3O8BA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords HCV NS3 protease/helicase
total genus 219
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8bA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8bA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA03
2JLXA 1NY6A 2O0KA 5KUTA 4Y79A 4I1UA 3QI2A 2F91A 1GITA 1Y3XA 1T91A 1AWHB 4KFRA 1GCTC 2EYQA 2ZJYA 5C3NA 4KTCA 4R9UC 4Y7AA 3URCA 3DFLA 1H8DH 3X1ZA 3IIKA 2YWFA 5EE5B 4FXGH 1Q1EA 5LB4A 3BG4B 4C0KA 1QHGA 2OC1A 5DG6A 3KKPA 4X8HA 2XZLA 3J81k 1N1LA 4NCYA 2A7JA 1NFUA 2GETA 2GZ8A 3SC3A 3K8YA 4PANA 3S9AA 5AF9H 4C0SA 3EPJA 1YCPK 2FS8A 1NG9A 2PWXA 2QP3A 1COWD 2I6SA 3AV0B 1D6JA 1T8MA 1IY0A 5GJ4B 3DFJA 4JL6A 2GVFA 1ZJDA 2P3SA 1R5OA 3O8DA 1GG6C 1O2SA 4DRZA 2JJ1A 3BE4A 3C8UA 4Q1EA 4YMVA 2GF0A 1BQYA 4UEHH 1VECA 4A1VA 3MU0A 2FG5A 2ATXA 2D2FA 1O38A 1FUKA 1SVMA 2VGCB 2R6AA 3SQWA 2PCJA 3RXOA 2A4QA 7LPRA 4IC6A 1QG4A 2RH5A 1GRQA 1M7HA 2CVHA 1FY4A 1M34E 1I4LD 2A7QA 3BH0A 3WHKA 2IA5A 4BZXA 3MUFA 4ZDJA 2WWFA 1FY1A 5J4KA 1WQ1R 4F49A 1HAOH 3EC1A 4K8BA 1DEKA 3LH1A 2CCJA 4LV6A 3A7YA 4ZCLA 4MDEA 3GY3A 2JJ8A 2Z3DA 2BMGB 3EPKA 3RM0H 1U0JA 2A32A 1CU1A 1N6XA 2C8YB 1N0WA 3GCTF 1UJ1A 2WJVA 4M1OA 2VF8A 1AGJA 5TVKA 4Q4HB 2OBLA 1UMAH 4KFTA 1D3DB 1ABIH 1ELBA 2WSSA 4OYHA 3QOFA 3GLHE 1GNQA 2OBOA 2SGQE 1EPTA 1TYNA 3D31A 1HAIH 5CE1A 4K1EA 4KBFA 1NRSH 2H5EA 2JJ2A 4RKEA 5A2MH 2ZU0C 3AGQA 4PR0A 3GLIB 1OSNA 3U1JB 5DI3A 1O2LA 1GAJA 4X2WA 2IYSA 2BD5A 1G3QA 3OIYA 3LA6A 4PQRA 1R5BA 1O3EA 1GNRA 1SG8B 2DCUA 1IHSH 2VIQA 3VXFH 1XEWY 1UVOA 4CVNA 5J40A 5LB2A 4OKSA 2UVQA 2F9NA 1XBTA 4V02A 2DHRA 1GGDB 2G1JA 2IHYA 2Q0HA 4IW3B 4INLA 3AH8A 3KCGH 3E6PH 1UDXA 1H8IH 3OF5A 3DHKH 4ESVA 4TMKA 3B1WA 4Y8YA 4BFTA 2ZE7A 1KZGB 1GI2A 5DIFA 4ZKEA 1KYNA 3TW4A 3OEED 4NPHA 1ELEE 1CT0E 1KDTA 1AY6H 4N0EA 1KJZA 4UJ3A 2XCNA 1CULC 2WWYA 2A5FA 5J5CA 3TIUA 1YZUA 3QXSA 1A3BH 2RGCA 3O8RA 1A2KC 3CH4B 2DFNA 4MKGA 2PZEA 4RD6A 4QBGB 1MO3A 3I73A 5JSZA 7ESTE 1ELCA 1GI6A 4C3ZA 4C2TA 1N6OA 3NHAA 1C1MA 2C98A 3PEVA 1GJ4H 4I99A 1QRXA 2IHBA 1O2QA 2ZI4A 2QC2A 2PUQH 2EI7A 3TE6A 1NBME 2W58A 3W6OA 1XZQA 1Z0KA 3IO5A 3R7WB 4IXNA 2VB0A 4ZROA 1DAMA 1NIPA 2AN9A 2IUTA 2R2WU 1OXUA 2QP4A 4LCBA 1MU8B 3RXVA 1LTQA 1WBBA 3ATLA 5CIQA 2VIPA 1AIPA 4A92A 1NIJA 2QE7D 1DITH 3U5ZB 4DT1A 2PKSB 2GCOA 2F1IA 1CVWH 2EFEB 4MRNA 4AN7A 3FPAA 3UNSA 5GADl 2WAYA 2A5IA 2ZI7A 1E4VA 3PMHB 3TH3H 4B2CA 5EW2H 3A8AA 2GAOA 2QZ4A 3W6NA 3MMGA 4EJSA 4Z1MA 4H9GA 3D23A 1KI1A 1EAIA 1WRBA 3GCNA 4WXPA 1ZIOA 2CNWD 1W49A 4PAQA 1DXPA 1FV9A 3FWYA 5DO9A 3OYPA 2XCFA 1UTNA 2CHVA 2CV3A 3RXDA 4TWZA 1Q22A 1PUJA 4D4KA 2QGNA 2F9UA 1E2DA 2JCSA 1A61H 5K8IA 4WWYA 1G16A 4LBZA 1EP6A 4DEXA 4DCDA 3ZYDA 4FCWA 4XBBA 1FOEB 5FOWA 4XVUA 2TIOA 3UREA 5L3SA 1SGTA 2ZQ2A 3BTDE 1VG8A 2P67A 1YP9A 1CGJE 1KI7A 5F03A 1S2MA 3RSOA 1RGQA 1O3AA 2PKAA 1H65A 2V4ZA 5J4HA 4V0LA 4CF7A 1XPOA 5DGJA 1O36A 2D2DA 3UIEA 2QTVB 5FOXA 2PEZA 2JAQA 4LJ9A 1GJ8B 3P95A 2O8MA 2B0FA 3SQEE 2GZ9A 2ZZUH 1RZ3A 4Q4AA 3AQ4A 2BOVA 2F7SA 1UTOA 3SHCH 4I8LA 2QY9A 2PX0A 5HYOA 2IXGA 2DFTA 1X8JA 5FUYA 2GCTC 4O0MA 1YVDA 2A0QB 2ZE6A 4ZCIA 1TE0A 3T27A 3T1VA 2C2HA 5HXFA 4MGKR 5DP9A 3DL0A 3KQHA 3BIUH 2F1JA 4UFGH 3A85A 3SI7A 3EG5A 2JETB 1A1VA 4IOMA 3A8DA 2XC0A 1AFEH 2ANWA 1DDJA 4HLDA 4LJ6A 1ZTKA 5BWMA 2G4TA 1DUEA 1J99A 4YC7A 2FIRH 2IYQA 3B1ZA 1KAGA 4DC9A 3GLGB 2ZGHA 1G8YA 3BC1A 1ZINA 5AHGH 3ZIAA 2A4OA 1FQ3A 3P8GA 4BTTB 1JALA 3BD9A 1R2QA 5JLJA 4FVDA 4GMDA 2ZJ5A 3FHTA 1L4UA 3SHAH 2VSFA 3A4NA 1F60A 1VYVA 4QNRA 1EB2A 4O3TA 4MUBA 4ABYA 3SUDA 3BH6A 1INCA 1KI6B 2MSDB 3AUXA 1KXEA 2DFKB 4BQSA 5KDLA 4CEJB 4LJ8A 2FWRA 4DSOA 4NU0A 3ZZ5A 3DZDA 4TTQA 5AJXA 1T8OA 1HT1E 4POAA 2JKHA 3M4YA 3PWCA 3K0CA 3PQCA 1UK4A 5EE3A 4Q4JB 2RA3A 1EZXC 3R20A 1X1RA 4PHHA 2IS4A 1SQAA 3UANA 3WYGA 3IBYA 1O3NA 1P60A 1IAUA 1BTWA 3W5JA 3LD9A 2ZRFA 4D25A 3CS7A 4ISNA 2HNTE 3RXRA 1PLLA 2DY1A 3GY5A 1AD8H 1O3PB 1GBBA 4BOHA 4M8NE 1DPOA 1FDPA 3FGNA 3EZ6A 3B1VA 3U98H 5JS8A 3LVRE 4UNRA 2QTHA 1D3QB 4H42U 2FX6A 1T6NA 2Q3FA 3F9HA 1IBRA 1N6KA 2P5TB 1UTMA 2A30A 4HAUA 3NTUA 1BJUA 3PENA 3HDTA 1TAGA 1GJBB 1T31A 1KMHB 2QSYA 1GHAF 5JZVA 1JJ7A 2VA8A 1RTKA 1DBSA 2BXTH 3A8BA 3AP2A 1TBZH 2OFXA 3WYFA 1FY8E 1TNDA 4BANB 1DVRA 4RVCA 2MSEB 3K0EA 1G17A 3ICQB 4D0GA 3SU2A 2OSBA 2RGXA 2GP9B 1ZBDA 2F3CE 3L0OA 3CX7A 1UJ2A 1C1SA 2F9MA 4F4IA 1VR1H 5FOVA 4TYWA 1BS1A 2P8OB 1N2CE 3QBVA 1IJEA 3HU3A 2GXUA 2WUBA 4HGCA 3T2NA 2EFGA 4JVMA 4FCVA 1X86B 1XX6A 2AMPA 3SV6A 3QXCA 1OXVA 5IDVA 4QXAA 1LPZB 3K70D 1NVVR 4WZAE 3BH7A 4H6SB 2IYRA 4EPTA 1XD2A 1VYUA 2WYGA 4DKXA 5GXPA 1E9BA 1Z8GA 