3O86A

Crystal structure of ampc beta-lactamase in complex with a sulfonamide boronic acid inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design, Synthesis, Crystal Structures, and Antimicrobial Activity of Sulfonamide Boronic Acids as beta-Lactamase Inhibitors
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Beta-lactamase
total genus 116
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3o86A00
3FWLA 5FQIA 4HBTA 2OLUA 3BLSA 3CJMA 5E43A 4ZJ3A 4JF4A 1YLZA 4DE0A 1PYYA 1IEMA 2EXBA 1RP5A 4FH4A 2XF3A 5AQBA 5EVID 2OLVA 3N8SA 1XX2A 3ISGA 4MEZA 3TG9A 4QY6A 2ZC6B 4BD0A 4DF6A 1BLHA 3DTMA 3WS2A 3O87A 3BLMA 4YFMA 4QD4A 3A3IA 3V5MA 4GZBA 4K0XA 4NETA 3QNBA 4Y0UA 3O3VA 3ZG7B 2BG1A 2WGWB 4RA7A 2A3UA 4WYYA 2UWXA 1MY8A 1W5DA 4KZ6A 1DJCA 2P9VB 3I7JA 1BLCA 1NXYA 4Y0OA 3S22A 3S4XA 1MXOA 5HAIA 2Y2NA 5F1FA 3VP2A 4IBXA 4EBNA 3ZFZA 3VP3A 3MBZA 3OPPA 4JBFA 1SKFA 5BOHA 3NDEA 3N4IA 2EFUA 3HLDA 4ZTKA 3GMWA 2WKHA 3HUMA 3G2ZA 3PBTA 2IWBA 3DWZA 2JCHA 2H10A 3A3EA 4BD1A 1BZAA 2OV5A 1E4DA 4LCMA 1IYOA 1CEFA 3W8KA 4S2JA 4JLFA 4B4ZA 1JWPA 1K6RA 3ZG0A 3N8RA 4S2NA 5CGXA 1K54A 2R9WA 1CK3A 2ZQDA 3UE0A 3IXBA 1MWSA 3SS3A 5CEBA 3S1YA 3VSLA 4EV4A 3VFFA 2EFXA 4R4SA 1QMFA 3ZNTA 1TVFA 5U47A 2WUQA 3IH8A 3UPOA 4QJGA 1EROA 4JXSA 4BJPA 1BTLA 1E3UA 4YINA 2G2WA 5FASA 3IF6A 5CGSA 1JTDA 2RL3A 5HX9A 4OPRA 3GSGA 5GHXA 1NZOA 1TDGA 3D4FA 1YM1A 4IEDA 1IYSA 3IF6C 3GVBA 2Y59A 1I2WA 2EX2A 4WELA 5DF7A 4MBKA 3BFGA 1TEMA 5F82A 3P98A 2Y2HA 2X02A 1K4FA 1MKIA 1ZG6A 1KGEA 2HDUA 3Q07A 4PM5A 4JXVA 4PM7A 3IWQA 3VP4A 1XA1A 5JYPA 3FKWA 3G32A 4JF6A 1U60A 4ZJ2A 2Q9MA 5L2FA 2XFSA 2C5WB 4F94A 3HUNA 1I5QA 4S2KA 1MWTA 2DNSA 3OC2A 3HLGA 3PBSA 4Y7PA 3IT9A 2ZC7A 3PBQA 3W4PA 5TR7A 5DF8A 3BEBA 3GR2A 4FH2A 1LL5A 2P74A 3IXDA 5F1GA 5FQ9A 2PU2A 2Y2PA 3TSGA 3WS4A 4KZBA 1FCMA 4JPMA 4FSFA 1LI0A 1K4EA 3AGEA 5CHUA 3UO9A 4KENB 5A93A 2FFFB 3G35A 3G31A 2VGKA 2BLSA 4WEKA 1GHIA 3VSKA 5M18A 1K25A 4KG5A 3BECA 5EPHA 3M6HA 3FKVA 4UA6A 1GHPA 3PBRA 1JVJA 4O7DA 1BSGA 3C7UA 4PPRA 3Q7VA 4S2NC 4X56A 3N8LA 2J8YA 3WS1A 2HP6A 1E3UD 4MBHA 5CGWA 4E3NA 1MPLA 5IHVA 4KG6A 1IYQA 3QHYA 3EQUA 4BL3A 5HAQA 4R1GA 2WADA 2XQZA 4OH0A 4LV3A 2HP9A 4KQRA 5D3OA 3UDIA 1PZPA 3VFHA 5HARA 3VOZA 2V2FF 1JWZA 4U0XA 1YLYA 2ZQ9A 2VGJA 3WRTA 3ZCZA 5AQ7A 1ES3A 3ZVTA 3C4PA 3LY4A 5DF9A 2Z2MB 4GB7A 2WK0A 1YQSA 3WRZA 3HLWA 4XXRA 1YT4A 1NY0A 4D2OA 2GDNA 3RXWA 3ZNYA 3SH9A 4CPKA 1PW1A 1N4OA 1XPBA 2JE5A 4WZ4A 3GRJA 3ZG9B 2OSUA 3OCNA 2HDRA 1ALQA 1PWGA 2Y2MA 3QNCA 3MZFA 1KE4A 5FQJA 2ZQ7A 5KMWA 5EVLA 3UPPA 4S2IA 4U3TA 4WMCA 5EE8A 5CTNA 2G2UA 2H5SA 1Z6FA 3O88A 2Y2GA 3IXHA 4OQIA 4EUZA 2ZC5B 3OPLA 5JYOA 4B88A 1GA0A 4KG2A 1FOFA 1ZKJA 3GV9A 3M6BA 1WYBA 4KZ9A 4R4RA 3EQVA 5GLBA 1QMEA 4S2MA 5E2HA 1BLPA 3UDXA 4ZJ1A 4Q8IA 3DWKA 1H8YA 3M2JA 2E8IA 1KE0A 5CEDA 3NY4A 2WGIA 2HDSA 2R9XA 1DJAA 3E2LA 3G34A 4LENA 4GKUA 1GHMA 1G6AA 3NCKA 3BRMA 1ZG4A 4N1XA 4K91A 2EX8A 4CJNA 1I2SA 3BFEA 3NI9A 3ZG8B 4E6XA 1LHYA 4MNRA 5KSCA 4E3KA 3ZHHA 2WZXA 1IKIA 5G18A 4DDSA 3V39A 4BENA 1XGJA 2J9PA 4KZ4A 2EX6A 3AGFA 1W79A 1K57C 3N6IA 1H8ZA 4WZ5C 4RX3A 1MWRA 3PAEA 1SCWA 3CZDA 3N7WA 1HD8A 2ZJ9A 3LCEA 2ZM8A 3A3JA 1K56D 1L2SA 1NJ4A 4RVAA 2J9OA 1XXMA 2ZC3B 3CG5A 3G2YA 4HBUA 4P85A 5TGFA 5HW3A 1IELA 4A5RA 3MFDA 2V20A 2PBYA 2ZLYA 3ZGAB 3HLCA 1FSYA 1Q2QA 3HLEA 5FAPA 4OONA 4S2OA 5GL9A 1ESUA 5KZHA 1JTGA 1ERMA 1PI5A 1IKGA 4PM8A 2ZM2A 4N92A 4K0WA 4OOMA 5FSRA 1YLWA 1W8QA 3HLBA 2XK1A 3LO7A 4UA9A 2XH9A 1L0FA 1FQGA 1G68A 4WBGA 1Y54A 2Y2LA 4LV1A 4N1HA 3SS4A 3VOYA 4EQIA 2XFTA 1KE3A 4R3JA 1RGYA 2H0YA 3HUOA 5HAPA 4OKPA 4OOLA 4P6BA 4KZ5A 2V1ZA 3PBOA 1HTZA 1RGZA 1XP4A 3UPNA 3PTEA 1ES5A 5EVIA 5E2FA 4E3OA 2ZM0A 3OZHA 4LV0A 3IH9A 5GHZA 4EWFA 5EVIC 4Z9QA 1GA9A 1KVLA 1EI5A 3FV7A 5CRFA 3V3SA 3LY3A 4OP8A 4DRTA 4OQHA 1YLPA 3Q1FA 4HEFA 5M1AA 4OPYA 3IQAA 3IF6B 2ZMAA 5A92A 3O86A 3IXGA 2ZQCA 2B5RA 4JXWA 2X01A 4DKIA 4E3JA 1S6RA 1XA7A 4FCFA 4IVKA 2XGNA 5DTKA 1K55C 3UE3A 3ITAA 5TFQA 1SDNA 4UA7A 4MBFA 4GN2A 4P87A 3UY6A 1IYPA 1WE4A 2XR0A 1HZOA 3VP1A 1NYYA 1CI9A 2XEPA 4JF5A 3MZEA 1ESIA 2WAFA 2ZQAA 4GDNA 3JYIA 3PBNA 5GLAA 4E3MA 2DCFA 4EBPA 1GCEA 4QY5A 3Q7VB 4U0TA 4WZ5A 4X69A 3MXSA 1CI8A 3E2KA 4ID4A 2QMIA 1ES2A 1Q2PA 4LCLA 1LL9A 4E6WA 2Q9NA 5HL1A 4BLMA 4N9LA 4OPQA 4UHUA 3ZG5A 1PWDA 3VMAA 1J9MA 3PAGA 4X68A 2IWCA 3BM6A 4JXGA 3ZDJA 1AXBA 3Q81A 1W8YA 3NC8A 4OVDA 3MXRA 4ZDXA 1YMXA 3BYDA 3Q82A 4PM6A 1M6KA 1C3BA 3BFCA 3NIAA 4X53A 3RJUA 1LLBA 1RCJA 5F83A 1KGGA 2QPNA 2WGWA 2X71A 4RYEA 4DXBA 3UN7A 5I94A 1ERQA 1VQQA 5FQQA 1L0GA 2P9VA 4PM9A 3VP0A 3HLFA 1YLJA 1K56A 3UDFA 4KQOA 4C3QA 1K57A 2WGVA 5CERA 3IHBA 3IWOA 4OOYA 2EX9A 1M40A 3ITBA 4GOGA 3V50A 4GDBA 5CHMA 1K38A 1DJBA 4GNUA 2Y2IA 3SH8A 2ZD8A 5AQAA 3ZVWA 4OLDA 3SH7A 3UE1A 4BL2A 5CECA 4B4XA 2FFYA 1K54C 2Y4AA 5A91A 1VM1A 4L0LA 1BULA 3HVFA 5E2EA 2JC7A 5FI7A 5FI2A 3SOIA 1KDSA 1NZUA 5EUAA 1L0DA 1HVBA 4HESA 1OMEA 2DRWA 3WS0A 3G4PA 1MWUA 3W4OA 3NDGA 2H0TA 5FDHA 3IWIA 2HDQA 3OPRA 1KGFA 3WS5A 1PI4A 3LEZA 3HREA 2HP5A 4R23A 1XGIA 4Y0TA 1FR6A 1MBLA 1NRFA 1H5XA 4KZ7A 3FZCA 4X6TA 1PIOA 1KDWA 1SDEA 1KVMA 4DDYA 4DXCA 1FSWA 4XUZA 5CXWA 3W4QA 4R0QA 2WYXA 3GTCA 5GLCA 4OQGA 5FQMA 4OPZA 3SS5A 3Q7ZA 1ZC2A 4KQQA 1W7FA 4WMCD 3HL9A 3NBLA 2C6WB 1E25A 1ONGA 4KZ3A 2CC1A 1LI9A 5EECA 1WYCA 4WEJA 1ES4A 2HPBA 1FCNA 4S2PA 3CMZA 4QB8A 5EOEA 1O7EA 1FCOA 4GD8A 2PU4A 1JWVA 4JKTA 4KZAA 4E3IA 1XKZA 2EXAA 2Y2JA 4GD6A 2Y91A 3DW0A 4IBRA 1DY6A 5E2GA 4P0MA 3G30A 4WM9A 5HFOA 4KZ8A 3A3DA 4ZAMA 4MLLA 4QHCA 2Z2LB 1EWZA 5GHYA 4XUXA 1YMSA 2XD1A 3HBRA 4NK3A 4OP5A 4EBLA 3FYZA 4LV2A 4M3KA 1PZOA 4DE2A 3BFFA 2I72A 1K6SA 2XDMA 4QU3A 4S2LA 2JBFA 2ZC4B 3UNWA 3OCLA 2ZQ8A 2RCXA 3V3RA 2J7VA 5GLDA 1BUEA 1ONHA 4OLGA 4BQMA 1S0WA 3GQZA 5KSHA 3C7VA 1K55A 1L0EA 3BFDA 1BLSA 5FQKA 2WKIA 2WZZA 3MKFA 1BT5A 3IF5A 5EVIB 2IWDA 4R3BA 3B3XA 4PMAA 2A49A 5FAOA 3OPHA 2Y55A 3TOIA 4UAAA 4DE1A 2Y2QA 4N9KA 2XLNA 3C4OA 1N9BA 5CHJA 3MZDA 5M19A 3IHAA 5FI6A 5J8XA 3A3FA 3M2KA 2Y2KA 5FATA 5A90A 1CEGA 1PWCA 5FA7A 4OQ0A 3C5AA 2WKEA 3MKEA 4C75A 4IVIA 1NYMA 2WAEA 5AQ9A 1O07A 4ZBEA 2Y2OA 3WWXA 1TDLA 4E3LA 5FAQA 1YLTA 3AGDA 4H8RA 1FR1A 5DTSA 5EOOA 4DE3A 4RX2A 5DTTA 1SHVA 4X55A 1PW8A 2XD5A 3P09A 5CTMA 4FD8A 5DVAA 3RXXA 2QZ6A 4C6YA
chains in the Genus database with same CATH superfamily
