DUIA 2I2FA 1DTWA 5K20A 4XDGA 4EVSA 1XD9A 1IUOA 1GYPA 2BCJQ 3HHEA 3P9NA 2PH5A 3FMOB 4FD2A 5BN1A 3VC3A 2VJQA 2H8GA 4C2UA 2K2WA 4GKBA 4PICA 4J0EA 3ZN2A 2C9YA 2DUUA 3BUSA 4YUXA 3BRSA 3QNWA 1EUDA 3C98A 4GVPA 4PPYA 1QONA 5T3UA 2BGNA 3L4SO 4L5YA 1PFKA 3BVPA 1JJ7A 1VG9B 3HB5X 3ITNA 2ZJ7A 1YCGA 2IXDA 3HCCA 4M54A 1G4HA 1LK7A 1WVMA 2YHIB 4U2DA 2OGTA 4U6QA 2DT5A 3WNVA 5MDHA 2FWBA 1NVXQ 2JFWA 1ETHA 3GA0A 4GQIA 4I4CA 5GINE 5JJLA 3GB9A 4BMZA 2IZOA 3B85A 1G17A 3HNOA 1JR3D 1D4ZA 1JDVA 4P35A 2OHXA 4FDUA 4QGAA 1BU8A 2YJZA 2J09A 3QKRB 4J2TA 1C0KA 3DHVA 1JGTA 5TQ0B 2D1SA 2PPVA 1MGPA 3SU8A 3TLXA 1GYRA 5BOSB 3K6SA 3WLOA 4EGQA 4HN4B 3DUWA 5F2OA 2RGYA 3X1WA 5LIPA 2I9KA 4DLPA 3M5CA 4YRTA 3MSXA 3FYCA 1Y4AE 2O1WA 4FMDF 4W82A 2X5XA 1D7AA 4TTVA 2DR3A 4A8JA 4EPWA 1VJTA 4RVNA 1JU9A 1ECFA 1UFVA 2O2HA 3GJTA 4GMDA 1BW9A 2JASA 2R25B 1THGA 2XD9A 2F3UA 2D74A 1P6UA 1WBJB 4IIFA 3QXJA 4QM6A 2G9QA 2IYRA 1RQLA 1EU1A 3Q7TA 4XYBA 4DSTA 1BEEA 1DG3A 4RY9A 4F4IA 4WLOA 4UHCA 5ALIA 4C1BA 3TFWA 2BZ0A 4G2TA 4AJ4A 2YICA 3U62A 1W88B 1HSOA 1KQNA 3EG5A 4MQLA 2XNKA 2V0NA 3SFTA 1G41A 3S99A 1A9PA 2UZ0A 1CE8B 2OPBA 2IH5A 3Q40A 4HXFB 3ZBQA 2BFBA 3THWA 4OX9B 5AJVB 1YZGA 3M6LA 1LI4A 2QVYX 2FUEA 4LZZA 1E5QA 3KL2A 1P1JA 3TNYA 1OB5A 1G66A 1D1TA 2X3YA 3G1WA 2CDBA 2ZU6A 2Q5OA 3E18A 2WM8A 2Q2OA 3DEHA 3MGCA 1SXJC 3DH0A 3GJRA 3W5AA 4RIHA 4BUJA 1LEHA 4ZHSA 4IMPA 4P4SA 5IJWA 1OXKB 4RADA 3M6FA 2WOJA 1N2JA 1SOVA 2F3RA 2UZ1A 4NBSA 1QQBA 4GPEA 4UW9A 1G4UR 5H8WA 1N5DA 2C5EA 1VECA 5IN5A 1GDHA 3CINA 3LDAA 4I9UA 2FB9A 2E5FA 4NFLA 5AJXA 4MV4A 2V96A 4HHEA 2WTUA 5FBQB 4UCXA 1EK1A 3QLVC 2YFKA 1SFRA 1SVKA 1RXWA 3AJ9A 4BY9E 1GEGA 2G8LA 2O23A 1O9BA 1LRJA 4RK5A 4DV3B 4JUBA 4XWOA 1EUYA 3RRYA 1IZ9A 2Y67A 3AOEA 4EI2A 4IIBA 1DRWA 2PL5A 1W1UA 2HAEA 1BYUA 4BEJA 2X9NA 3GVXA 3KOXA 3VR4H 4D79A 4EWLA 3UO8B 4ACBA 2IZ0A 2C03A 3TM4A 4DSZA 1WCIA 3QVLA 3KYDB 2EP5A 3E2MA 4RAOA 2VYCA 5L4LA 5TVKA 5EUQB 1D9ZA 3OWOA 4PONA 5FL7D 4EK9A 4L5BA 5I4BA 4G9EA 3H3FA 4YO7A 4D0RA 5A7GA 1RHUA 2C20A 5IW8A 2AXQA 2JLVA 2I3GA 2WJGA 5A02A 5F7ZA 3DAPA 4Z5XA 4B8ZA 1O89A 2KLHA 1P5JA 1ZIXA 2HQSA 2A9QA 4P58A 5BRNA 2R5WA 3O47A 3OFND 2RI6A 4Q3BA 4LYEA 1Z4KA 4KBYA 3V4RA 1LVHA 3X3HA 3T9AA 2JIZD 3VAAA 1V3QE 3F97A 3ZLBA 4IIDA 4D57A 3P4XA 4J16C 1FXSA 1TADA 1VIVA 1ZCZA 3KEQA 4U9UA 4IDHA 4WRRA 4Y6OA 3TIVA 3AF5A 3T3PB 3RABA 4CW7A 2P0AA 2UYGA 1CUGA 3V4ZA 3BXEA 1R4AA 3BWDD 3G5TA 3O8BA 2ZRIA 2PA3A 5KJCA 4JLPA 5I47A 3KUCA 2RHHA 2HM7A 2JI7A 5ETJA 4X7BA 3S5UA 3IODA 3T8YA 2FJ0A 4KQKA 2ATVA 4KSBA 1IOZA 5JCOA 3ZZTA 4PHGA 4ZFNA 2YY6A 4R3WA 1B0UA 2HPZA 4ZI3A 1SVIA 1BVYF 1EK5A 2FV8A 3E1KA 3NIBA 2PMEA 2PS0A 3BB4A 4MTCA 1Q91A 1FFDA 4EJ6A 2WFLB 4LHYA 2GF9A 2GEDA 3KZOA 4N82A 2O48X 5HUJA 1ZVQA 2I1LA 2ZIFA 1CVIA 1UODA 1VFNA 1AN9A 2NVUA 3LXMA 1RLTA 3RKSA 4KX3A 1XAGA 1J2RA 2WAAA 4NR0A 4BIIA 1NNSA 3BYZA 4HSEA 4YJHB 1WHSB 1AO0A 3LL7A 2HRZA 3NEAA 2O8EB 3E7DA 1RXYA 5A5EA 1VGVA 4FX5A 1KJYA 3C7AA 1SOWA 3GPLA 4DV5B 3FPAA 4MYUA 4WLVA 2BE9A 5E9AA 2Z58A 3LQQA 4HGPA 5EKXA 4UARA 3SR4A 3T12A 4IIUA 1P5HA 4EMTA 2FN7A 4HRYA 2J85A 3S27A 4EGSA 5KVAA 1WOMA 2BMJA 3L7LA 5JARA 4XLZA 1AXGA 4GMFA 1M74A 4C04A 1OD6A 1IHOA 3MB8A 1W59A 3Q3EA 3OE1A 1K6IA 2I6FA 3K72B 1AU9A 5KOIA 2R6HA 2X5OA 3P9XA 5CNJA 4ARBA 4LGMA 2IA5A 3IHTA 4IWXA 1ZESA 4F60A 3NHPA 4YLEA 2A57A 2QG4A 2WF6A 3JRNA 3SLGA 3ITKA 4INPA 4U39A 3RU3A 5J23A 4D81A 3LXRA 1M1YE 1SA0B 3AEUB 4F85A 4OMCA 3PFBA 4FGZA 3SF8B 4O4JB 3B13B 3LQKA 3QLUC 2YOGA 4G8CA 1N6KA 5DEOA 3DDNA 2XCUA 3DBIA 1W4LA 3AUKA 2C5BA 1UMBA 3G8YA 1E4OA 2HMAA 5HPYB 4XJVA 4MW2A 3DYBA 4NVRA 1GPLA 1M1YA 3RSSA 2G40A 2G9ZA 2Q2VA 1U3GA 4FONA 4A0GA 2EL9A 3GUYA 5IG2A 1PF7E 5DNCA 1OLUB 3E4DA 3D7MA 4MI9A 4QULA 1ZSYA 4CKBA 1SUPA 1C7JA 4GYWA 4MWTA 3B2QA 3H9GA 5E6SA 1CUHA 4CMJA 1QVAA 3JQ7A 1JZSA 1JI3A 2Z9CA 4PLPA 