2ZRKA 3SOSA 4JS0A 4ASHA 1GI8B 4AGJA 1Z0DA 3SU6A 3H5CB 1R8SA 2PW8H 1N5LA 3SU3A 1VTKA 5SZJA 1I2DA 3GLFB 2E87A 1G3MA 1HJAB 1KK0A 2WKQA 4OS5A 1V2KT 2NOAA 821PA 2E1RA 1CO7E 2FGKA 3PTBA 2OTVA 4TSFA 1AK2A 1P73A 2DBYA 2FOHA 2ZPSA 4MPVA 1SOZA 2HXYA 5EE9A 3CRRA 1HRTH 1TQDA 1IY1A 1OF1A 2GZDA 4BRWA 4HLUC 2D3WA 3M6AA 3OTPA 1P05A 4LXBH 1P0SH 5EUMA 2HALA 2ZR9A 2F1HA 4IVRA 2X77A 1JMOH 2RGAA 4RSPA 1G9XA 3QF4A 5EE1A 2ANCA 4QBHA 3VKGA 4D0LB 1ARBA 2FLBH 1NZQH 2CBZA 1P2OA 1JIRA 6GCHG 4EJSC 4HZHA 5A09A 4MPXA 1KGDA 5GJBA 3LPRA 1N5IA 1SLUB 2OBNA 2ZPTX 4D7FA 1UFQA 2Y7ZA 4X1PU 2PX3A 3BSQA 4A8JB 3AKDA 1MV5A 1MO4A 5TCAA 1BTYA 4Q9JA 1E4YA 1GMHG 1SI5H 2JLWA 2YNAA 1Z0IA 1Z07A 1LHFH 1DG3A 2OCPA 1O34A 3TNSA 2QXHA 2VU8E 2J4IA 5LPEA 2SHKA 1K9OE 1AZZA 3ITIA 3MFYA 3RAPR 4X8SH 1HXEH 2ZCHP 1V2LT 1K1JA 2J7KA 1F7ZA 5GDSH 5FOUA 1DUAA 1T3HA 2Z0MA 4ZKNU 2PZGA 4O03A 1PQ8A 4PSVA 2VRWA 2WWHA 2J41A 2EFHB 1E9AA 1MH1A 1HA3A 1H8ED 5EJEA 2A2ZA 2YYZA 3A1WA 1SGWA 4BFUA 1KK1A 4KYUA 1SR5C 5JFGA 7KMEH 1TX7A 3HKJB 1Y3VA 2OZEA 2AMQA 3SR0A 3K9NA 3AVXA 1SXJD 2NO0A 3MWIU 2GZ7A 1NMYA 3SUFA 1QBKC 4TL6A 4ZPXA 2FOEA 3MU5A 4LHYA 2J45A 1QA7A 4E06H 2FESH 1NNEA 1KLTA 2VEDA 3T61A 5FUVA 4DXAA 3WYAA 2ZC9H 1TNGA 3VR6A 5H8WA 1GDQA 2AXNA 4CRWB 1IQGA 1W4RA 5T3HA 1JJVA 2NMVA 4FUJA 4TYNA 4M7GA 4FIDA 2O8WA 5LGOA 1K5DA 2VIVA 3OIVA 4LBYA 1J90A 2BDYA 3KXIA 4TWWA 1XPRA 1P3CA 5JI3E 3PROA 1Z6JH 2H7VA 1FY5A 3LDXH 2BBOA 4XTRA 2V6NA 3QKRB 4JIMA 1CBUA 1TRYA 3Q76A 3WRYC 2AK2A 4IDOA 3EC2A 1SGFG 3GMTA 3QF7A 2ZDNA 2JLRA 4NSYA 2XXAA 4MGZR 1WF3A 3BTTE 1IQIA 2W2TA 3ICEA 1TNHA 4AIIA 4L9SA 2BLWA 5DISB 1ETTH 2LWIA 1H8EA 2IBMA 1G4AE 4JLNA 5SZKB 3LOXA 3GLGE 1SXJB 4DVAU 4WZ6A 2EI6A 4UE7H 4L5BA 5F6MA 1DANH 3EW9A 3ZD7A 1IQHA 2C5LA 3E8LA 4CREA 1BITA 1F5KU 3SW2B 2OK5A 4LZ1H 3FTQA 1VMAA 3VB7A 1C2DA 1HV8A 2OAQ1 2AH4X 4TWYA 1FZZA 4R7ZA 1P7CA 1LS6A 2WUCA 121PA 1SOTA 3THXA 3BBPA 1FMLA 1KHTA 3M7TA 2BCJQ 3SORA 5AUOB 1DAIA 4FUIA 4JYBA 1G8FA 4NCJA 3NWUA 3VB3A 4GSOA 5JWOA 1U98A 1ZPCA 1NLZA 4A36A 3ZYCA 2ZGCA 1CT4E 4WMEA 1SSXA 1F2UA 1AWFH 4JZ1A 3LFUA 1MTWA 5KU1A 1L8QA 3AKEA 1BMNH 1L1JA 4CR9A 2HWLB 3TUZC 1F2TA 1VCNA 1JNYA 2CHAC 4HDOB 1CHGA 1E2KA 6Q21A 1PVOA 3RS5A 4BASA 1C5PA 5KYKA 2ODPA 4PC6A 4ZUHA 1P5ZB 4DURA 1X7AC 1Z6TA 4LJ5A 3AF0A 2IYLD 2HPQH 2XBWA 4A6LA 3GJXC 1ELVA 5EXLA 3VR1A 3RC8A 1EJAA 2R8RA 3CW2A 5ANRB 3GJ4A 2J9NA 3KIDU 3K0AB 2QEQA 1ABJH 1LHGH 4DIEA 1MAYA 4ZKOU 2ZHEH 5F98A 1DWEH 3RS2A 4NA7A 2JLQA 3OAAD 1RJXB 1XMNB 2FA9A 3V00A 4BLPA 1XUFA 4WA7A 1FONA 3NIBA 4Q4HA 4GSYA 3HP1A 4XWKA 4D7GA 4UJ5A 4LZZA 2VWMA 3GD7A 2CLSA 3IPYA 3CRQA 4X2VA 4JSTA 1C1PA 2F43A 4JZIA 1GHWH 1MU6B 1W7AA 2HPPH 3CIOA 2ZJBA 1YBWA 1EXMA 2ZPRA 4UNNA 1NLYA 4UXJA 1ESMA 1LMWB 2CDNA 1CHOF 4IBLH 2QT0A 4LPSA 1GWAA 3ZQJA 1KI6A 2CL0X 3ZZTA 2WICA 2OCAA 1AE8H 4VGCB 3JVUA 3PJRA 3THOA 4AY2A 1N6LA 2NU4E 2IL1A 4K81B 3L6PA 1QIXB 3PCRB 3SFVA 1QDEA 2Q6TA 1RYHA 2ZRGA 5FI0B 4DBLC 2WOJA 6CHAB 4A1XA 2ZETA 1W10U 2ZS9A 1Z8IB 3ZDQA 2ZDVH 1WUNH 4INKA 4AI6A 1GMCG 2WVJA 2Z9IA 1LF0A 2R6GA 1LB1B 2QORA 4QM6A 4ZIRB 2EI8A 4B2AA 2BX3A 1PQAA 1OKXA 4M22A 4LSGA 1AKYA 5FAHA 5J4VA 3KXLA 2ORWA 3VR2A 2OLKA 4DIIH 3Q9LA 3W6PA 5FR1A 4HSEA 5E4FA 1S0RA 3BXZA 2PSYA 5FBWB 4LYHA 4Y0AA 4EPXA 4UNQA 2WOOA 4BFSA 2QENA 1NLFA 4NDZA 5CLQA 1MKWH 4OBEA 1QHSA 4FWIB 1BMLA 4O97A 3SNBA 3LBNA 1ANDA 3NHBA 1LY1A 4LV5B 3I4LA 3KKNA 1PJRA 3KFVA 2QCYA 5EW1H 2ERYA 2BLOA 3VPKA 2OE2A 2OESA 1AUTC 2VPPA 2ZP0H 3QEOA 4RSGA 2AD5A 5KSPA 4U02A 3RXJA 4W9MC 4BGDA 1TGSZ 4AB8A 1E0JA 4RD3A 1ZC3A 2ZRLA 5FX6A 2QAGB 4YDHB 1H4WA 3PV4A 3RU4D 1AO5A 2A5GA 3FMFA 3GEHA 2NGRA 3HGPA 1W0KA 2R65A 2GCOB 2BDIA 3K9HA 1CA0C 2BBTA 1P02A 3UWOA 1TQ6A 4TMWA 2ZGJA 1U9IA 2WBLC 1W0JA 1E0KA 1HCGA 4MDFA 4Q7LA 4XDEA 2SGDE 1KO8A 4MQBA 3BG4C 1T4UH 2JA1A 1WCV1 2ZDMA 3QIAA 1ZD9A 4LYJA 1SL3A 1ZRBA 4PQYA 2GXQA 1W14U 1TQ2A 2O8TA 3TKLA 1QF9A 4CT5A 1VG0B 2YHSA 5EQQA 2HV8A 1SVKA 1JAHA 1C4OA 3AEZA 2OV2A 2OD3B 1DE0A 2BKUA 1W12U 1HJ9A 3F6UH 1P06A 2CJWA 3TBKA 2XX3A 4Z54A 4RY2A 2YV5A 4OGXA 2BVNA 2ZHQH 1Z63A 2ZRDA 1P75A 2EC9H 1PPCE 2FTLE 2H9HA 3Q5EA 1AVGH 2SNVA 2EA3A 3LXRA 4XFQA 1E9DA 3PM3A 1MT0A 2QBYA 2ZRNA 1B5GH 4GHQA 3SJ9A 4MKHA 1SVOA 1SLVB 4IC5A 4TY7A 3DHWC 2ZR0A 3AB3A 1HEIA 2ZRCA 1KXAA 4BAQB 3F68H 4KFSA 2CEAA 4AYWA 2YNMA 4J0QA 3IPXA 4AYTA 1Z5ZA 1R5NA 3A7XA 1RRGA 3DO6A 4X8TH 2C8XB 1NVWQ 3EWSA 3M7UA 4HEJA 3QPWA 4A8JC 1O5CB 1SZPA 1DAFA 5EP3A 5K8UA 4DCTA 2C8ZB 2AGEX 3FFBA 3RMLH 4E22A 3ESTA 1NJFA 1NY22 2VF7A 2XXAB 5F3WB 1O32A 4NCHA 4XH9B 4KLZA 1JR3A 2PFEA 5KO2A 1T8NA 5AJVB 5GJVC 1NTPA 5E8EH 3U8OH 2FOCA 1ZM4A 2AFIE 