4HBTA 2V1BA 5CX7A 4DE0A 1BYWA 1S1ZA 1RP5A 2XF3A 5AQBA 4BD0A 2K31A 4YFMA 3A3IA 5G4YA 3E0YA 1KOUA 4GZBA 4NETA 3NOPC 1Y4OA 3MMHA 4RA7A 1G6OA 4KZ6A 5A8BA 1NXYA 4IBXA 4NG2A 4EBNA 3IX8A 3ZFZA 2EFUA 2WKHA 3G2ZA 3ICYA 3T4QA 5EV0A 2OV5A 3W8KA 1VETB 3KX0X 1JWPA 3N8RA 2V8FA 4GS9A 4HJ3A 1YPRA 1K54A 1MWSA 3SS3A 2EFXA 3ZNTA 3O5YA 4HH2A 2O0YA 1SKOB 3IH8A 3LIFA 4BJPA 1BTLA 3KO6A 3T50A 1JTDA 5AVEA 1YM1A 4Y2FA 3BFGA 3P98A 1ZG6A 1MKIA 3R7WB 3BW6A 3Q07A 3BJNA 4PM7A 3IWQA 3VP4A 2M7UA 4JF6A 5HPIA 5HL6A 3HLGA 3PBSA 3F1PA 3IT9A 3MQOA 3PBQA 5TR7A 5DF8A 3GR2A 1F5MA 4BBVA 3IXDA 1IOUA 3TSGA 2FFFB 1T1CA 2VGKA 3G31A 4PHTA 4WEKA 4YOFA 4UA6A 2L1MA 4I5SA 4X25A 2XA7M 3N8LA 5K5BA 2HP6A 4E3NA 5IHVA 3QHYA 1D06A 3EQUA 5HAQA 4HI4A 4OH0A 4KQRA 5FDSA 1YLYA 2VGJA 3ZVTA 1ES3A 2QHKA 2O9BA 2WK0A 3KSGA 4G3KA 2GDNA 3ZNYA 3SH9A 4L9FA 4CPKA 5LBRA 1XPBA 4WZ4A 3GRJA 1V9YA 5KMWA 3MZFA 2ZQ7A 1UWPX 4S2IA 5EE8A 5CTNA 3U2AA 2H5SA 1Z6FA 3O88A 1TS6A 3IXHA 4EUZA 2ZC5B 5JYOA 3A0RA 4KG2A 1FOFA 3M6BA 1WYBA 4KZ9A 2D02A 3EQVA 4LRYC 2DMWA 5DKLA 1BLPA 3KYZA 2QJ5A 1AWIA 1KE0A 4JGOA 2R9XA 4LENA 3LEQA 4GHIB 4N1XA 3EEHA 2JKGA 3JVVA 1G28A 2VJWA 3V39A 1NLYA 1XGJA 2EX6A 1W79A 2L0WA 4HOIA 2PRFA 2EA9A 1MWRA 1WA9A 3PAEA 4B9OA 3CZDA 1HD8A 2ZM8A 2GZAA 1G5UA 1NJ4A 4RVAA 4HBUA 5HW3A 1SKOA 1NWZA 1PNEA 3ZGAB 2XROA 4S2OA 3NJAA 2MJ6A 2ZM2A 3MR0A 4I3JA 3BQ8A 4UA9A 4EQIA 4LV1A 3SS4A 1P9WA 3VOYA 4EEUA 3HUOA 4OKPA 3BQAA 4DMZA 1GSVA 4M4XA 3UPNA 3PTEA 1S66L 2JN7A 5GHZA 1ODVA 3DBAA 5HZHA 3QP4A 1EI5A 4OQHA 1YLPA 4HEFA 4OPYA 2ZMAA 4DN0A 2ZQCA 4JXWA 4E3JA 1S6RA 5DTKA 2PR5A 1K55C 1MKMA 4GN2A 2XR0A 1HZOA 3MZEA 2WAFA 4BBUA 1XJ6A 4I3AA 3MXSA 1CI8A 1VETA 4ID4A 1ES2A 4LCLA 4E6WA 4GS9B 4BLMA 4UHUA 3ZG5A 2W3HA 3VMAA 3PAGA 3BM6A 2WKQA 5TBMB 3MXRA 4ZDXA 3MS6A 3D3OA 4QWOA 1GSXA 3HJIA 1F9IA 3BFCA 2WKPA 3NIAA 4X53A 2BTFP 2O99A 3UN7A 1UGUA 5J3WA 1VQQA 5FQQA 2P9VA 2I9VA 2VGLS 3HLFA 1K56A 1VEUB 3R7WA 1OJGA 1M40A 4CLCA 4CLCE 2VKSA 4GNUA 2Y2IA 1K54C 2Y4AA 5A91A 5E2EA 2IA2A 3SOIA 1NZUA 2XSSA 4HESA 2DRWA 2UV0E 2ZOHA 2H0TA 5FDHA 1PI4A 3LEZA 4R23A 2O9AA 1KVMA 2W3EA 4JGRA 4DDYA 3F1NA 3GDIA 2H28A 1ZC2A 3LIAA 3UB7A 4WMCD 3HL9A 3CITA 4KZ3A 3QP6A 1XFNA 1WYCA 1ES4A 3CMZA 3B42A 4GD8A 2PU4A 4KZAA 4E3IA 1XKZA 2YKFA 3T4TA 4WM9A 5HFOA 1LSXA 4MLLA 4QHCA 3E4OA 4XUXA 4NK3A 4YWZA 4LV2A 4YNRA 5DJUA 3H9WA 1K6SA 3PXPA 4QU3A 5DJTA 1V9ZA 4S2LA 2GX5A 3V3RA 1BUEA 3C7VA 3BFDA 3MKFA 1BT5A 3DAVA 5EVIB 4DE1A 2Y2QA 4N9KA 3MZDA 5A90A 4Y17A 4Q0JA 4IVIA 4IUHA 5FAQA 1YLTA 4DE3A 5F69A 1SHVA 5AJGA 2XD5A 4FD8A 3FWLA 2OLUA 1PYYA 2EXBA 3KYQA 2V1AA 5EVID 3T4JA 2OLVA 3N8SA 3ISGA 4EQ1A 1CJFA 4QY6A 1CQAA 3O87A 2W3GA 4QD4A 2B95A 2A24A 2V9AA 2WGWB 4WYYA 2UWXA 1MY8A 2P9VB 3S4XA 1XFQA 1MXOA 5F1FA 4LRZE 1Z09A 2B18A 3MBZA 4ETXA 1SKFA 5BOHA 3HLDA 4ZTKA 3GMWA 3T1SA 3H7WB 3A3EA 3A0SA 1IYOA 1CEFA 3OOVA 4JLFA 4HQAA 2JKFA 5CGXA 4EERA 2R9WA 2FZ0A 5CEBA 3S1YA 3TJZC 1QMFA 3CWFA 1EROA 1E3UA 4YINA 5HX9A 4OPRA 2Z6CA 4EETB 3GSGA 1NZOA 3D4FA 2ACGA 4EUVA 3KSHA 2EX2A 2HV1A 3F1OB 4MBKA 1NLZA 5F82A 1EW0A 3VE4A 4R3AA 4PKYA 1K4FA 1KGEA 4PM5A 1U60A 2Q9MA 5L2FA 2C5WB 3HUNA 3LFVA 3TW8A 2XA7S 3OC2A 3OBFA 5DKKA 1TD5A 3BEBA 3P7NA 4FH2A 4X1MA 2P74A 2PU2A 3BY9A 3UO9A 4KENB 3G35A 5F6AA 2BLSA 1W63M 1GHIA 2J80A 4KG5A 5EPHA 4F3LB 3JPUA 3C2WA 1GSWA 3FKVA 1OT6A 1JVJA 3C7UA 4CLCB 3NHQA 4S2NC 2OWJA 3WS1A 1E3UD 1IYQA 3IS2A 2VV7A 5D3OA 3UDIA 1PZPA 3VFHA 1JWZA 2JKTI 2J3TD 2JKRI 2VX8A 1K0KA 2YKHA 3ZCZA 3WRTA 5AQ7A 3C4PA 4GB7A 3WRZA 3HLWA 4XXRA 2B02A 1NY0A 4KUOA 2Q0OA 2OSUA 5TJJA 2HDRA 2Y2MA 1PWGA 5FQJA 3HJKA 3QP5A 2INWA 2HJ9C 1ZKJA 4S2MA 5E2HA 3DWKA 1H8YA 4JGQA 4NXEA 3M2JA 5CEDA 2HGVA 3E98A 4IJGA 3EGXC 1VHMA 4GKUA 3BRMA 4K91A 3LR3A 5KSCA 4E3KA 3ZHHA 1IKIA 3AGFA 1K57C 5L09A 3EEAA 3N7WA 2ZJ9A 3A3JA 2V0UA 2ZC3B 3MFDA 4FOFA 5GL9A 3F1OA 4PM8A 4N92A 4HHDA 4K0WA 4OOMA 5FSRA 1YLWA 2BASA 3PHYA 2VGLM 3HLBA 1FQGA 1D1JA 1Y54A 2Y2LA 1P0ZA 4R3JA 2H0YA 5HAPA 4OOLA 5KIZA 3PBOA 1XP4A 2PHYA 5E2FA 2ZM0A 2KX6A 3IH9A 1GA9A 3FV7A 5CRFA 3V3SA 3LY3A 4DRTA 5M1AA 3E4PA 3IF6B 2B5RA 2X01A 4DKIA 1OTIA 4IVKA 2XGNA 4K08A 1SDNA 4MBFA 4P87A 4F3LA 1WE4A 3VP1A 1NYYA 2XEPA 1ESIA 2ZQAA 3PBNA 4O0PA 3Q7VB 4WZ5A 2VV8A 4D60A 4N9LA 4OPQA 4Y5FA 5L10A 4X68A 2IWCA 4JXGA 3NC8A 1YMXA 3Q82A 1M6KA 1C3BA 1RCJA 1NRJA 2QPNA 2X71A 1L0GA 3ULFA 4C3QA 1K57A 2WGVA 5CERA 3IWOA 2EX9A 3NULA 3RFBA 3CUEC 3PYPA 3SH8A 3ZVWA 2G7UA 3SH7A 5CECA 3HVFA 3MSHA 5EUAA 3VE3A 1HVBA 3RH8B 4MMNA 4PKYG 3G4PA 2PYPA 1MWUA 3NDGA 3VOLA 4I39A 5FEGA 1KGFA 3WS5A 3HREA 1XGIA 1MBLA 1J3WA 1KDWA 4MCWA 3T4KA 5FEFA 4WL9A 2V0WA 1S4RA 5FQMA 1E25A 1PFLA 4HJ6A 4QB8A 5EM0A 4JKTA 3H82A 4GD6A 1YSPA 4IHQA 4UQIS 2Y91A 5E2GA 4IBRA 4P0MA 1YSQA 2NUTC 1OTDA 3HBRA 2XRNA 4NXGA 4M3KA 1PZOA 4LGWA 3K3CA 4DE2A 4GHIA 1TS0A 2XDMA 3LUQA 2ZC4B 4GW9A 3OCLA 2ZQ8A 4DJ3A 2J7VA 5GLDA 1K55A 1BLSA 3DTEA 2WKIA 3UMEA 4PMAA 3TOIA 5J7EA 3OPHA 2Y55A 4UAAA 3MQ0A 1N9BA 4R38A 2ZL1A 2Y8HA 3IHAA 5HWVA 2Y2KA 1PWCA 2HF6A 3C5AA 4C75A 1NYMA 3CPTA 2Y2OA 3WWXA 3AGDA 5EOOA 1ZHHB 4LRXC 3P09A 5DVAA 2QZ6A 4C6YA 5FQIA 4EEPA 5E43A 4ZJ3A 4JF4A 2JHEA 1IEMA 3DTIA 4HP9A 4IUKA 1XX2A 3TG9A 1P9RA 1BLHA 3BLMA 3B33A 2JKRM 2VLGA 3V5MA 4K0XA 3B47A 2BG1A 3ZG7B 2A3UA 5FL3A 1DJCA 3I7JA 1BLCA 2OOLA 3EWKA 3S22A 4ARZA 5AVFA 2Y2NA 1ACFA 3VP3A 3OPPA 3NDEA 3N4IA 3HUMA 3PBTA 2IWBA 1F98A 4S2JA 1XJ3A 3ZG0A 4S2NA 2PD7A 3UE0A 4HJ4A 3IXBA 3VSLA 4EV4A 4R4SA 3T1XA 2WUQA 5G4ZA 4JXSA 4EESA 4NXFA 2G2WA 3IF6A 2RL3A 2PT7A 1T18A 4IEDA 1IYSA 2Y59A 5DF7A 1TEMA 5EVEA 1JNUA 2Y2HA 2HDUA 1F2KA 1STZA 4JXVA 1XA1A 3G32A 5F68A 1I5QA 4S2KA 1MWTA 2DNSA 3S7NA 2KDKA 2ZC7A 2A2LA 5F1GA 1H0MA 2Y2PA 4Q0HA 2PD8A 4JPMA 4FSFA 1K4EA 3AGEA 5CHUA 1T1BA 3FC7A 3VSKA 3BECA 4XT2B 1OT9A 2Z6DA 3OLOA 3QP2A 3PBRA 1BSGA 5HSQA 4PPRA 4QPRA 3UB9A 1OJ5A 2J8YA 4MBHA 5CGWA 2OWHA 4KG6A 4BL3A 4R1GA 4LV3A 1W63Q 2HP9A 4O8GA 4BBTA 3T4OA 5HARA 2VEAA 3VOZA 4HP4A 4U0XA 3TE8A 5TBMA 3LIBA 2ZQ9A 3CPTB 3LY4A 1PRQA 1YQSA 1YT4A 3LGOA 3RXWA 1PW1A 1N4OA 2PBDP 3C38A 4Z1WA 2JE5A 2L4RA 3OCNA 4BMWA 1KE4A 5EVLA 3UPPA 4U3TA 2G2UA 4OQIA 4EU0A 5IS1A 2PAVP 3UE6A 4B88A 1GA0A 3UDXA 1N9OA 2WGIA 2HDSA 1DJAA 4CJNA 3BFEA 3C30A 4MNRA 2WZXA 5HDSA 1H3QA 3LICA 4KZ4A 4B93A 3N6IA 3TRCA 4JGPA 1H8ZA 4WZ5C 4RX3A 1CF0A 3SW1A 1SCWA 2CMNA 1L2SA 2J9OA 1XXMA 2ZL1B 1IELA 4MN6A 1ZTUA 3HLCA 1FSYA 5FAPA 4OONA 5KZHA 3W2ZA 1ERMA 4KUKA 3LR4A 1IKGA 2W1RA 3LO7A 2D01A 1L0FA 2XH9A 1G68A 4G3WA 4WLAA 3CLOA 1KE3A 4CLCC 3MF0A 3IBJA 4P6BA 4KZ5A 2V1ZA 2HJEA 1RGZA 3LI8A 5EVIA 4E3OA 1LSWA 4Z9QA 5HD3A 4KQDA 3BY8A 1OTAA 3EGDC 1XA7A 1LT0A 5TFQA 4UA7A 4BWIA 4GDNA 5GLAA 4EBPA 4U0TA 4FUWA 4X69A 3E2KA 2QMIA 1Q2PA 1LL9A 4WN5A 5HL1A 2W3DA 4GJ4A 1J9MA 4LPZA 4MN7A 3ZDJA 1AXBA 5HDCA 4OVDA 3G6OA 3RJUA 1LLBA 5F83A 1KGGA 2WGWA 4DXBA 3JVUA 2P7JA 3LR0A 4PM9A 3VP0A 1OPXA 1YLJA 3UDFA 2OAP1 3IHBA 2ZMVA 4DJ2A 3ZQ5A 4LFUA 1HLUP 3ZYTA 1K38A 2W0NA 2K2NA 2QJ7A 2QYBA 4BL2A 1S67L 3UE1A 3UMDA 5L8MA 3S7QA 1VM1A 4L0LA 1BULA 4Y3IA 3IS2B 5FI2A 1KDSA 3A0VA 3WS0A 1OMEA 3W4OA 3CAXA 2HDQA 3D72A 5HWTA 5L07A 4Y0TA 1H5XA 4X6TA 1DRMA 1PIOA 1SDEA 4DXCA 1FSWA 4XT2A 3QP8A 4MN5A 5GLCA 2W3FA 4OQGA 4KQQA 4GCZA 1W7FA 3NBLA 2C6WB 4L9GA 1ONGA 5EECA 4WEJA 5EOEA 1O7EA 1JWVA 2Y2JA 2M7VA 1OTEA 4KZ8A 3A3DA 3NECA 2Z2LB 1EWZA 1YMSA 3GECA 4OP5A 4EBLA 1VB6A 3FYZA 3KYEA 4HH3A 3BFFA 3T1RA 1S1YA 2RCXA 1ONHA 4OLGA 4BQMA 1S0WA 1L0EA 2GNXA 3BWLA 5FQKA 2WZZA 5F5YA 2IWDA 3UB6A 4R3BA 1T19A 3B3XA 4UEYA 1TS8A 5FAOA 3C4OA 5M19A 