4TL8A 4UUOA 3RU9A 1YDFA 5BV2P 3AFMA 1T34A 4UDOA 4WJZA 2YMLA 2X6TA 1QHXA 3H2BA 5BQPA 3TL6A 3OFJA 5F1PA 1QB8A 4YHBA 4EHKA 1L5HA 1MDFA 3GJXC 1ZJ6A 2GBIA 3SICE 1XI2A 2SHKA 1ZRSA 2WVGA 1Y3HA 3D6HA 3MTBA 1CDEA 4D5GA 2B69A 4UOQA 3RT1A 4NOKA 4QDJA 5KTKA 4IJVA 3O5AA 3RPEA 2BZ1A 1XHLA 4U7GA 2OCBA 3PKZA 1GTMA 4PO3X 4CEJA 1FTYA 4WL0A 5B3JA 3T3GA 2HJGA 4G97A 5K8JB 5DGHA 1U7PA 1T15A 1XKXA 5CGQB 2ATXA 2ZUTA 2QMYA 4GMKA 1CV2A 4KJZA 4AWAA 2OECA 3P52A 2WKPA 1D03A 2FW1A 3G6WA 2RB4A 4Q6BA 3U80A 1MV8A 1PYOA 1MVOA 1XTRA 2IZ5A 1W49A 3CQ9A 3CUTA 2P77A 3MTGA 4YTEA 3WWDA 4Y2RA 4B80A 1K5DA 4U2CA 4KRXA 4RZQA 3NVMB 3VR4D 4I4TA 3AOEC 4YA6A 4ZCRA 4P92A 3PEEA 2PNJA 1IY8A 4AG6A 1GAJA 3VNBA 2B6NA 2C3UA 4BP8A 5J47A 3WGLA 3CLHA 1YI1A 2EFDB 3G7SA 1YBFA 3VVLA 4B73A 1Y9ZA 5LLSA 3GBPA 4J1QA 2FWJA 3AR2A 1QE3A 3K0FA 5TRTA 3RYFA 3VM6A 3WQSB 3GDHA 1GKKA 4FUQA 4LX0A 2BR4A 521PA 1L4EA 2F1HA 2BF7A 2CXRA 1VZ2A 2JGIA 1EFRA 2ZU0C 3H4VA 3FW1A 3FH0A 3FNFA 3HY6A 4TVSA 4UDNA 4RULA 3BEDA 2XD4A 1DAMA 1JQBA 1A2QA 2H7XA 1CUXA 4I5EA 4AMVA 4EECA 4RABA 4YHHB 3EFHA 3I9LA 2BI8A 2IIBA 2XE4A 1KJ9A 2JHFA 4LE2A 4YS6A 2QP4A 1GPKA 2GAOA 1PQPA 4TKUB 4M87A 3ZEIA 1I1QB 1PS0A 4QAQA 3RAEC 3L7AA 2QN2A 2YRWA 4D82A 2XB9A 2V7WA 2DPHA 3K16A 5EE5B 2FEOA 4LI0A 1RKVA 1SC4A 3Q9LA 3RK4A 3VDNB 2NP6A 3G0GA 3NR2A 4G36A 4C0AC 1UZUA 4AYWA 2GFIA 5BW6B 2GH1A 1HDOA 2FNAA 2MSEB 1Z26A 3VR4A 3ZGYA 4D0LB 1ONSA 1P9NA 3MBKA 4FDMA 3ZDQA 3CUUA 3OJWA 2VF7A 1E60A 2QORA 5LP6A 2Y8EA 4BV2A 4BECA 2ODQA 4N7BA 1TK3A 2VDVE 3I9JA 3P27A 4IOJA 1QFZA 4XWTA 3ZKWB 4H4EA 4KR6A 1I0LA 2ZAOA 4F21A 3R5JA 3M3HA 2P4EA 4XUEA 1TUGA 3H6GA 4Y7DA 3TIIA 2PX2A 4AZ3A 2FUCA 2VHVA 4K6KA 4FFDA 3I6QA 3OWHA 4L02A 3KD3A 4HDRA 1M5UA 3QLEA 2FEWB 4LDZA 2WYOA 4M46A 3K2IA 1IY2A 2JRCA 4ND5A 5AHKA 2QRMA 4XH9B 4MWDA 4BB9A 4Q82A 1KORA 3LRPA 5JSYA 1YS2X 3L8CA 4EYOA 4R0VA 1X8LA 2OCGA 4CMIB 2BGUA 2C4TA 1L5KA 1FU4A 2FVXA 1Y81A 2VP5A 3LQ4A 1XT6A 2DRIA 4NFYA 1KDZA 2HHAA 4CKYA 2R6JA 3GC6A 4R1NA 4DQ0A 4MKGA 1CS0B 2IVFA 1I5OA 3DOOA 1IIRA 2JDIA 4D2IA 3ET5A 4HVLA 1Q17A 1X80A 2WU8A 2ZREA 3NIFB 3CJRA 4PYMA 2H7CA 1YJ8A 1TXGA 4DR2B 4JX8A 1RVDA 3UPUA 2QXTA 2I6SA 2HHLA 2ZK7A 5J43A 3SLKA 1C7EA 5H59A 3AW9A 4WESA 3ZJTA 3OHPA 1ODSA 4ZAYA 3V2IA 5LBTA 1X8XA 1LLCA 1TM1E 2FPPB 2AYYA 2WTMA 2X19A 1UKZA 2H92A 2CNDA 2O8VA 4C21A 4M8NE 3VR3A 2XCOA 4KE6A 1VSBA 4J1SA 3OT1B 4LQ4A 3UXYA 4HNTA 1L5RA 3K05A 4FC6A 4X1IA 4XRGA 1ONPA 5EJ8A 2IHKA 2NO7A 1AXRA 1KJWA 2BD0A 2RK6A 2DSTA 3EEIA 3LLUA 3GLGA 4XXHA 4BJ6A 2GN6A 2PLRA 1KMHA 1IM8A 2Q3JA 4HMOA 1ENPA 2V7GA 5EIXA 2ZFUA 4IBOA 3CZ5A 4CIAA 4KGZA 1QDUA 3GD7A 4PO1A 1T43A 3UZUA 3G2PA 2ZTMA 3I12A 2WKQA 1YI0A 4G56A 3Q9SA 2JCVA 2QG6A 4L75A 3O4FA 4TWIA 2QMEA 3QU2A 4G1UC 5J58A 2F3TA 3T7SA 5EERA 5IF3A 1XKLA 2UZIR 2VT7A 3CLTC 4RKEA 4XB6B 1IE3A 1YJQA 1YF3A 3L4KA 1DO2A 2H2FA 3UQZA 2XIQA 4BFWA 5HZMA 4ML3A 2CMHA 1J09A 3QEJA 3QLJA 4MGIR 4REMA 2BFPA 4QDOA 4TTQA 4BOYA 3K70C 1I2CA 1S3IA 2E1RA 2QUBA 4N0QA 3DT9A 4EPRA 4CT4B 3O2QB 1BS1A 2E0IA 2XAUA 3ZVNA 3BFVA 3ZH9B 1ZA1A 4GG1A 1W581 3IXQA 1Z75A 1DRJA 4TMVA 3IBYA 1CQJA 2R8YA 4M9RA 1KI1A 3DBRB 3DT8A 4R98A 3V2GA 4F2DA 4LWOA 3WNQA 1H9AA 3Q7RA 4IYRA 4JA2A 1JR6A 3H9EO 4Z51A 1OFHA 2ADOA 2AJTA 2BOVA 1DAHA 4MO2A 3ZCSA 2OORC 3H4TA 4X6UA 1MF7A 1BDBA 4WFIA 2WIGA 3GP8A 3FWNA 3S1LA 2BDEA 4C76A 1CIJA 3DEZA 3UUWA 2OFPA 4J3FA 2FSFA 4JWTA 4G1FA 5IK2A 2QN8A 1ZOSA 1XWIA 2FMXA 2RGCA 2X5JO 1FUYB 3FYDA 1R6UA 3PC6A 4PZZA 1KRWA 4P5PA 1QYDA 2NG1A 4NQRA 4EEXA 1ZDMA 4I5GA 3D6NB 1EVJA 2FWNA 1UP7A 4KH1A 3DULA 1H4VB 1PJTA 1L4MA 1ZJJA 2DHDA 3TXXA 2VPXA 1J5EB 5ECWA 2FG5A 3ANNA 4PYIA 4TKMA 3CRZA 1KFBB 2BGWA 1S8OA 1XRLA 1T8TA 3DL2A 3QPVA 1H6DA 1A4RA 4H15A 1TGYA 2XNDA 3RUCA 2OC4A 1KYYA 1NTRA 1A82A 3UV6A 4BTEA 5MN6A 1FA9A 5WRFA 2PXHA 3C8DA 4KO8A 5JMTA 3IKJA 4QO8A 2I2XB 