3O86A

Crystal structure of ampc beta-lactamase in complex with a sulfonamide boronic acid inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
358
structure length
351
Chain Sequence
APQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWGYADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGITLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVKPSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVKSTIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSIIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNYPNPARVDAAWQILNALQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Beta-lactamase
publication title Design, Synthesis, Crystal Structures, and Antimicrobial Activity of Sulfonamide Boronic Acids as beta-Lactamase Inhibitors
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 116
structure length 351
sequence length 358
chains with identical sequence B
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00144 Beta-lactamase Beta-lactamase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3o86A00
1LI9A 2EXAA 5A91A 4WMCA 5E43A 2Y2PA 3WS2A 4BL3A 4KQQA 4UA6A 4GKUA 4P87A 1Z6FA 3Q81A 3W4QA 3LEZA 3ZG8B 1TDLA 5E2FA 1SKFA 2DRWA 1PIOA 2WKEA 1SDNA 5FQ9A 4X69A 5DTTA 5DVAA 5HAIA 3MZFA 5HW3A 1VM1A 1MWUA 4KZ7A 4NK3A 4OONA 3OC2A 4N92A 1S0WA 3OPHA 3IF6B 4WZ5A 3UO9A 1PW8A 2Q9NA 1BT5A 3BLSA 4GD6A 2Y4AA 4PM8A 3UDXA 1GCEA 2P9VA 3IH9A 2ZD8A 1BZAA 2ZM8A 4KZ5A 2Y55A 4E3NA 1CEGA 1HZOA 2XD5A 4O7DA 5FATA 1JWPA 1NRFA 4WYYA 5I94A 1KGEA 4IEDA 5FQMA 4C75A 3JYIA 3SOIA 2Z2LB 5KSCA 1XX2A 1WE4A 4E3LA 4OPQA 1WYBA 4E3MA 1H5XA 5J8XA 1BTLA 4Y0TA 2QMIA 5CTMA 2H10A 2EX6A 4KQOA 4YINA 2IWCA 3ITAA 1ES2A 4QJGA 4DF6A 2R9WA 4KZ8A 3HUMA 1XGJA 3HLGA 4B4XA 4S2OA 3UPPA 2BG1A 3IQAA 3VFFA 1FSWA 3UPNA 2RCXA 3GR2A 4DKIA 1ONGA 2G2UA 2PU2A 1FSYA 5TR7A 1IYPA 1YLWA 3UE3A 1MKIA 4QU3A 4XUXA 2ZC5B 2CC1A 1YLJA 5DTSA 3WRZA 1K54C 4KZ4A 5CGSA 5E2GA 3RJUA 1K38A 3QNCA 4KZBA 3NIAA 3ZHHA 3IF6C 4C3QA 2ZLYA 5FAQA 5FQIA 1XP4A 2Y2OA 5L2FA 5CXWA 3V50A 1ESIA 2P9VB 1DJAA 1RGZA 3S22A 2QZ6A 2WGIA 4BD1A 4RX3A 1FQGA 3BFDA 3FYZA 5CRFA 2XGNA 1SHVA 4D2OA 5CGXA 3UDIA 1KGFA 4M3KA 4OP5A 3N8SA 3BFEA 1FR1A 3HLDA 4GZBA 4OOLA 3PBQA 4JF4A 1KE3A 4EBPA 4YFMA 3ISGA 3IXHA 4WMCD 1XGIA 3LO7A 1N9BA 4BL2A 2A3UA 4PPRA 4UAAA 5IHVA 4E3OA 4UA7A 4N9KA 3VSLA 3IWOA 2XFTA 1NYYA 1PZOA 3GQZA 4GN2A 3BRMA 3V3SA 2BLSA 3G35A 3B3XA 5U47A 1EROA 1LL9A 3VP2A 4N1XA 1K54A 4WZ4A 4OPZA 3HLEA 3DTMA 4JXWA 4OQGA 3RXWA 4BLMA 1JWZA 1W5DA 3DWKA 1HTZA 2V20A 3IF6A 1ERMA 2JCHA 3NI9A 4QD4A 3QHYA 5EE8A 3NY4A 2XLNA 3RXXA 3ITBA 4B88A 3FV7A 5CEBA 3O87A 4EUZA 3WS0A 1YT4A 1NXYA 2V1ZA 4KG6A 1KVMA 4S2LA 5CGWA 2OV5A 2WGWB 4R4SA 3MKFA 2Y2GA 3S4XA 4WZ5C 2OLVA 1IYSA 4OLDA 4XXRA 5GLDA 4P6BA 1MBLA 2HP6A 4GD8A 4OLGA 2UWXA 1KGGA 5KMWA 1BLPA 3M6HA 4DE1A 1I2WA 4QY5A 5HL1A 1WYCA 4F94A 2C6WB 2J7VA 2ZQCA 1NJ4A 1QMEA 1PI5A 1W79A 2ZC7A 2ZC3B 1TVFA 2XH9A 3HBRA 4ID4A 4E6XA 4KG5A 4ZAMA 1ZKJA 1O07A 3VP0A 4LV2A 4DE0A 3FKVA 3MBZA 2WZZA 4S2JA 3WRTA 2WK0A 4S2PA 3ZGAB 4FH4A 4DE2A 2ZM0A 2EX8A 2HPBA 1HD8A 2XK1A 4N9LA 4XUZA 4C6YA 2WYXA 4X68A 2DCFA 2WKHA 2XQZA 4RVAA 2Y2HA 4UA9A 3O3VA 3OCNA 4RA7A 4PM5A 1S6RA 5EVIB 5EECA 1RCJA 2Y2KA 1BLHA 1PI4A 3VFHA 4JXGA 3A3JA 1ERQA 2EFXA 3OPRA 1XA1A 4N1HA 1FOFA 3BLMA 3FKWA 1MXOA 4QB8A 2XEPA 3G4PA 4WM9A 4OPRA 3SS5A 4K91A 3QNBA 4KQRA 3UE0A 4GDNA 2WUQA 3SH8A 1IEMA 1ZG4A 4LV0A 3ZG9B 4FD8A 3CZDA 1ES3A 1K55C 3I7JA 3UDFA 4ZJ3A 2EXBA 4WELA 1CEFA 2HDRA 3A3IA 2WGVA 4OQIA 3WS1A 1H8YA 3ZDJA 3VOZA 1IKIA 5CHJA 5DTKA 2DNSA 3P98A 5F1GA 2XR0A 2JBFA 1K6SA 4MNRA 4R3JA 1RP5A 1HVBA 3MFDA 4EWFA 5KZHA 3ZG0A 2HDUA 2XD1A 4JF5A 1KDWA 3G30A 1ES4A 1K56A 5EVID 5GL9A 1XPBA 4ZBEA 3VSKA 2ZC4B 3Q1FA 3W8KA 1NZOA 2ZQ7A 3HLCA 1ONHA 1W8YA 2VGJA 2WAFA 2WGWA 5D3OA 1IELA 5M18A 3VP3A 4R1GA 5FI7A 4HESA 2WZXA 3C5AA 2A49A 3SH9A 3HUOA 5FI2A 1M6KA 5EVIC 1K57C 1K55A 4KZ6A 5GLAA 4EQIA 5FQQA 2EX9A 4ZTKA 5HFOA 2ZQDA 4IVKA 4LV1A 3LY4A 1W7FA 3EQUA 1NYMA 2H0YA 5F1FA 2Q9MA 1E4DA 4U0XA 3MXRA 3AGEA 5EOOA 1VQQA 4MBHA 3Q07A 4PM9A 1O7EA 1ES5A 5M1AA 4E3JA 1CI8A 4MLLA 3HVFA 1M40A 2WKIA 5AQAA 1G6AA 1OMEA 3DW0A 4PMAA 3N4IA 3E2LA 4OOMA 5JYPA 4S2MA 4LV3A 3W4OA 4MBKA 3N6IA 1K4EA 4S2NC 5HAPA 1PWDA 3G2YA 5A92A 4JF6A 2ZQAA 5EVIA 5EVLA 1K57A 3GVBA 1I2SA 3P09A 3MXSA 1PYYA 3PBSA 4OQ0A 3ZVWA 5HX9A 4KZ3A 5CTNA 5GHZA 1E25A 1FCNA 2XFSA 1FR6A 3VOYA 3GMWA 3OPPA 4B4ZA 1Q2PA 3BM6A 1IKGA 5HAQA 2Y2IA 3A3EA 3TOIA 2Y59A 3HLBA 1YLZA 4IBRA 1PZPA 2ZJ9A 3VMAA 1BULA 4X6TA 4E6WA 5GHYA 3NBLA 1YLYA 4HEFA 5EOEA 5AQ7A 3BFGA 1L0FA 1SDEA 3HL9A 5G18A 4DRTA 2Y2NA 1IYQA 4QY6A 2E8IA 5CHMA 1BLCA 4RX2A 2J8YA 3MZEA 1JTDA 4EBLA 1MWRA 1PW1A 3PAEA 4JKTA 3PAGA 3MKEA 1SCWA 3ZNTA 4A5RA 2H5SA 2ZQ9A 2ZMAA 4S2NA 1LLBA 1GHPA 1K56D 2FFYA 1N4OA 2PU4A 3MZDA 3PBRA 4IBXA 4S2IA 5FQJA 3HREA 5DF9A 3V5MA 1GA0A 3BEBA 3BYDA 4WEJA 3N7WA 1JWVA 3IH8A 3UN7A 3OPLA 5AQ9A 4NETA 1MWTA 1GHIA 3C4OA 2VGKA 3NDGA 4K0XA 4P0MA 2XF3A 3HLFA 1TEMA 5GLBA 3IF5A 4KG2A 3FZCA 4WBGA 4X55A 3EQVA 4H8RA 5FI6A 3ZCZA 3GSGA 2B5RA 1KE4A 5CECA 4GNUA 3BFCA 3BFFA 2WAEA 2Y91A 3IXGA 3ZFZA 5E2HA 5A93A 1QMFA 4GDBA 2ZM2A 3PBOA 3VP1A 5E2EA 4ZDXA 4DE3A 3C7VA 4MBFA 1BLSA 4KZAA 4Y0UA 1GA9A 5A90A 1K4FA 1XKZA 3N8RA 5M19A 2OLUA 4E3KA 4JLFA 5TFQA 1MY8A 3G2ZA 5KSHA 4LENA 2QPNA 3AGFA 4HBUA 4U0TA 2X02A 1E3UD 3VP4A 4PM7A 4ZJ2A 3UY6A 3M6BA 4GB7A 1MWSA 1TDGA 4DXBA 1G68A 5TGFA 1BSGA 3IXBA 4LCLA 1RGYA 3NCKA 3V39A 3Q7VB 1GHMA 5BOHA 2RL3A 2Z2MB 4E3IA 2FFFB 2OSUA 1FCOA 1YQSA 2X71A 4S2KA 3UE1A 4CPKA 1Q2QA 3PBNA 1EI5A 3BECA 4DDSA 4X53A 5FAPA 1XA7A 3IT9A 5FAOA 4Y7PA 1L0DA 3W4PA 1ZG6A 4CJNA 4MEZA 2R9XA 3SS4A 1LI0A 4K0WA 3UNWA 1J9MA 4EBNA 2J9PA 5EUAA 2PBYA 3E2KA 3M2KA 5CERA 5EPHA 1U60A 4R0QA 4FCFA 3DWZA 1KVLA 4OH0A 2XDMA 1KE0A 4JXSA 1MPLA 5F82A 3TG9A 1DY6A 2HDSA 3IHAA 5DF8A 3D4FA 4R3BA 2J9OA 1YM1A 3C7UA 2ZQ8A 1ESUA 3G31A 3GV9A 3LCEA 4Z9QA 3WS5A 3PBTA 3ZVTA 4R4RA 4R23A 4FH2A 2WADA 1NY0A 1YLTA 4X56A 3AGDA 2JC7A 3HLWA 1CK3A 5FA7A 4BJPA 4OPYA 3GRJA 1YMXA 5FASA 3IWIA 2V2FF 1W8QA 4PM6A 5FQKA 1E3UA 5HARA 1EWZA 1PWCA 4OP8A 3PTEA 2C5WB 1AXBA 1K25A 3CMZA 3N8LA 5JYOA 4DDYA 3CJMA 4UHUA 1L0EA 5GLCA 3CG5A 3WWXA 2H0TA 2GDNA 1C3BA 5CHUA 4OKPA 4QHCA 3LY3A 5DF7A 4ZJ1A 3M2JA 3ZG7B 1LHYA 3IWQA 1NZUA 3Q7ZA 1PWGA 5GHXA 2HP5A 3IHBA 1L2SA 4IVIA 4JPMA 4BQMA 1JVJA 4EV4A 4BENA 1Y54A 3IXDA 4WEKA 4DXCA 1BUEA 2EX2A 4U3TA 3SH7A 1XXMA 1CI9A 4Y0OA 2ZC6B 4OVDA 1IYOA 2IWBA 3S1YA 2HDQA 3OCLA 3TSGA 4RYEA 3ZG5A 5FDHA 5CEDA 3NC8A 1LL5A 4KENB 4OOYA 3V3RA 3FWLA 1L0GA 1ZC2A 2HP9A 4P85A 2Y2JA 3A3FA 3HUNA 2EFUA 3G34A 1KDSA 3Q7VA 5F83A 5FSRA 2IWDA 2Y2QA 3GTCA 1I5QA 2X01A 4HBTA 3SS3A 4OQHA 2Y2LA 1DJBA 3UPOA 1YMSA 2Y2MA 4JBFA 3NDEA 1ALQA 3OZHA 4KZ9A 1YLPA 4JXVA 4Q8IA 4BD0A 1FCMA 3O86A 1K6RA 3O88A 4L0LA 2G2WA 3Q82A 4FSFA 3ZNYA 2I72A 1H8ZA 2P74A 3C4PA 4GOGA 3A3DA 3G32A 3WS4A 1JTGA 4LCMA 2JE5A 1DJCA 5AQBA
chains in the Genus database with same CATH superfamily