2E8JA 5FA7A 1IFQA 2WKEA 2WAEA 1O07A 2JKTM 1TDLA 4E3LA 5DFXA 4H8RA 5DTTA 3R4KA 1PW8A 5CTMA 3BLSA 3CJMA 2NUPC 1YLZA 4ZRRA 4FH4A 4MEZA 3C8CA 2ZC6B 4DF6A 3DTMA 3WS2A 3LR5A 3MQQA 3QNBA 4Y0UA 3O3VA 1W5DA 4Y0OA 5HAIA 3VP2A 1VEUA 4JBFA 4CQHA 3DWZA 2JCHA 2H10A 1MZUA 4BD1A 1BZAA 5HWWA 1XJ4A 1E4DA 4LCMA 3V67A 4B4ZA 1K6RA 3NOUC 2ZQDA 1CK3A 2M1CA 3VFFA 4H6JB 1TVFA 4PAUA 5U47A 3UPOA 4QJGA 4EW7A 4II7A 2VA0A 5FASA 5CGSA 4LLOB 5GHXA 1TDGA 2Y79A 3IF6C 4I3IA 3GVBA 1I2WA 4WELA 4RQ9A 3FPWA 4WF0A 3F1NB 2X02A 2PR6A 1FIKA 5JYPA 3FKWA 4ZJ2A 2XFSA 4F94A 3MJQA 2K7SA 3PR6A 3UB5P 1N9NA 4R6LA 4Y7PA 3W4PA 3UB8A 1XJ2A 5J4EA 1LL5A 5FQ9A 1YKDA 3KSFA 4KZBA 3WS4A 1FCMA 1LI0A 2OAQ1 5A93A 3CI6A 4ETZA 3FG8A 1DP9A 5M18A 1K25A 2J3TC 3M6HA 1GHPA 4O7DA 3Q7VA 4X56A 4HIAA 2VZWA 1MPLA 3T4LA 2WADA 2XQZA 3IX4A 2V2FF 2AVXA 1OTBA 5C5KA 5DF9A 2Z2MB 2EWVA 2QWSA 2KLIA 4D2OA 3ZG9B 2J3WA 2VK3A 3VV4A 1ALQA 3QNCA 1Y28A 4WMCA 3LIEA 2Y2GA 3OPLA 4P6ZS 5IU1A 3GV9A 4NXBA 4R4RA 4ME4A 5GLBA 1QMEA 2A24B 1YAXA 3IX3A 3CUEA 4ZJ1A 4Q8IA 4HY8A 2E8IA 3NY4A 4Y15A 2V8CA 3DTKA 3E2LA 3G34A 4HNBA 1GHMA 1G6AA 3NCKA 1ZG4A 1P97A 2EX8A 1I2SA 1X0OA 3NI9A 3ZG8B 4E6XA 1LHYA 4I38A 5G18A 4DDSA 3RTYA 5HPFA 4BENA 2J9PA 5EFWA 3T12B 3L7HA 3S7PA 2LB9A 2PYRA 1FILA 3LCEA 1K56D 3H82B 1SZVA 3CG5A 5TGFA 3G2YA 4P85A 4A5RA 2V20A 2PBYA 2ZLYA 3SZTA 3LI9A 1Q2QA 3HLEA 1ESUA 1JTGA 1L3LA 1PI5A 2PDRA 4ARZB 4NKPA 4GLQA 1W8QA 4X1LA 2XK1A 2ZOIA 4E04A 4WBGA 4N1HA 1MC0A 2XFTA 4NEED 4FTXA 3NOTC 5DFYA 1RGYA 1D7EA 1HTZA 1ES5A 3OZHA 4LV0A 1T1AA 4EWFA 5EVIC 1KVLA 4Q0IA 1DP8A 4OP8A 3IBRA 3Q1FA 2P08A 3IQAA 3E4QA 5A92A 3O86A 3IXGA 4FCFA 3UE3A 3ITAA 2O9CA 3UY6A 1A0KA 2W1TB 1IYPA 1LSVA 4JF5A 1CI9A 4UQIM 3JYIA 3H7WA 4E3MA 2DCFA 1GCEA 4QY5A 4L9EA 4MDZA 3QP1A 4CLCD 2Q9NA 3F1PB 1PWDA 4H6JA 3Q81A 2WKRA 1W8YA 3D9YA 3BYDA 3EOIA 4PM6A 5MC7A 2QKPA 4RYEA 5I94A 3MFXA 1ERQA 3FPVA 3LIDA 4KQOA 4OOYA 2FH5A 3ITBA 4GOGA 3V50A 4GDBA 5CHMA 5IT5A 1DJBA 3U4LP 2ZD8A 5AQAA 4OLDA 4B4XA 2FFYA 1TF1A 2JC7A 5FI7A 2KOIA 1L0DA 2P04A 3HCYA 4R70A 1DP6A 1UWNX 3IWIA 3OPRA 2HP5A 1FR6A 1NRFA 3LYXA 4KZ7A 3FZCA 3K3DA 4XUZA 5CXWA 3W4QA 3KSIA 4R0QA 2WYXA 3GTCA 4OPZA 3SS5A 1LL8A 3Q7ZA 2CC1A 1LI9A 1N9LA 2HPBA 1FCNA 4S2PA 4G3VA 1FCOA 4P6ZM 5I5LA 2EXAA 3CHWP 3L9KA 3DW0A 1DY6A 3G30A 3MXQA 4ZAMA 2LB5A 5GHYA 5HDDA 2EWWA 2XD1A 5EM1A 4Y13A 2I72A 4O01A 2JBFA 3UNWA 3T1QB 5HD5A 3GQZA 5KSHA 2GJ3A 3IF5A 2ZMFA 2A49A 2XLNA 1S4SA 3S7OA 5CHJA 3P01A 4ESPA 5FI6A 5J8XA 3A3FA 3M2KA 5FATA 3T4SA 1CEGA 1H8MA 4OQ0A 2VV6A 3MKEA 2R78A 1TS7A 5AQ9A 4ZBEA 2W27A 3K2NA 1FR1A 2HZ5A 5DTSA 2W1TA 4AFIA 4EXOA 4RX2A 4WUJA 4X55A 3RXXA 2ZBBA
chains in the Genus database with same CATH topology
3FWLA 5FQIA 4HBTA 2OLUA 3BLSA 3CJMA 5E43A 4ZJ3A 4JF4A 1YLZA 4DE0A 1PYYA 1IEMA 2EXBA 1RP5A 4FH4A 2XF3A 5AQBA 5EVID 2OLVA 3N8SA 1XX2A 3ISGA 4MEZA 3TG9A 4QY6A 2ZC6B 4BD0A 4DF6A 1BLHA 3DTMA 3WS2A 3O87A 3BLMA 4YFMA 4QD4A 3A3IA 3V5MA 4GZBA 4K0XA 4NETA 3QNBA 4Y0UA 3O3VA 3ZG7B 2BG1A 2WGWB 4RA7A 2A3UA 4WYYA 2UWXA 1MY8A 1W5DA 4KZ6A 1DJCA 2P9VB 3I7JA 1BLCA 1NXYA 4Y0OA 3S22A 3S4XA 1MXOA 5HAIA 2Y2NA 5F1FA 3VP2A 4IBXA 4EBNA 3ZFZA 3VP3A 3MBZA 3OPPA 4JBFA 1SKFA 5BOHA 3NDEA 3N4IA 2EFUA 3HLDA 4ZTKA 3GMWA 2WKHA 3HUMA 3G2ZA 3PBTA 2IWBA 3DWZA 2JCHA 2H10A 3A3EA 4BD1A 1BZAA 2OV5A 1E4DA 4LCMA 1IYOA 1CEFA 3W8KA 4S2JA 4JLFA 4B4ZA 1JWPA 1K6RA 3ZG0A 3N8RA 4S2NA 5CGXA 1K54A 2R9WA 1CK3A 2ZQDA 3UE0A 3IXBA 1MWSA 3SS3A 5CEBA 3S1YA 3VSLA 4EV4A 3VFFA 2EFXA 4R4SA 1QMFA 3ZNTA 1TVFA 5U47A 2WUQA 3IH8A 3UPOA 4QJGA 1EROA 4JXSA 4BJPA 1BTLA 1E3UA 4YINA 2G2WA 5FASA 3IF6A 5CGSA 1JTDA 2RL3A 5HX9A 4OPRA 3GSGA 5GHXA 1NZOA 1TDGA 3D4FA 1YM1A 4IEDA 1IYSA 3IF6C 3GVBA 2Y59A 1I2WA 2EX2A 4WELA 5DF7A 4MBKA 3BFGA 1TEMA 5F82A 3P98A 2Y2HA 2X02A 1K4FA 1MKIA 1ZG6A 1KGEA 2HDUA 3Q07A 4PM5A 4JXVA 4PM7A 3IWQA 3VP4A 1XA1A 5JYPA 3FKWA 3G32A 4JF6A 1U60A 4ZJ2A 2Q9MA 5L2FA 2XFSA 2C5WB 4F94A 3HUNA 1I5QA 4S2KA 1MWTA 2DNSA 3OC2A 3HLGA 3PBSA 4Y7PA 3IT9A 2ZC7A 3PBQA 3W4PA 5TR7A 5DF8A 3BEBA 3GR2A 4FH2A 1LL5A 2P74A 3IXDA 5F1GA 5FQ9A 2PU2A 2Y2PA 3TSGA 3WS4A 4KZBA 1FCMA 4JPMA 4FSFA 1LI0A 1K4EA 3AGEA 5CHUA 3UO9A 4KENB 5A93A 2FFFB 3G35A 3G31A 2VGKA 2BLSA 4WEKA 1GHIA 3VSKA 5M18A 1K25A 4KG5A 3BECA 5EPHA 3M6HA 3FKVA 4UA6A 1GHPA 3PBRA 1JVJA 4O7DA 1BSGA 3C7UA 4PPRA 3Q7VA 4S2NC 4X56A 3N8LA 2J8YA 3WS1A 2HP6A 1E3UD 4MBHA 5CGWA 4E3NA 1MPLA 5IHVA 4KG6A 1IYQA 3QHYA 3EQUA 4BL3A 5HAQA 4R1GA 2WADA 2XQZA 4OH0A 4LV3A 2HP9A 4KQRA 5D3OA 3UDIA 1PZPA 3VFHA 5HARA 3VOZA 2V2FF 1JWZA 4U0XA 1YLYA 2ZQ9A 2VGJA 3WRTA 3ZCZA 5AQ7A 1ES3A 3ZVTA 3C4PA 3LY4A 5DF9A 2Z2MB 4GB7A 2WK0A 1YQSA 3WRZA 3HLWA 4XXRA 1YT4A 1NY0A 4D2OA 2GDNA 3RXWA 3ZNYA 3SH9A 4CPKA 1PW1A 1N4OA 1XPBA 2JE5A 4WZ4A 3GRJA 3ZG9B 2OSUA 3OCNA 2HDRA 1ALQA 1PWGA 2Y2MA 3QNCA 3MZFA 1KE4A 5FQJA 2ZQ7A 5KMWA 5EVLA 3UPPA 4S2IA 4U3TA 4WMCA 5EE8A 5CTNA 2G2UA 2H5SA 1Z6FA 3O88A 2Y2GA 3IXHA 4OQIA 4EUZA 2ZC5B 3OPLA 5JYOA 4B88A 1GA0A 4KG2A 1FOFA 1ZKJA 3GV9A 3M6BA 1WYBA 4KZ9A 4R4RA 3EQVA 5GLBA 1QMEA 4S2MA 5E2HA 1BLPA 3UDXA 4ZJ1A 4Q8IA 3DWKA 1H8YA 3M2JA 2E8IA 1KE0A 5CEDA 3NY4A 2WGIA 2HDSA 2R9XA 1DJAA 3E2LA 3G34A 4LENA 4GKUA 1GHMA 1G6AA 3NCKA 3BRMA 1ZG4A 4N1XA 4K91A 2EX8A 4CJNA 1I2SA 3BFEA 3NI9A 3ZG8B 4E6XA 1LHYA 4MNRA 5KSCA 4E3KA 3ZHHA 2WZXA 1IKIA 5G18A 4DDSA 3V39A 4BENA 1XGJA 2J9PA 4KZ4A 2EX6A 3AGFA 1W79A 1K57C 3N6IA 1H8ZA 4WZ5C 4RX3A 1MWRA 3PAEA 1SCWA 3CZDA 3N7WA 1HD8A 2ZJ9A 3LCEA 2ZM8A 3A3JA 1K56D 1L2SA 1NJ4A 4RVAA 2J9OA 1XXMA 2ZC3B 3CG5A 3G2YA 4HBUA 4P85A 5TGFA 5HW3A 1IELA 4A5RA 3MFDA 2V20A 2PBYA 2ZLYA 3ZGAB 3HLCA 1FSYA 1Q2QA 3HLEA 5FAPA 4OONA 4S2OA 5GL9A 1ESUA 5KZHA 1JTGA 1ERMA 1PI5A 1IKGA 4PM8A 2ZM2A 4N92A 4K0WA 4OOMA 5FSRA 1YLWA 1W8QA 3HLBA 2XK1A 3LO7A 4UA9A 2XH9A 1L0FA 1FQGA 1G68A 4WBGA 1Y54A 2Y2LA 4LV1A 4N1HA 3SS4A 3VOYA 4EQIA 2XFTA 1KE3A 4R3JA 1RGYA 2H0YA 3HUOA 5HAPA 4OKPA 4OOLA 4P6BA 4KZ5A 2V1ZA 3PBOA 1HTZA 1RGZA 1XP4A 3UPNA 3PTEA 1ES5A 5EVIA 5E2FA 4E3OA 2ZM0A 3OZHA 4LV0A 3IH9A 5GHZA 4EWFA 5EVIC 4Z9QA 1GA9A 1KVLA 1EI5A 3FV7A 5CRFA 3V3SA 3LY3A 4OP8A 4DRTA 4OQHA 1YLPA 3Q1FA 4HEFA 5M1AA 4OPYA 3IQAA 3IF6B 2ZMAA 5A92A 3O86A 3IXGA 2ZQCA 2B5RA 4JXWA 2X01A 4DKIA 4E3JA 1S6RA 1XA7A 4FCFA 4IVKA 2XGNA 5DTKA 1K55C 3UE3A 3ITAA 5TFQA 1SDNA 4UA7A 4MBFA 4GN2A 4P87A 3UY6A 1IYPA 1WE4A 2XR0A 1HZOA 3VP1A 1NYYA 1CI9A 2XEPA 4JF5A 3MZEA 1ESIA 2WAFA 2ZQAA 4GDNA 3JYIA 3PBNA 5GLAA 4E3MA 2DCFA 4EBPA 1GCEA 4QY5A 3Q7VB 4U0TA 4WZ5A 4X69A 3MXSA 1CI8A 3E2KA 4ID4A 2QMIA 1ES2A 1Q2PA 4LCLA 1LL9A 4E6WA 2Q9NA 5HL1A 4BLMA 4N9LA 4OPQA 4UHUA 3ZG5A 1PWDA 3VMAA 1J9MA 3PAGA 4X68A 2IWCA 3BM6A 4JXGA 3ZDJA 1AXBA 3Q81A 1W8YA 3NC8A 4OVDA 3MXRA 4ZDXA 1YMXA 3BYDA 3Q82A 4PM6A 1M6KA 1C3BA 3BFCA 3NIAA 4X53A 3RJUA 1LLBA 1RCJA 5F83A 1KGGA 2QPNA 2WGWA 2X71A 4RYEA 4DXBA 3UN7A 5I94A 1ERQA 1VQQA 5FQQA 1L0GA 2P9VA 4PM9A 3VP0A 3HLFA 1YLJA 1K56A 3UDFA 4KQOA 4C3QA 1K57A 2WGVA 