3JRWA 5FBLB 2YXEA 3TH5A 2PUTA 1PZXA 4EY7A 3KTFA 5IT0A 1AE1A 2Y66A 4IIGA 3W2EA 3DV0A 2C07A 1S2IA 3EVEA 2WB4A 3SK0A 4E33A 4B35A 3UWMA 2QDKA 4OUDA 4ZO9A 5FQNA 4Q19A 1NX6A 1RCUA 3ROKA 3WA7A 1ECBA 3ENZA 1YJXA 3H1PA 4XM0A 3NP9A 3I42A 1DVRA 1X7GA 2IYVA 4TRRA 2GASA 3KZNA 1CJTC 4DPKA 3HTXA 3QF4A 3EFBA 3C14C 3SQMA 3UATA 4PQRA 3V34A 4S1OA 5K45A 3KSBC 3EA5A 2XTAA 1MMFB 5LP6C 3HEAA 2QUZA 3AR9A 2NV2B 3KALA 3P1JA 4WCFA 4BN0A 3WNZA 1ECGA 1DBIA 4EQ6A 3ILHA 3PG5A 4MYRA 2A67A 4PWYA 3WGJA 1KVTA 1U7WA 1WTCA 2ONZA 3M2PA 3R8XA 4PSAA 1BX3A 1E3TA 1XRSB 3FN4A 2ZJ4A 2VXBA 3OMWA 3OT4A 4FZRA 4LQDA 4AS1A 4EFDA 4C2BA 4XQCA 3OSUA 5JQWA 1VC2A 3KE8A 3KXKA 2V7PA 5ALUA 4YAUA 3BXZA 4OSOA 3QUAA 4GNRA 4KCGA 3VTFA 1EGHA 2FPMA 4IO0A 4ZCTA 2YZ2A 5JWRA 2D0OB 4Z9FA 4Q05A 4B3FX 3GWGA 5A5GA 4G5GA 1T1IA 4Y9DA 1NMSA 1G7CA 2PL9A 3Q5DA 4IVRA 4Q02A 3OKCA 1SBIA 3OZUA 2GD2A 1YB1A 3U26A 1L5FA 2YYYA 1WHTB 2FOXA 1KYXA 3A1TA 4HMPA 3TNJA 4EG5A 1C81A 1UFOA 1USIA 2OLEA 5JS8A 1DIRA 3P0RA 3ABRB 1RXUA 4F5DA 2I03A 4Q16A 3FTEA 4NJMA 3A58B 1C9EA 4OQDA 3SJCA 2FOIA 5LQNA 3KT3A 3AT1A 1JA0A 1Z83A 1OBCA 4EB8A 4QLOA 2FPOA 1T9DA 4K6CA 2C2ZA 3KZXA 1NW8A 2XYPA 1N6HA 3DVAA 4KH0A 3A10A 4CMBA 3VR5A 4MIEA 4LHWA 5E9JA 1YVUA 1LPSA 1L7AA 2PFSA 4RFSB 4D3FA 4XA8A 3NI2A 1WA5A 4M0EA 3NH9A 3G5UA 4TXLA 2ECOA 1UADA 1LJLA 1TIKA 3A1UA 1HTBA 3HG7A 2OYRA 1FW8A 1ND6A 4MK4A 1QV9A 1MV5A 4AB1A 5I9IA 3U6KA 2WJIA 3FOEC 1UT6A 3O6VA 5CD9A 3I01M 4O0LA 3LQ1A 1EP3B 1IHUA 1M66A 1XZKA 2OAEA 3HYLA 1B76A 4GPAA 4LSWA 5FAXA 2E2WA 3HZRA 3WKEA 4ROSA 3D3KA 2WWHA 3PUXA 4FOPA 3ES9A 4TSFA 3UMGA 5KJEA 3KLNA 2ZI5A 4RH3A 2I4NA 1NF3A 3EEFA 3JZFA 3X1JA 4OQFA 1LQ2A 3MT8A 3GEGA 4G0MA 3ZK8A 4G07A 4GMXA 1ZN7A 1CBUA 1E2DA 4POAA 3JX9A 1QANA 4S1PA 1ELOA 4RELA 3QI2A 1W36B 1EWYA 2QLLA 4QOJA 3N2NA 3UKDA 3VKFA 4EZIA 1XEXB 5AK6A 4KBFA 1KH1A 3B3FA 2NQ2C 3JWGA 2OFXA 2H4FA 4CIVA 4RANA 4D45A 2G9VA 1E0SA 5FBKA 4YRKA 4BX3A 4CXMA 3CUSA 1SBNE 4TL6A 3E9QA 3QMWA 3LW8A 3K20A 2Q29A 5EKTA 4D9BA 1QP8A 1P44A 1R0XA 2VP3A 5DKFA 1ZNWA 2J5RA 4E6PA 3P4YA 4A8TA 1JILA 1K0UA 3CWZA 3DVLA 4UE3S 4UU8A 3TNLA 4TLBA 3M9XA 1ZAKA 1CNMA 2XI4A 2B37A 3PKIA 2ZJ1A 3LFHA 4PZ0A 3TTWA 3VNRA 4MWOA 3BRCA 3IOYA 2LV8A 3OIGA 1TRKA 1WUTA 2OZEA 2FN9A 4RJIA 2B0JA 3SKXA 2BMDA 2X13A 4OP3A 5AVJA 4AKTA 5J1TB 3W5HA 2ZSKA 4NYIR 5KYVA 1YFLA 1UAYA 4DGSA 2OORA 5ALHA 4CF3A 3EMVA 1JN0A 3O2NA 2I1VB 4G23A 1CIVA 5TLSA 2PLNA 3GVIA 1QHYA 2C58A 3C5VA 4H2DA 2D0DA 1MA3A 4GZ5A 3BTVA 4IGFA 1LPNA 3QYPA 4OF4A 4P3OA 4Q9HA 3SC4A 5IHPA 5E4TA 2B99A 3JYPA 2A0FA 3K9QO 5HIMA 3UWPA 5BNIA 4KXWA 1G2OA 5EUMA 5IT4A 5KQGA 5GZ3A 1YL6A 2QROA 4UNNA 2FZKA 1SOMA 2QAIA 4RW0A 1MU0A 4XUDA 3OLYA 1BX0A 2H1FA 3L6UA 4D56A 3B82A 4LI3X 2J9GA 4PBSA 1NYLA 2GHQA 2K7ZA 1E0AA 2PE5A 4YLYA 5B5SA 1OLXA 4CM5A 1ZSVA 3FHLA 5JXHA 4HGRA 4KN8A 1AKYA 3OLVA 2NXCA 1BKSB 5DHAA 4PTLA 3AINA 3DM9B 4HQOA 5ALNA 3H5VA 5EPEA 3D0OA 4L8YA 5K0NA 3VR2D 3OJOA 2A9JA 1Z37A 3JQAA 3VC1A 5ERYA 2G80A 1UC9A 3FHCB 1XYYA 2ZUCA 2O2IA 3CSSA 5DIZA 2KX7A 2VP0A 4YJFA 3MEQA 4KR3A 2EARA 3INGA 5EWMA 4JELA 1GZ4A 2HRCA 2P3QA 3EW9A 3QE4A 2ECFA 5D7NA 1TUEA 3ZX4A 4HFNA 2GX6A 1W36C 2NU6B 5AYVA 3NKFA 4P7GA 4XGRA 1YDHA 4OKNA 4BJ1A 3M5WA 5FYQA 4DG5A 1V9LA 2Y4NA 1PL0A 2J08A 5I8PA 2B4RO 4FK8A 2CKMA 4C0XA 2KPOA 2WMNB 1R50A 3AY7A 2IV2X 5J2UA 2EBUA 5I01A 3T54A 3EBPA 4IVNA 4M9SA 2C7GA 3GVCA 7MDHA 3MNFA 4IXMA 5HCNA 3U3JA 1NG1A 4RE6A 2HDOA 2HR1A 1QTRA 4W5TA 1R4NB 1W19A 5G3ZA 1FY2A 3DTNA 4AKEA 2QZPA 4IQ8A 3FAZA 3RHZA 1ZEJA 1VBFA 3DXFA 5T4EA 5E2BA 4HB0A 1AQUA 3TNDA 5LU9A 3JATB 1KDTA 1Z0KA 4EM6A 3VSAA 1TMGE 3ADOA 3E22B 3F6BX 2M98A 3PPWA 4YRRA 4X71A 1LX7A 2QQ5A 2WW8A 5I8WA 3QE9Y 2RARA 2DR0A 1PRYA 2B7CA 2ZYWX 4AP9A 3PL5A 1N32B 3BXOA 4DW8A 1QG6A 1M1XB 2B1IA 4EO4A 2FP3A 3R3XA 2J3DA 1RQGA 3JQ8A 2JAPA 3QW4B 4N49A 1R8QA 5D1NA 3V33A 