3LU9B 3SEAA 5A0FA 4I8HA 4E03A 2XB2A 2DWOA 2V35A 1Z6YA 3BWDD 3W94A 1CHOG 2CLDX 1QVAA 3TK9A 2FM2A 4ZV4A 3HK6B 4G5GA 3CNNA 4ZCMA 1OXGA 721PA 1P10A 4GUXA 2A5DA 1Z6AA 3PMJA 1A7SA 1NM6A 1N8OC 1XNJA 1GBEA 2PZFA 2HT6A 1VCIA 1LVYA 3CX6A 4GMXA 1GHBF 1HJAC 2HUPA 4AURA 3B9FH 2D4HA 2WWIA 2BY8X 2MSCB 4QG7A 1OWDA 4DB2A 5BXQC 3GCOA 2OO7A 2Z43A 1OYTH 3SYKA 2BDCA 1TNLA 3RXHA 3EYDA 5FPSA 2JLVA 5C2ZA 3LGYA 5G41A 2IYXA 3G0HA 5HR5A 2J0UB 4NWLA 3ZVAA 3K0AA 3T35A 1GL0E 1VITH 1D2MA 1O5EH 3RANA 4OJKA 3QXHA 2WV4A 3EA0A 1TL7C 2O8CA 2C78A 1S9HA 4Q7MB 5EZ6B 1COWA 4J1YA 3R3GB 2ZJ2A 1F6BA 1TQ4A 1P2JA 1MZDA 4C2UA 2HRVA 3UMRA 2AMDA 2GCHF 4RFVA 4A2PA 1XZPA 1FFHA 2V0BA 3DDCA 4XOJA 1GIAA 1JEDA 5M04A 1AS0A 3G01A 1ZJKA 3CNLA 4JVLA 3VGCB 4QBIA 4B75A 3RRMA 1T3LA 1KLIH 3TGJE 1GG6B 4Q19A 5EE0A 1GWNA 3F9FA 2KE5A 3RRNA 1L1NA 1HAZB 2PTCE 1O5BB 3QBTA 1C5WB 1W36C 1E6CA 4P3YA 1BH2A 2B8TA 3BTKE 2K5UA 4HYYA 3EZ2A 4ZKRU 4JYCA 4DLXA 3AASA 3VB4A 1UTPA 2NU0E 5HMAA 4H1VA 4B6EA 3GLHA 1ZSKA 2P2LA 4GOJA 2PLRA 4XSGA 1TALA 2R0KA 3T5FH 2UZ3A 3B7GA 2VP5A 4TQAA 5GJCA 1G5TA 2GRJA 1S3GA 2UUKB 2AXPA 2IJD1 4F4JA 1RJ9B 4G01B 2GILA 1H9HE 1GM5A 5JJLA 2VP6A 4B74A 4FU9A 2W7SA 5FTKA 3D65E 3UMFA 5EODA 4ZAEA 2OM2A 3DMNA 1NBMD 3NC0C 4RZ3A 1E2PA 1LS1A 1SVPA 2BLVA 2BEKA 2BD9A 1MABA 1KY9A 3CRMA 3CR8A 1E37B 3C16C 2GDDA 2F3RA 2ZQ5A 3REFA 3H84A 2AD1A 2YVUA 1AVWA 1UTJA 2G83A 1E32A 4O2RA 5C1BA 3TVDA 3ZZ8A 1YPEH 2PT7A 2PBRA 2J94A 1Q3TA 2K1QA 2QE7A 2BD8A 2ZNKH 3BTQE 1UVSH 1XCMA 4A7IB 1ZHPA 1YPMH 2GJAA 3ZS9A 2TGTA 2ILNA 2DYKA 1M1YE 5T6DA 1G3RA 1TMBH 5TARA 1U6QA 4INHA 5DSZA 5HKKA 3C5HA 1KSJA 2FJUA 1YZTA 1H8HD 1DAEA 2FU5C 4FD2A 4B3GA 1Z1JA 2GVDC 2JIZA 4LOYH 4WVFA 1FTNA 1Q2WA 1Z2CA 5JWHA 3QENA 1HAVA 2Y82A 2GDJA 4LOAA 3KUCA 1YLCA 2BBWA 3V4FA 3ZZ0A 4WXRA 1EZQA 4RD2A 2BJVA 1D9ZA 2NO9A 4I81A 4K2YA 5EG4A 1P2QA 3A1VA 1Y3YA 3D7MA 1O3MA 1O3YA 1WTGH 3X1XA 3RRYA 4Z51A 4D2IA 5AJZA 2A5AA 3A86A 3I92A 2J0VA 2ONKA 2QROA 2BVSH 3AVTA 2ZKSA 1S9DA 2QMOA 3CKLA 3Q5DA 1OYYA 1ZD8A 2FZ4A 3TGPA 3M1IA 1QCPA 1HBTH 1MH0A 1P2KA 4UD9H 3HKIB 2FEOA 2O9QA 4X6NA 3K1JA 1ELTA 4JYVH 1Z0FA 2UWLA 3M3TA 4ZDWA 3QG1A 4Y6DA 2FWWA 2WJIA 2J59A 4Q18A 1ANCA 2CK3D 1S5SA 3UFAA 4MGIR 1GBJA 1P61B 3HPQA 1OIWA 2VSOA 1H9IE 5H1YA 4QJ3A 1T4GA 3L33A 3UR9A 4PAMA 5AFYH 3AF1A 2XTMA 1PQ7A 1EAUA 1VITG 4F92B 4O3UA 1W7XH 4A1TA 2J46A 2NO6A 2OINA 3EAQA 2QF3A 4X8OA 1IHUA 3GDUA 4DG4A 1FX0A 1NRJB 2F9LA 3UTUH 4HZUA 1A0HB 1V2VT 1ESNA 4AYXA 1ZMNA 1EPTC 3SO3A 1KNQA 4ASUA 1DWDH 1NKSA 5FCKA 2B7DH 4CIDA 3C4JA 1E34B 3TH4H 4BAHB 5GWZA 2SFAA 3CBQA 1SGDE 2O0HA 5K0HA 2V6JA 2C4FH 1T9HA 4ILEA 2NIPA 2BB4A 3EA8A 3BB4A 1WXRA 3MU1A 4RZ2A 4X0WU 2CLCX 5DGXA 1B0FA 2BC9A 1MQ6A 5IT5A 4PC3A 4TYDA 5F2EA 3QLPH 4YO9A 3IIJA 2Z6VA 2RGEA 4NIXA 1GUAA 2IW3A 2OLGA 1OP2A 1FY3A 3IQWA 3AVUA 4IDHA 4Y0YE 1K1PA 1KSGA 2ZTXA 1CJKC 4UDWH 2BY7X 4QC2A 2FOAA 2VSXA 2WMOB 3NKKA 2ZR7A 1ZTLA 1G3DA 1C2FA 1E2IA 1Z71A 1T5IA 5LPNA 1O2NA 4R8TB 1K6MA 4D9RA 3WMFA 3H7OA 5HE8A 1TOCB 2Y5GA 3NK8A 2Z83A 5CYOA 1L2TA 3THWA 2QM7A 5E7IA 3SNDA 3LW8A 4X8MA 3NUMA 3PVSA 4F38A 4D80A 2VQSA 2QPTA 4XBDA 3LQQA 1A0JA 1YZNA 5DP7A 1YPHE 2ZJAA 1DAKA 3U8RH 5EXTA 3GDSA 1DWCH 4JVSB 4Q1CA 1KDOA 3DPUA 3W95A 2UUJB 3NBZC 4DCUA 3H86A 2ECKA 1UK2A 4HUTA 1G8HA 4C7OA 3QTVH 4A9AA 3ZIAD 1AHTH 2ZRPA 4FUHA 2I1VB 4EKDA 3G82C 1C2JA 1UDWA 2RDLA 1HAPH 3S9BA 3LDAA 2AIQA 4YESB 2CXVA 2IS6A 3UNQA 3RABA 3JZ2B 4JKIA 1GGDC 5JBAS 1OH7A 4KP0A 1ZRKA 2C93B 4NA8A 4R98A 4JJKA 4N3NA 3LT3A 3K9XB 4OHWA 3KHVA 1E2JA 1RS0A 1JQLB 3SGAE 2CK3A 4D0NA 4B76A 2BD4A 1YCPM 1N6RA 5GIBA 4PPFA 4LY6A 2O52A 1WDTA 3CZPA 1ZGIA 4K46A 4JVNA 4LJYA 5DKMA 4MITA 1O5DH 3T06B 5K8LA 3GJ6A 4K3JA 1LHEH 4NGAH 4OHZA 5K7RA 5BYKA 2OG2A 5G4BA 1U90A 3NKVA 4GPTA 2PT5A 4HAXA 3A7ZA 1JQJC 2P3TB 2X2FA 1KNXA 1Z2AA 2O8FA 1P2SA 1QY6A 2WPJS 1KIGH 3MO3A 5FH9A 1D5CA 1CGHA 1UHBB 1Y8TA 4C0LA 3TR0A 1RVDA 1SKYB 2J0UA 3AVWA 4ZHMU 1ZSJA 3DKVA 2FXRA 1OIVA 1SGEE 4Z8XA 1QHIA 4QM7A 1GHYH 1EX6A 1XUHA 2QTFA 3U61B 1ZRHA 1V2UT 2ZM5A 5L3QB 2VIWA 5B6LA 2W26A 1UKVY 5T6GA 5JWRA 1NY5A 3RXLA 1XUJA 1YGCH 1EWRA 1W8BH 4BTIB 1T8TA 2Z4RA 4K5ZA 3NBYC 4ABAA 4Q5IA 1UBCA 1OB2A 2CF9H 2FP7B 3ZYEA 4ABDA 1V2NT 3LV8A 4JL8A 1O35A 2VIOA 1T7CA 2IYTA 3IQXA 2ZU3A 3A1UA 4BFYA 4KXFB 3VTKA 2SNWA 4OM9A 3LX5A 2B7CA 3VU9B 2A4RA 3BFXA 1GFIA 1HIAA 2G1KA 1K1LA 3A8CA 1RIWC 4IOJA 1BIFA 1XJCA 1WU1A 3LQRA 1TPSA 1G21E 1YC0A 421PA 2FX3A 1TQ0B 1IQNA 4D26A 1TTTA 4OK5A 4NZYA 2EYUA 2C90B 3ZZ4A 5EPYA 1GRRA 4QRHA 1O87A 3EA9A 3KZ1E 2ZWLH 1C4U2 4DLVA 4EPVA 2OC7A 4HB4A 3SJIA 3ZV8A 4JLBA 1LW7A 1W46A 3GISB 4DGJA 4JK6A 