5CERA 3IHBA 3IWOA 4OOYA 2EX9A 1M40A 3ITBA 4GOGA 3V50A 4GDBA 5CHMA 1K38A 1DJBA 4GNUA 2Y2IA 3SH8A 2ZD8A 5AQAA 3ZVWA 4OLDA 3SH7A 3UE1A 4BL2A 5CECA 4B4XA 2FFYA 1K54C 2Y4AA 5A91A 1VM1A 4L0LA 1BULA 3HVFA 5E2EA 2JC7A 5FI7A 5FI2A 3SOIA 1KDSA 1NZUA 5EUAA 1L0DA 1HVBA 4HESA 1OMEA 2DRWA 3WS0A 3G4PA 1MWUA 3W4OA 3NDGA 2H0TA 5FDHA 3IWIA 2HDQA 3OPRA 1KGFA 3WS5A 1PI4A 3LEZA 3HREA 2HP5A 4R23A 1XGIA 4Y0TA 1FR6A 1MBLA 1NRFA 1H5XA 4KZ7A 3FZCA 4X6TA 1PIOA 1KDWA 1SDEA 1KVMA 4DDYA 4DXCA 1FSWA 4XUZA 5CXWA 3W4QA 4R0QA 2WYXA 3GTCA 5GLCA 4OQGA 5FQMA 4OPZA 3SS5A 3Q7ZA 1ZC2A 4KQQA 1W7FA 4WMCD 3HL9A 3NBLA 2C6WB 1E25A 1ONGA 4KZ3A 2CC1A 1LI9A 5EECA 1WYCA 4WEJA 1ES4A 2HPBA 1FCNA 4S2PA 3CMZA 4QB8A 5EOEA 1O7EA 1FCOA 4GD8A 2PU4A 1JWVA 4JKTA 4KZAA 4E3IA 1XKZA 2EXAA 2Y2JA 4GD6A 2Y91A 3DW0A 4IBRA 1DY6A 5E2GA 4P0MA 3G30A 4WM9A 5HFOA 4KZ8A 3A3DA 4ZAMA 4MLLA 4QHCA 2Z2LB 1EWZA 5GHYA 4XUXA 1YMSA 2XD1A 3HBRA 4NK3A 4OP5A 4EBLA 3FYZA 4LV2A 4M3KA 1PZOA 4DE2A 3BFFA 2I72A 1K6SA 2XDMA 4QU3A 4S2LA 2JBFA 2ZC4B 3UNWA 3OCLA 2ZQ8A 2RCXA 3V3RA 2J7VA 5GLDA 1BUEA 1ONHA 4OLGA 4BQMA 1S0WA 3GQZA 5KSHA 3C7VA 1K55A 1L0EA 3BFDA 1BLSA 5FQKA 2WKIA 2WZZA 3MKFA 1BT5A 3IF5A 5EVIB 2IWDA 4R3BA 3B3XA 4PMAA 2A49A 5FAOA 3OPHA 2Y55A 3TOIA 4UAAA 4DE1A 2Y2QA 4N9KA 2XLNA 3C4OA 1N9BA 5CHJA 3MZDA 5M19A 3IHAA 5FI6A 5J8XA 3A3FA 3M2KA 2Y2KA 5FATA 5A90A 1CEGA 1PWCA 5FA7A 4OQ0A 3C5AA 2WKEA 3MKEA 4C75A 4IVIA 1NYMA 2WAEA 5AQ9A 1O07A 4ZBEA 2Y2OA 3WWXA 1TDLA 4E3LA 5FAQA 1YLTA 3AGDA 4H8RA 1FR1A 5DTSA 5EOOA 4DE3A 4RX2A 5DTTA 1SHVA 4X55A 1PW8A 2XD5A 3P09A 5CTMA 4FD8A 5DVAA 3RXXA 2QZ6A 4C6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FWL A;  5FQI A;  4HBT A;  2OLU A;  3BLS A;  3CJM A;  5E43 A;  4ZJ3 A;  4JF4 A;  1YLZ A;  4DE0 A;  1PYY A;  1IEM A;  2EXB A;  1RP5 A;  4FH4 A;  2XF3 A;  5AQB A;  5EVI D;  2OLV A;  3N8S A;  1XX2 A;  3ISG A;  4MEZ A;  3TG9 A;  4QY6 A;  2ZC6 B;  4BD0 A;  4DF6 A;  1BLH A;  3DTM A;  3WS2 A;  3O87 A;  3BLM A;  4YFM A;  4QD4 A;  3A3I A;  3V5M A;  4GZB A;  4K0X A;  4NET A;  3QNB A;  4Y0U A;  3O3V A;  3ZG7 B;  2BG1 A;  2WGW B;  4RA7 A;  2A3U A;  4WYY A;  2UWX A;  1MY8 A;  1W5D A;  4KZ6 A;  1DJC A;  2P9V B;  3I7J A;  1BLC A;  1NXY A;  4Y0O A;  3S22 A;  3S4X A;  1MXO A;  5HAI A;  2Y2N A;  5F1F A;  3VP2 A;  4IBX A;  4EBN A;  3ZFZ A;  3VP3 A;  3MBZ A;  3OPP A;  4JBF A;  1SKF A;  5BOH A;  3NDE A;  3N4I A;  2EFU A;  3HLD A;  4ZTK A;  3GMW A;  2WKH A;  3HUM A;  3G2Z A;  3PBT A;  2IWB A;  3DWZ A;  2JCH A;  2H10 A;  3A3E A;  4BD1 A;  1BZA A;  2OV5 A;  1E4D A;  4LCM A;  1IYO A;  1CEF A;  3W8K A;  4S2J A;  4JLF A;  4B4Z A;  1JWP A;  1K6R A;  3ZG0 A;  3N8R A;  4S2N A;  5CGX A;  1K54 A;  2R9W A;  1CK3 A;  2ZQD A;  3UE0 A;  3IXB A;  1MWS A;  3SS3 A;  5CEB A;  3S1Y A;  3VSL A;  4EV4 A;  3VFF A;  2EFX A;  4R4S A;  1QMF A;  3ZNT A;  1TVF A;  5U47 A;  2WUQ A;  3IH8 A;  3UPO A;  4QJG A;  1ERO A;  4JXS A;  4BJP A;  1BTL A;  1E3U A;  4YIN A;  2G2W A;  5FAS A;  3IF6 A;  5CGS A;  1JTD A;  2RL3 A;  5HX9 A;  4OPR A;  3GSG A;  5GHX A;  1NZO A;  1TDG A;  3D4F A;  1YM1 A;  4IED A;  1IYS A;  3IF6 C;  3GVB A;  2Y59 A;  1I2W A;  2EX2 A;  4WEL A;  5DF7 A;  4MBK A;  3BFG A;  1TEM A;  5F82 A;  3P98 A;  2Y2H A;  2X02 A;  1K4F A;  1MKI A;  1ZG6 A;  1KGE A;  2HDU A;  3Q07 A;  4PM5 A;  4JXV A;  4PM7 A;  3IWQ A;  3VP4 A;  1XA1 A;  5JYP A;  3FKW A;  3G32 A;  4JF6 A;  1U60 A;  4ZJ2 A;  2Q9M A;  5L2F A;  2XFS A;  2C5W B;  4F94 A;  3HUN A;  1I5Q A;  4S2K A;  1MWT A;  2DNS A;  3OC2 A;  3HLG A;  3PBS A;  4Y7P A;  3IT9 A;  2ZC7 A;  3PBQ A;  3W4P A;  5TR7 A;  5DF8 A;  3BEB A;  3GR2 A;  4FH2 A;  1LL5 A;  2P74 A;  3IXD A;  5F1G A;  5FQ9 A;  2PU2 A;  2Y2P A;  3TSG A;  3WS4 A;  4KZB A;  1FCM A;  4JPM A;  4FSF A;  1LI0 A;  1K4E A;  3AGE A;  5CHU A;  3UO9 A;  4KEN B;  5A93 A;  2FFF B;  3G35 A;  3G31 A;  2VGK A;  2BLS A;  4WEK A;  1GHI A;  3VSK A;  5M18 A;  1K25 A;  4KG5 A;  3BEC A;  5EPH A;  3M6H A;  3FKV A;  4UA6 A;  1GHP A;  3PBR A;  1JVJ A;  4O7D A;  1BSG A;  3C7U A;  4PPR A;  3Q7V A;  4S2N C;  4X56 A;  3N8L A;  2J8Y A;  3WS1 A;  2HP6 A;  1E3U D;  4MBH A;  5CGW A;  4E3N A;  1MPL A;  5IHV A;  4KG6 A;  1IYQ A;  3QHY A;  3EQU A;  4BL3 A;  5HAQ A;  4R1G A;  2WAD A;  2XQZ A;  4OH0 A;  4LV3 A;  2HP9 A;  4KQR A;  5D3O A;  3UDI A;  1PZP A;  3VFH A;  5HAR A;  3VOZ A;  2V2F F;  1JWZ A;  4U0X A;  1YLY A;  2ZQ9 A;  2VGJ A;  3WRT A;  3ZCZ A;  5AQ7 A;  1ES3 A;  3ZVT A;  3C4P A;  3LY4 A;  5DF9 A;  2Z2M B;  4GB7 A;  2WK0 A;  1YQS A;  3WRZ A;  3HLW A;  4XXR A;  1YT4 A;  1NY0 A;  4D2O A;  2GDN A;  3RXW A;  3ZNY A;  3SH9 A;  4CPK A;  1PW1 A;  1N4O A;  1XPB A;  2JE5 A;  4WZ4 A;  3GRJ A;  3ZG9 B;  2OSU A;  3OCN A;  2HDR A;  1ALQ A;  1PWG A;  2Y2M A;  3QNC A;  3MZF A;  1KE4 A;  5FQJ A;  2ZQ7 A;  5KMW A;  5EVL A;  3UPP A;  4S2I A;  4U3T A;  4WMC A;  5EE8 A;  5CTN A;  2G2U A;  2H5S A;  1Z6F A;  3O88 A;  2Y2G A;  3IXH A;  4OQI A;  4EUZ A;  2ZC5 B;  3OPL A;  5JYO A;  4B88 A;  1GA0 A;  4KG2 A;  1FOF A;  1ZKJ A;  3GV9 A;  3M6B A;  1WYB A;  4KZ9 A;  4R4R A;  3EQV A;  5GLB A;  1QME A;  4S2M A;  5E2H A;  1BLP A;  3UDX A;  4ZJ1 A;  4Q8I A;  3DWK A;  1H8Y A;  3M2J A;  2E8I A;  1KE0 A;  5CED A;  3NY4 A;  2WGI A;  2HDS A;  2R9X A;  1DJA A;  3E2L A;  3G34 A;  4LEN A;  4GKU A;  1GHM A;  1G6A A;  3NCK A;  3BRM A;  1ZG4 A;  4N1X A;  4K91 A;  2EX8 A;  4CJN A;  1I2S A;  3BFE A;  3NI9 A;  3ZG8 B;  4E6X A;  1LHY A;  4MNR A;  5KSC A;  4E3K A;  3ZHH A;  2WZX A;  1IKI A;  5G18 A;  4DDS A;  3V39 A;  4BEN A;  1XGJ A;  2J9P A;  4KZ4 A;  2EX6 A;  3AGF A;  1W79 A;  1K57 C;  3N6I A;  1H8Z A;  4WZ5 C;  4RX3 A;  1MWR A;  3PAE A;  1SCW A;  3CZD A;  3N7W A;  1HD8 A;  2ZJ9 A;  3LCE A;  2ZM8 A;  3A3J A;  1K56 D;  1L2S A;  1NJ4 A;  4RVA A;  2J9O A;  1XXM A;  2ZC3 B;  3CG5 A;  3G2Y A;  4HBU A;  4P85 A;  5TGF A;  5HW3 A;  1IEL A;  4A5R A;  3MFD A;  2V20 A;  2PBY A;  2ZLY A;  3ZGA B;  3HLC A;  1FSY A;  1Q2Q A;  3HLE A;  5FAP A;  4OON A;  4S2O A;  5GL9 A;  1ESU A;  5KZH A;  1JTG A;  1ERM A;  1PI5 A;  1IKG A;  4PM8 A;  2ZM2 A;  4N92 A;  4K0W A;  4OOM A;  5FSR A;  1YLW A;  1W8Q A;  3HLB A;  2XK1 A;  3LO7 A;  4UA9 A;  2XH9 A;  1L0F A;  1FQG A;  1G68 A;  4WBG A;  1Y54 A;  2Y2L A;  4LV1 A;  4N1H A;  3SS4 A;  3VOY A;  4EQI A;  2XFT A;  1KE3 A;  4R3J A;  1RGY A;  2H0Y A;  3HUO A;  5HAP A;  4OKP A;  4OOL A;  4P6B A;  4KZ5 A;  2V1Z A;  3PBO A;  1HTZ A;  1RGZ A;  1XP4 A;  3UPN A;  3PTE A;  1ES5 A;  5EVI A;  5E2F A;  4E3O A;  2ZM0 A;  3OZH A;  4LV0 A;  3IH9 A;  5GHZ A;  4EWF A;  5EVI C;  4Z9Q A;  1GA9 A;  1KVL A;  1EI5 A;  3FV7 A;  5CRF A;  3V3S A;  3LY3 A;  4OP8 A;  4DRT A;  4OQH A;  1YLP A;  3Q1F A;  4HEF A;  5M1A A;  4OPY A;  3IQA A;  3IF6 B;  2ZMA A;  5A92 A;  3O86 A;  3IXG A;  2ZQC A;  2B5R A;  4JXW A;  2X01 A;  4DKI A;  4E3J A;  