3ILXA 1KQFA 3TGLA 3J81A 1V8PA 2YZNA 1RZRA 3P9RA 1KAOA 1U2DA 1B8VA 2BMVA 4FQ5A 1EX6A 5CTAA 4YRFA 2ZKIA 2Q3MA 3HYSA 1LZLA 2QVLA 2ST1A 4JP5A 3DR5A 1NRJB 3IKLA 1NC3A 5FWXB 3Q11A 1JFRA 3HFSA 4NMWA 3BB3A 2AE1A 3ZWMA 5ULLA 4EKIA 1MW8X 4QYMA 2Q2QA 3CNLA 2PR7A 4P6VF 1F60A 3KTOA 1RS0A 4Q34A 3V80A 3BXHA 1UT8A 4CI0B 1RT9A 1QHFA 4WXMA 5IRCD 2UKDA 3R3WA 3RS8A 3OQIA 3N8HA 2GKGA 3H5WA 3JW8A 4ZZ3A 4U2BA 5LXTB 4WT7A 1NNI1 4BC1A 1U9ZA 5DNAA 3CT6A 3EC2A 5LA6F 3QXSA 3G2HA 4HQRA 4EHDA 1K06A 1UZMA 3A37A 1GFSA 4IOMA 4KQJA 3REQA 5BV7A 3RVBA 1DFIA 1FNDA 4QFMA 3HR7A 3FOFC 3A14A 2QSJA 4G01B 4AMZA 2J48A 1Z38A 1G16A 4MLPA 4DR7B 3TXYA 3OCXA 2G6BA 1IH8A 1S5PA 3IVAA 1PL8A 4BKPA 5E7MA 1B93A 1DEOA 4HD8A 1RM0A 1YNSA 2QQGA 4MVJM 2CEKA 2WWVD 4M3NA 3LWZA 2O2DA 4MP8A 4R16A 3UCEA 1JG2A 3CCCA 3GUUA 4PWZA 1FNSA 3DONA 3G2QA 1Q1AA 5KVVA 1G8GA 3GI1A 2OZPA 2B98A 2P2LA 4FMCF 3U3MA 4BKUA 4BCBA 3S5JA 4LXGA 4IGEA 3CBQA 3JQFC 5CX1B 5K0GA 4HDRB 4RSHA 1EGMB 3I0NA 4CG0A 4QPDA 1B0ZA 1O4WA 2QLFA 4QSMA 2A1IA 4U9IS 1LH0A 1DWPA 1GU0A 1XJ0A 3AQIA 2Y92A 3DV0B 1X7XB 1EVLA 1XD8A 1XEAA 1K8YB 3BWMA 3GU3A 1IHDA 4JBNA 4C20A 1DU4A 721PA 4DTIA 2YZKA 3AEXA 3GBVA 4AS3A 3B1ZA 1PDVA 2LKDA 2AQ8A 4F96A 3O3NB 5EP1A 4P7KA 3VDQA 2J67A 4WUVA 2O7SA 3KZCA 3QXHA 4YROA 5U4QA 1EE9A 1Z5OA 2ALJA 2W6IA 1N75A 3MQFA 1T6YA 3BRWD 1T3SA 2HJSA 3P9ZA 1B4DA 3DPIA 3JQAD 3ML1A 1XDSA 3PPVA 1M7BA 2WWRA 1VYVA 1BE8A 2IYUA 1GNTA 2IPOA 1A8QA 2BFFB 5DNDA 4F4HA 4I46A 1KIMA 3PC3A 1MOSA 3O1IC 3H75A 2A14A 4UPVA 1I6LA 5K8LA 5L8VA 4TGLA 2JL1A 4KR9A 4UUQA 2J3JA 2RAFA 2MTBA 5F77A 5FT9A 2YL2A 3N9IA 2Q0XA 3UKJA 5CA1A 1ISHA 2O8CA 4PIPA 4PW0A 3SEFA 4XYEA 5C35A 2DH5A 2D7JA 4LZAA 1NPYA 1UWCA 1LQUA 3OA2A 4PG5A 2ONKA 1OU4A 2YWEA 3ZOZA 1G98A 4UATA 5BV8A 2CY0A 1UBLS 1FMCA 1XQXA 1FDVA 2GZDA 3TZEA 2A3RA 5G0UA 3HCPA 1GTVA 3OJLA 3DBRA 3PFCA 5IX8A 3JD2A 2HLNA 3E3OA 4ND7A 3CJQA 4AL4A 2OV8A 4RK6A 1JSZA 3IVCA 1B73A 2RKBA 2R8OA 3SS7X 4A6EA 3ZJUA 1E3LA 4FKMA 1N2OA 1KVRA 3AI7A 3T1TA 2CLEB 2UUOA 1G8PA 1HH4A 1XBTA 4CMGA 2RBEA 4YY3B 1K98A 4HLUC 2ZVJA 1DJOA 4IFIA 3M83A 1NI4A 2H4YA 2P9YA 1FP1D 1OXTA 4OHYA 2OD7A 3PGLA 4YCJA 2GVZC 2UZ3A 4I8IA 1PU2A 3LPMA 5KQSA 2Y2VA 3V2UA 4LRXA 4DZZA 5EE3A 2PYIA 4P4NA 3TCKA 3FUCA 3L7DA 1P5ZB 3AUAA 1JBKA 1F9EA 3C1UA 3JQBA 3BREA 3CZRA 3QH4A 4CCAA 3TEFA 1RRMA 5KMGA 5CYGA 1W5BA 3PZRA 3CU5A 2J7KA 2YFYA 3OT5A 1VA4A 4R5HA 3R5TA 1S8NA 4F4UA 1ZM4A 3SJBA 4KRFA 1XZQA 3PFIA 3KXDA 3Q0EA 1V1RB 3NM4A 4L16A 2OAQ1 2CE7A 2ZPTX 5JS2A 4JROA 2DHEA 1R3UA 1YCHA 4LJ5A 3TN7A 2NUPA 1P31A 1A3CA 3QVKA 1UR5A 3GLFE 1E77A 4OHOA 1PI3A 3AEQB 3X1KA 1GIAA 3ISTA 2OC9A 1WXXA 2G8NA 2HJRA 3U4IA 4IH9A 3UAWA 5B6PA 1APBA 1SM4A 4N41A 5AUOB 5FI5A 3ZDEA 4FDLA 2XR1A 1V3VA 1KZ9A 1RAGA 4XCVA 4D9JA 3CWQA 4IEFB 2GLUA 1N2SA 3I2FA 2EZ4A 5JOQA 1QS0B 1ZI9A 3O3MB 1TCUA 3GAMA 4M37A 3UW3A 1TO2E 3GP3A 3NV9A 1FLVA 4NZMA 4PF1A 4TV8B 5HK9A 2XMSA 2VP9A 1I1NA 4G9GA 4TV8A 4YCLA 2BRUC 3T34A 5D87A 1O95A 4BX9A 2WILA 5ILGA 5JAUA 5ADVA 1H4SA 1EWRA 4JSTA 2ZCVA 5KHOC 1U0NA 4N3BA 4RUKA 3H2JA 3P94A 2EYQA 2P2CA 5F98A 1KYZA 1I80A 3TR6A 3P20A 1QQTA 3MCAA 2WM2A 5E3HA 1NXQA 1PJ4A 1Q1BA 2DY1A 1RXSA 4NHEA 1GQOA 3LHKA 2ZBUA 4OJQA 5JPDA 4LBZA 1MIOB 4TYQA 2IHJA 4UHEA 1U8UA 3A6KA 4JI7B 1ZD3A 2BONA 1XAJA 2QQ0A 3RH0A 3ESXA 5AD1A 4HX9A 2HLPA 2AG6A 3LQYA 1AUOA 1N57A 1M54A 2VUHB 3CF4A 3RV3A 1JT2A 1AZLA 5JDCA 5H3HA 1HF3A 2H5JA 2K87A 2VBIA 3EUFA 3N0TA 4RKRA 5GVRA 4ON9A 4C6TB 4EG8A 5KYWB 4X0EA 1T4MA 4QAJA 2ZRKA 3L6OO 1UINA 5K8IA 2CYAA 4TXHA 4MUYA 4OFXA 3LUPA 3MT0A 1JHZA 2QDXA 3MGGA 1PE0A 4GVLA 4LTDA 4URWR 1LX6A 5KVQA 3ZD8A 1K9SA 1NYTA 2C29D 3M4JA 4FFSA 4GP6A 4S0XA 4GT1A 2V7BA 1IL0A 1YSCA 3FNRA 4TWZA 4EA6A 1JDUA 2UZAA 3NP7A 2GXAA 5JO9A 1EB9A 4AMGA 2JIMA 1Z6AA 1NY5A 5F5LA 2JVJA 1SVMA 3REGA 1ADYA 1W2WB 2JEYA 2O05A 3FCYA 2ZSFA 4B76A 1HPLA 3N87A 1UBFA 4C89A 1E9AA 4X64B 4DBVO 1C80A 4ZCMA 2BBOA 4ZTZB 1Q15A 1LBEA 1K6XA 1GNVA 1U0GA 2FF5A 2GSDA 1KAQA 1PEDA 3IB3A 3QV1A 2J9ZB 3IUSA 5IT5A 5M2QA 2VJKA 5K3BA 5L3QB 2EBWA 2GEUA 3K09A 3ID6C 3CIFA 5HTKA 6ADHA 4IFTA 4MVJD 1HE2A 3P9CA 1W2HA 2YVQA 3MTDA 4BO5A 3GIWA 3AP1A 4XGKA 3OCZA 4EKGA 3T99A 3L92A 1KO5A 1LW7A 5CUQA 1A7KA 5FLEX 1L5WA 4R1MA 3SE7A 4RF4A 4WLEA 1H6CA 2XCLA 2PKCA 4NDAA 4ES6A 1L5LA 1QUFA 5IZCA 4OD0A 4G5FA 2XNCA 4W5WA 1XXHE 4ZJUA 1TL7C 3KAPA 2RI0A 2VK2A 2ZG6A 3ELUA 3PC8A 1ORDA 4R3UC 3A2NA 2CVZA 4U7JA 3RS2A 4JENA 4A6XA 5B57C 1G2QA 1ZCBA 3IQFA 1NRXA 3MRVA 1T2NA 5LQUA 3EASA 2Y1FA 4RFLA 4CKWA 1A69A 2DQZA 4B34A 4E70A 2JF0A 2O4CA 3HUTA 4IL5A 2YJTD 3NKLA 4ASUD 2J3EA 2WJ4A 3D1VA 3H9QA 4JP3A 3BEOA 5KAMA 3PGMA 4GU5A 4D25A 3K0CC 1J2TA 3V4PB 5K0TA 3M89A 1PAUA 2C2MA 4FXOA 2PBLA 2P9ZA 1BKYA 2B4QA 1SCUA 1XCMA 2O3RA 3JARA 4LEIA 2I7TA 1FJHA 1F2TA 1NQ5A 1YR8A 3R7DA 2Y4OA 3UAVA 5MF6A 2JLXA 4WY5A 4QFCA 2CUKA 4KQFA 4JA0A 3F90A 4X5OA 1BCSA 3ZGZA 1FEZA 1JXQA 1WCXA 1E2GA 2W2LD 3KVRA 3MMZA 3QPDA 4LYJA 4MDYA 1D2CA 3ZBTA 1V96A 2XX3A 4XQGA 2VQFB 3ANYB 4DARA 3RFXA 1BNCA 5KOJA 3HDJA 1JTVA 2PZAA 3DZDA 5IKPA 1PJ8A 1LK5A 1V47A 3ROZA 1X8JA 3DFFA 4I55A 3NNDA 3U4DA 3VAZA 4N6OA 1OKKA 3VJLA 1GKLA 4JI6B 1ZIOA 2PQ0A 2Q4RA 2PGJA 5L51A 4O25A 1B7GO 1PJBA 4QSHA 1MQ9A 4DKJA 3LCVB 2GBPA 4LWQA 3CNHA 2LDBA 3S44A 4YX9A 3AVUA 1XNRB 4WN3A 2CK3A 3OU6A 1P91A 4I5FA 1ZXLA 1UDCA 1Y9DA 2IKQA 5DM0A 5JCJD 5KU1A 1TF5A 3DOIA 3QPUA 3GYGA 4ETIA 4YRMA 2Y1OA 2R6DA 4UEQA 1TZBA 1MRSA 1V5GA 2O3TA 3LFUA 4URZR 4G65A 3HJTA 5TGZA 1ZR2A 4PRKA 1M1NA 2FPKA 1J07A 3COPA 4FU0A 3N39C 4CV1A 4JJAA 3THWB 5B30A 1LSOA 2F8LA 1I30A 1G0NA 1YR6A 1WQ1R 1ZQ1A 4R0NA 3KQHA 5IVHA 2VJLA 5ENDA 1W1IA 5IANA 4B44A 1TMOA 4GMGA 4BCDA 3EE6A 3MSCA 5CEFA 4KMSA 5AI4A 3WK7A 5LNK6 4XDZA 1ZVVA 1KVUA 2ZSIA 3LBIA 3M9WA 3TSAA 1J70A 2EXXA 3LECA 4GPBA 5REQB 2CFCA 3S2EA 8ABPA 3EGDB 3QQPA 4WHMA 1RD4A 2YY5A 1Y5NA 2PTGA 2YDYA 3J7AC 4UHDA 1ZCAA 4FN5A 5EKDA 4BNYA 3PC4A 3CR3C 2BH2A 4RETA 4Z4QA 2PANA 1SC9A 3ZR4B 1ABFA 3L1UA 1ITZA 1L4UA 4HNRA 1FFHA 1DHTA 3VPFA 3R2JA 2XCSB 3HM9A 3M70A 2BFAA 4NG4A 3UK2A 3OQMA 2H06A 3IAAA 5JCXA 1NONA 3EX7C 5BUSA 1QO0A 3IAS1 3N2LA 2IU6A 3T3IA 3CR8A 2AWOA 3GGPA 1VXOA 1JG1A 3KVOA 4EG1A 4BAGA 3OBBA 3ILYA 3MUOA 3OWXA 5AVVA 3NASA 4LZWA 2IBSA 1N0WA 5C3UA 2CL0X 4XM1A 3LA8A 5GGXA 5IVPA 2BMWA 1KIAA 2NMVA 1OX4A 4H1VA 5KC8A 3EMKA 3CPEA 4PYQA 2JA2A 4EUHA 3IJPA 4A92A 4KPEC 2DFKB 3OUUA 2PGAA 3LP5A 2QTNA 3FNEA 1TYZA 1Z07A 4IHJA 3ORYA 1CNEA 3RCBA 1Q1NA 4FFOA 4DDWA 4W5RA 1DADA 2AFHA 1P0FA 1ZW1A 4KPGA 4YJDA 3AESA 1U1DA 1V9CA 2ZXEA 4FZ5A 3FFXA 4YCDA 3RS4A 2CXXA 3VO1A 4E5KA 1IBRA 2OFFA 3LFTA 2SKEA 3MWDA 3OQPA 5FJIA 3TQSA 3ZWBA 3KQQA 1O97C 4OAOA 2PYZA 4PZEA 1VYUA 5TR9A 2QNBA 4A16A 1AHIA 2O6HA 2G83A 4B31A 4EW2A 3VPHA 2C2HA 4IJ5A 1IHXA 3QVMA 4WK2B 2BC9A 3RR2A 4MR9A 3ZU3A 3N0WA 2R84A 3ZXUB 2JAXA 3FYHA 4HWPA 3O8OB 4L7QA 4M0KA 1HLDA 5JYEA 1DELA 3GLSA 4P34A 1PT9A 1ZM3A 4DNXA 4QRHA 3TDNA 2YNMA 1Z56C 3RJ9A 3SJZA 3ZVLA 3AR7A 3KQNA 3IMEA 1A7UA 2DOKA 4JBWA 3X1MA 3ICPA 3NO4A 2QE7D 4NNJA 3LCUA 2HA4A 3ROQA 2ZM6B 3N28A 2IE0A 1QVVA 3L7CA 4DDKA 3L0SA 3QEOA 5KTYA 3D0RA 2WVAA 5J1SB 2BLNA 2GAJA 4TM7A 1PT6A 5AOCA 3WQHA 4IQ0A 1GGNA 3UXMA 4JLJA 3RS3A 2OG1A 2CDRA 3CPHA 3ZHBA 2C2GA 1D0SA 1PNVA 4WOCA 4FZJA 2CDNA 1Q0PA 5FR2A 5F3DA 2E5LB 1LI7A 3BIOA 1B16A 1CG6A 3DOCA 2VP4A 3D8RA 1TZ2A 4CZ2A 5C7OO 1D8AA 1I4LD 1P2BA 3CXUA 3JAKA 4LZJA 2ZJ3A 3IXMA 3WL6A 3PICA 4N0MA 1EDEA 1A72A 1E0DA 4Z9YA 5J40A 3ZCTA 4KPYA 5CA0A 4M9XA 3TF5A 1FX0B 1E6CA 1U04A 1ODCA 5EP2A 4P83A 3I6BA 2D3WA 4WOKA 1QM5A 5JSKA 2AFHE 4RHEA 2FJPA 1PDOA 1HG1A 2Q28A 2QYSA 1T1RA 5LMZA 5DHUA 4B5LA 5IK2D 3KOZA 2EX1A 3FLMA 2FF7A 2VBFA 2QR3A 1P1IA 1WW2A 1GSIA 1LBSA 1HLFA 1V6AA 2FW0A 3KR0A 2OBFA 