4L9WA 5HM2A 3NEJA 3LJJA 4RI0A 1RFNA 4U01A 5G3YA 4XE4A 3CWZA 2OILA 5L2YH 5DNYB 2QAAA 3MSXA 1KXBA 2ZI2H 4Y11E 5HCIA 1K2I1 2N46A 2ZU4A 4WMDA 1GCTB 1YM0A 4NBSA 1G3EA 2ZSFA 3QNUA 4R2HA 2VIIA 2BLQA 2J95A 1BMMH 2QM8A 2ZFFH 4X6PA 1RRKA 4Y7BA 4FUDA 2AK3A 2BDGA 2AS9A 2Z94A 3W8RA 2Y6TA 2RB4A 1FPHH 3B8JA 2R6DA 1W3CA 4TY6A 4Y10E 3A7WA 2GA8A 1U9IC 1EZUC 3T29A 3RM2H 1Z28A 1TAWA 1ZTJA 1Y3UA 1D4PB 3RLWH 1QB1A 2FSGA 3IIMA 3LX8A 1ZMLA 2WWXA 1AZTA 3EX7C 2H18A 2RG3A 4EUNA 3EWAA 3PIRA 1G1MA 1A5GH 1GVLA 4BAOB 1T8LA 1BOFA 1BRUP 1JWTA 3FZDA 2BCGY 5DN6D 1II8A 1C5MD 1XXHB 4DT7B 5TMPA 1UTQA 1T32A 3HR8A 3FKSA 4JLKA 2ZTYA 4IFEA 1F0UA 1ZYUA 1N6YA 2AR7A 2BBSA 2WPDA 1LCYA 3E70C 4BXWA 4PROA 2W83A 3PUWA 2CGAA 1P2UA 1UBEA 2FZZA 3NBXX 3HWSA 4AZ2B 3CWQA 4EAQA 1C4Y2 2QMUA 2QQ0A 1W11U 3PWBA 4GFDA 1EPTB 2JDID 3BTFE 2AKYA 3V4RA 3TQFA 1DO2A 1O2WA 2C03A 1O2ZA 1C1UH 2JJ2D 3LLMA 1OFIA 3ONWA 1FP7A 3Q3JB 3AF3A 4LI0A 1GHXH 2OC0A 3MMPA 4DIDA 1FZQA 3ADKA 2W3IA 1MTNC 3OHMA 4X6OA 4DT1B 1E94E 2JIZD 2B5TB 4EIWA 1UBGA 2GEDA 4G0NA 4JYTA 1VG9B 2ATVA 4CBOA 3FP7E 1HJ8A 4A0HA 2GHIA 1XEWX 2ZJZA 5B2ZA 3OEHD 3ATIA 2EWVA 4C7OB 1KO1A 4PXAA 4LC1A 5CMXH 3I62A 2FTMA 3EAJA 1HXFH 3GOVB 4LV8B 5J4SA 1S0QA 1DT2A 3UG7A 3W3AA 3W34A 2BOKA 1ETUA 2WWWA 2VNTA 1JBKA 4UXHA 1HQYE 1RIFA 3SV2H 5HCNA 2XNDA 2Y5FA 4M9XA 3LY5A 2V54A 1D3TB 5SZIA 3CH5A 4FMCB 4I1VA 1LDTT 3A1TA 4PC2A 1ZZZA 3QK1A 3QF4B 3KJHA 4PC7A 1WMSA 3HGNA 1XVMA 1DX5M 1XJ0A 3AUYA 4RKJB 2A31A 1IQPA 2CXXA 2CE7A 2GX4A 5P21A 1HDTH 2VHJA 3KKQA 4GP6A 4DY7B 5JHGB 4DDVA 4Z6AH 4PAOA 2ZRHA 1FI8A 1PPZA 4E05H 4DDTA 2V7QD 2ZPQA 2R3UA 4CZ2A 1V2JT 1KLJH 5A8ZA 1OXSC 3HK3B 3MH7A 3OY6U 5BN5A 4FMBB 1Y5AT 1II9A 1QZXA 3OX7U 4KAXA 2FSIA 5DHAA 2IJOB 5DI3B 4P4SA 3KKOA 2B6HA 1W0YH 5EOKA 2BZ6H 3KQUA 5EPNA 1N6PA 4PO9A 3OTJE 1DOAA 1BJVA 4F91B 2AFHE 4Y0ZE 4QT8C 2GK7A 3LGUA 1E79A 2XZPA 2GJ9A 2J9RA 3N7OA 1HQCA 4Q7YA 3CPHA 3QGNB 2GCTB 4LYAA 1DXWA 2ZF0H 4BFWA 4BUJA 4MNXA 2RAPA 3B5JA 3SQXA 3K2UA 3M5MA 5B30A 1E96A 4WBSA 1KKMA 1S85A 2NU1E 3AVZA 2IC5A 1EOJA 4JBXA 3H4MA 4EPRA 3EA7A 1C2EA 3PB1E 5CK4A 2GF9A 1X8KA 4G5RA 2TBSA 4OS2A 5I25A 1CRQA 2WHXA 3PV2A 2AKAB 2TPIZ 1ESBA 1M9UA 1CT2E 1U8YA 3WBKA 3SUEA 1FMJA 3UPEA 1S4QA 3WP0A 2A2QH 3SNAA 4X1RU 3I5XA 1XU4A 5J4YA 4OS4A 5DK1A 1SBWA 1A5TA 2AERH 3U4QB 2A7CA 1E9CA 1OHHD 4X8LA 1GTVA 1KI8A 2BHGA 3C41J 4MYTA 2J5XA 4D8NA 1NT1A 1IOEA 1PPEE 3RXAA 4DEYA 1OYQA 3MI4A 3VR5A 3UK6A 4W5JA 1O0DH 4PZZA 4JT4A 1HB0B 1KJYA 4I7YH 1KY2A 2V1UA 1AZ8A 1Z6EA 4GRAA 1GMHF 5GJWC 4Y0VA 1X6VA 1R0XA 1Z0JA 4TYYA 2NG1A 4NFFA 1ONBA 1YRAA 4DDUA 2QAGC 4Q1BA 2IYUA 3AKCA 4ARZB 4C0BA 3AAVA 4Q1AA 3UMSA 4X2YA 1BYUA 1MO6A 2W3KA 1VCMA 1LPKB 3E1XB 1YRBA 1E0AA 1G8GA 1GKIA 2OT3B 3I78A 2BXUH 2D1JA 4LRWA 2PMDA 1TRNA 1R7RA 2G5VA 4TSFD 4MPWA 2F83A 5CDFA 4TTPA 1FAKH 2MMGA 2W6IA 2GTBA 4CT4B 4ZDIA 3EIQA 1IN5A 1Z8JB 1WBGB 4K1SA 3CS0A 2CJIA 4DCNA 4OK6A 4M9QA 2H5DA 2A3RA 1S0UA 3STIA 3M61U 4B32A 4GCHF 3CUEF 4JKYA 1AA9A 3CENA 2H9EH 1O30A 4A4DA 5C67A 3X1DA 2ZS8A 2VWNA 2J92A 1HIAB 3CONA 2ZFSA 3SGQE 2PMKA 2O8UA 4UFDH 4OQFA 3UXMA 3S7KB 2Q6FA 3PEWA 3X1YA 1TUEA 1J70A 4MPUA 4D82A 2CVFA 3BIVH 1T0HB 3TRFA 1AGPA 1QQUA 2ZRAA 5HE9A 4NG9H 1BMAA 5KSYA 4HTCH 4A5TS 1FMGA 3I3SR 5LDDC 4Q21A 3B60A 1KTTB 2QA5A 2Z5FA 4P0TA 3LC5A 3VKHA 3IO3A 4ZXXH 2WPLS 3FB4A 5E7JA 4IMQA 3BERA 1G4UR 1C5ZB 1O3CA 5AJWA 2BY6X 2KB0A 1J14A 2O8EA 3HATH 4K8OA 3NDBB 1MBMA 1YPHC 4JCNA 2VL7A 4WVPE 2VO1A 3MAAC 3U44B 1MABB 4EDHA 2WV9A 1Q57A 4NH0A 7GCHG 3BFVA 1TX8A 4C0HA 2IEYA 2FMJA 1HTWA 1SGPE 3L8ZA 1T4VH 5EU8A 4JZFH 5HKKD 3R9IA 1O3LA 1WE2A 5GPIB 1E9EA 3LJOA 2FDAA 4XOIA 5L8VA 1RD3B 1ZUNB 3BFKA 3F9EA 1E2LA 1BRBE 1CS4C 2ZYUX 4HATA 3FAOA 4FUCA 3BB3A 5IRCD 4IW4E 1JRTA 1SKYE 1P04A 3QTOH 1G36A 3BTWE 3QPUA 5F8XA 4RFSA 2OBQA 1YPKH 4DIHH 3LH5A 2QPOA 5EXSA 1YLDA 4B3DA 2W5EA 2XB4A 5TB5A 4RFSB 2HT1A 5JBTA 2HYIC 5EXXA 2GESA 4MNYA 2O8LA 1TPOA 3TJOA 1J17T 4ACAA 2X19A 3TK1A 2W2XA 2PGQB 2Q21A 4DW2U 3DUXH 4JT2A 4M21A 5FTNA 2TMKA 1ZVQA 2VINA 1EG7A 2RHDA 4XWAA 2ZSBA 1YZGA 4ISOA 1M7BA 3A82A 4O3MA 3AM1A 3SS8A 5C5NA 1ZHRA 1SC8U 3RXEA 3I61A 3ZVBA 1KTSB 4B2BA 4R0IA 3M5LA 3B9QA 1KMHA 1EP5A 3GFOA 3QKSB 2J3EA 1G37A 2FFAA 1SGIB 1XTJA 1KY3A 3ADBA 2IN2A 2PTNA 3E2IA 5CLLA 1PV4A 1GDUA 3AW1A 2HOBA 1OPXA 3FMPB 2IUSA 5L30H 3THYB 8OHMA 3KB1A 1RRFA 3RXUA 2RGBA 3RS4A 1TUIA 2FEMA 4DSNA 5KNCA 3VX4A 2P16A 1YCPH 2FZLA 3MNXA 4B3BA 3T1OA 1FQJA 1CGIE 1EOLA 1IN4A 2ZS7A 3CPJB 1LKAA 7GCHF 3C1KA 5FFMA 5CK5A 4L4UA 1P11E 4BNRA 3WHLA 3GCGA 1HH4A 2FYQA 1G41A 1ZAKA 1P2NA 2IOTA 2JH0D 3P8NA 1TADA 1F3OA 1UVUH 1MBQA 2OLJA 