1LI9A 3FC7A 4WMCA 3E98A 2Y2PA 4QPRA 4GKUA 3W4QA 1Z6FA 3CITA 5E2FA 1SKFA 1PIOA 1KOUA 1MWUA 2ZOIA 5DKKA 4OONA 2JKGA 3VE4A 4N92A 3OPHA 1YKDA 3IF6B 2G7UA 3IH9A 2V8CA 3CPTA 2XD5A 4O7DA 1N9LA 5FATA 2M7VA 5FQMA 4C75A 5KSCA 2BTFP 5F68A 4E3LA 1T19A 1V9YA 1WYBA 2D02A 5J8XA 4GS9B 1BTLA 5CTMA 4MN5A 2EX6A 1ES2A 4QJGA 1WA9A 4DF6A 2R9WA 4B4XA 4S2OA 3UPPA 3F1NA 2BG1A 3VFFA 2Z6DA 2G2UA 5TR7A 1YLWA 2ZC5B 1YLJA 3WRZA 3QNCA 4C3QA 3V50A 5IS1A 2QZ6A 4RX3A 1FQGA 2FH5A 3BFDA 1S66L 3KO6A 4D2OA 4OP5A 2W27A 4ETXA 3ISGA 3LFVA 4PPRA 4UAAA 2VKSA 4E3OA 3G35A 3B3XA 3LR3A 1EROA 4WZ4A 4OPZA 4JXWA 4X1MA 4BLMA 2JKRI 4NKPA 3NI9A 1ERMA 4QD4A 4FUWA 5EE8A 3RXXA 3NULA 4EUZA 2V1ZA 4R4SA 4WUJA 2OLVA 2QHKA 3H82B 5KMWA 4II7A 3M6HA 4QY5A 1SKOB 4KQDA 1PI5A 3TW8A 2ZC3B 1TVFA 2XH9A 3NOUC 4E6XA 2V9AA 1FILA 1ZKJA 1BYWA 4FOFA 3MBZA 4S2JA 4DE2A 4FH4A 2EX8A 2HPBA 1G6OA 2XK1A 4X68A 4D60A 1LSVA 2WKHA 4UA9A 4WN5A 3O3VA 4BWIA 1S6RA 5EVIB 2J3WA 1F5MA 1PI4A 3VFHA 3A3JA 1XA1A 1XJ4A 3QNBA 4EESA 2YKHA 3O5YA 4ZJ3A 1CEFA 4LRYC 3WS1A 1IKIA 2XR0A 2JBFA 3MFDA 4Q0JA 2OWHA 1ES4A 5EVID 4LGWA 3Q1FA 3HLCA 2WAFA 3JVUA 3VP3A 5FI7A 2WZXA 3SH9A 2PRFA 4KZ6A 1OTBA 4LLOB 4KUKA 5HFOA 2AVXA 1YPRA 4LRZE 3A0RA 3IBRA 1TS6A 3P01A 3H7WB 1O7EA 1DP9A 2ACGA 1CI8A 1G6AA 4JGQA 3E2LA 5JYPA 3W4OA 4MBKA 1P9RA 1I2SA 3P09A 3DTKA 4HJ6A 4OQ0A 3NHQA 3VOYA 3OPPA 3BM6A 3T1RA 4B93A 2Y2IA 3A3EA 3TOIA 2PAVP 1YLZA 1MKMA 4E6WA 2H28A 3NBLA 4HJ3A 4DRTA 3BFGA 1L0FA 4QY6A 3MFXA 4NXFA 1OT6A 2H5SA 1K56D 2PU4A 3EWKA 3V5MA 1GA0A 3N7WA 2INWA 3OPLA 2P08A 1MWTA 1GHIA 1NLZA 4P0MA 3HLFA 4KG2A 5CX7A 2UV0E 1S4RA 2W3HA 1ZTUA 1OPXA 3PBOA 3MQOA 5E2EA 4ZDXA 1BLSA 4KZAA 1GA9A 1L3LA 3BWLA 4HBUA 3LIBA 3CHWP 1MWSA 4CLCB 3F1PA 5TGFA 3NCKA 5DJTA 4G3KA 2RL3A 2Z2MB 3UE1A 2OSUA 2J3TD 3PBNA 1EI5A 1ACFA 4MN6A 3IT9A 1ZG6A 4CJNA 2R9XA 1LI0A 1TD5A 1J9MA 2GX5A 3E2KA 3DTIA 4R0QA 1KVLA 3IS2B 5DFXA 5EM0A 2K31A 1VETA 3P7NA 5DF8A 4UEYA 1YM1A 3CWFA 1ESUA 3GV9A 3BW6A 3PBTA 4R4RA 2WADA 4X56A 5DFYA 3AGDA 4ESPA 2JKRM 3MF0A 3IWIA 1W8QA 5HARA 1E3UA 1EWZA 4OP8A 3B47A 3PTEA 2C5WB 5F69A 5JYOA 2GZAA 4I38A 4DDYA 3CJMA 2PT7A 5GLCA 2H0TA 5CHUA 4QHCA 4DN0A 3LY3A 5DF7A 3M2JA 3E4QA 3IWQA 3KSIA 2HP5A 4EV4A 1Y54A 2Q0OA 4DXCA 2EX2A 3CAXA 5J7EA 3S1YA 3OCLA 2K2NA 3TSGA 4RYEA 3F1NB 4OOYA 3V3RA 3FPWA 2HP9A 3A3FA 3HUNA 1KDSA 2Y2QA 4PHTA 3SS3A 2HJEA 1DJBA 3UPOA 3K2NA 3NDEA 1FCMA 1K6RA 3O88A 4L0LA 5LBRA 1H8MA 2I72A 1S67L 4O8GA 2V0UA 4GOGA 3EEAA 5HD3A 1JTGA 4LCMA 5HDCA 5A91A 4BL3A 2Y8HA 4G3WA 1CF0A 2WKQA 5HAIA 5FEFA 5HDSA 1T1AA 4KZ7A 3OC2A 1S0WA 4GD6A 3BLSA 2P9VA 2ZM8A 2Y55A 3L9KA 1HZOA 2FZ0A 1JWPA 1NRFA 1KGEA 3JYIA 3KSGA 1XX2A 1WE4A 4LPZA 5HWWA 5EFWA 3MS6A 4YINA 4KQOA 3KYQA 3T4LA 5DJUA 4E04A 2PYRA 4F3LA 5HSQA 2A24A 3QP6A 4H6JA 1N9OA 4DKIA 4XT2A 3T4JA 4XUXA 4QU3A 2W0NA 5DTSA 5CGSA 4KZBA 3ZHHA 4EEUA 5FAQA 5L2FA 1ESIA 2L1MA 1DJAA 1RGZA 2VJWA 4BBVA 3LIEA 5HWVA 3FYZA 5CRFA 1SHVA 3V67A 5L10A 3UDIA 4JF4A 1KE3A 1XJ3A 4YFMA 1XGIA 3K3CA 2OAP1 4BL2A 2A3UA 3R7WB 3IWOA 4Y3IA 2XFTA 1NYYA 1PZOA 3BRMA 3R4KA 3HLEA 4OQGA 1JWZA 2V20A 3QHYA 2XLNA 3ITBA 5CEBA 4X25A 1KVMA 5CGWA 2OV5A 3S7OA 2Y2GA 3S4XA 3EGXC 2UWXA 3NOTC 4P6ZM 1J3WA 4DE1A 2C6WB 1LL8A 4EXOA 4WF0A 5MC7A 3VP0A 4HIAA 3ZGAB 4RQ9A 3T1XA 3KSFA 5HPIA 4N9LA 3BJNA 3T1SA 5G4YA 4DJ2A 4RVAA 5J3WA 3OCNA 4RA7A 3NECA 3MXQA 4PM5A 5EECA 4JXGA 4N1HA 5AJGA 3FKWA 4QB8A 2XEPA 4Y17A 2O9CA 3UE0A 4LV0A 1V9ZA 1K55C 4EERA 3A3IA 4OQIA 1H8YA 3ZDJA 3ZYTA 4MNRA 4EWFA 3ZG0A 2HDUA 2XD1A 3OOVA 5GL9A 2ZC4B 4G3VA 3W8KA 3C30A 1NZOA 3EGDC 2ZQ7A 1W8YA 5D3OA 1STZA 5EV0A 3S7NA 1M6KA 1K55A 2VV8A 3K3DA 2EX9A 1Y28A 2ZQDA 4LV1A 3LY4A 1W7FA 3EQUA 4YNRA 2Q9MA 3MXRA 2ZMFA 4PM9A 5M1AA 4E3JA 3F1OB 4OOMA 3VV4A 4P6ZS 3UB7A 4JF6A 5EVLA 3PBSA 4KZ3A 3QP2A 2V0WA 1FR6A 2EWWA 1OJ5A 3GMWA 4B4ZA 1Q2PA 3LUQA 2KDKA 1VETB 4IBRA 3E0YA 2ZJ9A 1P97A 2MJ6A 3T1QB 2B95A 2P04A 4LFUA 1SDEA 2W3EA 2Y2NA 3RTYA 2E8IA 1BLCA 3LICA 1JTDA 4R6LA 4M4XA 3PAEA 2QJ7A 1G5UA 3UE6A 3T4QA 2ZQ9A 2ZMAA 1GHPA 5FEGA 3HREA 5DF9A 2VK3A 4ZRRA 1G28A 3QP5A 4WEJA 2HV1A 4O0PA 1Y4OA 1TEMA 4WBGA 3FZCA 4X55A 3GSGA 1KE4A 1PNEA 2WAEA 5E2HA 4HNBA 1QMFA 3C7VA 2ZOHA 4Y0UA 2HJ9C 1OTIA 2OLUA 2LB9A 3B42A 5TFQA 1MY8A 3G2ZA 5KSHA 3AGFA 1E3UD 3VP4A 3M6BA 1TDGA 2VV6A 1CQAA 1BSGA 3IXBA 3ZQ5A 4CPKA 4S2KA 4B9OA 3H9WA 5FL3A 4NXEA 4X53A 1W63M 1XA7A 1L0DA 3W4PA 3MQQA 3MSHA 3DWZA 4OH0A 3TG9A 5F82A 3IHAA 3D4FA 4R3BA 2V8FA 3C7UA 3BY8A 3G31A 3LCEA 4NXBA 1HLUP 3WS5A 3PXPA 3ZVTA 4FH2A 1NY0A 1YLTA 3L7HA 2JC7A 5L09A 4BJPA 4HY8A 1VEUA 2V2FF 5TBMA 4GHIA 5EM1A 1AXBA 1K25A 3CMZA 3N8LA 3DTEA 1P9WA 2GDNA 1C3BA 3D72A 4Y15A 1LHYA 4CQHA 1NZUA 4HH2A 4EW7A 1PWGA 3HCYA 5J4EA 1L2SA 3LI9A 5A8BA 4BENA 2W3FA 4OVDA 3EEHA 1EW0A 4IUHA 5FDHA 2YKFA 2A24B 3T12B 2PR5A 4H6JB 1L0GA 4MDZA 4XT2B 2EFUA 3GDIA 3Q7VA 3GTCA 4HBTA 4DMZA 1SZVA 1YMSA 2Y2MA 1ALQA 4KZ9A 1YLPA 4JXVA 4GS9A 4BD0A 3O86A 4HHDA 2G2WA 3Q82A 4FSFA 2OAQ1 1PRQA 2P74A 3A3DA 3G32A 3UMDA 5E43A 3BQ8A 2K7SA 3WS2A 4KQQA 4ARZA 4P87A 3Q81A 2O9BA 3ZG8B 2DRWA 2WKEA 4QWOA 1DP6A 4WZ5A 1PW8A 2Q9NA 2Y4AA 4PM8A 3UDXA 2ZD8A 1BZAA 4E3NA 1CEGA 3ICYA 5I94A 1TF1A 4IEDA 2Z2LB 4OPQA 1H5XA 4Y0TA 1D1JA 3ITAA 4IHQA 3MMHA 1XGJA 4HP4A 3KSHA 3IQAA 1FSWA 5G4ZA 4CLCD 2RCXA 3GR2A 1ONGA 3RH8B 2PU2A 2O99A 1MKIA 3IX3A 1K38A 2Y2OA 3S22A 2BASA 2WGIA 4BD1A 1T1BA 3CPTB 5C5KA 2XGNA 1YAXA 3T50A 1KGFA 3BFEA 1FR1A 3HLDA 4GZBA 4EBPA 3IXHA 4WMCD 4NXGA 5IHVA 4UA7A 3VSLA 3V3SA 3GQZA 2BLSA 5U47A 1ZHHB 4N1XA 3RXWA 3DWKA 4O01A 1HTZA 1AWIA 2ZL1A 3FV7A 2B18A 2IA2A 3O87A 2B02A 1YT4A 2QYBA 3MKFA 4IJGA 3G6OA 3T4KA 4OLDA 4P6BA 2HP6A 4OLGA 1BLPA 1TS8A 3NOPC 1I2WA 1T1CA 2XRNA 1WYCA 2J7VA 4EQ1A 1F2KA 1W79A 2ZC7A 3HBRA 4KG5A 4ZAMA 4HI4A 2L0WA 1O07A 2JHEA 1S1ZA 3TRCA 4LV2A 4DE0A 3FKVA 2WK0A 4S2PA 2ZM0A 3PHYA 1HD8A 4BBTA 4C6YA 2DCFA 2XQZA 2Y2HA 4Q0IA 2Y2KA 1BLHA 3LIDA 3BLMA 4MCWA 3G4PA 4OPRA 3SS5A 4K91A 2D01A 3LYXA 2HGVA 2W1TA 3SH8A 4WLAA 4FD8A 4JGPA 2JKFA 1ES3A 3CZDA 4WELA 1UWPX 3H7WA 5CHJA 5DTKA 3P98A 1HVBA 4Z1WA 2W1RA 5DKLA 3LI8A 4JF5A 2M7UA 1K56A 4I39A 4ZBEA 3UMEA 2VGJA 2WGWA 1N9NA 1IELA 4R1GA 4HESA 2A49A 5FI2A 4EQIA 2XA7M 4ZTKA 1S1YA 2VGLM 2H0YA 4U0XA 5EOOA 3UB8A 3ULFA 4EUVA 4MBHA 3Q07A 4GCZA 2WKIA 5AQAA 5AVFA 1ODVA 1TS0A 3QP8A 4LV3A 3PYPA 1K4EA 4S2NC 3TE8A 3G2YA 5A92A 4Y5FA 1PYYA 1VHMA 5HX9A 5GHZA 1E25A 1FCNA 4R70A 3HJIA 2Y59A 3HLBA 1PZPA 5AVEA 3VMAA 2GJ3A 1FIKA 2V1AA 4YWZA 5GHYA 1YLYA 5G18A 5EOEA 5AQ7A 3HL9A 4I3IA 4RX2A 3UB5P 2WKPA 1VEUB 1MWRA 4L9GA 5TBMB 3A0SA 3PAGA 3MKEA 4GHIB 3ZNTA 2KOIA 4S2NA 2FFYA 2VZWA 4IBXA 3MZDA 3U4LP 1F9IA 5FQJA 1TS7A 1D06A 1JWVA 3IH8A 2W3GA 5AQ9A 4NETA 4MMNA 3C4OA 3IS2A 2VGKA 2V1BA 2XF3A 3IF5A 5FI6A 5KIZA 2WKRA 3ZCZA 2B5RA 4GNUA 3BFFA 3IXGA 5A93A 3ZFZA 3VP1A 4DE3A 4MBFA 5A90A 2JKTI 1XKZA 5IT5A 3N8RA 2QPNA 1CJFA 2X02A 2CMNA 2VLGA 1YSPA 4GB7A 5TJJA 1K0KA 4DXBA 1RGYA 3V39A 3Q7VB 4E3IA 4HOIA 2X71A 1Q2QA 2O9AA 3BECA 4BBUA 5FAPA 5FAOA 4Y7PA 2XA7S 3SZTA 2I9VA 4MEZA 4EBNA 4UQIM 