4BIMA 4E5DA 2HY7A 4ESEA 4MUAA 1JUDA 1JDTA 3DO5A 4QJ5A 3QWIA 3HNPA 1ACLA 4B3MB 4G0UA 2IYNA 3Q88A 2HLDD 4HDKA 2FFHA 2D2EA 1P0MA 1NW7A 2A1TS 2DJ5A 5HG0A 4G85A 4G5HA 4OI1A 3TIFA 1D4FA 3E3LA 3H4MA 1QCDA 3CIOA 3U17A 1XEXA 2VT2A 3BSYA 5ALEA 1IQPA 1CUJA 2BP7B 1RWVA 1GGMA 5HQ3B 2F3PA 4WKGA 4LV8B 1QTNA 1U2GC 1GDDA 3U3XA 4MVJA 4PO8A 1M2OB 3RC2A 1B8NA 3IUMA 3QX3A 1AKEA 4KX5A 3LWBA 3WLIA 3AVXA 2I29A 3NYQA 4Z7NB 1JHOA 1ZXBA 3FIJA 2F1KA 3VR6H 5DYIA 2X0NA 5C5DA 2IDMA 5DB4A 1Z6TA 1L5SA 4AM8A 2JIRA 3I8SA 4UNPA 4C9BA 4IHAA 5D3QA 2Z8YM 3AMVA 5DYNA 3T5PA 2DE0X 3IV9A 3PDIA 1WXDA 1QVRA 1RTKA 3HK2A 1N34B 3WMRA 3MOSA 3ZEAA 1T36A 5AVZA 2FN4A 4I50F 3EPPA 1FMLA 5KX5F 3L3BA 1GUDA 4G0YA 4WWHA 3EXHB 1P6XA 3IT1A 4LOLA 2CLDX 3GRZA 1TB4A 2ERXA 2HD4A 1HDIA 3BMCB 1QYRA 1MX3A 3QW2A 1HUQA 2ZIVB 3DBOB 4K2HA 3TLCA 2HDNB 1MC4A 1D4OA 1EXVA 3OY7A 4XTCS 1V26A 1T0HB 4C4PA 2GHTA 2CD7A 1XNHA 3EWNA 3GJ5A 3K9HA 2ZYGA 3AJRA 2ZWAA 1V45E 2E87A 2VCEA 3GUCA 1SUFA 1YVEI 3FWYA 4DQLA 1QQ6A 1KGDA 3OCUA 2AL7A 3AHGA 4AO6A 1T9KA 4I1RA 3PSAA 4CUZA 4EQZA 1SN7A 1F8GA 4KV7A 1VE1A 2G82A 5FTJA 3D59A 1L7PA 2JFUA 4UULA 5LQMA 1ZR4A 3UJ8A 4GI1A 1XCLA 3SQXA 2CNKA 4HVAA 1GO2A 2YWBA 3L5OA 4JR0A 2AD5A 3K6JA 3U4GA 4B43A 3UJNA 1K6EA 1PWXA 3HCDA 1UEJA 3O3OB 1N8TA 1BS9A 1OIWA 4G0ZA 4LRWA 4PRLA 3T5DA 3ELWA 2CJWB 4HX2A 3B89A 2C4KA 4PQYA 1II9A 2BM0A 3P45A 4K26A 4WA8A 3USCS 4QBIA 4D4GA 1GTRA 4WECA 1KZYC 3HMKA 4OSPA 1UJ2A 2FVYA 2ZSDA 5DI3B 1IRXA 1XKQA 1K2VN 2J5BA 2W4IA 2XUZA 4IGIA 5JCOC 3P32A 4EVQA 3LT5A 5JI3E 4J1TA 1BMFD 1TO1E 2QUHA 3C70A 3FPCA 1T8RA 1X15A 5AVOA 2EGHA 4RLQA 2EFJA 5KTOA 1BHSA 3WIDA 3C74A 4NHOA 4TSRA 4YJ3B 4FKBA 2GO1A 2XQIA 1XMSA 3EVNA 4XYLA 2PT7A 3ICOA 4Q7MB 2AOUB 1TZJA 5JDCC 3ZVKA 1C14A 1PR9A 2VEDA 2BHSA 4MUMA 1PUIA 2PO5A 1H5QA 3CN7A 4OBBA 2ECQA 3T1QA 4BO0A 2WHXA 3Q6MA 5A62A 4CL8A 2OQ2A 4PIVA 1UK7A 4RHYA 3U16A 1KA9H 1N25A 1TIPA 1AGYA 4IF4A 3BTUA 3RU7A 3I9V6 3LYUA 4KL8S 3ETGA 1PL7A 4KFUA 4IZHA 3BFPA 3RG8A 2QTHA 2CLMB 1UJMA 4E6EA 2ROQA 4WOJA 1LV8A 1YS1X 4ZOLB 1F38A 2VA8A 3VNSA 2VRNA 1LUAA 4MW5A 3TSYA 1PJLA 4Z9BA 4CM4B 2AV6A 1X74A 2YWXA 2HN9A 1YH3A 2P62A 1WPXA 3ESRA 3TSZA 3WK5A 4DY6A 3LI2A 5IXJA 4EUNA 4J0CA 3OLZA 4RLHA 3KV1A 4DHEA 4MA5A 3H04A 3KZ1E 1TPZA 2OV4A 1U28A 2JAWA 4HS4A 3AHFA 1NM5C 3DTVA 3MJ4A 4WY8A 2G0TA 3TPZA 3UCXA 4FFBB 2ZRBA 4LXXA 3NCTA 5TMBA 1ZOIA 2P68A 3QBJA 3UPDA 3FZYA 3CKYA 4Y18A 4Q1AA 4R8LA 1R8XA 5H1YA 1FE8A 4I66A 2HUPA 1KBOA 1AX9A 3DMPA 1NSFA 2R1TA 5MN4A 1SKYB 2JK0A 2C9DA 3HSSA 1ENOA 2WFMA 3NU1A 1GG2A 3KJNA 4HK4A 4EABA 3QQ5A 3VZPA 1XMXA 5IVIA 4DM4A 1OX6A 1BQ3A 3Q0TA 5TDHA 4DMRA 3BORA 4TXMA 1SOAA 4IYJA 2V7QA 3GR6A 1UQRA 3OTQA 3LX6A 1OCEA 1JEYB 3Q8KA 3CH4B 5CB4F 3W6UA 4QZVA 3HJUA 4NG5A 1VPLA 1FX1A 1XZFA 4YMSA 5EXDA 4A0SA 2PMWB 1UJ6A 3NWOA 4Q1DA 3T0IA 2CL7X 4EFLA 3EW7A 1MB0A 1VCHA 1V8BA 2UYCA 1UM8A 2QTBA 3LT2A 1GSAA 3VHQA 1GA1A 1XTTA 3JARB 5FHRA 1KK3A 4KWEA 4NZZA 1YDWA 1TAHA 2BT4A 4FHGA 4LZLA 1CD5A 2CV1A 5DLEA 2PA0A 1P0PA 2QR2A 3NHUA 3I6ZA 1JFFB 3VFDA 3ZWVA 4CMKA 2NSLA 2QL5A 4DEXA 1CK4A 2PZJA 4KFTA 1PWHA 1AMOA 1GNLA 4ZYZA 3I64A 4MRRA 1S1CA 3KUXA 5CTJA 2XMGA 1OAKA 1RQNA 3LX4A 3OT1A 1YQDA 1JLKA 4IWNA 5G4KA 1OVMA 1T1GA 1REQA 3FOZA 1RMQA 3PQFA 4IILA 5BN3B 3PPYA 1KJ8A 1RPAA 5JZOA 2JBAB 1GQFA 4MAFA 1WX1A 1EXNA 4C6RA 1DKNA 4BLQA 3D6MA 3QOXA 1OZGA 2O06A 3CX7A 1GWNA 5EWJB 1G3QA 1NVAA 1RLUA 1TJNA 4ARZB 1DRKA 3GCWA 5AH0A 2ZCUA 3DFUA 4HNHA 4MS3B 4R7ZA 3M34A 1NKTA 2JD1A 1PEYA 3ONWA 1R5BA 5FOSA 1ZPDA 3WGTA 2JFVA 4CN8A 3RTEA 3WGNA 3S3TA 1WWKA 1NVDA 1LDEA 3BD7A 4M0FA 4I1OA 4F5EA 2ZBEA 4V0NA 2JVIA 3QMVA 1QAMA 2BIFA 1N6RA 2GKOA 2WT4A 4H59A 4NTZA 5DSZA 3V8NA 3V7NA 1BE1A 3AYZB 3WSVA 1MJHA 3G1UA 8GPBA 4N40A 3P9QA 1U6JA 1J2EA 1I3CA 1PR2A 2BGIA 2QRJA 3ZUGA 2HHHB 2YS6A 1RMTA 2A9VA 2FP4A 2PYDA 2C2BA 1TKBA 4LRSB 