1ELDE 4PZLA 4P31A 4BZQA 3U3JA 1T8UA 2CHGA 1MUEB 2FH5B 2IK8A 2IYVA 3WY9A 1VIAA 3RMNH 3D8BA 3SN6A 5JEDA 4IN2A 1DM4B 3OE7D 1GBMA 1C1QA 3NC1C 1SVIA 2ZVPX 1U99A 3P4XA 1N0UA 5IHPA 2HJGA 4B3CA 3DVLA 3K09C 3FVFB 2VIDA 4C4PA 2NPFA 1UF9A 3SFZA 3S0NA 2H1UA 2R44A 1YU9A 4IOLA 2CL6X 3KNXA 1C5UA 2GAAA 4ZH8A 4TTRA 3A37A 2L0XA 1OSSA 4N1AA 2A5JA 1XTRA 2V6IA 5EGMA 1C1OA 2J87A 1UVTH 3RDZA 5LD2B 3NWJA 1G9IE 2ZFTA 1ZCAA 4ZKSU 1S96A 2QI9C 2FLRH 5C4GB 3U8TH 1PPHE 4G5SA 4PPGA 5AJYA 1AGRA 4OHYA 4ZI3A 1MTVA 1AUJA 1QG2A 2GTPA 3H2YA 1NU9A 3FMIA 1E38B 2QXGA 1FQKA 2R62A 1C1TA 1DS6A 1SHHB 1O5AB 4E7RG 3UWIA 1X1SA 2J7PA 1KJWA 4HUQB 8ESTE 3QSYA 3KL6A 3SHWA 1W2KH 1SULA 4Q9IA 3GJ7A 3ZZCA 1EFUA 5KSOA 3K70B 3K0SA 1AB9C 1SGQE 1P9NA 3TU7H 5KDOA 3T25A 3ADCA 1TF5A 5A0CA 2XITA 2BHRA 1Z7KA 5FL3A 2SGEE 2ODEA 5AUPB 1A4WH 1IXSB 2HLCA 1RFLA 2WPHS 2V3CC 2ONJA 3AP3A 3WNDA 4CGZA 1GHVH 3X2SA 1V2PT 2ZE8A 1MRNA 2G77B 1MKXH 2HYDA 3SBDA 1JAIA 1GBKA 2JH6D 4Q9LA 4TLCA 2F9VA 1W48A 4LHVA 2GJKA 1G19A 1PUIA 2F3TA 1JECA 5I46H 1JEEA 2O8DB 3FOZA 3GEIA 3RMMH 4GT1A 3RVBA 2AFQB 4YXWD 2GMTC 1NF3A 1JXPA 1KXCA 1KK3A 4Y8XA 1AJEA 2REXB 4AKHA 1Q31A 1YZKA 1K8RA 4KSCA 3QPVA 3LGIA 1ZU4A 4ERNA 3OEEA 5CITA 1UO6A 5E0GA 4E07A 3KTAB 1BTHH 3ASZA 2QY0B 1C1RA 2Y81A 1OWEA 1K1IA 1D9XA 2ZG0H 4TT3D 1TEVA 3SE0A 1BA8B 3E0PB 1OP8A 2XBVA 3F0TA 1E2HA 3U7HB 1TMTH 5T1VA 2Q3HA 1B7XB 1DLEA 2A45B 4SGBE 1TU4A 1G3IA 2OXSA 4PQFA 2C99A 2F55A 4NA9H 3PLKA 5JYIA 2WV5A 3VQTA 4GP7A 3NVAA 4AGKA 4B34A 3CPEA 3X1WA 3RLFA 3VNVA 1E1RA 1G7TA 3BEIB 1PQ5A 2CCKA 2P3FH 3TW8B 2ZROA 4GVUA 5JB9S 1W5SA 1JPJA 4OI0A 3JVVA 3QKTA 3GJ5A 3TPIZ 2ODWA 3VFEA 4PO8A 4B43A 2ZXUA 2GNOA 4CEHA 4ARZA 3M0EA 2QUZA 4KODA 3OU0A 1EX7A 1EFRD 3CRVA 3QE0A 4X2XA 5J47A 3TNTA 2XSZD 3RDPA 2UUYA 3ZVFA 1ZM3A 4MTBA 3LO5A 2UKDA 1ZUHA 1TPPA 1G291 3RXSA 3P20A 5A4JA 5PTPA 4AKEA 1OX1A 1XM1A 3SU4A 5GNDA 2UUFB 2LPRA 3MH5A 4TLAA 2FEQH 1N8OB 3ZZAA 1P3JA 4FCTA 4KLNA 1OP0A 1B0EA 3D49H 3I5YA 3RS0A 4D4MA 2DWPA 3VXEH 4NCIA 3M5OA 1G7CA 3ZVGA 2H2ZA 4JLOA 2OFOA 1GKUB 1OFHA 3P70B 5BPEA 1O3GA 2C8VA 4K69A 3PMAB 1O2IA 3S1AB 1P2MA 3V12A 3SBEA 1QHNA 2D62A 3JZ1B 1B0UA 1CR0A 4FMDB 2NPIA 3O8BA 4RCYA 4JLAA 4B33A 4Q9HA 2KWIA 1KZ7B 4OS6A 2O8BB 3TNFA 2F1RA 1YPJH 1O2KA 1ZD1A 1PFXC 3OIWA 4ZIRA 4OHXA 1RPZA 4X1NU 3VEQB 2H8KA 2ESTE 1LVGA 1IXRC 1FUUA 1Q1BA 2WYJA 1TNKA 4F7WA 4HLUA 4WH8A 5FX5A 4LGMA 1GBCA 5EQRA 4TN1A 2Z9GA 1R0ZA 4TL8A 4Q00A 1NN5A 4ESHA 1WTHD 5DLQC 2ZAMA 5AUQA 2FE4A 9ESTA 1OJLA 2J0SA 2OP9A 1NFWA 3PG5A 2VHUA 3T1QA 1FN6A 2IWHA 4KELA 1WQVH 2G0TA 1ZCBA 2HVXA 2FFHA 3GICB 2JETC 3RHFA 1GP2A 1E2EA 1N25A 3K6YA 1QHYA 3RNLA 3UUZA 1NJGA 3QXXA 5LD2C 2BJWA 2OCVB 3K09A 3FVQA 1GILA 1SMFE 1XTKA 2C3SA 1IHTH 1E9SA 1ZU5A 1BRAA 5KPDA 2FNAA 2OHFA 4HZUB 3B82A 1DVAH 3ZZDA 5G53C 4NTZA 5HM9A 3TGIE 4MH0R 1TX4B 1NN3A 2EW1A 3D62A 4BLTA 4URYR 5EP4A 4AWXA 1EX3A 1DO0A 4OQNA 1IQLA 1TNJA 1BTPA 1TFXA 1E9RA 1GBLA 3N70A 2ZSDA 1ELAA 1ZC4A 1RW4A 4XTCS 2BDTA 3GDVA 1E1RD 1ZM7A 3RXKA 2PLXA 3RXFA 4ABBA 1C5LH 5EUQB 1DY9A 3WXMA 4URWR 1CXZA 1CJMA 1E1QA 3MNSA 1NI3A 1SGRE 1G30B 5CYPA 2OBMA 4URXR 1IQKA 5EP2A 1F5NA 3ZVMA 2DE9A 5B58C 4AKGA 3SV7A 2XW9A 4CRFA 2BEJA 4D6PA 3DOEA 4QGFA 3EPHA 1IY2A 3LW7A 1G18A 3PUYA 2C9CA 1GHBG 3BV9B 3K0CC 4TLDA 2FN4A 4G5OA 4YTAA 2FOMB 1HUQA 3GY8A 2O0JA 1ID5H 1AIXH 4A6PA 3ODFA 3QVUA 3MWJA 1GJ9B 4DCVA 2QBYB 2G8TA 3UNRA 4HDCA 2ZU6A 5AK0A 4LHWA 1DSUA 3Q85A 5DP8A 1BTXA 2NWNA 2ZSEA 2WJHA 2STAE 2GD4B 4AYVB 3H09A 4CDGA 5CM9C 3U69H 5FL7D 3BTME 3W9YA 1R6BX 2VVVA 1TF2A 4NE2A 3IHWA 4BFVA 4ASUD 1G5PA 1C4V2 3OESA 5DYGA 2Z7FE 3SZRA 4K60A 3EXAA 1BBRK 5JECA 2M5TA 5EZ5A 3L8YA 1BIOA 4NYJQ 4BECA 1E2MA 2D7DA 4F4CA 1F2TB 3QZRA 1Z0AA 2WM9B 3QKUA 4OGYA 4A2WA 1V2OT 3A1SA 2BYAX 4ABFA 4I33A 1V6DA 3P27A 5A0AE 3KUDA 4XD7A 2VLIA 2VVCA 1P9UA 5K8TA 1AKEA 3MH6A 1NSTA 3UOUA 1QRWA 3IWMA 1RE0A 2YOLA 4Q03A 1TGNA 1LV7A 4Q4JA 3L0PA 5D3MA 4CRDA 1MCTA 4MDSA 1GL6A 3TQCA 1ZP6A 1PPBH 1QGFA 4ABJA 3UOPA 1D8TA 1ODFA 1ZIPA 3B78A 5UKDA 3HU2A 1EATA 1EJMA 2OQ5A 1ELOA 2ZCLP 4AOQA 4XSHA 4ISIH 1GI4A 3MYWA 3U7GA 4TYQA 2BTCE 5LPFA 1YR6A 3RXPA 2J1LA 3KJGA 4HB2A 2OCBA 3FP8E 4BLSA 2UWOA 5KTYA 4IS5A 3AVQA 1SGNE 5E3HA 1HFDA 1LNZA 1NRPH 3S9CA 1VHTA 1F2SE 1WV7H 1OH6A 1R0YA 3T1TA 4OS7A 1VCQA 5FI1B 2GEUA 3LKWA 2XAUA 4OK3A 4Y76A 4EPWA 1E36B 4QBFA 221PA 2XJ4A 4CEIA 1NRQH 5DHFA 5HTKA 3VAAA 2YC2C 3TSWA 1SFQB 1N5JA 3NBFA 1D3PB 1MD7A 4FWTA 4FI3C 1HAGE 3VX3A 1YPLH 4CHAC 1O2PA 1DPFA 2HGTH 2B8WA 3EZ7A 1JXOA 4ZKDA 2V55B 3K70C 1XFAA 1OOKB 2XJ9A 5JSZB 2NO1A 5J4LA 3FHOA 4MRRA 2I1QA 5B64A 4DUGD 1J8AA 1C5SA 2ODNA 