5EUAA 3M2KA 2VGLS 1U60A 4K08A 2PDRA 4FCFA 5L8MA 2XDMA 1KE0A 4JXSA 1MPLA 1DY6A 2HDSA 2J9OA 2ZQ8A 4Z9QA 3LIAA 1F98A 4R23A 4ARZB 1VB6A 3KYEA 5FA7A 5FASA 4PM6A 1XJ6A 3F1PB 4UHUA 3CG5A 3MR0A 3CLOA 4Y2FA 1OT9A 4OKPA 4ZJ1A 4Q0HA 3ZG7B 3Q7ZA 5GHXA 3IHBA 4JPMA 4LRXC 4BQMA 1JVJA 3IXDA 2L4RA 4U3TA 1XXMA 1CI9A 2VA0A 1IYOA 2IWBA 4AFIA 2HDQA 5FDSA 3ZG5A 3NC8A 1LL5A 4PKYA 2XROA 1GSWA 4EEPA 4P85A 3KX0X 1IOUA 3G34A 5F83A 5FSRA 1NWZA 5L07A 1I5QA 2X01A 4OQHA 2Y2LA 2VEAA 3LIFA 3RFBA 4IUKA 4JBFA 3OZHA 4Q8IA 3ZNYA 1H8ZA 3WS4A 3IX4A 2JE5A 1DJCA 2EXAA 1MZUA 4UA6A 3C8CA 3LEZA 1TDLA 4NEED 2GNXA 1SDNA 5FQ9A 4X69A 5DTTA 1PFLA 5DVAA 3MZFA 5HW3A 1VM1A 2ZMVA 4UQIS 1GSXA 4NK3A 3UO9A 1BT5A 2ZL1B 1GCEA 2EWVA 4KZ5A 2KLIA 3NJAA 1UWNX 4WYYA 1LSWA 3SOIA 1LSXA 4E3MA 2QMIA 1LT0A 2H10A 3JVVA 2IWCA 2PHYA 1H3QA 3R7WA 4L9EA 4KZ8A 3HUMA 3HLGA 3QP1A 2EA9A 1OTDA 3UPNA 1FSYA 5F5YA 1X0OA 1IYPA 3UE3A 3T4SA 2CC1A 1K54C 4KZ4A 5E2GA 3RJUA 3NIAA 3IF6C 2ZLYA 2W3DA 5FQIA 1XP4A 5CXWA 2P9VB 2DMWA 3LR0A 2M1CA 3QP4A 5CGXA 2W1TB 4M3KA 3N8SA 4NG2A 4DJ3A 3DAVA 4OOLA 3PBQA 3D3OA 3LO7A 1N9BA 4N9KA 4F3LB 4GN2A 2A2LA 3MQ0A 2OOLA 4PAUA 1LL9A 3VP2A 2Z6CA 1K54A 3DTMA 1W5DA 5F6AA 3IF6A 2QJ5A 2JCHA 3EOIA 4B88A 3SW1A 3NY4A 4JGRA 3WS0A 1NXYA 4KG6A 3S7PA 4S2LA 1XJ2A 2WGWB 3T4OA 4MN7A 4WZ5C 4XXRA 1IYSA 5GLDA 3BQAA 1MBLA 4GD8A 2JKTM 1KGGA 5HL1A 5K5BA 4F94A 1OJGA 2PD7A 2ZQCA 3JPUA 1NJ4A 1QMEA 5HPFA 4ID4A 2VV7A 2WZZA 4I3AA 3WRTA 5HZHA 1DP8A 1D7EA 4XUZA 2WYXA 2XSSA 1RCJA 2OWJA 3OLOA 1ERQA 2EFXA 3OPRA 3IX8A 1FOFA 5HD5A 1MXOA 4WM9A 4EETB 4KQRA 4GDNA 2WUQA 1IEMA 1ZG4A 3ZG9B 3I7JA 3UDFA 3FPVA 2EXBA 2HDRA 2HZ5A 3LR4A 3BY9A 2WGVA 2O0YA 3VOZA 2DNSA 5F1GA 1K6SA 4R3JA 1RP5A 3F1OA 5KZHA 1OTAA 3LR5A 2HF6A 1KDWA 3G30A 1XPBA 3FG8A 3VSKA 3CUEC 4I5SA 2NUTC 5EVEA 4R38A 1ONHA 1S4SA 5HDDA 4KUOA 3C5AA 3HUOA 5EVIC 1K57C 2JN7A 3H82A 5GLAA 3TJZC 5FQQA 1SKOA 3MJQA 2R78A 3OBFA 3C38A 4IVKA 4I3JA 1NYMA 5F1FA 1E4DA 3A0VA 3AGEA 4YOFA 3VOLA 1VQQA 1A0KA 2E8JA 3E4PA 1ES5A 4MLLA 4GW9A 3HVFA 1M40A 1OMEA 3DW0A 4PMAA 3N4IA 3CUEA 4S2MA 3N6IA 3U2AA 3UB6A 2KX6A 2P7JA 1PWDA 5HAPA 5EVIA 2ZQAA 1K57A 3GVBA 3MXSA 3ZVWA 5CTNA 4L9FA 2XFSA 4ME4A 3HJKA 1IKGA 2PD8A 5HAQA 2ZBBA 1BULA 4X6TA 4GJ4A 4HEFA 1IYQA 4HQAA 1IFQA 1Z09A 3C2WA 5CHMA 2VX8A 2J8YA 3MZEA 4EBLA 1PW1A 2NUPC 4JKTA 5I5LA 1SCWA 4A5RA 3CI6A 1LLBA 4S2IA 1N4OA 5M18A 3PBRA 3BYDA 3BEBA 3UN7A 4GLQA 1H0MA 1T18A 3D9YA 3T4TA 3NDGA 4K0XA 3B33A 4WL9A 5GLBA 3EQVA 4H8RA 4HJ4A 5CECA 3BFCA 2J80A 2Y91A 4GDBA 2ZM2A 2QWSA 4CLCE 1K4FA 1NLYA 5M19A 4E3KA 4JLFA 1P0ZA 4LENA 4U0TA 4PM7A 4ZJ2A 3UY6A 1NRJA 2PBDP 1G68A 4LCLA 3VE3A 1GHMA 5BOHA 2FFFB 1FCOA 1YQSA 4EU0A 4DDSA 3SS4A 3PR6A 4K0WA 3UNWA 1W63Q 2J9PA 2PBYA 5CERA 2PR6A 5EPHA 2J3TC 3UB9A 1XFQA 5HL6A 5IU1A 3IBJA 3HLWA 1CK3A 1OTEA 4PKYG 4OPYA 3GRJA 1YMXA 5FQKA 4HH3A 1PWCA 4CLCC 1L0EA 1YSQA 3WWXA 3W2ZA 1GSVA 5HWTA 3S7QA 4X1LA 2QKPA 4IVIA 4JGOA 2LB5A 4WEKA 1BUEA 3SH7A 4Y13A 4HP9A 4Y0OA 2ZC6B 3KYZA 3DBAA 5CEDA 4KENB 3FWLA 1ZC2A 3LEQA 4CLCA 1XFNA 2Y2JA 1UGUA 2IWDA 3E4OA 4BMWA 4FTXA 1DRMA 4ETZA 2PYPA 1JNUA 4R3AA 3LGOA 3C4PA 5AQBA 1MC0A 3GECA 2Y79A
chains in the Genus database with same CATH topology
1LI9A 2EXAA 5A91A 4WMCA 5E43A 2Y2PA 3WS2A 4BL3A 4KQQA 4UA6A 4GKUA 4P87A 1Z6FA 3Q81A 3W4QA 3LEZA 3ZG8B 1TDLA 5E2FA 1SKFA 2DRWA 1PIOA 2WKEA 1SDNA 5FQ9A 4X69A 5DTTA 5DVAA 5HAIA 3MZFA 5HW3A 1VM1A 1MWUA 4KZ7A 4NK3A 4OONA 3OC2A 4N92A 1S0WA 3OPHA 3IF6B 4WZ5A 3UO9A 1PW8A 2Q9NA 1BT5A 3BLSA 4GD6A 2Y4AA 4PM8A 3UDXA 1GCEA 2P9VA 3IH9A 2ZD8A 1BZAA 2ZM8A 4KZ5A 2Y55A 4E3NA 1CEGA 1HZOA 2XD5A 4O7DA 5FATA 1JWPA 1NRFA 4WYYA 5I94A 1KGEA 4IEDA 5FQMA 4C75A 3JYIA 3SOIA 2Z2LB 5KSCA 1XX2A 1WE4A 4E3LA 4OPQA 1WYBA 4E3MA 1H5XA 5J8XA 1BTLA 4Y0TA 2QMIA 5CTMA 2H10A 2EX6A 4KQOA 4YINA 2IWCA 3ITAA 1ES2A 4QJGA 4DF6A 2R9WA 4KZ8A 3HUMA 1XGJA 3HLGA 4B4XA 4S2OA 3UPPA 2BG1A 3IQAA 3VFFA 1FSWA 3UPNA 2RCXA 3GR2A 4DKIA 1ONGA 2G2UA 2PU2A 1FSYA 5TR7A 1IYPA 1YLWA 3UE3A 1MKIA 4QU3A 4XUXA 2ZC5B 2CC1A 1YLJA 5DTSA 3WRZA 1K54C 4KZ4A 5CGSA 5E2GA 3RJUA 1K38A 3QNCA 4KZBA 3NIAA 3ZHHA 3IF6C 4C3QA 2ZLYA 5FAQA 5FQIA 1XP4A 2Y2OA 5L2FA 5CXWA 3V50A 1ESIA 2P9VB 1DJAA 1RGZA 3S22A 2QZ6A 2WGIA 4BD1A 4RX3A 1FQGA 3BFDA 3FYZA 5CRFA 2XGNA 1SHVA 4D2OA 5CGXA 3UDIA 1KGFA 4M3KA 4OP5A 3N8SA 3BFEA 1FR1A 3HLDA 4GZBA 4OOLA 3PBQA 4JF4A 1KE3A 4EBPA 4YFMA 3ISGA 3IXHA 4WMCD 1XGIA 3LO7A 1N9BA 4BL2A 2A3UA 4PPRA 4UAAA 5IHVA 4E3OA 4UA7A 4N9KA 3VSLA 3IWOA 2XFTA 1NYYA 1PZOA 3GQZA 4GN2A 3BRMA 3V3SA 2BLSA 3G35A 3B3XA 5U47A 1EROA 1LL9A 3VP2A 4N1XA 1K54A 4WZ4A 4OPZA 3HLEA 3DTMA 4JXWA 4OQGA 3RXWA 4BLMA 1JWZA 1W5DA 3DWKA 1HTZA 2V20A 3IF6A 1ERMA 2JCHA 3NI9A 4QD4A 3QHYA 5EE8A 3NY4A 2XLNA 3RXXA 3ITBA 4B88A 3FV7A 5CEBA 3O87A 4EUZA 3WS0A 1YT4A 1NXYA 2V1ZA 4KG6A 1KVMA 4S2LA 5CGWA 2OV5A 2WGWB 4R4SA 3MKFA 2Y2GA 3S4XA 4WZ5C 2OLVA 1IYSA 4OLDA 4XXRA 5GLDA 4P6BA 1MBLA 2HP6A 4GD8A 4OLGA 2UWXA 1KGGA 5KMWA 1BLPA 3M6HA 4DE1A 1I2WA 4QY5A 5HL1A 1WYCA 4F94A 2C6WB 2J7VA 2ZQCA 1NJ4A 1QMEA 1PI5A 1W79A 2ZC7A 2ZC3B 1TVFA 2XH9A 3HBRA 4ID4A 4E6XA 4KG5A 4ZAMA 1ZKJA 1O07A 3VP0A 4LV2A 4DE0A 3FKVA 3MBZA 2WZZA 4S2JA 3WRTA 2WK0A 4S2PA 3ZGAB 4FH4A 4DE2A 2ZM0A 2EX8A 2HPBA 1HD8A 2XK1A 4N9LA 4XUZA 4C6YA 2WYXA 4X68A 2DCFA 2WKHA 2XQZA 4RVAA 2Y2HA 4UA9A 3O3VA 3OCNA 4RA7A 4PM5A 1S6RA 5EVIB 5EECA 1RCJA 2Y2KA 1BLHA 1PI4A 3VFHA 4JXGA 3A3JA 1ERQA 2EFXA 3OPRA 1XA1A 4N1HA 1FOFA 3BLMA 3FKWA 1MXOA 4QB8A 2XEPA 3G4PA 4WM9A 4OPRA 3SS5A 4K91A 3QNBA 4KQRA 3UE0A 4GDNA 2WUQA 3SH8A 1IEMA 1ZG4A 4LV0A 3ZG9B 4FD8A 3CZDA 1ES3A 1K55C 3I7JA 3UDFA 4ZJ3A 2EXBA 4WELA 1CEFA 2HDRA 3A3IA 2WGVA 4OQIA 3WS1A 1H8YA 3ZDJA 3VOZA 1IKIA 5CHJA 5DTKA 2DNSA 3P98A 5F1GA 2XR0A 2JBFA 1K6SA 4MNRA 4R3JA 1RP5A 1HVBA 3MFDA 4EWFA 5KZHA 3ZG0A 2HDUA 2XD1A 4JF5A 1KDWA 3G30A 1ES4A 1K56A 5EVID 5GL9A 1XPBA 4ZBEA 3VSKA 2ZC4B 3Q1FA 3W8KA 1NZOA 2ZQ7A 3HLCA 1ONHA 1W8YA 2VGJA 2WAFA 2WGWA 5D3OA 1IELA 5M18A 3VP3A 4R1GA 5FI7A 4HESA 2WZXA 3C5AA 2A49A 3SH9A 3HUOA 5FI2A 1M6KA 5EVIC 1K57C 1K55A 4KZ6A 5GLAA 4EQIA 5FQQA 2EX9A 4ZTKA 5HFOA 2ZQDA 4IVKA 4LV1A 3LY4A 1W7FA 3EQUA 1NYMA 2H0YA 5F1FA 2Q9MA 1E4DA 4U0XA 3MXRA 3AGEA 5EOOA 1VQQA 4MBHA 3Q07A 4PM9A 1O7EA 1ES5A 5M1AA 4E3JA 1CI8A 4MLLA 3HVFA 1M40A 2WKIA 5AQAA 1G6AA 1OMEA 3DW0A 4PMAA 3N4IA 3E2LA 4OOMA 5JYPA 4S2MA 4LV3A 3W4OA 4MBKA 3N6IA 1K4EA 4S2NC 5HAPA 1PWDA 3G2YA 5A92A 4JF6A 2ZQAA 5EVIA 5EVLA 1K57A 3GVBA 1I2SA 3P09A 3MXSA 1PYYA 3PBSA 4OQ0A 3ZVWA 5HX9A 4KZ3A 5CTNA 5GHZA 1E25A 1FCNA 2XFSA 1FR6A 3VOYA 3GMWA 3OPPA 4B4ZA 1Q2PA 3BM6A 1IKGA 5HAQA 2Y2IA 3A3EA 3TOIA 2Y59A 3HLBA 1YLZA 4IBRA 1PZPA 2ZJ9A 3VMAA 1BULA 4X6TA 4E6WA 5GHYA 3NBLA 1YLYA 4HEFA 5EOEA 5AQ7A 3BFGA 1L0FA 1SDEA 3HL9A 5G18A 4DRTA 2Y2NA 1IYQA 4QY6A 2E8IA 5CHMA 1BLCA 4RX2A 2J8YA 3MZEA 1JTDA 4EBLA 1MWRA 1PW1A 3PAEA 4JKTA 3PAGA 3MKEA 1SCWA 3ZNTA 4A5RA 2H5SA 2ZQ9A 2ZMAA 4S2NA 1LLBA 1GHPA 1K56D 2FFYA 1N4OA 2PU4A 3MZDA 3PBRA 4IBXA 4S2IA 5FQJA 3HREA 5DF9A 3V5MA 1GA0A 3BEBA 