1ZD4A 3WE7A 2PGOA 5JFOA 4KQ1A 4RWZA 2PUGA 1LBIA 1VSUA 2EP8A 2AF3C 2X9LA 3C5WP 2G63A 1WZNA 4IKEA 1Q5PA 4AZ3B 3AILA 4PSUA 2P35A 3SBOA 3UV7A 3Q9NA 1WLYA 4L4RA 2BUCA 4NV1A 2R8ZA 4EFMA 1CQZA 5LNK1 3O93A 3C3BA 4HL6A 2VF8A 1Q0UA 1K66A 2P2SA 1Q1QA 1Z45A 2ZJAA 4OQ4A 2HDHA 1MOPA 2WKRA 1VE7A 5KO2A 3HA3A 4YP7A 4DBLC 2QD2A 1T0PA 2B1JA 2EWMA 3EAGA 4O02B 5CW2A 3RYTC 1C0EA 2JI6A 2R7NA 3AVPA 4NMHA 4XPIA 3HA5A 3GJYA 1R0RE 1WD5A 2AZTA 5FI1B 2FFRA 4W9NA 2ISSD 5FNVA 1ZMTA 2X8WA 3EZYA 5IJ0B 3O0DA 3WKBA 3B3AA 1KBQA 1RIFA 1SJ9A 3E5RA 3OOEA 4W5HA 1N4AA 2PMDA 1LTKA 2ZRQA 4IDPA 3EY4A 3D3EA 1CEXA 4LCJA 1TM4E 2I99A 4KXQA 1X1RA 2W93A 4D96A 2JJYA 2VQSA 3TQIA 1HEUA 2JJ1A 2Q5LA 1ORIA 1S2MA 3NBAA 3ZX5A 5FBVB 1OROA 1M2VA 5FL7A 2QLNA 5HILA 3PHLA 5JW6A 4JEIA 5DCLA 3VOSA 4ZT3A 2ZTHA 2O1XA 1MOZA 4R84A 3FPHA 3BFJA 4BU0A 5KC9A 2F8SA 4HMQA 4QPCA 2J0SA 3OZXA 4J7CA 4R1QA 5A2GA 5K8CA 3B3QA 1O6GA 1GQQA 4LSZA 2P2NA 2DWQA 5K03A 1W9MA 4Y2QA 3UFXA 4EZBA 4BFLA 5J5CA 5LOVF 3SZ3A 4G0XA 3KO8A 4I4TB 3ORRA 1QRTA 2EFCB 5SYMA 4RCVA 4DJAA 3M1IA 2A0YA 2F1OA 4OV6B 3ZD6A 3QLTA 4OIMA 3HO1A 3PEUA 2MYPA 3DO6A 3HKDA 3JD0A 1WTAA 5E9QA 2ZRMA 3KTAA 2W0SA 3IPCA 4AF6A 4YRIA 3QMPA 5JAOA 1DDGA 5TJHA 4F71A 1E3WB 2ZJZA 1EGAA 3L0ZA 4ZEWA 4QQRA 1WS6A 3HFJA 4BMVA 5FORA 1XMJA 1RE0A 1PQUA 3RS0A 1FK8A 2VUIB 3GMSA 4XIGS 3R3VA 5T8KC 3UUGA 3MAJA 4CG1A 1BSVA 4NH0A 5EJ2A 5BN5B 1I4DD 1NI4B 2EWVA 3CMCO 4JFAA 1JSLA 2YOHA 2NW6A 4JJ8A 2JLUA 3BHMA 5EY5B 2YIJA 3ISVA 4CYMA 1RI5A 1UBTS 4RY2A 3K8ZA 3I09A 3JWIA 4CQNA 2J1LA 3H9BA 2YWDA 3TOCA 5D85A 4TOIA 1FCJA 4ZI5A 1H2HA 1N3YA 5K0SA 5F3WB 2H1LA 2O4UX 4M1OA 2WQZA 4BVJA 1HC7A 5B7GA 2PMFA 4NNPA 4IZIA 1J8QA 4HQ0A 5E6SB 4P3PA 3PHCA 4KW7A 1M3SA 2ZSBA 4CN9A 2X8LA 1RRFA 1MP0A 3NVDA 1BTOA 1JPJA 2FPGB 1LS1A 2XUOA 2CLCX 3NTOA 4IOLA 1OZFA 3KU4A 1NQXA 1FBNA 2GMWA 2LD4A 2X1VA 3NHYA 2FUKA 1FYVA 2EJTA 3O4HA 3RT9A 5IJ0A 1UMBB 2ZRHA 1Z4IA 4BQSA 1GGHA 2BZSA 2IU3A 2NZXA 2O8FA 3RFFA 2VDOB 3F2IA 1R4MB 1Z28A 1KZHA 3G3EA 2GNAA 3EVCA 2QJTA 5AW7A 1YA6A 3OX2A 5B2ZA 2DMRA 3ZE7A 3I23A 2D5LA 3IP1A 3CVVA 3C7KA 1A04A 1FFXB 1NUTA 3N0XA 3LLSA 3U3RA 5IJ9B 1UPXA 1YI8A 1LY1A 1TZMA 5C1IA 3WDSA 3CYFA 4BO4A 1HY3A 1NASA 1ECLA 2CL5A 4AJOA 4YT4A 1EG7A 5IZ4A 1TNDA 2R8EA 2WHRA 4TMKA 1XTSA 4PZ9A 2RFLA 5FX2A 4QDUA 1P4GA 5JSZA 5CX1A 4L07A 3TAUA 2H63A 2XYGA 3Q7EA 3JV7A 3WBFA 2GJKA 1VLLA 1AKRA 1QIJA 2FZ4A 2B1RA 2VF2A 1COZA 1LSSA 1DRUA 1RQXA 3A1FA 3G5LA 2DBYA 2OK8A 3JZDA 4OUKX 2M6RA 4O29A 2QAGC 3SC2B 4QBFA 2B4YA 1V8OA 4YCSA 1P75A 1RM4A 2HWKA 2XDQB 3T7KA 4ZCPA 2XXAB 1Y48E 1WHSA 1YWGO 1PWEA 4C2TA 1C1XB 1ETUA 4H77A 4UTOA 3OAAD 2E18A 3WA6A 1N0UA 3WGQA 1DBPA 1DC6A 3RK0A 3NHAA 2FGKA 1ISJA 5JXWA 3BWVA 1L5GB 5DH9A 4JI1B 1L1EA 4MCAA 3PNOA 2QZ9A 4JC5A 1XZGA 3GH3A 2RHRA 3GG9A 2X2PA 1RQ7A 1X7WA 1YS4A 1UMCB 5KSPA 3H2YA 3ER8A 4ZAVA 5F4ZA 3HVIA 4JL6A 5U9CA 1NL3A 2I80A 3ZIAA 2PX6A 1CC1S 4GX2A 3PTZA 1FRZA 1JJIA 1N5MA 1VDMA 1C9KA 5ER6A 3RVQA 3B60A 5BN3A 4KR2A 5C37A 3FDXA 1YS9A 2YC2C 3R9XB 3I0ZA 3LPDA 5BN4B 2FUG6 5B1HA 5TMEA 3HJNA 4M0LA 4KUHA 2QL9A 4KSYA 4L6AA 1EFTA 4ZVOA 2ADFA 1AGRA 4R9RA 5IDYA 2FG6C 5IN4A 4KFRA 1SBQA 1E18A 2C2KA 2CE2X 1VJ0A 4OLAA 2ZIXA 2R86A 2QJOA 3B1YA 3HQ4O 1XPRA 1R18A 3D5EA 2HXSA 2B1GA 2VK1A 1A9YA 3KELA 3VPGA 4NFSA 2AEMA 2I4OA 5GMOA 4YEDA 1S4MA 4ZP1A 5EE1A 4ZVRA 2BBTA 4M99A 3K4HA 4QYIB 3NCHA 2VQDA 1WB5A 1FVFA 1YASA 4UKDA 3RWBA 3S1AA 5GJWC 3ITDA 1E2IA 4C7XA 4QD3A 4DRYA 3NX4A 1CUEA 1WU7A 2RGBA 3GZ4A 2B1QA 1L7EA 2G08A 3IXLA 3OPXA 3HR8A 1UKBA 3RRXA 1LPPA 1RAFA 1M2NA 2EATA 3II6X 4ZPJA 1HOTA 3RIHA 2NUAA 2OGWA 2VRBA 3ORFA 3QVSA 4DHWA 5IASA 5DMXA 2VSYA 1U99A 4O4LF 1WY7A 2K4MA 2WAMA 4JP1A 4P82A 5AK4A 4TYWA 3CTMA 5DM60 4HAVA 4OQEA 4K6GA 2BKEA 1ZXXA 3HCBA 3PITA 3N2GA 3X1DA 5CR9A 4HI0E 3U39A 3B7WA 3L8FA 1NJSA 3U1TA 4K9LA 4XX1A 1WR8A 