1FAXA 2Y7XA 1GJ6A 2WIBA 4B2PA 1W7GH 3C5CA 2XBXA 4A8JA 2EWWA 2ALVA 1KSHA 4Q7ZA 4SGAE 2W00A 2GBLC 4RD4A 4Q1DA 3SNCA 1TMUH 4M1TA 4NIYA 2R2MB 1MOZA 2ZUDA 2CL7X 2ZTZA 4ABHA 4KSBA 1Q3HA 1XTSA 1PLKA 1MKYA 1VCOA 3GLFE 2ZFPH 1CEEA 2GXSA 3NDPA 5A8YA 2VP2A 1YR9A 2YC4C 1LF5A 2XXLA 3GLFA 1XEXA 5EXNA 2NU3E 1CR4A 3QG5A 5SZHB 4LJAA 3IEUA 3MNBA 2HCJB 5AFZH 4WOPA 1A0LA 2O8DA 3SI3H 2BMJA 3U4QA 1N0VC 1F5LA 1OT3A 3GY4A 3SQHE 2D8WA 1QHHA 2XRCA 2C9OA 5JHHB 3TIFA 4D4JA 4W5HA 5C46F 1GJ7B 1GI3A 5CB8A 4D9QA 2I4IA 3PUXA 2OC8A 3MWLA 1C9PA 3VB6A 2X2EA 4C30A 1GI1A 4JSYA 2ZI6A 3CF6R 3UY9A 4CYMA 4BZPA 3FP6E 2JJ1D 3PEYA 2JDIA 1KSNA 5AUNB 1DOJA 1JXMA 2PL3A 5C18A 4YDSA 4BRUA 1SHKA 4M53A 2BY5X 2ZI9A 2ZI3A 4KKDA 3GLGA 4YLGA 1HAHH 3U2QA 1NMZA 4DJZB 1QHHB 4OI2A 3BEUA 2NZJA 2IYZA 4H6TA 3D6TB 1QHRB 2ALPA 4ESTE 1UCYE 1X8LA 3G5UA 2SGFE 3RLYH 4QOSA 1XTQA 2G88A 5JI2E 4A2QA 1VJAU 3IG6B 2FS9A 3KX2A 1NG1A 2NO7A 3PEUA 2RGNA 3MO6A 1K1MA 2PKSC 3SJOA 3MGCA 4DLWA 2FOGA 1ZNZA 4WXVA 1TPZA 1OE0A 3CZQA 1D2NA 1GZSA 4KTUA 4TLBA 4GPGA 4I1SA 1NC6A 4NMMA 2B8OH 2C95A 1SGYE 1GJAB 1ANBA 3IKJA 1Z22A 5ESBA 3RXTA 4EFNA 5FHTA 2H57A 3L0IB 2G6BA 2H92A 1FIWA 5FTMA 5F9FA 1UADA 4QL3A 4PZYA 2IYWA 3PR1A 8GCHG 1XUGA 2HNTF 1UTLM 5JCZA 2F9BH 4FMDF 4X1SU 2VH5R 5A5GA 4DUGA 2BM0A 2G0NA 1P09A 4Z0KA 1Y3AA 3ZVRA 3JZMA 2DE8A 4CR5A 3Q8XB 2FV8A 4Q01A 4BFXA 1EQ9A 1CQQA 2QA9E 3I77A 2JGNA 3R9WA 3SBKA 4MYHA 2GWHA 3NEYA 3PO1C 1XMSA 5E95A 3KN2A 4C9BA 4WF8A 3RXQA 1QBVH 5FPHA 1ZOMA 2GVZC 3FMOB 1YHNA 1MCVA 4BFZA 1AFQB 1F48A 1JIMA 2WMNB 2A1DB 3WMGA 1C1WH 1YYY1 2GCPA 3QKRA 2QP9X 3E3TA 1JR6A 4LZ4B 3TR5A 2A4GA 1LTOA 2ZITA 1SKQA 3ETLA 5L2ZH 5CIWA 3GCTG 1XXHE 1R4AA 5AWFC 3O47A 2LCFA 4IOKA 2DFLA 3SJ8A 1VDZA 3E91A 4I4LA 4RZUA 1AU8A 2ORVA 3GQBA 1GMDG 5FCRA 4B73A 1IOZA 3LBHA 3P26A 621PA 4U32A 3U6KA 2QT1A 5E7MA 4AX9H 5KPJA 5JPMH 2NU2E 4B48A 1CTQA 4EQ6B 4R2IA 1OWIA 1II8B 3SYLA 2JLSA 5FTLA 5FPTA 1WCZA 4MRVA 4TYPA 2ZJOA 4IDPA 3ZS8A 2VP4A 1DAHA 3EQ0H 2C77A 3FANA 1ELGA 1DE7H 1SFIA 3KGPA 2I6QA 4PHFA 4U2WA 5TXGA 1RJ9A 4IHQA 2W0SA 4GBMA 3N5CA 1D6WA 3T5GA 3MH4A 1OHHA 1FN8A 2G00A 5JBBS 1O3IA 2GJSA 4JMYA 1Z8FA 5A8XA 3MTYA 4PX9A 3PLPA 4JLVA 8GCHF 5CDFE 4NYIQ 521PA 4OS1A 1VKJA 1ZM9A 1TU3A 2WPIS 4H4FA 1O2VA 2W6JA 3OFNA 3UQVA 2ZFQH 1AQYA 4URVR 4G1UC 2PV9B 4RKFA 1CP2A 1GOTA 1V2QT 5JMTA 2J34A 1YPGH 1NL3A 3SUGA 3TK6A 3FKQA 3P92A 4PTLA 1EESA 1CJTC 4ZMAH 3R7WA 4W7SA 1XB2A 1XD2B 3GCHC 4GL2A 1G32B 1FXYA 3M36A 2QAJA 1MKXK 1KIMA 2P6RA 1XXDA 4GI7A 3SV8A 6GCHF 3EA5A 3RYTC 5HPYB 5FBQB 4DVGA 2RKOA 4LHXA 2IPHA 2XNSA 3F9GA 2WPKS 5EP1A 2PGBB 3W3ZB 4KGAA 2VHTA 2GZHA 1DG1G 4CRCA 4A0GA 2OXRA 1BTZA 1NFXA 3T62A 1ZGVA 3TSZA 2DWQA 4OQMA 3LAWA 2ANKH 3RXMA 1V2RT 1GMCF 4NKRA 4BXSA 1W0ZU 2FOFA 4EFLA 2NQ2C 1J8YF 1O31A 3THYA 1G2MA 1L2EA 1LO6A 1NROH 5C1YA 4KTSA 1QURH 2IYYA 3CP7A 2X1VA 2IX3A 1ZSLA 5J4QA 1NPMA 1SPJA 4YMWA 1IQMA 1TA6A 1M74A 2ZU2A 1K22H 4WZBE 2GEVA 2BQ7B 4KVGA 4FUBA 1KOFA 1SLXB 4DLSA 2FPZA 1OB5A 1SHZA 5ETXA 2QGRA 1S82A 4D4LA 3ATKA 1O33A 1S84A 4MLFB 5JDUB 3IDQA 3O8CA 2DPXA 2REOA 3UQOA 1P12E 3HYTA 4YQFA 3WY8A 5FXLA 3EZ9A 1FNMA 3VR3A 1NU7B 1IN7A 3SHFA 2V3HH 4YZUA 5FBVB 1GNPA 1HE1C 3B2EA 1US8B 3RXBA 5E0JA 1O2XA 3CM0A 4U5XA 2W0MA 3VFDA 3LGWA 1O2OA 3PFIA 2XZOA 3TJVA 2FYRA 1P62B 3MOCA 2B21A 1KO4A 4NYMQ 4L15A 1TQ7B 5DP3A 3RWMB 1FIZA 1W4AA 2P93A 3GJ3A 1G5RA 1RIWB 2QMHA 2IS1A 1BCUH 3CF0A 2Z9LA 1QFKH 4NCKA 5C5OA 2QXIA 3L3TA 4W5WA 3KTAA 1NN6A 2FPLA 3IBGA 4Q4LA 4OQLA 1XX9A 1WQSA 2BWJA 3DZ8A 2PJZA 4US1R 3DEFA 3VR4A 5G40A 1S1CA 1UM8A 3BIFA 2HEIA 2FO9A 1GI5A 5JS7A 3FZZA 2AIPA 2J7PD 1W0JD 3A58B 4DB4A 1P9RA 1XMVA 1GI9B 1EFCA 1TWXB 1PJPA 4OJQA 1J8MF 3R8FA 1W2GA 2BQ6B 5F9HA 2P95A 2OCYC 1BRCE 3WNCA 4QKQA 2AL7A 2PSXA 1W4CA 3SJBA 4IVPA 3Q00A 2GKSA 3QEJA 1HNEE 1IAQA 1XD8A 2OAP1 3QGJA 1C9KA 2A5YB 1C2LA 3M3SA 3TVTA 5ELXA 3BEFB 4URZR 3LBIA 2OEPA 3GJ0A 2WJYA 5CB6A 1DELA 1AN0A 4PHGA 2BMFA 2W7UA 1GJCB 1SGCA 3TAUA 1XJQA 4FMCF 4B3XA 4A6XA 4IRUB 2KJQA 1RXPA 1CA0B 1G7RA 1OFUX 1AQUA 1KTVA 2H16A 1Z47A 4AD8A 2GV6A 2TGPZ 2IEZA 4PC1A 2EU8A 2OUAA 2IF0A 4BEJA 2BV3A 1MTNB 3P8FA 5CHAB 1A46H 1QTFA 3A83A 5KSZA 1QL8A 3ELAH 1LPGB 4AC9A 4HI3A 1X3SA 1GI0A 4CEJA 2J38A 4LWZA 2KI5A 3T26A 2YOHA 3M7QA 3OE7A 3GY2A 2O8CB 4QFMA 1V43A 1K1OA 2H17A 1ELFA 2XC5A 1S1MA 2HJVA 2ANBA 1A5IA 2ZDAH 2R9VA 3TJZA 2F43B 2ZTSA 3Q77A 3KDSE 3ZZUA 1CA8B 3P6ZB 1WP9A 2ODYB 3BS4A 1N6NA 3NXSA 4WY3A 1C5NH 3F8TA 4XIGS 4RD0A 2QN6A 3RU4E 3L43A 4TMTA 4JZDH 4QHYA 1O5GH 2I3BA 3H7TA 1IM2A 3PMBB 4PPQA 3VMFA 2QXJA 4Z8YA 2ZYVX 1F0SA 3UR6A 1GDDA 4MKIA 4NYMR 4GCHG 2PH1A 