3BYDA 4WEJA 3N7WA 1JWVA 3IH8A 3UN7A 3OPLA 5AQ9A 4NETA 1MWTA 1GHIA 3C4OA 2VGKA 3NDGA 4K0XA 4P0MA 2XF3A 3HLFA 1TEMA 5GLBA 3IF5A 4KG2A 3FZCA 4WBGA 4X55A 3EQVA 4H8RA 5FI6A 3ZCZA 3GSGA 2B5RA 1KE4A 5CECA 4GNUA 3BFCA 3BFFA 2WAEA 2Y91A 3IXGA 3ZFZA 5E2HA 5A93A 1QMFA 4GDBA 2ZM2A 3PBOA 3VP1A 5E2EA 4ZDXA 4DE3A 3C7VA 4MBFA 1BLSA 4KZAA 4Y0UA 1GA9A 5A90A 1K4FA 1XKZA 3N8RA 5M19A 2OLUA 4E3KA 4JLFA 5TFQA 1MY8A 3G2ZA 5KSHA 4LENA 2QPNA 3AGFA 4HBUA 4U0TA 2X02A 1E3UD 3VP4A 4PM7A 4ZJ2A 3UY6A 3M6BA 4GB7A 1MWSA 1TDGA 4DXBA 1G68A 5TGFA 1BSGA 3IXBA 4LCLA 1RGYA 3NCKA 3V39A 3Q7VB 1GHMA 5BOHA 2RL3A 2Z2MB 4E3IA 2FFFB 2OSUA 1FCOA 1YQSA 2X71A 4S2KA 3UE1A 4CPKA 1Q2QA 3PBNA 1EI5A 3BECA 4DDSA 4X53A 5FAPA 1XA7A 3IT9A 5FAOA 4Y7PA 1L0DA 3W4PA 1ZG6A 4CJNA 4MEZA 2R9XA 3SS4A 1LI0A 4K0WA 3UNWA 1J9MA 4EBNA 2J9PA 5EUAA 2PBYA 3E2KA 3M2KA 5CERA 5EPHA 1U60A 4R0QA 4FCFA 3DWZA 1KVLA 4OH0A 2XDMA 1KE0A 4JXSA 1MPLA 5F82A 3TG9A 1DY6A 2HDSA 3IHAA 5DF8A 3D4FA 4R3BA 2J9OA 1YM1A 3C7UA 2ZQ8A 1ESUA 3G31A 3GV9A 3LCEA 4Z9QA 3WS5A 3PBTA 3ZVTA 4R4RA 4R23A 4FH2A 2WADA 1NY0A 1YLTA 4X56A 3AGDA 2JC7A 3HLWA 1CK3A 5FA7A 4BJPA 4OPYA 3GRJA 1YMXA 5FASA 3IWIA 2V2FF 1W8QA 4PM6A 5FQKA 1E3UA 5HARA 1EWZA 1PWCA 4OP8A 3PTEA 2C5WB 1AXBA 1K25A 3CMZA 3N8LA 5JYOA 4DDYA 3CJMA 4UHUA 1L0EA 5GLCA 3CG5A 3WWXA 2H0TA 2GDNA 1C3BA 5CHUA 4OKPA 4QHCA 3LY3A 5DF7A 4ZJ1A 3M2JA 3ZG7B 1LHYA 3IWQA 1NZUA 3Q7ZA 1PWGA 5GHXA 2HP5A 3IHBA 1L2SA 4IVIA 4JPMA 4BQMA 1JVJA 4EV4A 4BENA 1Y54A 3IXDA 4WEKA 4DXCA 1BUEA 2EX2A 4U3TA 3SH7A 1XXMA 1CI9A 4Y0OA 2ZC6B 4OVDA 1IYOA 2IWBA 3S1YA 2HDQA 3OCLA 3TSGA 4RYEA 3ZG5A 5FDHA 5CEDA 3NC8A 1LL5A 4KENB 4OOYA 3V3RA 3FWLA 1L0GA 1ZC2A 2HP9A 4P85A 2Y2JA 3A3FA 3HUNA 2EFUA 3G34A 1KDSA 3Q7VA 5F83A 5FSRA 2IWDA 2Y2QA 3GTCA 1I5QA 2X01A 4HBTA 3SS3A 4OQHA 2Y2LA 1DJBA 3UPOA 1YMSA 2Y2MA 4JBFA 3NDEA 1ALQA 3OZHA 4KZ9A 1YLPA 4JXVA 4Q8IA 4BD0A 1FCMA 3O86A 1K6RA 3O88A 4L0LA 2G2WA 3Q82A 4FSFA 3ZNYA 2I72A 1H8ZA 2P74A 3C4PA 4GOGA 3A3DA 3G32A 3WS4A 1JTGA 4LCMA 2JE5A 1DJCA 5AQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LI9 A;  2EXA A;  5A91 A;  4WMC A;  5E43 A;  2Y2P A;  3WS2 A;  4BL3 A;  4KQQ A;  4UA6 A;  4GKU A;  4P87 A;  1Z6F A;  3Q81 A;  3W4Q A;  3LEZ A;  3ZG8 B;  1TDL A;  5E2F A;  1SKF A;  2DRW A;  1PIO A;  2WKE A;  1SDN A;  5FQ9 A;  4X69 A;  5DTT A;  5DVA A;  5HAI A;  3MZF A;  5HW3 A;  1VM1 A;  1MWU A;  4KZ7 A;  4NK3 A;  4OON A;  3OC2 A;  4N92 A;  1S0W A;  3OPH A;  3IF6 B;  4WZ5 A;  3UO9 A;  1PW8 A;  2Q9N A;  1BT5 A;  3BLS A;  4GD6 A;  2Y4A A;  4PM8 A;  3UDX A;  1GCE A;  2P9V A;  3IH9 A;  2ZD8 A;  1BZA A;  2ZM8 A;  4KZ5 A;  2Y55 A;  4E3N A;  1CEG A;  1HZO A;  2XD5 A;  4O7D A;  5FAT A;  1JWP A;  1NRF A;  4WYY A;  5I94 A;  1KGE A;  4IED A;  5FQM A;  4C75 A;  3JYI A;  3SOI A;  2Z2L B;  5KSC A;  1XX2 A;  1WE4 A;  4E3L A;  4OPQ A;  1WYB A;  4E3M A;  1H5X A;  5J8X A;  1BTL A;  4Y0T A;  2QMI A;  5CTM A;  2H10 A;  2EX6 A;  4KQO A;  4YIN A;  2IWC A;  3ITA A;  1ES2 A;  4QJG A;  4DF6 A;  2R9W A;  4KZ8 A;  3HUM A;  1XGJ A;  3HLG A;  4B4X A;  4S2O A;  3UPP A;  2BG1 A;  3IQA A;  3VFF A;  1FSW A;  3UPN A;  2RCX A;  3GR2 A;  4DKI A;  1ONG A;  2G2U A;  2PU2 A;  1FSY A;  5TR7 A;  1IYP A;  1YLW A;  3UE3 A;  1MKI A;  4QU3 A;  4XUX A;  2ZC5 B;  2CC1 A;  1YLJ A;  5DTS A;  3WRZ A;  1K54 C;  4KZ4 A;  5CGS A;  5E2G A;  3RJU A;  1K38 A;  3QNC A;  4KZB A;  3NIA A;  3ZHH A;  3IF6 C;  4C3Q A;  2ZLY A;  5FAQ A;  5FQI A;  1XP4 A;  2Y2O A;  5L2F A;  5CXW A;  3V50 A;  1ESI A;  2P9V B;  1DJA A;  1RGZ A;  3S22 A;  2QZ6 A;  2WGI A;  4BD1 A;  4RX3 A;  1FQG A;  3BFD A;  3FYZ A;  5CRF A;  2XGN A;  1SHV A;  4D2O A;  5CGX A;  3UDI A;  1KGF A;  4M3K A;  4OP5 A;  3N8S A;  3BFE A;  1FR1 A;  3HLD A;  4GZB A;  4OOL A;  3PBQ A;  4JF4 A;  1KE3 A;  4EBP A;  4YFM A;  3ISG A;  3IXH A;  4WMC D;  1XGI A;  3LO7 A;  1N9B A;  4BL2 A;  2A3U A;  4PPR A;  4UAA A;  5IHV A;  4E3O A;  4UA7 A;  4N9K A;  3VSL A;  3IWO A;  2XFT A;  1NYY A;  1PZO A;  3GQZ A;  4GN2 A;  3BRM A;  3V3S A;  2BLS A;  3G35 A;  3B3X A;  5U47 A;  1ERO A;  1LL9 A;  3VP2 A;  4N1X A;  1K54 A;  4WZ4 A;  4OPZ A;  3HLE A;  3DTM A;  4JXW A;  4OQG A;  3RXW A;  4BLM A;  1JWZ A;  1W5D A;  3DWK A;  1HTZ A;  2V20 A;  3IF6 A;  1ERM A;  2JCH A;  3NI9 A;  4QD4 A;  3QHY A;  5EE8 A;  3NY4 A;  2XLN A;  3RXX A;  3ITB A;  4B88 A;  3FV7 A;  5CEB A;  3O87 A;  4EUZ A;  3WS0 A;  1YT4 A;  1NXY A;  2V1Z A;  4KG6 A;  1KVM A;  4S2L A;  5CGW A;  2OV5 A;  2WGW B;  4R4S A;  3MKF A;  2Y2G A;  3S4X A;  4WZ5 C;  2OLV A;  1IYS A;  4OLD A;  4XXR A;  5GLD A;  4P6B A;  1MBL A;  2HP6 A;  4GD8 A;  4OLG A;  2UWX A;  1KGG A;  5KMW A;  1BLP A;  3M6H A;  4DE1 A;  1I2W A;  4QY5 A;  5HL1 A;  1WYC A;  4F94 A;  2C6W B;  2J7V A;  2ZQC A;  1NJ4 A;  1QME A;  1PI5 A;  1W79 A;  2ZC7 A;  2ZC3 B;  1TVF A;  2XH9 A;  3HBR A;  4ID4 A;  4E6X A;  4KG5 A;  4ZAM A;  1ZKJ A;  1O07 A;  3VP0 A;  4LV2 A;  4DE0 A;  3FKV A;  3MBZ A;  2WZZ A;  4S2J A;  3WRT A;  2WK0 A;  4S2P A;  3ZGA B;  4FH4 A;  4DE2 A;  2ZM0 A;  2EX8 A;  2HPB A;  1HD8 A;  2XK1 A;  4N9L A;  4XUZ A;  4C6Y A;  2WYX A;  4X68 A;  2DCF A;  2WKH A;  2XQZ A;  4RVA A;  2Y2H A;  4UA9 A;  3O3V A;  3OCN A;  4RA7 A;  4PM5 A;  1S6R A;  5EVI B;  5EEC A;  1RCJ A;  2Y2K A;  1BLH A;  1PI4 A;  3VFH A;  4JXG A;  3A3J A;  1ERQ A;  2EFX A;  3OPR A;  1XA1 A;  4N1H A;  1FOF A;  3BLM A;  3FKW A;  1MXO A;  4QB8 A;  2XEP A;  3G4P A;  4WM9 A;  4OPR A;  3SS5 A;  4K91 A;  3QNB A;  4KQR A;  3UE0 A;  4GDN A;  2WUQ A;  3SH8 A;  1IEM A;  1ZG4 A;  4LV0 A;  3ZG9 B;  4FD8 A;  3CZD A;  1ES3 A;  1K55 C;  3I7J A;  3UDF A;  4ZJ3 A;  2EXB A;  4WEL A;  1CEF A;  2HDR A;  3A3I A;  2WGV A;  4OQI A;  3WS1 A;  1H8Y A;  3ZDJ A;  3VOZ A;  1IKI A;  5CHJ A;  5DTK A;  2DNS A;  3P98 A;  5F1G A;  2XR0 A;  2JBF A;  1K6S A;  4MNR A;  4R3J A;  1RP5 A;  1HVB A;  3MFD A;  4EWF A;  5KZH A;  3ZG0 A;  2HDU A;  2XD1 A;  4JF5 A;  1KDW A;  3G30 A;  1ES4 A;  1K56 A;  5EVI D;  5GL9 A;  1XPB A;  4ZBE A;  3VSK A;  2ZC4 B;  3Q1F A;  3W8K A;  1NZO A;  2ZQ7 A;  3HLC A;  1ONH A;  1W8Y A;  2VGJ A;  2WAF A;  2WGW A;  5D3O A;  1IEL A;  5M18 A;  3VP3 A;  4R1G A;  5FI7 A;  4HES A;  2WZX A;  3C5A A;  2A49 A;  3SH9 A;  3HUO A;  5FI2 A;  1M6K A;  5EVI C;  1K57 C;  1K55 A;  4KZ6 A;  5GLA A;  4EQI A;  5FQQ A;  2EX9 A;  4ZTK A;  5HFO A;  2ZQD A;  4IVK A;  4LV1 A;  3LY4 A;  1W7F A;  3EQU A;  1NYM A;  2H0Y A;  5F1F A;  2Q9M A;  1E4D A;  4U0X A;  3MXR A;  3AGE A;  5EOO A;  1VQQ A;  4MBH A;  3Q07 A;  4PM9 A;  1O7E A;  1ES5 A;  5M1A A;  4E3J A;  1CI8 A;  4MLL A;  3HVF A;  1M40 A;  2WKI A;  5AQA A;  1G6A A;  1OME A;  3DW0 A;  4PMA A;  3N4I A;  3E2L A;  4OOM A;  5JYP A;  4S2M A;  4LV3 A;  3W4O A;  4MBK A;  3N6I A;  1K4E A;  4S2N C;  5HAP A;  1PWD A;  3G2Y A;  5A92 A;  4JF6 A;  2ZQA A;  5EVI A;  5EVL A;  1K57 A;  3GVB A;  1I2S A;  3P09 A;  3MXS A;  1PYY A;  3PBS A;  4OQ0 A;  3ZVW A;  5HX9 