4M6WA 5BSKA 1DO8A 1ZUD1 5KI6A 3RC8A 5GY7A 3U49A 4FZVA 5HDBB 1TCBA 4YRZA 1M2EA 3KU1A 1MABB 1S96A 4LYGA 2OESA 4GKAA 5FPQA 5J2UB 4I5DA 1ORVA 3DTVB 1ISMA 1DKPA 3UIEA 1Q19A 3TTTA 4L8FA 4JJ6A 5DI9A 1WMSA 2XVAA 3ND8A 3ZWCA 3ANTA 3H18A 5IH3A 1PR0A 4KPFC 4LFCB 1ZGBA 2O1EA 3DZCA 1XLWA 3OX4A 4UBIA 3OESA 4W8GA 3BCRA 1Z8HA 4Z0HO 1Q7CA 5T4FA 1AJEA 1JKJA 3PHIA 4TT3A 2V4ZA 3ABZA 3D6AA 4ZVSA 4ZVPA 3UMCA 5L40A 3AI3A 3FYTA 1V71A 3BL8A 2X0DA 2BKUA 1HQCA 1Z68A 4I2NA 3OX3A 1U0SY 4Q24A 3SS8A 1QF6A 2E4WA 3A0RB 3SEAA 3D8SA 4LOJA 3KYBA 3GEIA 2IPAB 3E3AA 5DV9A 5K3EA 3O8LA 1SBHA 2PXXA 2J4DA 2I66A 1KXZA 3CLTD 3F6PA 3T35A 4QL3A 2V5AA 1ZWLA 2X42A 3PWKA 4KOEC 3ZU6A 3TGPA 1JDZA 1CQWA 2PWZA 4YRJA 1NWHA 2V0GA 1Z0JA 2Z08A 2YJGA 1UXHA 2G72A 2JGJA 3NTLA 4URXR 1UXIA 5EINA 1XVAA 3I3OA 1SQGA 5B1EA 3KDAA 1Q20A 1HRDA 2W6PA 5JSHA 1TT7A 3F8WA 4DUYB 1H2RS 5DNWA 3TX2A 4CTNA 1CU1A 2HMVA 5EHQA 5F35A 3ZCPA 1DARA 3NT4A 3KQYA 2MMCA 3NHWA 2WYUA 4GE3A 1EQ2A 1YQQA 3NXKA 2GCOB 4WV3A 5A9SA 5C8YF 5K3FB 3RF6A 1PZFA 2MDTA 3R3ZA 3PJGA 3F7MA 5THXA 4CGZA 4H3KB 3WS7A 1G18A 3GRFA 3BRWA 1W5AA 4J0IA 1XDBA 3B6MA 4LW8A 5TQ0A 2HF7A 3O9MA 4G81A 4L9AA 4CR7A 1GKUB 2GYWA 3RO7A 1MHTA 3HJFA 1O3YA 3AG6A 3LE8A 2EV9A 4BJ3A 1SD1A 1JA9A 5LPNA 4XIIA 3X2EA 3AM3A 3FMVA 1G2PA 2WOOA 4C3UA 4FGLA 1ULAA 1T2EA 5BURA 2WUFA 2DFDA 2P79A 3T4UA 1VSTA 3M0EA 2R6AA 3AR5A 4LDJA 4HBZA 4YXWD 5H9WA 4I50B 1IJKA 1H0KA 4DUPA 4PNEA 1PR3A 2NV6A 3OTWA 1FDWA 4MIYA 2GN4A 1QQAA 1KI7A 3FPKA 2CNNA 2GEKA 4WXRA 2JCSA 2RGNC 1A5BB 1TF2A 2V7TA 1DEAA 1KNXA 3U4HA 4Z1MA 3A6EA 5JSFA 3HWWA 3SVLA 1FQWA 1ABBA 1CEQA 1E1LA 1BH2A 1NTOA 3MRTA 2I4LA 3Q5GA 3NYWA 1LBHA 3B9BA 4O1MA 4HFMA 3EGCA 3Q87B 1DTWB 2NV0A 4RMJA 3GZJA 5DCYA 5EZQA 3V32A 4O0MA 3SXPA 4DB2A 2FZGA 4K81B 2YXDA 5AVTA 1IHPA 4BNUA 4PCAA 3R0VA 1MRNA 3U7JA 5FL3A 3V6LA 1W46A 2ORWA 1VP9A 1Z34A 1IIBA 1VSVA 1YZHA 1AM4D 2J3KA 3JVVA 4Y2TA 2NUAB 3TAHA 5AVQA 1AKQA 4RVUA 2XGMA 1PJZA 4FQ8A 2QE6A 2G4LA 3E9YA 4NENB 1X2BA 421PA 4D7AA 4C7OB 3PDIB 1Y5MA 1Z15A 1DMRA 2Y3IA 3M82A 3RYIA 4BFVA 2RD2A 1AA6A 1KQGA 4CKEA 3J80A 3CLVA 4EY8A 2B8TA 3ZGXA 2RGDA 4N0EA 3WOHA 2DYKA 5KWEA 1ODFA 1QZUA 1ZGGA 3AGQA 2EFHB 2EJWA 2RHWA 3P2IA 3UAGA 3ZOKA 4A73A 3BM5A 4AICA 5JS1A 2MR6A 3FCOA 3Q85A 1E89A 4QECA 3E6AA 1GZHB 5K8VA 2HIAA 1M2OA 3TLJA 2Q9BA 1EJ2A 1U9JA 4F9TA 1XAHA 3KOOA 1NW4A 1JKMA 5EHNA 4MEAA 3RSQA 4GYYA 4JAVC 1U2RA 2DUWA 5REQA 2V58A 1NV8A 3SYNA 3ABQB 1JHRA 3FCCA 4R31A 1OYYA 1MEEA 3GJ0A 2JA1A 5AVYA 4LJSA 1SOUA 2AXPA 3AR8A 4LXTA 4B9AA 4UE2A 3BGVA 4N03A 3ZYCA 3T7CA 3W6ZA 5KVSA 1NG9A 4FCTA 4N4AA 4KPUA 4HADA 5LBIA 4CV2A 2XA2A 4LRUA 1CRLA 2X3UA 2GSWA 2O7QA 3EH1A 1SCBA 4XTRA 4A7PA 2OD9A 2XUJA 1WMAA 1AB5A 3PGJA 2O8FB 4RYLA 2VLIA 4UOZA 1OPRA 4L27A 3ZZNA 4D9IA 1GL7A 5EHGA 1V4VA 2RMKA 2VNHA 1VRVA 3FDJA 3W2GA 1KDOA 2XXAA 4Q9DA 4URYR 4WSOA 1MPXA 2WAXA 5ALFA 5HXAA 1H1TA 3JVEA 1W7AA 1PT8A 1M1UA 1OU0A 2IELA 4OGKA 4U3JB 2PUVA 3ZDZB 2H1WA 1X0VA 3H9JA 1YRWA 7REQB 3PQCA 1H9BA 2EW8A 1I0ZA 3EOZA 3EZLA 4N3NA 1YBHA 4BPRA 1U90A 1EE1A 3E4CA 4HB3A 3KB8A 3UHAA 3TRHA 1RC1A 3BJMA 1RLJA 3W9SA 2ORYA 1ZOOA 2WF7A 3RSHA 3UXEA 3IAHA 5TQJA 1HKHA 2QTGA 4OQYA 1ZD8A 5EZYF 4F38A 2XKJE 3IUEA 3L41A 3TK1A 2RE8A 1HNXB 3A2MA 3I4LA 5FTMA 4PQFA 2ZSHA 3PDHA 3WKAA 4X3OA 3ZWXA 1NWCA 3O38A 3W3AA 2Z9DA 3HXPA 4HP8A 4C4RA 4FYVA 3WP0A 3G0DA 2YYAA 3R3SA 2OCIA 3W04A 1SGWA 2N1MA 4KOAA 1UIRA 1IYZA 2ADMA 3JTEA 3LWNA 1XTPA 5IC5A 3RUFA 1N33B 1KI3A 4P3KA 2R85A 3ESBA 3UV3A 1DJQA 3STWA 3EB9A 2HA0A 1MHPA 2BZGA 2Z09A 3CPSA 4NZ9A 3LZ6A 4GP9A 1RXVA 4ZOQI 2CGEA 1LQTA 3FKSA 3KAKA 2XB8A 4UUPA 3NGXA 2GTHA 3L1IA 1GA6A 1R6VA 2VYFA 5BQOA 4BC0A 3HRHA 1DDOA 2EX4A 2Y9MB 1C0LA 1CZKA 4KG7A 1NI5A 3MWDB 1EFPA 3DO8A 2C2YA 1PWZA 2WWIA 3ER6A 4OATA 4JXJA 2OAP1 4I5IA 4CG2A 4EW3A 2VPZA 1SXHA 3H1AA 1SPBS 4J3JA 3ICEA 1G21B