4BAKB 3VHLB 4CRAA 2WZQA 2TGDA 3EPLA 1NESE 1P9SA 4JK5A 3AGPA 1QQ4A 1QL7A 2AGIX 1G3UA 1KDPA 1UPTA 3TLOA 2HNTC 2ZECA 2G3YA 3BJIC 1MAXA 1EK0A 2AHOA 1Z29A 3QWCH 2O8FB 4VGCC 5C4MA 1A3EH 3GLIE 3BN9A 2OQUA 3CB4A 5AVDA 4MYUA 4IXMA 1HV7A 3TUIC 2BD2A 3SN8A 1IONA 4TL9A 1TIOA 4P4UA 3MD0A 5FTJA 2ZO3H 1TEXA 1H1BA 3E16B 1D2EA 3QUMP 4NYJR 2DR3A 3MCAA 1ANEA 3LXXA 5ESTE 1EKBB 4KV9A 4MKFA 2ZYTX 1OFTA 4JLDA 5TV2A 3SNHA 2ZSAA 4CBNA 3UIRA 2ZQ1A 1YZQA 3V3MA 3LGVA 3S69A 1YZLA 3SJKA 1EZSC 8KME2 2EEKA 2ZHWH 2J0QA 4XSKU 2ZDLA 2FFBA 4UQOA 5GVSA 1AFQC 4NWKA 1AKSA 2G51A 1TNIA 2CHQA 2F6RA 4QNMA 3RSLA 4MRSA 3BOSA 3UPUA 2BQWB 3PO1B 2ZRBA 2JASA 2CN0H 4ABEA 4V0NA 2VTKA 4I8KA 2QIQA 4AK9A 1GRNA 1C1NA 1TRMA 5EXPA 1QJ7B 4MNWA 4TPIZ 3RU4T 4P4SB 3TSOA 1ESTA 3HR7A 1FPCH 4JLMA 4FINA 1TONA 1G64A 4IJMA 2XC4A 3NG1A 2EVWX 1EUFA 3NH6A 1QJ6B 2C8WB 1O2TA 3KB2A 3EIEA 4UNPA 4I8GA 3SYNA 2QL6A 1TBQH 4M1WA 2A7HA 2CJWB 1E9FA 1HGTH 3A81A 1Q0UA 1LVOA 1GG2A 2ZEJA 3RS3A 4Q7JB 2FPMA 2ULLA 2ZRIA 3KQBA 4TZ0A 1Z8RA 2LKCA 1DWBH 2PHBA 1K28D 1NN0A 2Q3MA 2VGCC 4GNKA 4Q7KA 3PV0A 1CJVC 3AAUA 4ISLA 5JB8S 1WAYB 3KJIA 5IDKA 3UWKA 3GFPA 3GPLA 1JI0A 1HY3A 2FFQA 4KJZA 2XWBI 3GYLB 1DICA 4CW7A 1E0SA 3K53A 4LK2A 3WMEA 1SXJC 3QJYA 1C5XB 3DM5A 1O2RA 1ZJ6A 5JCPA 4LC0A 4UNSA 1MTUA 5FBRB 3U60B 1P03A 3ZZ3A 4HLQB 4UFEH 4Q48A 1MR3F 3QUSA 2JLUA 2Q9BA 1N3BA 4S35A 2TGAA 3SYJA 1L7VC 2Y80A 1SQ5A 4QJ5A 3KQNA 2GT8A 1SHYA 3IEVA 1EFRA 2P65A 5JBCS 1WBDA 1PZNA 2G9NA 3I8XA 3PITA 1RTFB 1A2BA 1GBHA 1OKKA 4DWJA 1C2HA 4KCGA 2WAXA 1OWKA 1UEJA 3B9PA 1CRPA 4JL5A 3KFXA 1GBDA 2YOFA 1KI2A 4DLZA 1EGAA 1CE5A 2BZAA 3Q7QA 1E3MA 1NO9H 1KO7A 4JBWA 4JBYA 2ZGXH 3KKMA 3DM9B 3TMKA 1OH5A 5TDHA 4FU8A 4EPYA 5HGGA 2P5SA 4AFZA 4AFSA 1UK3A 1F5RA 1W2HA 1MD8A 4CEIB 4A82A 4HAWA 1KI3A 4ZDKA 1NSFA 5L3QA 3KQLA 1QB6A 5DO4H 1UBFA 3TLXA 3SJAA 3ZVDA 1AM4D 3A80A 3LIWA 1IN8A 4M1MA 3K0FA 4CH8B 4WAUA 2OXCA 1ARCA 4QHSA 3B23B 3A84A 2BX4A 2WSSD 3K65B 4NSVA 4NIVA 2STBE 5FOTA 4DJTA 5B6OA 2XWAA 3B8HA 1Q1ZA 1YR7A 5B57C 3T12A 3EGKH 4Q2KA 2IF2A 4F93B 3GFTA 1Y5UT 1ZNWA 1S3SA 3A89A 4XWOA 1FX0B 1Z3IX 1O3BA 5D3QA 1R8QA 1A7JA 1ZYOA 1E2GA 3LC3A 4FVBA 1MRSA 1AB9B 1KKLA 1GKYA 1BO6A 1XXFA 2P0EA 3AVPA 4IDQA 1AS3A 3AF4A 2JH5D 1SVLA 2ZI5A 1GVNB 2J2UA 1DLKB 4AG6A 1ACBE 3U9AH 1BOQA 4DLUA 4C0JA 2D2EA 1BTUA 4IN1A 1VGCC 1W44A 1MKWK 4ACBA 1S83A 4JYUH 1II0A 2YINC 4B2LA 2FSHA 5JEEA 4L16A 4NL4H 1GVZA 3WBJA 4GLYA 2D7CA 1M2OB 3IILA 3LGTA 5KNBA 4BWYA 2VHCA 3ENSB 4HAZA 1YR8A 3K6ZA 4DLRA 4KBGA 3N2EA 1GCDA 4YLQH 1M6NA 2WKRA 1GBFA 3A7TA 4UONA 1CBWC 2YNBA 2N42A 3SV9A 2VYFA 2D26C 4V0MA 3TH2H 4ISHH 1HE8B 1O2MA 2GCNA 1GI7B 3AF2A 1BYIA 1QRAA 2CCGA 4V0OA 2N1BA 1LFDB 3QO6A 1ZUIA 4Q1FA 1XD9A 4DSTA 4MGYR 3TJUA 5EQTA 1C5YB 3BK7A 1DTSA 2HXSA 3MWYW 1A2CH 4LPKA 4HLCA 2CNWA 2FI5E 2PEYA 1XUIA 4LBWA 1HT2E 2IT1A 3Q7PA 1JB1A 4YOIA 4M9SA 2XOKA 3CR7A 2FF7A 1ZM2A 3UWJH 8LPRA 4EQ6A 1O5FH 1EFHA 1XMIA 3RXIA 5A0BA 4NFEA 3I72A 1G6HA 2YJTD 1HLTH 5DPAA 2PCLA 2PLFA 1EB1H 2Z9JA 2GDEH 3RC4A 5BYJA 2QSZA 4X8UH 3QZQA 2KSQA 2H9TH 1C1VH 1OXXK 5BQ5A 1F0TA 1O3HA 2V3OH 4TL7A 3U3KA 2PKAB 1WSSH 1VGCB 3Q3XA 3BB1A 4NZQA 1Z6XA 2W2VA 1XKBC 1ZHMA 1E35B 4UXIA 1NN1A 3QKSA 4YONB 1DARA 4XJXA 1Z06A 2P94A 1SVWA 5KDDA 1WYKA 4E5UA 3M37A 3EE0B 4LK4A 1V2MT 2ZREA 3W5IA 1I4TD 1ZPBA 5GVRA 3K9GA 1VHLA 4V03A 3OSYA 1QRZA 2F9PA 3GLHB 5FOSA 1Z83A 3EIHA 3KQKA 3BRWD 4CH2B 3VHXA 1FW6A 2BVRH 2VWOA 3FFGA 1BUIA 4U30A 4CRBA 4GOXA 2ZJ8A 4V0ME 2D74A 1BMFA 1F2UB 2P59A 1UVPA 3AVVA 4K8YA 5L3RA 1YQTA 2VP0A 4UKDA 2YKGA 1E2FA 2EFCB 1J7KA 4I8JA 2CMYA 1XCPA 4P32A 1W1WA 2WSMA 3RMOH 3KEEA 3AK5A 2HDNB 5FR2A 1S8FA 1RKBA 5HZHA 3GEEA 1KI4A 4HUQA 1N6HA 3CLVA 1YKTA 4G3XA 1VZQH 3P32A 4C0AC 4GDFA 1FNIA 4HB0A 1N5KA 1O2HA 1E2QA 2QG6A 2ORIA 3KQCA 2MMCA 1HURA 1LQDB 2G4UA 3P8OA 3VU9A 3NPSA 5L3VA 1AN1E 3MHWU 3S7HB 2QGZA 1SXJA 2BM2A 5C1UA 1Z08A 1E0FD 1O2JA 1A82A 5GCHF 1XEXB 1THPB 5JJKA 2OFWA 1BB0B 5CM8B 2Q9CA 4MA4A 4X8VH 2XTTB 1KYIA 4M1SA 3ATMA 1NS3A 5BN3A 2IXEA 3ZZ9A 1E1QD 1W36B 1C2KA 3GCHB 3A7VA 4FN5A 3NCLA 2ZCKP 4NYIR 3U7EB 1TBRH 4IEEA 2F9OA 3GLIA 1BMFD 4PPNA 1TF7A 1KK2A 4QGAA 2QRZA 4HAVA 4PO1A 1CIPA 4DLTA 1R0WA 2BOHB 2QNRA 5EXMA 4B47A 2KAIA 4ZO4A 4Q80A 3ZH9B 2PJRA 4US0R 5E2OA 6ESTA 3LNCA 4URUR 1OW3B 4TT3A 3KL4A 1WOFA 1S6FA 3A4LA 3TVJB 1TGCA 3B1XA 2BVXH 2HF9A 1B23P 5IYTA 4HZIA 4KU4A 5JJIA 4NZLA 3RP2A 5FPYA 4B2IA 2WWGA 1Y59T 1QR3E 1QBNA 3M3VA 1YF4A 4QGHA 2ZIAA 2WINI 3B6EA 5C1XA 2BD3A 3M5NA 2JLYA 1U81A 4FU7A 2CMKA 4TPYA 4TLEA 4WMFA 2Q1JA 4J2YB 1G7SA 2C9YA 1P2IA 3VNUA 5IF9A 2TRMA 2HF8A 1JRSA 1XUKA 2YZ2A 1C5TA 