A;  4KZ3 A;  5CTN A;  5GHZ A;  1E25 A;  1FCN A;  2XFS A;  1FR6 A;  3VOY A;  3GMW A;  3OPP A;  4B4Z A;  1Q2P A;  3BM6 A;  1IKG A;  5HAQ A;  2Y2I A;  3A3E A;  3TOI A;  2Y59 A;  3HLB A;  1YLZ A;  4IBR A;  1PZP A;  2ZJ9 A;  3VMA A;  1BUL A;  4X6T A;  4E6W A;  5GHY A;  3NBL A;  1YLY A;  4HEF A;  5EOE A;  5AQ7 A;  3BFG A;  1L0F A;  1SDE A;  3HL9 A;  5G18 A;  4DRT A;  2Y2N A;  1IYQ A;  4QY6 A;  2E8I A;  5CHM A;  1BLC A;  4RX2 A;  2J8Y A;  3MZE A;  1JTD A;  4EBL A;  1MWR A;  1PW1 A;  3PAE A;  4JKT A;  3PAG A;  3MKE A;  1SCW A;  3ZNT A;  4A5R A;  2H5S A;  2ZQ9 A;  2ZMA A;  4S2N A;  1LLB A;  1GHP A;  1K56 D;  2FFY A;  1N4O A;  2PU4 A;  3MZD A;  3PBR A;  4IBX A;  4S2I A;  5FQJ A;  3HRE A;  5DF9 A;  3V5M A;  1GA0 A;  3BEB A;  3BYD A;  4WEJ A;  3N7W A;  1JWV A;  3IH8 A;  3UN7 A;  3OPL A;  5AQ9 A;  4NET A;  1MWT A;  1GHI A;  3C4O A;  2VGK A;  3NDG A;  4K0X A;  4P0M A;  2XF3 A;  3HLF A;  1TEM A;  5GLB A;  3IF5 A;  4KG2 A;  3FZC A;  4WBG A;  4X55 A;  3EQV A;  4H8R A;  5FI6 A;  3ZCZ A;  3GSG A;  2B5R A;  1KE4 A;  5CEC A;  4GNU A;  3BFC A;  3BFF A;  2WAE A;  2Y91 A;  3IXG A;  3ZFZ A;  5E2H A;  5A93 A;  1QMF A;  4GDB A;  2ZM2 A;  3PBO A;  3VP1 A;  5E2E A;  4ZDX A;  4DE3 A;  3C7V A;  4MBF A;  1BLS A;  4KZA A;  4Y0U A;  1GA9 A;  5A90 A;  1K4F A;  1XKZ A;  3N8R A;  5M19 A;  2OLU A;  4E3K A;  4JLF A;  5TFQ A;  1MY8 A;  3G2Z A;  5KSH A;  4LEN A;  2QPN A;  3AGF A;  4HBU A;  4U0T A;  2X02 A;  1E3U D;  3VP4 A;  4PM7 A;  4ZJ2 A;  3UY6 A;  3M6B A;  4GB7 A;  1MWS A;  1TDG A;  4DXB A;  1G68 A;  5TGF A;  1BSG A;  3IXB A;  4LCL A;  1RGY A;  3NCK A;  3V39 A;  3Q7V B;  1GHM A;  5BOH A;  2RL3 A;  2Z2M B;  4E3I A;  2FFF B;  2OSU A;  1FCO A;  1YQS A;  2X71 A;  4S2K A;  3UE1 A;  4CPK A;  1Q2Q A;  3PBN A;  1EI5 A;  3BEC A;  4DDS A;  4X53 A;  5FAP A;  1XA7 A;  3IT9 A;  5FAO A;  4Y7P A;  1L0D A;  3W4P A;  1ZG6 A;  4CJN A;  4MEZ A;  2R9X A;  3SS4 A;  1LI0 A;  4K0W A;  3UNW A;  1J9M A;  4EBN A;  2J9P A;  5EUA A;  2PBY A;  3E2K A;  3M2K A;  5CER A;  5EPH A;  1U60 A;  4R0Q A;  4FCF A;  3DWZ A;  1KVL A;  4OH0 A;  2XDM A;  1KE0 A;  4JXS A;  1MPL A;  5F82 A;  3TG9 A;  1DY6 A;  2HDS A;  3IHA A;  5DF8 A;  3D4F A;  4R3B A;  2J9O A;  1YM1 A;  3C7U A;  2ZQ8 A;  1ESU A;  3G31 A;  3GV9 A;  3LCE A;  4Z9Q A;  3WS5 A;  3PBT A;  3ZVT A;  4R4R A;  4R23 A;  4FH2 A;  2WAD A;  1NY0 A;  1YLT A;  4X56 A;  3AGD A;  2JC7 A;  3HLW A;  1CK3 A;  5FA7 A;  4BJP A;  4OPY A;  3GRJ A;  1YMX A;  5FAS A;  3IWI A;  2V2F F;  1W8Q A;  4PM6 A;  5FQK A;  1E3U A;  5HAR A;  1EWZ A;  1PWC A;  4OP8 A;  3PTE A;  2C5W B;  1AXB A;  1K25 A;  3CMZ A;  3N8L A;  5JYO A;  4DDY A;  3CJM A;  4UHU A;  1L0E A;  5GLC A;  3CG5 A;  3WWX A;  2H0T A;  2GDN A;  1C3B A;  5CHU A;  4OKP A;  4QHC A;  3LY3 A;  5DF7 A;  4ZJ1 A;  3M2J A;  3ZG7 B;  1LHY A;  3IWQ A;  1NZU A;  3Q7Z A;  1PWG A;  5GHX A;  2HP5 A;  3IHB A;  1L2S A;  4IVI A;  4JPM A;  4BQM A;  1JVJ A;  4EV4 A;  4BEN A;  1Y54 A;  3IXD A;  4WEK A;  4DXC A;  1BUE A;  2EX2 A;  4U3T A;  3SH7 A;  1XXM A;  1CI9 A;  4Y0O A;  2ZC6 B;  4OVD A;  1IYO A;  2IWB A;  3S1Y A;  2HDQ A;  3OCL A;  3TSG A;  4RYE A;  3ZG5 A;  5FDH A;  5CED A;  3NC8 A;  1LL5 A;  4KEN B;  4OOY A;  3V3R A;  3FWL A;  1L0G A;  1ZC2 A;  2HP9 A;  4P85 A;  2Y2J A;  3A3F A;  3HUN A;  2EFU A;  3G34 A;  1KDS A;  3Q7V A;  5F83 A;  5FSR A;  2IWD A;  2Y2Q A;  3GTC A;  1I5Q A;  2X01 A;  4HBT A;  3SS3 A;  4OQH A;  2Y2L A;  1DJB A;  3UPO A;  1YMS A;  2Y2M A;  4JBF A;  3NDE A;  1ALQ A;  3OZH A;  4KZ9 A;  1YLP A;  4JXV A;  4Q8I A;  4BD0 A;  1FCM A;  3O86 A;  1K6R A;  3O88 A;  4L0L A;  2G2W A;  3Q82 A;  4FSF A;  3ZNY A;  2I72 A;  1H8Z A;  2P74 A;  3C4P A;  4GOG A;  3A3D A;  3G32 A;  3WS4 A;  1JTG A;  4LCM A;  2JE5 A;  1DJC A;  5AQB A; 
#chains in the Genus database with same CATH topology
 1LI9 A;  3FC7 A;  4WMC A;  3E98 A;  2Y2P A;  4QPR A;  4GKU A;  3W4Q A;  1Z6F A;  3CIT A;  5E2F A;  1SKF A;  1PIO A;  1KOU A;  1MWU A;  2ZOI A;  5DKK A;  4OON A;  2JKG A;  3VE4 A;  4N92 A;  3OPH A;  1YKD A;  3IF6 B;  2G7U A;  3IH9 A;  2V8C A;  3CPT A;  2XD5 A;  4O7D A;  1N9L A;  5FAT A;  2M7V A;  5FQM A;  4C75 A;  5KSC A;  2BTF P;  5F68 A;  4E3L A;  1T19 A;  1V9Y A;  1WYB A;  2D02 A;  5J8X A;  4GS9 B;  1BTL A;  5CTM A;  4MN5 A;  2EX6 A;  1ES2 A;  4QJG A;  1WA9 A;  4DF6 A;  2R9W A;  4B4X A;  4S2O A;  3UPP A;  3F1N A;  2BG1 A;  3VFF A;  2Z6D A;  2G2U A;  5TR7 A;  1YLW A;  2ZC5 B;  1YLJ A;  3WRZ A;  3QNC A;  4C3Q A;  3V50 A;  5IS1 A;  2QZ6 A;  4RX3 A;  1FQG A;  2FH5 A;  3BFD A;  1S66 L;  3KO6 A;  4D2O A;  4OP5 A;  2W27 A;  4ETX A;  3ISG A;  3LFV A;  4PPR A;  4UAA A;  2VKS A;  4E3O A;  3G35 A;  3B3X A;  3LR3 A;  1ERO A;  4WZ4 A;  4OPZ A;  4JXW A;  4X1M A;  4BLM A;  2JKR I;  4NKP A;  3NI9 A;  1ERM A;  4QD4 A;  4FUW A;  5EE8 A;  3RXX A;  3NUL A;  4EUZ A;  2V1Z A;  4R4S A;  4WUJ A;  2OLV A;  2QHK A;  3H82 B;  5KMW A;  4II7 A;  3M6H A;  4QY5 A;  1SKO B;  4KQD A;  1PI5 A;  3TW8 A;  2ZC3 B;  1TVF A;  2XH9 A;  3NOU C;  4E6X A;  2V9A A;  1FIL A;  1ZKJ A;  1BYW A;  4FOF A;  3MBZ A;  4S2J A;  4DE2 A;  4FH4 A;  2EX8 A;  2HPB A;  1G6O A;  2XK1 A;  4X68 A;  4D60 A;  1LSV A;  2WKH A;  4UA9 A;  4WN5 A;  3O3V A;  4BWI A;  1S6R A;  5EVI B;  2J3W A;  1F5M A;  1PI4 A;  3VFH A;  3A3J A;  1XA1 A;  1XJ4 A;  3QNB A;  4EES A;  2YKH A;  3O5Y A;  4ZJ3 A;  1CEF A;  4LRY C;  3WS1 A;  1IKI A;  2XR0 A;  2JBF A;  3MFD A;  4Q0J A;  2OWH A;  1ES4 A;  5EVI D;  4LGW A;  3Q1F A;  3HLC A;  2WAF A;  3JVU A;  3VP3 A;  5FI7 A;  2WZX A;  3SH9 A;  2PRF A;  4KZ6 A;  1OTB A;  4LLO B;  4KUK A;  5HFO A;  2AVX A;  1YPR A;  4LRZ E;  3A0R A;  3IBR A;  1TS6 A;  3P01 A;  3H7W B;  1O7E A;  1DP9 A;  2ACG A;  1CI8 A;  1G6A A;  4JGQ A;  3E2L A;  5JYP A;  3W4O A;  4MBK A;  1P9R A;  1I2S A;  3P09 A;  3DTK A;  4HJ6 A;  4OQ0 A;  3NHQ A;  3VOY A;  3OPP A;  3BM6 A;  3T1R A;  4B93 A;  2Y2I A;  3A3E A;  3TOI A;  2PAV P;  1YLZ A;  1MKM A;  4E6W A;  2H28 A;  3NBL A;  4HJ3 A;  4DRT A;  3BFG A;  1L0F A;  4QY6 A;  3MFX A;  4NXF A;  1OT6 A;  2H5S A;  1K56 D;  2PU4 A;  3EWK A;  3V5M A;  1GA0 A;  3N7W A;  2INW A;  3OPL A;  2P08 A;  1MWT A;  1GHI A;  1NLZ A;  4P0M A;  3HLF A;  4KG2 A;  5CX7 A;  2UV0 E;  1S4R A;  2W3H A;  1ZTU A;  1OPX A;  3PBO A;  3MQO A;  5E2E A;  4ZDX A;  1BLS A;  4KZA A;  1GA9 A;  1L3L A;  3BWL A;  4HBU A;  3LIB A;  3CHW P;  1MWS A;  4CLC B;  3F1P A;  5TGF A;  3NCK A;  5DJT A;  4G3K A;  2RL3 A;  2Z2M B;  3UE1 A;  2OSU A;  2J3T D;  3PBN A;  1EI5 A;  1ACF A;  4MN6 A;  3IT9 A;  1ZG6 A;  4CJN A;  2R9X A;  1LI0 A;  1TD5 A;  1J9M A;  2GX5 A;  3E2K A;  3DTI A;  4R0Q A;  1KVL A;  3IS2 B;  5DFX A;  5EM0 A;  2K31 A;  1VET A;  3P7N A;  5DF8 A;  4UEY A;  1YM1 A;  3CWF A;  1ESU A;  3GV9 A;  3BW6 A;  3PBT A;  4R4R A;  2WAD A;  4X56 A;  5DFY A;  3AGD A;  4ESP A;  2JKR M;  3MF0 A;  3IWI A;  1W8Q A;  5HAR A;  1E3U A;  