1S6R A;  1XA7 A;  4FCF A;  4IVK A;  2XGN A;  5DTK A;  1K55 C;  3UE3 A;  3ITA A;  5TFQ A;  1SDN A;  4UA7 A;  4MBF A;  4GN2 A;  4P87 A;  3UY6 A;  1IYP A;  1WE4 A;  2XR0 A;  1HZO A;  3VP1 A;  1NYY A;  1CI9 A;  2XEP A;  4JF5 A;  3MZE A;  1ESI A;  2WAF A;  2ZQA A;  4GDN A;  3JYI A;  3PBN A;  5GLA A;  4E3M A;  2DCF A;  4EBP A;  1GCE A;  4QY5 A;  3Q7V B;  4U0T A;  4WZ5 A;  4X69 A;  3MXS A;  1CI8 A;  3E2K A;  4ID4 A;  2QMI A;  1ES2 A;  1Q2P A;  4LCL A;  1LL9 A;  4E6W A;  2Q9N A;  5HL1 A;  4BLM A;  4N9L A;  4OPQ A;  4UHU A;  3ZG5 A;  1PWD A;  3VMA A;  1J9M A;  3PAG A;  4X68 A;  2IWC A;  3BM6 A;  4JXG A;  3ZDJ A;  1AXB A;  3Q81 A;  1W8Y A;  3NC8 A;  4OVD A;  3MXR A;  4ZDX A;  1YMX A;  3BYD A;  3Q82 A;  4PM6 A;  1M6K A;  1C3B A;  3BFC A;  3NIA A;  4X53 A;  3RJU A;  1LLB A;  1RCJ A;  5F83 A;  1KGG A;  2QPN A;  2WGW A;  2X71 A;  4RYE A;  4DXB A;  3UN7 A;  5I94 A;  1ERQ A;  1VQQ A;  5FQQ A;  1L0G A;  2P9V A;  4PM9 A;  3VP0 A;  3HLF A;  1YLJ A;  1K56 A;  3UDF A;  4KQO A;  4C3Q A;  1K57 A;  2WGV A;  5CER A;  3IHB A;  3IWO A;  4OOY A;  2EX9 A;  1M40 A;  3ITB A;  4GOG A;  3V50 A;  4GDB A;  5CHM A;  1K38 A;  1DJB A;  4GNU A;  2Y2I A;  3SH8 A;  2ZD8 A;  5AQA A;  3ZVW A;  4OLD A;  3SH7 A;  3UE1 A;  4BL2 A;  5CEC A;  4B4X A;  2FFY A;  1K54 C;  2Y4A A;  5A91 A;  1VM1 A;  4L0L A;  1BUL A;  3HVF A;  5E2E A;  2JC7 A;  5FI7 A;  5FI2 A;  3SOI A;  1KDS A;  1NZU A;  5EUA A;  1L0D A;  1HVB A;  4HES A;  1OME A;  2DRW A;  3WS0 A;  3G4P A;  1MWU A;  3W4O A;  3NDG A;  2H0T A;  5FDH A;  3IWI A;  2HDQ A;  3OPR A;  1KGF A;  3WS5 A;  1PI4 A;  3LEZ A;  3HRE A;  2HP5 A;  4R23 A;  1XGI A;  4Y0T A;  1FR6 A;  1MBL A;  1NRF A;  1H5X A;  4KZ7 A;  3FZC A;  4X6T A;  1PIO A;  1KDW A;  1SDE A;  1KVM A;  4DDY A;  4DXC A;  1FSW A;  4XUZ A;  5CXW A;  3W4Q A;  4R0Q A;  2WYX A;  3GTC A;  5GLC A;  4OQG A;  5FQM A;  4OPZ A;  3SS5 A;  3Q7Z A;  1ZC2 A;  4KQQ A;  1W7F A;  4WMC D;  3HL9 A;  3NBL A;  2C6W B;  1E25 A;  1ONG A;  4KZ3 A;  2CC1 A;  1LI9 A;  5EEC A;  1WYC A;  4WEJ A;  1ES4 A;  2HPB A;  1FCN A;  4S2P A;  3CMZ A;  4QB8 A;  5EOE A;  1O7E A;  1FCO A;  4GD8 A;  2PU4 A;  1JWV A;  4JKT A;  4KZA A;  4E3I A;  1XKZ A;  2EXA A;  2Y2J A;  4GD6 A;  2Y91 A;  3DW0 A;  4IBR A;  1DY6 A;  5E2G A;  4P0M A;  3G30 A;  4WM9 A;  5HFO A;  4KZ8 A;  3A3D A;  4ZAM A;  4MLL A;  4QHC A;  2Z2L B;  1EWZ A;  5GHY A;  4XUX A;  1YMS A;  2XD1 A;  3HBR A;  4NK3 A;  4OP5 A;  4EBL A;  3FYZ A;  4LV2 A;  4M3K A;  1PZO A;  4DE2 A;  3BFF A;  2I72 A;  1K6S A;  2XDM A;  4QU3 A;  4S2L A;  2JBF A;  2ZC4 B;  3UNW A;  3OCL A;  2ZQ8 A;  2RCX A;  3V3R A;  2J7V A;  5GLD A;  1BUE A;  1ONH A;  4OLG A;  4BQM A;  1S0W A;  3GQZ A;  5KSH A;  3C7V A;  1K55 A;  1L0E A;  3BFD A;  1BLS A;  5FQK A;  2WKI A;  2WZZ A;  3MKF A;  1BT5 A;  3IF5 A;  5EVI B;  2IWD A;  4R3B A;  3B3X A;  4PMA A;  2A49 A;  5FAO A;  3OPH A;  2Y55 A;  3TOI A;  4UAA A;  4DE1 A;  2Y2Q A;  4N9K A;  2XLN A;  3C4O A;  1N9B A;  5CHJ A;  3MZD A;  5M19 A;  3IHA A;  5FI6 A;  5J8X A;  3A3F A;  3M2K A;  2Y2K A;  5FAT A;  5A90 A;  1CEG A;  1PWC A;  5FA7 A;  4OQ0 A;  3C5A A;  2WKE A;  3MKE A;  4C75 A;  4IVI A;  1NYM A;  2WAE A;  5AQ9 A;  1O07 A;  4ZBE A;  2Y2O A;  3WWX A;  1TDL A;  4E3L A;  5FAQ A;  1YLT A;  3AGD A;  4H8R A;  1FR1 A;  5DTS A;  5EOO A;  4DE3 A;  4RX2 A;  5DTT A;  1SHV A;  4X55 A;  1PW8 A;  2XD5 A;  3P09 A;  5CTM A;  4FD8 A;  5DVA A;  3RXX A;  2QZ6 A;  4C6Y A; 
#chains in the Genus database with same CATH topology
 4HBT A;  2V1B A;  5CX7 A;  4DE0 A;  1BYW A;  1S1Z A;  1RP5 A;  2XF3 A;  5AQB A;  4BD0 A;  2K31 A;  4YFM A;  3A3I A;  5G4Y A;  3E0Y A;  1KOU A;  4GZB A;  4NET A;  3NOP C;  1Y4O A;  3MMH A;  4RA7 A;  1G6O A;  4KZ6 A;  5A8B A;  1NXY A;  4IBX A;  4NG2 A;  4EBN A;  3IX8 A;  3ZFZ A;  2EFU A;  2WKH A;  3G2Z A;  3ICY A;  3T4Q A;  5EV0 A;  2OV5 A;  3W8K A;  1VET B;  3KX0 X;  1JWP A;  3N8R A;  2V8F A;  4GS9 A;  4HJ3 A;  1YPR A;  1K54 A;  1MWS A;  3SS3 A;  2EFX A;  3ZNT A;  3O5Y A;  4HH2 A;  2O0Y A;  1SKO B;  3IH8 A;  3LIF A;  4BJP A;  1BTL A;  3KO6 A;  3T50 A;  1JTD A;  5AVE A;  1YM1 A;  4Y2F A;  3BFG A;  3P98 A;  1ZG6 A;  1MKI A;  3R7W B;  3BW6 A;  3Q07 A;  3BJN A;  4PM7 A;  3IWQ A;  3VP4 A;  2M7U A;  4JF6 A;  5HPI A;  5HL6 A;  3HLG A;  3PBS A;  3F1P A;  3IT9 A;  3MQO A;  3PBQ A;  5TR7 A;  5DF8 A;  3GR2 A;  1F5M A;  4BBV A;  3IXD A;  1IOU A;  3TSG A;  2FFF B;  1T1C A;  2VGK A;  3G31 A;  4PHT A;  4WEK A;  4YOF A;  4UA6 A;  2L1M A;  4I5S A;  4X25 A;  2XA7 M;  3N8L A;  5K5B A;  2HP6 A;  4E3N A;  5IHV A;  3QHY A;  1D06 A;  3EQU A;  5HAQ A;  4HI4 A;  4OH0 A;  4KQR A;  5FDS A;  1YLY A;  2VGJ A;  3ZVT A;  1ES3 A;  2QHK A;  2O9B A;  2WK0 A;  3KSG A;  4G3K A;  2GDN A;  3ZNY A;  3SH9 A;  4L9F A;  4CPK A;  5LBR A;  1XPB A;  4WZ4 A;  3GRJ A;  1V9Y A;  5KMW A;  3MZF A;  2ZQ7 A;  1UWP X;  4S2I A;  5EE8 A;  5CTN A;  3U2A A;  2H5S A;  1Z6F A;  3O88 A;  1TS6 A;  3IXH A;  4EUZ A;  2ZC5 B;  5JYO A;  3A0R A;  4KG2 A;  1FOF A;  3M6B A;  1WYB A;  4KZ9 A;  2D02 A;  3EQV A;  4LRY C;  2DMW A;  5DKL A;  1BLP A;  3KYZ A;  2QJ5 A;  1AWI A;  1KE0 A;  4JGO A;  2R9X A;  4LEN A;  3LEQ A;  4GHI B;  4N1X A;  3EEH A;  2JKG A;  3JVV A;  1G28 A;  2VJW A;  3V39 A;  1NLY A;  1XGJ A;  2EX6 A;  1W79 A;  2L0W A;  4HOI A;  2PRF A;  2EA9 A;  1MWR A;  1WA9 A;  3PAE A;  4B9O A;  3CZD A;  1HD8 A;  2ZM8 A;  2GZA A;  1G5U A;  1NJ4 A;  4RVA A;  4HBU A;  5HW3 A;  1SKO A;  1NWZ A;  1PNE A;  3ZGA B;  2XRO A;  4S2O A;  3NJA A;  2MJ6 A;  2ZM2 A;  3MR0 A;  4I3J A;  3BQ8 A;  4UA9 A;  4EQI A;  4LV1 A;  3SS4 A;  1P9W A;  3VOY A;  4EEU A;  3HUO A;  4OKP A;  3BQA A;  4DMZ A;  1GSV A;  4M4X A;  3UPN A;  3PTE A;  1S66 L;  2JN7 A;  5GHZ A;  1ODV A;  3DBA A;  5HZH A;  3QP4 A;  1EI5 A;  4OQH A;  1YLP A;  4HEF A;  4OPY A;  2ZMA A;  4DN0 A;  2ZQC A;  4JXW A;  4E3J A;  1S6R A;  5DTK A;  2PR5 A;  1K55 C;  1MKM A;  4GN2 A;  2XR0 A;  1HZO A;  3MZE A;  2WAF A;  4BBU A;  1XJ6 A;  4I3A A;  3MXS A;  1CI8 A;  1VET A;  4ID4 A;  1ES2 A;  4LCL A;  4E6W A;  4GS9 B;  4BLM A;  4UHU A;  3ZG5 A;  2W3H A;  3VMA A;  3PAG A;  3BM6 A;  2WKQ A;  5TBM B;  3MXR A;  4ZDX A;  3MS6 A;  3D3O A;  4QWO A;  1GSX A;  3HJI A;  1F9I A;  3BFC A;  2WKP A;  3NIA A;  4X53 A;  2BTF P;  2O99 A;  3UN7 A;  1UGU A;  5J3W A;  1VQQ A;  5FQQ A;  2P9V A;  2I9V A;  2VGL S;  3HLF A;  1K56 A;  1VEU B;  3R7W A;  1OJG A;  1M40 A;  4CLC A;  4CLC E;  2VKS A;  4GNU A;  2Y2I A;  1K54 C;  2Y4A A;  5A91 A;  5E2E A;  2IA2 A;  3SOI A;  1NZU A;  2XSS A;  4HES A;  2DRW A;  2UV0 E;  2ZOH A;  2H0T A;  5FDH A;  1PI4 A;  3LEZ A;  4R23 A;  2O9A A;  1KVM A;  2W3E A;  4JGR A;  4DDY A;  3F1N A;  3GDI A;  2H28 A;  1ZC2 A;  3LIA A;  3UB7 A;  4WMC D;  3HL9 A;  3CIT A;  4KZ3 A;  3QP6 A;  1XFN A;  1WYC A;  1ES4 A;  3CMZ A;  