1EWZ A;  4OP8 A;  3B47 A;  3PTE A;  2C5W B;  5F69 A;  5JYO A;  2GZA A;  4I38 A;  4DDY A;  3CJM A;  2PT7 A;  5GLC A;  2H0T A;  5CHU A;  4QHC A;  4DN0 A;  3LY3 A;  5DF7 A;  3M2J A;  3E4Q A;  3IWQ A;  3KSI A;  2HP5 A;  4EV4 A;  1Y54 A;  2Q0O A;  4DXC A;  2EX2 A;  3CAX A;  5J7E A;  3S1Y A;  3OCL A;  2K2N A;  3TSG A;  4RYE A;  3F1N B;  4OOY A;  3V3R A;  3FPW A;  2HP9 A;  3A3F A;  3HUN A;  1KDS A;  2Y2Q A;  4PHT A;  3SS3 A;  2HJE A;  1DJB A;  3UPO A;  3K2N A;  3NDE A;  1FCM A;  1K6R A;  3O88 A;  4L0L A;  5LBR A;  1H8M A;  2I72 A;  1S67 L;  4O8G A;  2V0U A;  4GOG A;  3EEA A;  5HD3 A;  1JTG A;  4LCM A;  5HDC A;  5A91 A;  4BL3 A;  2Y8H A;  4G3W A;  1CF0 A;  2WKQ A;  5HAI A;  5FEF A;  5HDS A;  1T1A A;  4KZ7 A;  3OC2 A;  1S0W A;  4GD6 A;  3BLS A;  2P9V A;  2ZM8 A;  2Y55 A;  3L9K A;  1HZO A;  2FZ0 A;  1JWP A;  1NRF A;  1KGE A;  3JYI A;  3KSG A;  1XX2 A;  1WE4 A;  4LPZ A;  5HWW A;  5EFW A;  3MS6 A;  4YIN A;  4KQO A;  3KYQ A;  3T4L A;  5DJU A;  4E04 A;  2PYR A;  4F3L A;  5HSQ A;  2A24 A;  3QP6 A;  4H6J A;  1N9O A;  4DKI A;  4XT2 A;  3T4J A;  4XUX A;  4QU3 A;  2W0N A;  5DTS A;  5CGS A;  4KZB A;  3ZHH A;  4EEU A;  5FAQ A;  5L2F A;  1ESI A;  2L1M A;  1DJA A;  1RGZ A;  2VJW A;  4BBV A;  3LIE A;  5HWV A;  3FYZ A;  5CRF A;  1SHV A;  3V67 A;  5L10 A;  3UDI A;  4JF4 A;  1KE3 A;  1XJ3 A;  4YFM A;  1XGI A;  3K3C A;  2OAP 1;  4BL2 A;  2A3U A;  3R7W B;  3IWO A;  4Y3I A;  2XFT A;  1NYY A;  1PZO A;  3BRM A;  3R4K A;  3HLE A;  4OQG A;  1JWZ A;  2V20 A;  3QHY A;  2XLN A;  3ITB A;  5CEB A;  4X25 A;  1KVM A;  5CGW A;  2OV5 A;  3S7O A;  2Y2G A;  3S4X A;  3EGX C;  2UWX A;  3NOT C;  4P6Z M;  1J3W A;  4DE1 A;  2C6W B;  1LL8 A;  4EXO A;  4WF0 A;  5MC7 A;  3VP0 A;  4HIA A;  3ZGA B;  4RQ9 A;  3T1X A;  3KSF A;  5HPI A;  4N9L A;  3BJN A;  3T1S A;  5G4Y A;  4DJ2 A;  4RVA A;  5J3W A;  3OCN A;  4RA7 A;  3NEC A;  3MXQ A;  4PM5 A;  5EEC A;  4JXG A;  4N1H A;  5AJG A;  3FKW A;  4QB8 A;  2XEP A;  4Y17 A;  2O9C A;  3UE0 A;  4LV0 A;  1V9Z A;  1K55 C;  4EER A;  3A3I A;  4OQI A;  1H8Y A;  3ZDJ A;  3ZYT A;  4MNR A;  4EWF A;  3ZG0 A;  2HDU A;  2XD1 A;  3OOV A;  5GL9 A;  2ZC4 B;  4G3V A;  3W8K A;  3C30 A;  1NZO A;  3EGD C;  2ZQ7 A;  1W8Y A;  5D3O A;  1STZ A;  5EV0 A;  3S7N A;  1M6K A;  1K55 A;  2VV8 A;  3K3D A;  2EX9 A;  1Y28 A;  2ZQD A;  4LV1 A;  3LY4 A;  1W7F A;  3EQU A;  4YNR A;  2Q9M A;  3MXR A;  2ZMF A;  4PM9 A;  5M1A A;  4E3J A;  3F1O B;  4OOM A;  3VV4 A;  4P6Z S;  3UB7 A;  4JF6 A;  5EVL A;  3PBS A;  4KZ3 A;  3QP2 A;  2V0W A;  1FR6 A;  2EWW A;  1OJ5 A;  3GMW A;  4B4Z A;  1Q2P A;  3LUQ A;  2KDK A;  1VET B;  4IBR A;  3E0Y A;  2ZJ9 A;  1P97 A;  2MJ6 A;  3T1Q B;  2B95 A;  2P04 A;  4LFU A;  1SDE A;  2W3E A;  2Y2N A;  3RTY A;  2E8I A;  1BLC A;  3LIC A;  1JTD A;  4R6L A;  4M4X A;  3PAE A;  2QJ7 A;  1G5U A;  3UE6 A;  3T4Q A;  2ZQ9 A;  2ZMA A;  1GHP A;  5FEG A;  3HRE A;  5DF9 A;  2VK3 A;  4ZRR A;  1G28 A;  3QP5 A;  4WEJ A;  2HV1 A;  4O0P A;  1Y4O A;  1TEM A;  4WBG A;  3FZC A;  4X55 A;  3GSG A;  1KE4 A;  1PNE A;  2WAE A;  5E2H A;  4HNB A;  1QMF A;  3C7V A;  2ZOH A;  4Y0U A;  2HJ9 C;  1OTI A;  2OLU A;  2LB9 A;  3B42 A;  5TFQ A;  1MY8 A;  3G2Z A;  5KSH A;  3AGF A;  1E3U D;  3VP4 A;  3M6B A;  1TDG A;  2VV6 A;  1CQA A;  1BSG A;  3IXB A;  3ZQ5 A;  4CPK A;  4S2K A;  4B9O A;  3H9W A;  5FL3 A;  4NXE A;  4X53 A;  1W63 M;  1XA7 A;  1L0D A;  3W4P A;  3MQQ A;  3MSH A;  3DWZ A;  4OH0 A;  3TG9 A;  5F82 A;  3IHA A;  3D4F A;  4R3B A;  2V8F A;  3C7U A;  3BY8 A;  3G31 A;  3LCE A;  4NXB A;  1HLU P;  3WS5 A;  3PXP A;  3ZVT A;  4FH2 A;  1NY0 A;  1YLT A;  3L7H A;  2JC7 A;  5L09 A;  4BJP A;  4HY8 A;  1VEU A;  2V2F F;  5TBM A;  4GHI A;  5EM1 A;  1AXB A;  1K25 A;  3CMZ A;  3N8L A;  3DTE A;  1P9W A;  2GDN A;  1C3B A;  3D72 A;  4Y15 A;  1LHY A;  4CQH A;  1NZU A;  4HH2 A;  4EW7 A;  1PWG A;  3HCY A;  5J4E A;  1L2S A;  3LI9 A;  5A8B A;  4BEN A;  2W3F A;  4OVD A;  3EEH A;  1EW0 A;  4IUH A;  5FDH A;  2YKF A;  2A24 B;  3T12 B;  2PR5 A;  4H6J B;  1L0G A;  4MDZ A;  4XT2 B;  2EFU A;  3GDI A;  3Q7V A;  3GTC A;  4HBT A;  4DMZ A;  1SZV A;  1YMS A;  2Y2M A;  1ALQ A;  4KZ9 A;  1YLP A;  4JXV A;  4GS9 A;  4BD0 A;  3O86 A;  4HHD A;  2G2W A;  3Q82 A;  4FSF A;  2OAQ 1;  1PRQ A;  2P74 A;  3A3D A;  3G32 A;  3UMD A;  5E43 A;  3BQ8 A;  2K7S A;  3WS2 A;  4KQQ A;  4ARZ A;  4P87 A;  3Q81 A;  2O9B A;  3ZG8 B;  2DRW A;  2WKE A;  4QWO A;  1DP6 A;  4WZ5 A;  1PW8 A;  2Q9N A;  2Y4A A;  4PM8 A;  3UDX A;  2ZD8 A;  1BZA A;  4E3N A;  1CEG A;  3ICY A;  5I94 A;  1TF1 A;  4IED A;  2Z2L B;  4OPQ A;  1H5X A;  4Y0T A;  1D1J A;  3ITA A;  4IHQ A;  3MMH A;  1XGJ A;  4HP4 A;  3KSH A;  3IQA A;  1FSW A;  5G4Z A;  4CLC D;  2RCX A;  3GR2 A;  1ONG A;  3RH8 B;  2PU2 A;  2O99 A;  1MKI A;  3IX3 A;  1K38 A;  2Y2O A;  3S22 A;  2BAS A;  2WGI A;  4BD1 A;  1T1B A;  3CPT B;  5C5K A;  2XGN A;  1YAX A;  3T50 A;  1KGF A;  3BFE A;  1FR1 A;  3HLD A;  4GZB A;  4EBP A;  3IXH A;  4WMC D;  4NXG A;  5IHV A;  4UA7 A;  3VSL A;  3V3S A;  3GQZ A;  2BLS A;  5U47 A;  1ZHH B;  4N1X A;  3RXW A;  3DWK A;  4O01 A;  1HTZ A;  1AWI A;  2ZL1 A;  3FV7 A;  2B18 A;  2IA2 A;  3O87 A;  2B02 A;  1YT4 A;  2QYB A;  3MKF A;  4IJG A;  3G6O A;  3T4K A;  4OLD A;  4P6B A;  2HP6 A;  4OLG A;  1BLP A;  1TS8 A;  3NOP C;  1I2W A;  1T1C A;  2XRN A;  1WYC A;  2J7V A;  4EQ1 A;  1F2K A;  1W79 A;  2ZC7 A;  3HBR A;  4KG5 A;  4ZAM A;  4HI4 A;  2L0W A;  1O07 A;  2JHE A;  1S1Z A;  3TRC A;  4LV2 A;  4DE0 A;  3FKV A;  2WK0 A;  4S2P A;  2ZM0 A;  3PHY A;  1HD8 A;  4BBT A;  4C6Y A;  2DCF A;  2XQZ A;  2Y2H A;  4Q0I A;  2Y2K A;  1BLH A;  3LID A;  3BLM A;  4MCW A;  3G4P A;  4OPR A;  3SS5 A;  4K91 A;  2D01 A;  3LYX A;  2HGV A;  2W1T A;  3SH8 A;  4WLA A;  4FD8 A;  4JGP A;  2JKF A;  1ES3 A;  3CZD A;  4WEL A;  1UWP X;  3H7W A;  5CHJ A;  5DTK A;  3P98 A;  1HVB A;  4Z1W A;  2W1R A;  5DKL A;  3LI8 A;  4JF5 A;  2M7U A;  1K56 A;  4I39 A;  4ZBE A;  3UME A;  2VGJ A;  2WGW A;  1N9N A;  1IEL A;  4R1G A;  4HES A;  2A49 A;  5FI2 A;  4EQI A;  2XA7 M;  4ZTK A;  1S1Y A;  2VGL M;  2H0Y A;  4U0X A;  5EOO A;  3UB8 A;  3ULF A;  4EUV A;  4MBH A;  3Q07 A;  4GCZ A;  2WKI A;  5AQA A;  5AVF A;  1ODV A;  1TS0 A;  3QP8 A;  4LV3 A;  3PYP A;  1K4E A;  4S2N C;  3TE8 A;  3G2Y A;  5A92 A;  4Y5F A;  1PYY A;  1VHM A;  5HX9 A;  5GHZ A;  1E25 A;  1FCN A;  4R70 A;  3HJI A;  2Y59 A;  3HLB A;  1PZP A;  5AVE A;  3VMA A;  2GJ3 A;  1FIK A;  2V1A A;  4YWZ A;  5GHY A;  1YLY A;  5G18 A;  5EOE A;  5AQ7 A;  3HL9 A;  4I3I A;  4RX2 A;  3UB5 P;  2WKP A;  1VEU B;  1MWR A;  4L9G A;  5TBM B;  3A0S A;  3PAG A;  3MKE A;  4GHI B;  3ZNT A;  2KOI A;  4S2N A;  2FFY A;  2VZW A;  4IBX A;  3MZD A;  3U4L P;  1F9I A;  5FQJ A;  1TS7 A;  1D06 A;  1JWV A;  3IH8 A;  2W3G A;  5AQ9 A;  4NET A;  4MMN A;  3C4O A;  3IS2 A;  2VGK A;  2V1B A;  2XF3 A;  3IF5 A;  5FI6 A;  5KIZ A;  2WKR A;  3ZCZ A;  2B5R A;  