3B42 A;  4GD8 A;  2PU4 A;  4KZA A;  4E3I A;  1XKZ A;  2YKF A;  3T4T A;  4WM9 A;  5HFO A;  1LSX A;  4MLL A;  4QHC A;  3E4O A;  4XUX A;  4NK3 A;  4YWZ A;  4LV2 A;  4YNR A;  5DJU A;  3H9W A;  1K6S A;  3PXP A;  4QU3 A;  5DJT A;  1V9Z A;  4S2L A;  2GX5 A;  3V3R A;  1BUE A;  3C7V A;  3BFD A;  3MKF A;  1BT5 A;  3DAV A;  5EVI B;  4DE1 A;  2Y2Q A;  4N9K A;  3MZD A;  5A90 A;  4Y17 A;  4Q0J A;  4IVI A;  4IUH A;  5FAQ A;  1YLT A;  4DE3 A;  5F69 A;  1SHV A;  5AJG A;  2XD5 A;  4FD8 A;  3FWL A;  2OLU A;  1PYY A;  2EXB A;  3KYQ A;  2V1A A;  5EVI D;  3T4J A;  2OLV A;  3N8S A;  3ISG A;  4EQ1 A;  1CJF A;  4QY6 A;  1CQA A;  3O87 A;  2W3G A;  4QD4 A;  2B95 A;  2A24 A;  2V9A A;  2WGW B;  4WYY A;  2UWX A;  1MY8 A;  2P9V B;  3S4X A;  1XFQ A;  1MXO A;  5F1F A;  4LRZ E;  1Z09 A;  2B18 A;  3MBZ A;  4ETX A;  1SKF A;  5BOH A;  3HLD A;  4ZTK A;  3GMW A;  3T1S A;  3H7W B;  3A3E A;  3A0S A;  1IYO A;  1CEF A;  3OOV A;  4JLF A;  4HQA A;  2JKF A;  5CGX A;  4EER A;  2R9W A;  2FZ0 A;  5CEB A;  3S1Y A;  3TJZ C;  1QMF A;  3CWF A;  1ERO A;  1E3U A;  4YIN A;  5HX9 A;  4OPR A;  2Z6C A;  4EET B;  3GSG A;  1NZO A;  3D4F A;  2ACG A;  4EUV A;  3KSH A;  2EX2 A;  2HV1 A;  3F1O B;  4MBK A;  1NLZ A;  5F82 A;  1EW0 A;  3VE4 A;  4R3A A;  4PKY A;  1K4F A;  1KGE A;  4PM5 A;  1U60 A;  2Q9M A;  5L2F A;  2C5W B;  3HUN A;  3LFV A;  3TW8 A;  2XA7 S;  3OC2 A;  3OBF A;  5DKK A;  1TD5 A;  3BEB A;  3P7N A;  4FH2 A;  4X1M A;  2P74 A;  2PU2 A;  3BY9 A;  3UO9 A;  4KEN B;  3G35 A;  5F6A A;  2BLS A;  1W63 M;  1GHI A;  2J80 A;  4KG5 A;  5EPH A;  4F3L B;  3JPU A;  3C2W A;  1GSW A;  3FKV A;  1OT6 A;  1JVJ A;  3C7U A;  4CLC B;  3NHQ A;  4S2N C;  2OWJ A;  3WS1 A;  1E3U D;  1IYQ A;  3IS2 A;  2VV7 A;  5D3O A;  3UDI A;  1PZP A;  3VFH A;  1JWZ A;  2JKT I;  2J3T D;  2JKR I;  2VX8 A;  1K0K A;  2YKH A;  3ZCZ A;  3WRT A;  5AQ7 A;  3C4P A;  4GB7 A;  3WRZ A;  3HLW A;  4XXR A;  2B02 A;  1NY0 A;  4KUO A;  2Q0O A;  2OSU A;  5TJJ A;  2HDR A;  2Y2M A;  1PWG A;  5FQJ A;  3HJK A;  3QP5 A;  2INW A;  2HJ9 C;  1ZKJ A;  4S2M A;  5E2H A;  3DWK A;  1H8Y A;  4JGQ A;  4NXE A;  3M2J A;  5CED A;  2HGV A;  3E98 A;  4IJG A;  3EGX C;  1VHM A;  4GKU A;  3BRM A;  4K91 A;  3LR3 A;  5KSC A;  4E3K A;  3ZHH A;  1IKI A;  3AGF A;  1K57 C;  5L09 A;  3EEA A;  3N7W A;  2ZJ9 A;  3A3J A;  2V0U A;  2ZC3 B;  3MFD A;  4FOF A;  5GL9 A;  3F1O A;  4PM8 A;  4N92 A;  4HHD A;  4K0W A;  4OOM A;  5FSR A;  1YLW A;  2BAS A;  3PHY A;  2VGL M;  3HLB A;  1FQG A;  1D1J A;  1Y54 A;  2Y2L A;  1P0Z A;  4R3J A;  2H0Y A;  5HAP A;  4OOL A;  5KIZ A;  3PBO A;  1XP4 A;  2PHY A;  5E2F A;  2ZM0 A;  2KX6 A;  3IH9 A;  1GA9 A;  3FV7 A;  5CRF A;  3V3S A;  3LY3 A;  4DRT A;  5M1A A;  3E4P A;  3IF6 B;  2B5R A;  2X01 A;  4DKI A;  1OTI A;  4IVK A;  2XGN A;  4K08 A;  1SDN A;  4MBF A;  4P87 A;  4F3L A;  1WE4 A;  3VP1 A;  1NYY A;  2XEP A;  1ESI A;  2ZQA A;  3PBN A;  4O0P A;  3Q7V B;  4WZ5 A;  2VV8 A;  4D60 A;  4N9L A;  4OPQ A;  4Y5F A;  5L10 A;  4X68 A;  2IWC A;  4JXG A;  3NC8 A;  1YMX A;  3Q82 A;  1M6K A;  1C3B A;  1RCJ A;  1NRJ A;  2QPN A;  2X71 A;  1L0G A;  3ULF A;  4C3Q A;  1K57 A;  2WGV A;  5CER A;  3IWO A;  2EX9 A;  3NUL A;  3RFB A;  3CUE C;  3PYP A;  3SH8 A;  3ZVW A;  2G7U A;  3SH7 A;  5CEC A;  3HVF A;  3MSH A;  5EUA A;  3VE3 A;  1HVB A;  3RH8 B;  4MMN A;  4PKY G;  3G4P A;  2PYP A;  1MWU A;  3NDG A;  3VOL A;  4I39 A;  5FEG A;  1KGF A;  3WS5 A;  3HRE A;  1XGI A;  1MBL A;  1J3W A;  1KDW A;  4MCW A;  3T4K A;  5FEF A;  4WL9 A;  2V0W A;  1S4R A;  5FQM A;  1E25 A;  1PFL A;  4HJ6 A;  4QB8 A;  5EM0 A;  4JKT A;  3H82 A;  4GD6 A;  1YSP A;  4IHQ A;  4UQI S;  2Y91 A;  5E2G A;  4IBR A;  4P0M A;  1YSQ A;  2NUT C;  1OTD A;  3HBR A;  2XRN A;  4NXG A;  4M3K A;  1PZO A;  4LGW A;  3K3C A;  4DE2 A;  4GHI A;  1TS0 A;  2XDM A;  3LUQ A;  2ZC4 B;  4GW9 A;  3OCL A;  2ZQ8 A;  4DJ3 A;  2J7V A;  5GLD A;  1K55 A;  1BLS A;  3DTE A;  2WKI A;  3UME A;  4PMA A;  3TOI A;  5J7E A;  3OPH A;  2Y55 A;  4UAA A;  3MQ0 A;  1N9B A;  4R38 A;  2ZL1 A;  2Y8H A;  3IHA A;  5HWV A;  2Y2K A;  1PWC A;  2HF6 A;  3C5A A;  4C75 A;  1NYM A;  3CPT A;  2Y2O A;  3WWX A;  3AGD A;  5EOO A;  1ZHH B;  4LRX C;  3P09 A;  5DVA A;  2QZ6 A;  4C6Y A;  5FQI A;  4EEP A;  5E43 A;  4ZJ3 A;  4JF4 A;  2JHE A;  1IEM A;  3DTI A;  4HP9 A;  4IUK A;  1XX2 A;  3TG9 A;  1P9R A;  1BLH A;  3BLM A;  3B33 A;  2JKR M;  2VLG A;  3V5M A;  4K0X A;  3B47 A;  2BG1 A;  3ZG7 B;  2A3U A;  5FL3 A;  1DJC A;  3I7J A;  1BLC A;  2OOL A;  3EWK A;  3S22 A;  4ARZ A;  5AVF A;  2Y2N A;  1ACF A;  3VP3 A;  3OPP A;  3NDE A;  3N4I A;  3HUM A;  3PBT A;  2IWB A;  1F98 A;  4S2J A;  1XJ3 A;  3ZG0 A;  4S2N A;  2PD7 A;  3UE0 A;  4HJ4 A;  3IXB A;  3VSL A;  4EV4 A;  4R4S A;  3T1X A;  2WUQ A;  5G4Z A;  4JXS A;  4EES A;  4NXF A;  2G2W A;  3IF6 A;  2RL3 A;  2PT7 A;  1T18 A;  4IED A;  1IYS A;  2Y59 A;  5DF7 A;  1TEM A;  5EVE A;  1JNU A;  2Y2H A;  2HDU A;  1F2K A;  1STZ A;  4JXV A;  1XA1 A;  3G32 A;  5F68 A;  1I5Q A;  4S2K A;  1MWT A;  2DNS A;  3S7N A;  2KDK A;  2ZC7 A;  2A2L A;  5F1G A;  1H0M A;  2Y2P A;  4Q0H A;  2PD8 A;  4JPM A;  4FSF A;  1K4E A;  3AGE A;  5CHU A;  1T1B A;  3FC7 A;  3VSK A;  3BEC A;  4XT2 B;  1OT9 A;  2Z6D A;  3OLO A;  3QP2 A;  3PBR A;  1BSG A;  5HSQ A;  4PPR A;  4QPR A;  3UB9 A;  1OJ5 A;  2J8Y A;  4MBH A;  5CGW A;  2OWH A;  4KG6 A;  4BL3 A;  4R1G A;  4LV3 A;  1W63 Q;  2HP9 A;  4O8G A;  4BBT A;  3T4O A;  5HAR A;  2VEA A;  3VOZ A;  4HP4 A;  4U0X A;  3TE8 A;  5TBM A;  3LIB A;  2ZQ9 A;  3CPT B;  3LY4 A;  1PRQ A;  1YQS A;  1YT4 A;  3LGO A;  3RXW A;  1PW1 A;  1N4O A;  2PBD P;  3C38 A;  4Z1W A;  2JE5 A;  2L4R A;  3OCN A;  4BMW A;  1KE4 A;  5EVL A;  3UPP A;  4U3T A;  2G2U A;  4OQI A;  4EU0 A;  5IS1 A;  2PAV P;  3UE6 A;  4B88 A;  1GA0 A;  3UDX A;  1N9O A;  2WGI A;  2HDS A;  1DJA A;  4CJN A;  3BFE A;  3C30 A;  4MNR A;  2WZX A;  5HDS A;  1H3Q A;  3LIC A;  4KZ4 A;  4B93 A;  3N6I A;  3TRC A;  4JGP A;  1H8Z A;  4WZ5 C;  4RX3 A;  1CF0 A;  3SW1 A;  1SCW A;  2CMN A;  1L2S A;  2J9O A;  1XXM A;  2ZL1 B;  1IEL A;  4MN6 A;  1ZTU A;  3HLC A;  1FSY A;  5FAP A;  4OON A;  5KZH A;  3W2Z A;  1ERM A;  4KUK A;  3LR4 A;  1IKG A;  2W1R A;  3LO7 A;  2D01 A;  1L0F A;  2XH9 A;  1G68 A;  4G3W A;  4WLA A;  3CLO A;  1KE3 A;  4CLC C;  3MF0 A;  3IBJ A;  4P6B A;  4KZ5 A;  2V1Z A;  2HJE A;  1RGZ A;  3LI8 A;  5EVI A;  4E3O A;  1LSW A;  4Z9Q A;  5HD3 A;  4KQD A;  3BY8 A;  1OTA A;  3EGD C;  1XA7 A;  1LT0 A;  5TFQ A;  4UA7 A;  4BWI A;  4GDN A;  5GLA A;  4EBP A;  4U0T A;  4FUW A;  4X69 A;  3E2K A;  2QMI A;  1Q2P A;  1LL9 A;  4WN5 A;  5HL1 A;  2W3D A;  4GJ4 A;  1J9M A;  4LPZ A;  4MN7 A;  3ZDJ A;  1AXB A;  5HDC A;  4OVD A;  3G6O A;  3RJU A;  1LLB A;  5F83 A;  1KGG A;  2WGW A;  4DXB A;  3JVU A;  2P7J A;  3LR0 A;  4PM9 A;  3VP0 A;  1OPX A;  1YLJ A;  3UDF A;  2OAP 1;  3IHB A;  2ZMV A;  4DJ2 A;  3ZQ5 A;  4LFU A;  1HLU P;  3ZYT A;  1K38 A;  2W0N A;  2K2N A;  2QJ7 A;  2QYB A;  4BL2 A;  1S67 L;  3UE1 A;  3UMD A;  5L8M A;  3S7Q A;  1VM1 A;  4L0L A;  1BUL A;  4Y3I A;  3IS2 B;  5FI2 A;  1KDS A;  3A0V A;  3WS0 A;  1OME A;  3W4O A;  3CAX A;  2HDQ A;  3D72 A;  5HWT A;  5L07 A;  4Y0T A;  1H5X A;  4X6T A;  1DRM A;  1PIO A;  1SDE A;  4DXC A;  1FSW A;  4XT2 A;  3QP8 A;  4MN5 A;  5GLC A;  2W3F A;  4OQG A;  4KQQ A;  4GCZ A;  1W7F A;  3NBL A;  2C6W B;  4L9G A;  1ONG A;  5EEC A;  4WEJ A;  5EOE A;  1O7E A;  1JWV A;  2Y2J A;  2M7V A;  1OTE A;  4KZ8 A;  3A3D A;  3NEC A;  2Z2L B;  1EWZ A;  1YMS A;  3GEC A;  4OP5 A;  4EBL A;  1VB6 A;  3FYZ A;  3KYE A;  4HH3 A;  3BFF A;  3T1R A;  1S1Y A;  2RCX A;  1ONH A;  4OLG A;  4BQM A;  1S0W A;  1L0E A;  2GNX A;  3BWL A;  5FQK A;  2WZZ A;  5F5Y A;  2IWD A;  3UB6 A;  4R3B A;  1T19 A;  3B3X A;  4UEY A;  1TS8 A;  5FAO A;  3C4O A;  5M19 A;  2E8J A;  5FA7 A;  1IFQ A;  2WKE A;  2WAE A;  1O07 A;  2JKT M;  1TDL A;  4E3L A;  5DFX A;  4H8R A;  5DTT A;  3R4K A;  1PW8 A;  5CTM A;  3BLS A;  3CJM A;  2NUP C;  1YLZ A;  4ZRR A;  4FH4 A;  4MEZ A;  3C8C A;  2ZC6 B;  4DF6 A;  3DTM A;  3WS2 A;  3LR5 A;  3MQQ A;  3QNB A;  4Y0U A;  3O3V A;  1W5D A;  4Y0O A;  5HAI A;  3VP2 A;  1VEU A;  4JBF A;  4CQH A;  3DWZ A;  2JCH A;  2H10 A;  1MZU A;  4BD1 A;  1BZA A;  5HWW A;  1XJ4 A;  1E4D A;  4LCM A;  3V67 A;  4B4Z A;  1K6R A;  3NOU C;  2ZQD A;  1CK3 A;  2M1C A;  3VFF A;  4H6J B;  1TVF A;  4PAU A;  5U47 A;  3UPO A;  4QJG A;  4EW7 A;  4II7 A;  2VA0 A;  5FAS A;  5CGS A;  4LLO B;  5GHX A;  1TDG A;  2Y79 A;  3IF6 C;  4I3I A;  3GVB A;  1I2W A;  4WEL A;  4RQ9 A;  3FPW A;  4WF0 A;  3F1N B;  2X02 A;  2PR6 A;  1FIK A;  5JYP A;  3FKW A;  4ZJ2 A;  2XFS A;  4F94 A;  3MJQ A;  2K7S A;  3PR6 A;  3UB5 P;  1N9N A;  4R6L A;  4Y7P A;  3W4P A;  3UB8 A;  1XJ2 A;  5J4E A;  1LL5 A;  5FQ9 A;  1YKD A;  3KSF A;  4KZB A;  3WS4 A;  1FCM A;  1LI0 A;  2OAQ 1;  5A93 A;  3CI6 A;  4ETZ A;  3FG8 A;  1DP9 A;  5M18 A;  1K25 A;  2J3T C;  3M6H A;  1GHP A;  4O7D A;  3Q7V A;  4X56 A;  4HIA A;  2VZW A;  1MPL A;  3T4L A;  2WAD A;  2XQZ A;  3IX4 A;  2V2F F;  2AVX A;  1OTB A;  5C5K A;  5DF9 A;  2Z2M B;  2EWV A;  2QWS A;  2KLI A;  4D2O A;  3ZG9 B;  2J3W A;  2VK3 A;  3VV4 A;  1ALQ A;  3QNC A;  1Y28 A;  4WMC A;  3LIE A;  2Y2G A;  3OPL A;  4P6Z S;  5IU1 A;  3GV9 A;  4NXB A;  4R4R A;  4ME4 A;  5GLB A;  1QME A;  2A24 B;  1YAX A;  3IX3 A;  3CUE A;  4ZJ1 A;  4Q8I A;  4HY8 A;  2E8I A;  3NY4 A;  4Y15 A;  2V8C A;  3DTK A;  3E2L A;  3G34 A;  4HNB A;  1GHM A;  1G6A A;  3NCK A;  1ZG4 A;  1P97 A;  2EX8 A;  1I2S A;  1X0O A;  3NI9 A;  3ZG8 B;  4E6X A;  1LHY A;  4I38 A;  5G18 A;  4DDS A;  3RTY A;  5HPF A;  4BEN A;  2J9P A;  5EFW A;  3T12 B;  3L7H A;  3S7P A;  2LB9 A;  2PYR A;  1FIL A;  3LCE A;  1K56 D;  3H82 B;  1SZV A;  3CG5 A;  5TGF A;  3G2Y A;  4P85 A;  4A5R A;  2V20 A;  2PBY A;  2ZLY A;  3SZT A;  3LI9 A;  1Q2Q A;  3HLE A;  1ESU A;  1JTG A;  1L3L A;  1PI5 A;  2PDR A;  4ARZ B;  4NKP A;  4GLQ A;  1W8Q A;  4X1L A;  2XK1 A;  2ZOI A;  4E04 A;  4WBG A;  4N1H A;  1MC0 A;  2XFT A;  4NEE D;  4FTX A;  3NOT C;  5DFY A;  1RGY A;  1D7E A;  1HTZ A;  1ES5 A;  3OZH A;  4LV0 A;  1T1A A;  4EWF A;  5EVI C;  1KVL A;  4Q0I A;  1DP8 A;  4OP8 A;  3IBR A;  3Q1F A;  2P08 A;  3IQA A;  3E4Q A;  5A92 A;  3O86 A;  3IXG A;  4FCF A;  3UE3 A;  3ITA A;  2O9C A;  3UY6 A;  1A0K A;  2W1T B;  1IYP A;  1LSV A;  4JF5 A;  1CI9 A;  4UQI M;  3JYI A;  3H7W A;  4E3M A;  2DCF A;  1GCE A;  4QY5 A;  4L9E A;  4MDZ A;  3QP1 A;  4CLC D;  2Q9N A;  3F1P B;  1PWD A;  4H6J A;  3Q81 A;  2WKR A;  1W8Y A;  3D9Y A;  3BYD A;  3EOI A;  4PM6 A;  5MC7 A;  2QKP A;  4RYE A;  5I94 A;  3MFX A;  1ERQ A;  3FPV A;  3LID A;  4KQO A;  4OOY A;  2FH5 A;  3ITB A;  4GOG A;  3V50 A;  4GDB A;  5CHM A;  5IT5 A;  1DJB A;  3U4L P;  2ZD8 A;  5AQA A;  4OLD A;  4B4X A;  2FFY A;  1TF1 A;  2JC7 A;  5FI7 A;  2KOI A;  1L0D A;  2P04 A;  3HCY A;  4R70 A;  1DP6 A;  1UWN X;  3IWI A;  3OPR A;  2HP5 A;  1FR6 A;  1NRF A;  3LYX A;  4KZ7 A;  3FZC A;  3K3D A;  4XUZ A;  5CXW A;  3W4Q A;  3KSI A;  4R0Q A;  2WYX A;  3GTC A;  4OPZ A;  3SS5 A;  1LL8 A;  3Q7Z A;  2CC1 A;  1LI9 A;  1N9L A;  2HPB A;  1FCN A;  4S2P A;  4G3V A;  1FCO A;  4P6Z M;  5I5L A;  2EXA A;  3CHW P;  3L9K A;  3DW0 A;  1DY6 A;  3G30 A;  3MXQ A;  4ZAM A;  2LB5 A;  5GHY A;  5HDD A;  2EWW A;  2XD1 A;  5EM1 A;  4Y13 A;  2I72 A;  4O01 A;  2JBF A;  3UNW A;  3T1Q B;  5HD5 A;  3GQZ A;  5KSH A;  2GJ3 A;  3IF5 A;  2ZMF A;  2A49 A;  2XLN A;  1S4S A;  3S7O A;  5CHJ A;  3P01 A;  4ESP A;  5FI6 A;  5J8X A;  3A3F A;  3M2K A;  5FAT A;  3T4S A;  1CEG A;  1H8M A;  4OQ0 A;  2VV6 A;  3MKE A;  2R78 A;  1TS7 A;  5AQ9 A;  4ZBE A;  2W27 A;  3K2N A;  1FR1 A;  2HZ5 A;  5DTS A;  2W1T A;  4AFI A;  4EXO A;  4RX2 A;  4WUJ A;  4X55 A;  3RXX A;  2ZBB A; 
#chains in the Genus database with same CATH homology
 3FWL A;  5FQI A;  4HBT A;  2OLU A;  3BLS A;  3CJM A;  5E43 A;  4ZJ3 A;  4JF4 A;  1YLZ A;  4DE0 A;  1PYY A;  1IEM A;  2EXB A;  1RP5 A;  4FH4 A;  2XF3 A;  5AQB A;  5EVI D;  2OLV A;  3N8S A;  1XX2 A;  3ISG A;  4MEZ A;  3TG9 A;  4QY6 A;  2ZC6 B;  4BD0 A;  4DF6 A;  1BLH A;  3DTM A;  3WS2 A;  3O87 A;  3BLM A;  4YFM A;  4QD4 A;  3A3I A;  3V5M A;  4GZB A;  4K0X A;  4NET A;  3QNB A;  4Y0U A;  3O3V A;  3ZG7 B;  2BG1 A;  2WGW B;  4RA7 A;  2A3U A;  4WYY A;  2UWX A;  1MY8 A;  1W5D A;  4KZ6 A;  1DJC A;  2P9V B;  3I7J A;  1BLC A;  1NXY A;  4Y0O A;  3S22 A;  3S4X A;  1MXO A;  5HAI A;  2Y2N A;  5F1F A;  3VP2 A;  4IBX A;  4EBN A;  3ZFZ A;  3VP3 A;  3MBZ A;  3OPP A;  4JBF A;  1SKF A;  5BOH A;  3NDE A;  3N4I A;  2EFU A;  3HLD A;  4ZTK A;  3GMW A;  2WKH A;  3HUM A;  3G2Z A;  3PBT A;  2IWB A;  3DWZ A;  2JCH A;  2H10 A;  3A3E A;  4BD1 A;  1BZA A;  2OV5 A;  1E4D A;  4LCM A;  1IYO A;  1CEF A;  3W8K A;  4S2J A;  4JLF A;  4B4Z A;  1JWP A;  1K6R A;  3ZG0 A;  3N8R A;  4S2N A;  5CGX A;  1K54 A;  2R9W A;  1CK3 A;  2ZQD A;  3UE0 A;  3IXB A;  1MWS A;  3SS3 A;  5CEB A;  3S1Y A;  3VSL A;  4EV4 A;  3VFF A;  2EFX A;  4R4S A;  1QMF A;  3ZNT A;  1TVF A;  5U47 A;  2WUQ A;  3IH8 A;  3UPO A;  4QJG A;  1ERO A;  4JXS A;  4BJP A;  1BTL A;  1E3U A;  4YIN A;  2G2W A;  5FAS A;  3IF6 A;  5CGS A;  1JTD A;  2RL3 A;  5HX9 A;  4OPR A;  3GSG A;  5GHX A;  1NZO A;  1TDG A;  3D4F A;  1YM1 A;  4IED A;  1IYS A;  3IF6 C;  3GVB A;  2Y59 A;  1I2W A;  2EX2 A;  4WEL A;  5DF7 A;  4MBK A;  3BFG A;  1TEM A;  5F82 A;  3P98 A;  2Y2H A;  2X02 A;  1K4F A;  1MKI A;  1ZG6 A;  1KGE A;  2HDU A;  3Q07 A;  4PM5 A;  4JXV A;  4PM7 A;  3IWQ A;  3VP4 A;  1XA1 A;  5JYP A;  3FKW A;  3G32 A;  4JF6 A;  1U60 A;  4ZJ2 A;  2Q9M A;  5L2F A;  2XFS A;  2C5W B;  4F94 A;  3HUN A;  1I5Q A;  4S2K A;  1MWT A;  2DNS A;  3OC2 A;  3HLG A;  3PBS A;  4Y7P A;  3IT9 A;  2ZC7 A;  3PBQ A;  3W4P A;  5TR7 A;  5DF8 A;  3BEB A;  3GR2 A;  4FH2 A;  1LL5 A;  2P74 A;  3IXD A;  5F1G A;  5FQ9 A;  2PU2 A;  2Y2P A;  3TSG A;  3WS4 A;  4KZB A;  1FCM A;  4JPM A;  4FSF A;  1LI0 A;  1K4E A;  3AGE A;  5CHU A;  3UO9 A;  4KEN B;  5A93 A;  2FFF B;  3G35 A;  3G31 A;  2VGK A;  2BLS A;  4WEK A;  1GHI A;  3VSK A;  5M18 A;  1K25 A;  4KG5 A;  3BEC A;  5EPH A;  3M6H A;  3FKV A;  4UA6 A;  1GHP A;  3PBR A;  1JVJ A;  4O7D A;  1BSG A;  3C7U A;  4PPR A;  3Q7V A;  4S2N C;  4X56 A;  3N8L A;  2J8Y A;  3WS1 A;  2HP6 A;  1E3U D;  4MBH A;  5CGW A;  4E3N A;  1MPL A;  5IHV A;  4KG6 A;  1IYQ A;  3QHY A;  3EQU A;  4BL3 A;  5HAQ A;  4R1G A;  2WAD A;  2XQZ A;  4OH0 A;  4LV3 A;  2HP9 A;  4KQR A;  5D3O A;  3UDI A;  1PZP A;  3VFH A;  5HAR A;  3VOZ A;  2V2F F;  1JWZ A;  4U0X A;  1YLY A;  2ZQ9 A;  2VGJ A;  3WRT A;  3ZCZ A;  5AQ7 A;  1ES3 A;  3ZVT A;  3C4P A;  3LY4 A;  5DF9 A;  2Z2M B;  4GB7 A;  2WK0 A;  1YQS A;  3WRZ A;  3HLW A;  4XXR A;  1YT4 A;  1NY0 A;  4D2O A;  2GDN A;  3RXW A;  3ZNY A;  3SH9 A;  4CPK A;  1PW1 A;  1N4O A;  1XPB A;  2JE5 A;  4WZ4 A;  3GRJ A;  3ZG9 B;  2OSU A;  3OCN A;  2HDR A;  1ALQ A;  1PWG A;  2Y2M A;  3QNC A;  3MZF A;  1KE4 A;  5FQJ A;  2ZQ7 A;  5KMW A;  5EVL A;  3UPP A;  4S2I A;  4U3T A;  4WMC A;  5EE8 A;  5CTN A;  2G2U A;  2H5S A;  1Z6F A;  3O88 A;  2Y2G A;  3IXH A;  4OQI A;  4EUZ A;  2ZC5 B;  3OPL A;  5JYO A;  4B88 A;  1GA0 A;  4KG2 A;  1FOF A;  1ZKJ A;  3GV9 A;  3M6B A;  1WYB A;  4KZ9 A;  4R4R A;  3EQV A;  5GLB A;  1QME A;  4S2M A;  5E2H A;  1BLP A;  3UDX A;  4ZJ1 A;  4Q8I A;  3DWK A;  1H8Y A;  3M2J A;  2E8I A;  1KE0 A;  5CED A;  3NY4 A;  2WGI A;  2HDS A;  2R9X A;  1DJA A;  3E2L A;  3G34 A;  4LEN A;  4GKU A;  1GHM A;  1G6A A;  3NCK A;  3BRM A;  1ZG4 A;  4N1X A;  4K91 A;  2EX8 A;  4CJN A;  1I2S A;  3BFE A;  3NI9 A;  3ZG8 B;  4E6X A;  1LHY A;  4MNR A;  5KSC A;  4E3K A;  3ZHH A;  2WZX A;  1IKI A;  5G18 A;  4DDS A;  3V39 A;  4BEN A;  1XGJ A;  2J9P A;  4KZ4 A;  2EX6 A;  3AGF A;  1W79 A;  1K57 C;  3N6I A;  1H8Z A;  4WZ5 C;  4RX3 A;  1MWR A;  3PAE A;  1SCW A;  3CZD A;  3N7W A;  1HD8 A;  2ZJ9 A;  3LCE A;  2ZM8 A;  3A3J A;  1K56 D;  1L2S A;  1NJ4 A;  4RVA A;  2J9O A;  1XXM A;  2ZC3 B;  3CG5 A;  3G2Y A;  4HBU A;  4P85 A;  5TGF A;  5HW3 A;  1IEL A;  4A5R A;  3MFD A;  2V20 A;  2PBY A;  2ZLY A;  3ZGA B;  3HLC A;  1FSY A;  1Q2Q A;  3HLE A;  5FAP A;  4OON A;  4S2O A;  5GL9 A;  1ESU A;  5KZH A;  1JTG A;  1ERM A;  1PI5 A;  1IKG A;  4PM8 A;  2ZM2 A;  4N92 A;  4K0W A;  4OOM A;  5FSR A;  1YLW A;  1W8Q A;  3HLB A;  2XK1 A;  3LO7 A;  4UA9 A;  2XH9 A;  1L0F A;  1FQG A;  1G68 A;  4WBG A;  1Y54 A;  2Y2L A;  4LV1 A;  4N1H A;  3SS4 A;  3VOY A;  4EQI A;  2XFT A;  1KE3 A;  4R3J A;  1RGY A;  2H0Y A;  3HUO A;  5HAP A;  4OKP A;  4OOL A;  4P6B A;  4KZ5 A;  2V1Z A;  3PBO A;  1HTZ A;  1RGZ A;  1XP4 A;  3UPN A;  3PTE A;  1ES5 A;  5EVI A;  5E2F A;  4E3O A;  2ZM0 A;  3OZH A;  4LV0 A;  3IH9 A;  5GHZ A;  4EWF A;  5EVI C;  4Z9Q A;  1GA9 A;  1KVL A;  1EI5 A;  3FV7 A;  5CRF A;  3V3S A;  3LY3 A;  4OP8 A;  4DRT A;  4OQH A;  1YLP A;  3Q1F A;  4HEF A;  5M1A A;  4OPY A;  3IQA A;  3IF6 B;  2ZMA A;  5A92 A;  3O86 A;  3IXG A;  2ZQC A;  2B5R A;  4JXW A;  2X01 A;  4DKI A;  4E3J A;  1S6R A;  1XA7 A;  4FCF A;  4IVK A;  2XGN A;  5DTK A;  1K55 C;  3UE3 A;  3ITA A;  5TFQ A;  1SDN A;  4UA7 A;  4MBF A;  4GN2 A;  4P87 A;  3UY6 A;  1IYP A;  1WE4 A;  2XR0 A;  1HZO A;  3VP1 A;  1NYY A;  1CI9 A;  2XEP A;  4JF5 A;  3MZE A;  1ESI A;  2WAF A;  2ZQA A;  4GDN A;  3JYI A;  3PBN A;  5GLA A;  4E3M A;  2DCF A;  4EBP A;  1GCE A;  4QY5 A;  3Q7V B;  4U0T A;  4WZ5 A;  4X69 A;  3MXS A;  1CI8 A;  3E2K A;  4ID4 A;  2QMI A;  1ES2 A;  1Q2P A;  4LCL A;  1LL9 A;  4E6W A;  2Q9N A;  5HL1 A;  4BLM A;  4N9L A;  4OPQ A;  4UHU A;  3ZG5 A;  1PWD A;  3VMA A;  1J9M A;  3PAG A;  4X68 A;  2IWC A;  3BM6 A;  4JXG A;  3ZDJ A;  1AXB A;  3Q81 A;  1W8Y A;  3NC8 A;  4OVD A;  3MXR A;  4ZDX A;  1YMX A;  3BYD A;  3Q82 A;  4PM6 A;  1M6K A;  1C3B A;  3BFC A;  3NIA A;  4X53 A;  3RJU A;  1LLB A;  1RCJ A;  5F83 A;  1KGG A;  2QPN A;  2WGW A;  2X71 A;  4RYE A;  4DXB A;  3UN7 A;  5I94 A;  1ERQ A;  1VQQ A;  5FQQ A;  1L0G A;  2P9V A;  4PM9 A;  3VP0 A;  3HLF A;  1YLJ A;  1K56 A;  3UDF A;  4KQO A;  4C3Q A;  1K57 A;  2WGV A;  5CER A;  3IHB A;  3IWO A;  4OOY A;  2EX9 A;  1M40 A;  3ITB A;  4GOG A;  3V50 A;  4GDB A;  5CHM A;  1K38 A;  1DJB A;  4GNU A;  2Y2I A;  3SH8 A;  2ZD8 A;  5AQA A;  3ZVW A;  4OLD A;  3SH7 A;  3UE1 A;  4BL2 A;  5CEC A;  4B4X A;  2FFY A;  1K54 C;  2Y4A A;  5A91 A;  1VM1 A;  4L0L A;  1BUL A;  3HVF A;  5E2E A;  2JC7 A;  5FI7 A;  5FI2 A;  3SOI A;  1KDS A;  1NZU A;  5EUA A;  1L0D A;  1HVB A;  4HES A;  1OME A;  2DRW A;  3WS0 A;  3G4P A;  1MWU A;  3W4O A;  3NDG A;  2H0T A;  5FDH A;  3IWI A;  2HDQ A;  3OPR A;  1KGF A;  3WS5 A;  1PI4 A;  3LEZ A;  3HRE A;  2HP5 A;  4R23 A;  1XGI A;  4Y0T A;  1FR6 A;  1MBL A;  1NRF A;  1H5X A;  4KZ7 A;  3FZC A;  4X6T A;  1PIO A;  1KDW A;  1SDE A;  1KVM A;  4DDY A;  4DXC A;  1FSW A;  4XUZ A;  5CXW A;  3W4Q A;  4R0Q A;  2WYX A;  3GTC A;  5GLC A;  4OQG A;  5FQM A;  4OPZ A;  3SS5 A;  3Q7Z A;  1ZC2 A;  4KQQ A;  1W7F A;  4WMC D;  3HL9 A;  3NBL A;  2C6W B;  1E25 A;  1ONG A;  4KZ3 A;  2CC1 A;  1LI9 A;  5EEC A;  1WYC A;  4WEJ A;  1ES4 A;  2HPB A;  1FCN A;  4S2P A;  3CMZ A;  4QB8 A;  5EOE A;  1O7E A;  1FCO A;  4GD8 A;  2PU4 A;  1JWV A;  4JKT A;  4KZA A;  4E3I A;  1XKZ A;  2EXA A;  2Y2J A;  4GD6 A;  2Y91 A;  3DW0 A;  4IBR A;  1DY6 A;  5E2G A;  4P0M A;  3G30 A;  4WM9 A;  5HFO A;  4KZ8 A;  3A3D A;  4ZAM A;  4MLL A;  4QHC A;  2Z2L B;  1EWZ A;  5GHY A;  4XUX A;  1YMS A;  2XD1 A;  3HBR A;  4NK3 A;  4OP5 A;  4EBL A;  3FYZ A;  4LV2 A;  4M3K A;  1PZO A;  4DE2 A;  3BFF A;  2I72 A;  1K6S A;  2XDM A;  4QU3 A;  4S2L A;  2JBF A;  2ZC4 B;  3UNW A;  3OCL A;  2ZQ8 A;  2RCX A;  3V3R A;  2J7V A;  5GLD A;  1BUE A;  1ONH A;  4OLG A;  4BQM A;  1S0W A;  3GQZ A;  5KSH A;  3C7V A;  1K55 A;  1L0E A;  3BFD A;  1BLS A;  5FQK A;  2WKI A;  2WZZ A;  3MKF A;  1BT5 A;  3IF5 A;  5EVI B;  2IWD A;  4R3B A;  3B3X A;  4PMA A;  2A49 A;  5FAO A;  3OPH A;  2Y55 A;  3TOI A;  4UAA A;  4DE1 A;  2Y2Q A;  4N9K A;  2XLN A;  3C4O A;  1N9B A;  5CHJ A;  3MZD A;  5M19 A;  3IHA A;  5FI6 A;  5J8X A;  3A3F A;  3M2K A;  2Y2K A;  5FAT A;  5A90 A;  1CEG A;  1PWC A;  5FA7 A;  4OQ0 A;  3C5A A;  2WKE A;  3MKE A;  4C75 A;  4IVI A;  1NYM A;  2WAE A;  5AQ9 A;  1O07 A;  4ZBE A;  2Y2O A;  3WWX A;  1TDL A;  4E3L A;  5FAQ A;  1YLT A;  3AGD A;  4H8R A;  1FR1 A;  5DTS A;  5EOO A;  4DE3 A;  4RX2 A;  5DTT A;  1SHV A;  4X55 A;  1PW8 A;  2XD5 A;  3P09 A;  5CTM A;  4FD8 A;  5DVA A;  3RXX A;  2QZ6 A;  4C6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...