4GNU A;  3BFF A;  3IXG A;  5A93 A;  3ZFZ A;  3VP1 A;  4DE3 A;  4MBF A;  5A90 A;  2JKT I;  1XKZ A;  5IT5 A;  3N8R A;  2QPN A;  1CJF A;  2X02 A;  2CMN A;  2VLG A;  1YSP A;  4GB7 A;  5TJJ A;  1K0K A;  4DXB A;  1RGY A;  3V39 A;  3Q7V B;  4E3I A;  4HOI A;  2X71 A;  1Q2Q A;  2O9A A;  3BEC A;  4BBU A;  5FAP A;  5FAO A;  4Y7P A;  2XA7 S;  3SZT A;  2I9V A;  4MEZ A;  4EBN A;  4UQI M;  5EUA A;  3M2K A;  2VGL S;  1U60 A;  4K08 A;  2PDR A;  4FCF A;  5L8M A;  2XDM A;  1KE0 A;  4JXS A;  1MPL A;  1DY6 A;  2HDS A;  2J9O A;  2ZQ8 A;  4Z9Q A;  3LIA A;  1F98 A;  4R23 A;  4ARZ B;  1VB6 A;  3KYE A;  5FA7 A;  5FAS A;  4PM6 A;  1XJ6 A;  3F1P B;  4UHU A;  3CG5 A;  3MR0 A;  3CLO A;  4Y2F A;  1OT9 A;  4OKP A;  4ZJ1 A;  4Q0H A;  3ZG7 B;  3Q7Z A;  5GHX A;  3IHB A;  4JPM A;  4LRX C;  4BQM A;  1JVJ A;  3IXD A;  2L4R A;  4U3T A;  1XXM A;  1CI9 A;  2VA0 A;  1IYO A;  2IWB A;  4AFI A;  2HDQ A;  5FDS A;  3ZG5 A;  3NC8 A;  1LL5 A;  4PKY A;  2XRO A;  1GSW A;  4EEP A;  4P85 A;  3KX0 X;  1IOU A;  3G34 A;  5F83 A;  5FSR A;  1NWZ A;  5L07 A;  1I5Q A;  2X01 A;  4OQH A;  2Y2L A;  2VEA A;  3LIF A;  3RFB A;  4IUK A;  4JBF A;  3OZH A;  4Q8I A;  3ZNY A;  1H8Z A;  3WS4 A;  3IX4 A;  2JE5 A;  1DJC A;  2EXA A;  1MZU A;  4UA6 A;  3C8C A;  3LEZ A;  1TDL A;  4NEE D;  2GNX A;  1SDN A;  5FQ9 A;  4X69 A;  5DTT A;  1PFL A;  5DVA A;  3MZF A;  5HW3 A;  1VM1 A;  2ZMV A;  4UQI S;  1GSX A;  4NK3 A;  3UO9 A;  1BT5 A;  2ZL1 B;  1GCE A;  2EWV A;  4KZ5 A;  2KLI A;  3NJA A;  1UWN X;  4WYY A;  1LSW A;  3SOI A;  1LSX A;  4E3M A;  2QMI A;  1LT0 A;  2H10 A;  3JVV A;  2IWC A;  2PHY A;  1H3Q A;  3R7W A;  4L9E A;  4KZ8 A;  3HUM A;  3HLG A;  3QP1 A;  2EA9 A;  1OTD A;  3UPN A;  1FSY A;  5F5Y A;  1X0O A;  1IYP A;  3UE3 A;  3T4S A;  2CC1 A;  1K54 C;  4KZ4 A;  5E2G A;  3RJU A;  3NIA A;  3IF6 C;  2ZLY A;  2W3D A;  5FQI A;  1XP4 A;  5CXW A;  2P9V B;  2DMW A;  3LR0 A;  2M1C A;  3QP4 A;  5CGX A;  2W1T B;  4M3K A;  3N8S A;  4NG2 A;  4DJ3 A;  3DAV A;  4OOL A;  3PBQ A;  3D3O A;  3LO7 A;  1N9B A;  4N9K A;  4F3L B;  4GN2 A;  2A2L A;  3MQ0 A;  2OOL A;  4PAU A;  1LL9 A;  3VP2 A;  2Z6C A;  1K54 A;  3DTM A;  1W5D A;  5F6A A;  3IF6 A;  2QJ5 A;  2JCH A;  3EOI A;  4B88 A;  3SW1 A;  3NY4 A;  4JGR A;  3WS0 A;  1NXY A;  4KG6 A;  3S7P A;  4S2L A;  1XJ2 A;  2WGW B;  3T4O A;  4MN7 A;  4WZ5 C;  4XXR A;  1IYS A;  5GLD A;  3BQA A;  1MBL A;  4GD8 A;  2JKT M;  1KGG A;  5HL1 A;  5K5B A;  4F94 A;  1OJG A;  2PD7 A;  2ZQC A;  3JPU A;  1NJ4 A;  1QME A;  5HPF A;  4ID4 A;  2VV7 A;  2WZZ A;  4I3A A;  3WRT A;  5HZH A;  1DP8 A;  1D7E A;  4XUZ A;  2WYX A;  2XSS A;  1RCJ A;  2OWJ A;  3OLO A;  1ERQ A;  2EFX A;  3OPR A;  3IX8 A;  1FOF A;  5HD5 A;  1MXO A;  4WM9 A;  4EET B;  4KQR A;  4GDN A;  2WUQ A;  1IEM A;  1ZG4 A;  3ZG9 B;  3I7J A;  3UDF A;  3FPV A;  2EXB A;  2HDR A;  2HZ5 A;  3LR4 A;  3BY9 A;  2WGV A;  2O0Y A;  3VOZ A;  2DNS A;  5F1G A;  1K6S A;  4R3J A;  1RP5 A;  3F1O A;  5KZH A;  1OTA A;  3LR5 A;  2HF6 A;  1KDW A;  3G30 A;  1XPB A;  3FG8 A;  3VSK A;  3CUE C;  4I5S A;  2NUT C;  5EVE A;  4R38 A;  1ONH A;  1S4S A;  5HDD A;  4KUO A;  3C5A A;  3HUO A;  5EVI C;  1K57 C;  2JN7 A;  3H82 A;  5GLA A;  3TJZ C;  5FQQ A;  1SKO A;  3MJQ A;  2R78 A;  3OBF A;  3C38 A;  4IVK A;  4I3J A;  1NYM A;  5F1F A;  1E4D A;  3A0V A;  3AGE A;  4YOF A;  3VOL A;  1VQQ A;  1A0K A;  2E8J A;  3E4P A;  1ES5 A;  4MLL A;  4GW9 A;  3HVF A;  1M40 A;  1OME A;  3DW0 A;  4PMA A;  3N4I A;  3CUE A;  4S2M A;  3N6I A;  3U2A A;  3UB6 A;  2KX6 A;  2P7J A;  1PWD A;  5HAP A;  5EVI A;  2ZQA A;  1K57 A;  3GVB A;  3MXS A;  3ZVW A;  5CTN A;  4L9F A;  2XFS A;  4ME4 A;  3HJK A;  1IKG A;  2PD8 A;  5HAQ A;  2ZBB A;  1BUL A;  4X6T A;  4GJ4 A;  4HEF A;  1IYQ A;  4HQA A;  1IFQ A;  1Z09 A;  3C2W A;  5CHM A;  2VX8 A;  2J8Y A;  3MZE A;  4EBL A;  1PW1 A;  2NUP C;  4JKT A;  5I5L A;  1SCW A;  4A5R A;  3CI6 A;  1LLB A;  4S2I A;  1N4O A;  5M18 A;  3PBR A;  3BYD A;  3BEB A;  3UN7 A;  4GLQ A;  1H0M A;  1T18 A;  3D9Y A;  3T4T A;  3NDG A;  4K0X A;  3B33 A;  4WL9 A;  5GLB A;  3EQV A;  4H8R A;  4HJ4 A;  5CEC A;  3BFC A;  2J80 A;  2Y91 A;  4GDB A;  2ZM2 A;  2QWS A;  4CLC E;  1K4F A;  1NLY A;  5M19 A;  4E3K A;  4JLF A;  1P0Z A;  4LEN A;  4U0T A;  4PM7 A;  4ZJ2 A;  3UY6 A;  1NRJ A;  2PBD P;  1G68 A;  4LCL A;  3VE3 A;  1GHM A;  5BOH A;  2FFF B;  1FCO A;  1YQS A;  4EU0 A;  4DDS A;  3SS4 A;  3PR6 A;  4K0W A;  3UNW A;  1W63 Q;  2J9P A;  2PBY A;  5CER A;  2PR6 A;  5EPH A;  2J3T C;  3UB9 A;  1XFQ A;  5HL6 A;  5IU1 A;  3IBJ A;  3HLW A;  1CK3 A;  1OTE A;  4PKY G;  4OPY A;  3GRJ A;  1YMX A;  5FQK A;  4HH3 A;  1PWC A;  4CLC C;  1L0E A;  1YSQ A;  3WWX A;  3W2Z A;  1GSV A;  5HWT A;  3S7Q A;  4X1L A;  2QKP A;  4IVI A;  4JGO A;  2LB5 A;  4WEK A;  1BUE A;  3SH7 A;  4Y13 A;  4HP9 A;  4Y0O A;  2ZC6 B;  3KYZ A;  3DBA A;  5CED A;  4KEN B;  3FWL A;  1ZC2 A;  3LEQ A;  4CLC A;  1XFN A;  2Y2J A;  1UGU A;  2IWD A;  3E4O A;  4BMW A;  4FTX A;  1DRM A;  4ETZ A;  2PYP A;  1JNU A;  4R3A A;  3LGO A;  3C4P A;  5AQB A;  1MC0 A;  3GEC A;  2Y79 A; 
#chains in the Genus database with same CATH homology
 1LI9 A;  2EXA A;  5A91 A;  4WMC A;  5E43 A;  2Y2P A;  3WS2 A;  4BL3 A;  4KQQ A;  4UA6 A;  4GKU A;  4P87 A;  1Z6F A;  3Q81 A;  3W4Q A;  3LEZ A;  3ZG8 B;  1TDL A;  5E2F A;  1SKF A;  2DRW A;  1PIO A;  2WKE A;  1SDN A;  5FQ9 A;  4X69 A;  5DTT A;  5DVA A;  5HAI A;  3MZF A;  5HW3 A;  1VM1 A;  1MWU A;  4KZ7 A;  4NK3 A;  4OON A;  3OC2 A;  4N92 A;  1S0W A;  3OPH A;  3IF6 B;  4WZ5 A;  3UO9 A;  1PW8 A;  2Q9N A;  1BT5 A;  3BLS A;  4GD6 A;  2Y4A A;  4PM8 A;  3UDX A;  1GCE A;  2P9V A;  3IH9 A;  2ZD8 A;  1BZA A;  2ZM8 A;  4KZ5 A;  2Y55 A;  4E3N A;  1CEG A;  1HZO A;  2XD5 A;  4O7D A;  5FAT A;  1JWP A;  1NRF A;  4WYY A;  5I94 A;  1KGE A;  4IED A;  5FQM A;  4C75 A;  3JYI A;  3SOI A;  2Z2L B;  5KSC A;  1XX2 A;  1WE4 A;  4E3L A;  4OPQ A;  1WYB A;  4E3M A;  1H5X A;  5J8X A;  1BTL A;  4Y0T A;  2QMI A;  5CTM A;  2H10 A;  2EX6 A;  4KQO A;  4YIN A;  2IWC A;  3ITA A;  1ES2 A;  4QJG A;  4DF6 A;  2R9W A;  4KZ8 A;  3HUM A;  1XGJ A;  3HLG A;  4B4X A;  4S2O A;  3UPP A;  2BG1 A;  3IQA A;  3VFF A;  1FSW A;  3UPN A;  2RCX A;  3GR2 A;  4DKI A;  1ONG A;  2G2U A;  2PU2 A;  1FSY A;  5TR7 A;  1IYP A;  1YLW A;  3UE3 A;  1MKI A;  4QU3 A;  4XUX A;  2ZC5 B;  2CC1 A;  1YLJ A;  5DTS A;  3WRZ A;  1K54 C;  4KZ4 A;  5CGS A;  5E2G A;  3RJU A;  1K38 A;  3QNC A;  4KZB A;  3NIA A;  3ZHH A;  3IF6 C;  4C3Q A;  2ZLY A;  5FAQ A;  5FQI A;  1XP4 A;  2Y2O A;  5L2F A;  5CXW A;  3V50 A;  1ESI A;  2P9V B;  1DJA A;  1RGZ A;  3S22 A;  2QZ6 A;  2WGI A;  4BD1 A;  4RX3 A;  1FQG A;  3BFD A;  3FYZ A;  5CRF A;  2XGN A;  1SHV A;  4D2O A;  5CGX A;  3UDI A;  1KGF A;  4M3K A;  4OP5 A;  3N8S A;  3BFE A;  1FR1 A;  3HLD A;  4GZB A;  4OOL A;  3PBQ A;  4JF4 A;  1KE3 A;  4EBP A;  4YFM A;  3ISG A;  3IXH A;  4WMC D;  1XGI A;  3LO7 A;  1N9B A;  4BL2 A;  2A3U A;  4PPR A;  4UAA A;  5IHV A;  4E3O A;  4UA7 A;  4N9K A;  3VSL A;  3IWO A;  2XFT A;  1NYY A;  1PZO A;  3GQZ A;  4GN2 A;  3BRM A;  3V3S A;  2BLS A;  3G35 A;  3B3X A;  5U47 A;  1ERO A;  1LL9 A;  3VP2 A;  4N1X A;  1K54 A;  4WZ4 A;  4OPZ A;  3HLE A;  3DTM A;  4JXW A;  4OQG A;  3RXW A;  4BLM A;  1JWZ A;  1W5D A;  3DWK A;  1HTZ A;  2V20 A;  3IF6 A;  1ERM A;  2JCH A;  3NI9 A;  4QD4 A;  3QHY A;  5EE8 A;  3NY4 A;  2XLN A;  3RXX A;  3ITB A;  4B88 A;  3FV7 A;  5CEB A;  3O87 A;  4EUZ A;  3WS0 A;  1YT4 A;  1NXY A;  2V1Z A;  4KG6 A;  1KVM A;  4S2L A;  5CGW A;  2OV5 A;  2WGW B;  4R4S A;  3MKF A;  2Y2G A;  3S4X A;  4WZ5 C;  2OLV A;  1IYS A;  4OLD A;  4XXR A;  5GLD A;  4P6B A;  1MBL A;  2HP6 A;  4GD8 A;  4OLG A;  2UWX A;  1KGG A;  5KMW A;  1BLP A;  3M6H A;  4DE1 A;  1I2W A;  4QY5 A;  5HL1 A;  1WYC A;  4F94 A;  2C6W B;  2J7V A;  2ZQC A;  1NJ4 A;  1QME A;  1PI5 A;  1W79 A;  2ZC7 A;  2ZC3 B;  1TVF A;  2XH9 A;  3HBR A;  4ID4 A;  4E6X A;  4KG5 A;  4ZAM A;  1ZKJ A;  1O07 A;  3VP0 A;  4LV2 A;  4DE0 A;  3FKV A;  3MBZ A;  2WZZ A;  4S2J A;  3WRT A;  2WK0 A;  4S2P A;  3ZGA B;  4FH4 A;  4DE2 A;  2ZM0 A;  2EX8 A;  2HPB A;  1HD8 A;  2XK1 A;  4N9L A;  4XUZ A;  4C6Y A;  2WYX A;  4X68 A;  2DCF A;  2WKH A;  2XQZ A;  4RVA A;  2Y2H A;  4UA9 A;  3O3V A;  3OCN A;  4RA7 A;  4PM5 A;  1S6R A;  5EVI B;  5EEC A;  1RCJ A;  2Y2K A;  1BLH A;  1PI4 A;  3VFH A;  4JXG A;  3A3J A;  1ERQ A;  2EFX A;  3OPR A;  1XA1 A;  4N1H A;  1FOF A;  3BLM A;  3FKW A;  1MXO A;  4QB8 A;  2XEP A;  3G4P A;  4WM9 A;  4OPR A;  3SS5 A;  4K91 A;  3QNB A;  4KQR A;  3UE0 A;  4GDN A;  2WUQ A;  3SH8 A;  1IEM A;  1ZG4 A;  4LV0 A;  3ZG9 B;  4FD8 A;  3CZD A;  1ES3 A;  1K55 C;  3I7J A;  3UDF A;  4ZJ3 A;  2EXB A;  4WEL A;  1CEF A;  2HDR A;  3A3I A;  2WGV A;  4OQI A;  3WS1 A;  1H8Y A;  3ZDJ A;  3VOZ A;  1IKI A;  5CHJ A;  5DTK A;  2DNS A;  3P98 A;  5F1G A;  2XR0 A;  2JBF A;  1K6S A;  4MNR A;  4R3J A;  1RP5 A;  1HVB A;  3MFD A;  4EWF A;  5KZH A;  3ZG0 A;  2HDU A;  2XD1 A;  4JF5 A;  1KDW A;  3G30 A;  1ES4 A;  1K56 A;  5EVI D;  5GL9 A;  1XPB A;  4ZBE A;  3VSK A;  2ZC4 B;  3Q1F A;  3W8K A;  1NZO A;  2ZQ7 A;  3HLC A;  1ONH A;  1W8Y A;  2VGJ A;  2WAF A;  2WGW A;  5D3O A;  1IEL A;  5M18 A;  3VP3 A;  4R1G A;  5FI7 A;  4HES A;  2WZX A;  3C5A A;  2A49 A;  3SH9 A;  3HUO A;  5FI2 A;  1M6K A;  5EVI C;  1K57 C;  1K55 A;  4KZ6 A;  5GLA A;  4EQI A;  5FQQ A;  2EX9 A;  4ZTK A;  5HFO A;  2ZQD A;  4IVK A;  4LV1 A;  3LY4 A;  1W7F A;  3EQU A;  1NYM A;  2H0Y A;  5F1F A;  2Q9M A;  1E4D A;  4U0X A;  3MXR A;  3AGE A;  5EOO A;  1VQQ A;  4MBH A;  3Q07 A;  4PM9 A;  1O7E A;  1ES5 A;  5M1A A;  4E3J A;  1CI8 A;  4MLL A;  3HVF A;  1M40 A;  2WKI A;  5AQA A;  1G6A A;  1OME A;  3DW0 A;  4PMA A;  3N4I A;  3E2L A;  4OOM A;  5JYP A;  4S2M A;  4LV3 A;  3W4O A;  4MBK A;  3N6I A;  1K4E A;  4S2N C;  5HAP A;  1PWD A;  3G2Y A;  5A92 A;  4JF6 A;  2ZQA A;  5EVI A;  5EVL A;  1K57 A;  3GVB A;  1I2S A;  3P09 A;  3MXS A;  1PYY A;  3PBS A;  4OQ0 A;  3ZVW A;  5HX9 A;  4KZ3 A;  5CTN A;  5GHZ A;  1E25 A;  1FCN A;  2XFS A;  1FR6 A;  3VOY A;  3GMW A;  3OPP A;  4B4Z A;  1Q2P A;  3BM6 A;  1IKG A;  5HAQ A;  2Y2I A;  3A3E A;  3TOI A;  2Y59 A;  3HLB A;  1YLZ A;  4IBR A;  1PZP A;  2ZJ9 A;  3VMA A;  1BUL A;  4X6T A;  4E6W A;  5GHY A;  3NBL A;  1YLY A;  4HEF A;  5EOE A;  5AQ7 A;  3BFG A;  1L0F A;  1SDE A;  3HL9 A;  5G18 A;  4DRT A;  2Y2N A;  1IYQ A;  4QY6 A;  2E8I A;  5CHM A;  1BLC A;  4RX2 A;  2J8Y A;  3MZE A;  1JTD A;  4EBL A;  1MWR A;  1PW1 A;  3PAE A;  4JKT A;  3PAG A;  3MKE A;  1SCW A;  3ZNT A;  4A5R A;  2H5S A;  2ZQ9 A;  2ZMA A;  4S2N A;  1LLB A;  1GHP A;  1K56 D;  2FFY A;  1N4O A;  2PU4 A;  3MZD A;  3PBR A;  4IBX A;  4S2I A;  5FQJ A;  3HRE A;  5DF9 A;  3V5M A;  1GA0 A;  3BEB A;  3BYD A;  4WEJ A;  3N7W A;  1JWV A;  3IH8 A;  3UN7 A;  3OPL A;  5AQ9 A;  4NET A;  1MWT A;  1GHI A;  3C4O A;  2VGK A;  3NDG A;  4K0X A;  4P0M A;  2XF3 A;  3HLF A;  1TEM A;  5GLB A;  3IF5 A;  4KG2 A;  3FZC A;  4WBG A;  4X55 A;  3EQV A;  4H8R A;  5FI6 A;  3ZCZ A;  3GSG A;  2B5R A;  1KE4 A;  5CEC A;  4GNU A;  3BFC A;  3BFF A;  2WAE A;  2Y91 A;  3IXG A;  3ZFZ A;  5E2H A;  5A93 A;  1QMF A;  4GDB A;  2ZM2 A;  3PBO A;  3VP1 A;  5E2E A;  4ZDX A;  4DE3 A;  3C7V A;  4MBF A;  1BLS A;  4KZA A;  4Y0U A;  1GA9 A;  5A90 A;  1K4F A;  1XKZ A;  3N8R A;  5M19 A;  2OLU A;  4E3K A;  4JLF A;  5TFQ A;  1MY8 A;  3G2Z A;  5KSH A;  4LEN A;  2QPN A;  3AGF A;  4HBU A;  4U0T A;  2X02 A;  1E3U D;  3VP4 A;  4PM7 A;  4ZJ2 A;  3UY6 A;  3M6B A;  4GB7 A;  1MWS A;  1TDG A;  4DXB A;  1G68 A;  5TGF A;  1BSG A;  3IXB A;  4LCL A;  1RGY A;  3NCK A;  3V39 A;  3Q7V B;  1GHM A;  5BOH A;  2RL3 A;  2Z2M B;  4E3I A;  2FFF B;  2OSU A;  1FCO A;  1YQS A;  2X71 A;  4S2K A;  3UE1 A;  4CPK A;  1Q2Q A;  3PBN A;  1EI5 A;  3BEC A;  4DDS A;  4X53 A;  5FAP A;  1XA7 A;  3IT9 A;  5FAO A;  4Y7P A;  1L0D A;  3W4P A;  1ZG6 A;  4CJN A;  4MEZ A;  2R9X A;  3SS4 A;  1LI0 A;  4K0W A;  3UNW A;  1J9M A;  4EBN A;  2J9P A;  5EUA A;  2PBY A;  3E2K A;  3M2K A;  5CER A;  5EPH A;  1U60 A;  4R0Q A;  4FCF A;  3DWZ A;  1KVL A;  4OH0 A;  2XDM A;  1KE0 A;  4JXS A;  1MPL A;  5F82 A;  3TG9 A;  1DY6 A;  2HDS A;  3IHA A;  5DF8 A;  3D4F A;  4R3B A;  2J9O A;  1YM1 A;  3C7U A;  2ZQ8 A;  1ESU A;  3G31 A;  3GV9 A;  3LCE A;  4Z9Q A;  3WS5 A;  3PBT A;  3ZVT A;  4R4R A;  4R23 A;  4FH2 A;  2WAD A;  1NY0 A;  1YLT A;  4X56 A;  3AGD A;  2JC7 A;  3HLW A;  1CK3 A;  5FA7 A;  4BJP A;  4OPY A;  3GRJ A;  1YMX A;  5FAS A;  3IWI A;  2V2F F;  1W8Q A;  4PM6 A;  5FQK A;  1E3U A;  5HAR A;  1EWZ A;  1PWC A;  4OP8 A;  3PTE A;  2C5W B;  1AXB A;  1K25 A;  3CMZ A;  3N8L A;  5JYO A;  4DDY A;  3CJM A;  4UHU A;  1L0E A;  5GLC A;  3CG5 A;  3WWX A;  2H0T A;  2GDN A;  1C3B A;  5CHU A;  4OKP A;  4QHC A;  3LY3 A;  5DF7 A;  4ZJ1 A;  3M2J A;  3ZG7 B;  1LHY A;  3IWQ A;  1NZU A;  3Q7Z A;  1PWG A;  5GHX A;  2HP5 A;  3IHB A;  1L2S A;  4IVI A;  4JPM A;  4BQM A;  1JVJ A;  4EV4 A;  4BEN A;  1Y54 A;  3IXD A;  4WEK A;  4DXC A;  1BUE A;  2EX2 A;  4U3T A;  3SH7 A;  1XXM A;  1CI9 A;  4Y0O A;  2ZC6 B;  4OVD A;  1IYO A;  2IWB A;  3S1Y A;  2HDQ A;  3OCL A;  3TSG A;  4RYE A;  3ZG5 A;  5FDH A;  5CED A;  3NC8 A;  1LL5 A;  4KEN B;  4OOY A;  3V3R A;  3FWL A;  1L0G A;  1ZC2 A;  2HP9 A;  4P85 A;  2Y2J A;  3A3F A;  3HUN A;  2EFU A;  3G34 A;  1KDS A;  3Q7V A;  5F83 A;  5FSR A;  2IWD A;  2Y2Q A;  3GTC A;  1I5Q A;  2X01 A;  4HBT A;  3SS3 A;  4OQH A;  2Y2L A;  1DJB A;  3UPO A;  1YMS A;  2Y2M A;  4JBF A;  3NDE A;  1ALQ A;  3OZH A;  4KZ9 A;  1YLP A;  4JXV A;  4Q8I A;  4BD0 A;  1FCM A;  3O86 A;  1K6R A;  3O88 A;  4L0L A;  2G2W A;  3Q82 A;  4FSF A;  3ZNY A;  2I72 A;  1H8Z A;  2P74 A;  3C4P A;  4GOG A;  3A3D A;  3G32 A;  3WS4 A;  1JTG A;  4LCM A;  2JE5 A;  1DJC A;  5AQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...