3C14C 4LUCA 2Z3EA 3ZV9A 1K1NA 2RHMA 2BDHA 1R10A 1C9TA 3AVYA 1LHDH 2G5NA 1WB9A 2GCHG 1UAAA 2ANYA 1P6XA 1U0LA 3BGWA 2V9PA 4M2LA 4ABGA 1PPFE 1G3BA 1P01A 2QF0A 2BKEA 2QAGA 1XTIA 3PXGA 4YOJA 4TMXA 2ZVQX 5D3MB 1BT7A 4HDQB 1E99A 1VITF 1NVXQ 1GL1A 4ZHLU 3KF2A 1FPMA 2R2AA 4MG3A 1JPNA 1GL9B 1KAOA 3URDA 5GCHG 1HPGA 1QNJA 4MNVA 3FDIA 4KO8A 2WTUA 3K9LA 1BZXE 5DP6A 1F92A 2YWEA 4JZKA 2AWNA 4YLUA 4PSKA 3KQDA 2VH6A 1FTSA 4LDJA 2RA0A 1JR3E 2AWOA 2FGJA 1GPZA 3AP1A 2JLZA 3K0FB 3GY7A 3FE2A 4JJZA 3R0FA 3F3YA 2KBEA 1U2RA 2ZHFH 4BEBA 2CHAB 4FXPA 3ZZBA 5FUXA 1G8PA 2PUXB 2VH0A 4YXWA 2BM1A 1N6IA 4A0FA 4HI0E 1XEFA 5DI9A 4M0LA 4YOGA 3U6BA 1A4RA 3REGA 1ETRH 3EDXB 1IQEA 1MMJN 1OS8A 2VVUA 2GMTB 4GHTA 1ESAA 2ZIQH 1MO5A 4XVRA 3JZAA 1V3XA 3KXKA 3Q3KA 3BTGE 2VJ1A 2ZUCA 4Z1MD 4DSUA 3DD2H 4EFMA 1P2VA 4BPBA 4AB9A 3FFAA 1U8ZA 5DP5A 4X1QU 5FPKA 1GL7A 1U8AA 3ND8A 4Q02A 2GJ8A 2HCBA 2WIAA 2QU8A 3OEHA 4N0DA 1L4YA 2GV7A 1E79D 3L82B 2V8OA 1AE5A 4IDNA 2GKVE 3W8NA 3MJHA 5H68A 2ZRMA 5ABWA 3SZEA 4B1TA 5DP4A 2C04A 3CO5A 3RXGA 3IUYA 1MTSA 3LLUA 4ZI2A 4RCZA 1ETSH 2EQBA 4H1UA 1C5RA 4IEIA 1O39A 4YT6H 1ZNXA 2H1LA 1G6OA 1TB6H 3AW0A 2RMKA 4O9VA 3U3OA 3PLBA 1H9LB 3TUJC 2X8AA 3Q3YA 1U94A 1JBUH 4DHEA 1I4DD 4GAWA 3MWKA 3SNEA 3VGCC 2O8BA 4JMPA 2ERXA 5G3ZA 3ZVEA 1FNNA 3HYRA 2B92A 1PYTD 1P9WA 5FBEA 2G81E 1FLEE 3SU1A 3OZXA 1G2LA 5C20A 3I8SA 5L6NH 1K5GA 1D6RA 5FBIA 4RKOB 2XNIA 2CF8H 3DKPA 3TITA 2FOLA 5CJ2A 2YWHA 3ZVCA 3CNOA 4Y71A 1Q3XA 1O3OA 1Z6GA 2A78A 1JR3D 3MU8A 4BLQA 1U0HC 4MUAA 3ZVLA 5LH8A 2FI3E 1E2NA 3RC5A 4FUEA 3V7TA 2YWGA 4KI0A 1C2GA 2Y5HA 3OAAA 1NVUQ 3HJNA 3OIUA 3MG9A 4K1TA 1TMKA 2BMDA 2LKDA 1W36D 2ANMH 3TJNA 2ZU1A 3H1TA 1CJUC 1LQEA 3C15C 1AKSB 3E90B 1GMDF 5JRJA 5DH9A 2IUUA 4US2R 3W90A 1W13U 5FBLB 5C2JB 1KDRA 3C27B 1J15A 4NIWA 1S81A 3ZVNA 2FPKA 5E2PA 5KOYA 1EFTA 1QL9A 3LONA 3B13B 3MO9A 3TAHA 1EAWA 1UCYH 4IMZA 2ZDKA 4Q47A 1CBWB 3ATWA 2UZIR 1L4DA 4TZ6A 2WPDD 3RRZA 1SQOA 3DMDA 4HFPB 1QA0A 3QVVA 2XTZA 1NKTA 6LPRA 3FKSD 2ODQA 1ZR0A 1CR2A 3HU1A 3LVQE 1P72A 3OY5U 1TOMH 4QHTA 3T15A 4YM9A 4B35A 4HB3A 3U7FB 4GZMA 2AEIH 4AORA 1YJ5A 4IVQA 4B71A 2GBLA 4Q4AB 1W4BA 4RD1A 4P33A 1Y3WA 2WKPA 3Q72A 5EQSA 4XBCA 3EZFA 1QHXA 1SVSA 2DUCA 1GVKB 3ZJYA 1IJFA 3SJCA 2H5CA 3RS7A 1BKDR 1NP6A 2G55A 2PR3A 1G3CA 4WW0A 1BDAA 1EASA 3ASYA 4G5QA 4HAYA 4EJSB 4CHAB 3MU4A 3TGKE 4A0RA 3BTEE 1RRPA 2FDCA 2ZHDA 3A36A 3FHCB 5SGAE 3U3RA 2C96A 3RC6A 4UFFH 1LHCH 1WXQA 3IGFA 3IITA 1KXDA 1VCPA 1GBAA 1S6HA 4OI1A 1TA2A 1Q44A 4PHTA 1THRH 4E7NA 5DE3A 5JRZA 1CF4A 2QRNA 1L1GA 2ZA5A 1RTLA 4NP6A 1XWIA 2BY9X 1TPAE 2Z4SA 5FL7A 4KHZA 4M9ZA 1DS2E 4Y8ZA 1RC8A 1HUTH 4FW9A 4TQ9A 4ON9A 1IQJA 2OUKA 2KBFA 4GZLA 2Z3CA 4OHVA 4V0KA 5JBQA 3ZZ7A 4RJLA 1CLUA 1THSH 1UCYK 1XCGB 1TLDA 4O2LA 4ZXYH 4DOQA 4AKIA 3SI4H 4PFSA 2A5KA 3QDZB 1NBMA 4AG2A 3R8CA 1NMXA 1UTKA 3SU8A 1Q20A 2VHQA 2REBA 2ASEA 3MFJA 4Q7XA 1PLJA 3BF6H 4FUGA 1DADA 4B3FX 2D06A 5AR1A 1O3DA 3UG6A 2GGVB 4C0QC 1V2TT 1HYLA 2R6FA 2JEOA 4YMUA 4NHOA 1V2WT 1HYQA 1AVXA 3HPTB 1XF9A 4JLPA 4BLOA 1KDQA 3SOPA 3NXPA 3I1FA 3PTNA 3ODDA 4THNH 3THWB 3GYMA 1K21H 1TX6A 2H6MA 1DAGA 5KHOC 3THXB 4M4SA 2LNCA 1UEIA 1ZMXA 1YE8A 3A8TA 1M7GA 3ECCA 4MQAA 4M1YA 5CJPA 1P57B 2R0LA 2XSZA 3MNCA 1P3EA 2F4LA 2R9PA 1J9CH 3GY6A 3P4YA 4AG1A 3U44A 2SGAA 1QVRA 2XGJA 1W5TA 3I29A 1V2ST 4II7A 1CR1A 1FL9A 5E0HA 4BLRA 1KDQB 2R6CA 3WP1B 1GBTA 2W6JD 3OFND 5CHAC 1P4SA 4LBVA 3KJEA 1A1RA 2GT7A 4KFUA 2UWPA 4AFQA 2ZAOA 1LVBA 4WIAA 3I32A 4AFUA 3S1AA 1C5OH 1OV4A 2HLDD 3MLEA 4XVQA 1C2IA 3SZNA 1XP8A 2O5VA 4U00A 4I31A 5TY0A 1FP6A 1AS2A 4DLYA 1SXJE 1SB1H 2ZE5A 2V7QA 5F8TA 1O2GH 3V0XA 1QBOA 3DA9B 1SGFA 2XEXA 4ITRC 3L0SA 4LYFA 4CEHB 2YOGA 6CHAC 1VJ9U 1XKAC 1G20E 2Q6DA 4NCNA 4O25A 1GDNA 1ORFA 3GJ8A 1Q1QA 1O3FA 2JATA 4QJ4A 2XOKD 4L8GA 3UATA 3BG8A 4MRPA 2QQEA 3LH3A 3PUVA 4IGDA 1UKEA 1VG1A 5LPRA 2GZAA 4A1FA 2ASUB 3EASA 4JZEH 1LVMA 2BD7A 2GXAA 1BBRH 1US8A 2WJGA 3STJA 2RCNA 1EWQA 2NZ8A 3V13A 1XMJA 1XXHA 3LRPA 2NTYC 4TQUS 1T0JB 1OWJA 2WJJA 2RGNC 4E09A 1GHAG 1QB9A 3E1SA 3SJZA 4A15A 1OH8A 1W47A 1UHBA 1O37A 1T5LA 1DFPA 1KXFA 4YMTA 3PUZA 3P1JA 1Y63A 2ZFRH 3BORA 2ZU5A 4MVNA 2HLDA 2XYAA 1OLOA 2ZRJA 3QX5H 3ZD6A 2A9KA 1V5WA 4GOKA 4IKEA 3WNBA 4RZXA 2QYIA 3PV5A 4FUFA 4AYYB 3A88A 1GJDB 3MJRA 3AKYA 4KITB 2BDBA 4TMZA 3A4MA 3KQEA 4I1OA 1UKYA 5TJXA 3QN7A 5IK2D 3VB5A 1JOUB 3EARA 4YMSA 1A5HA 3ZZ6A 2QMEA 3LWNA 2BMEA 4OQXA 1L0ZA 4KYIB 4P4TA 3T5DA 1IN6A 3ND9A 2XBYA 3QXJA 5DJ7A 4RN6A 1WA5A 1OIXA 1XPUA 1E69A 5DN6A 1TGTA 2ZANA 3T28A 1VIYA 1O3JA 1NRRH 9LPRA 1OWHA 4LX0A 2FODA 4NONA 1VPLA 3R9XA 2FOBA 2XNDD 1PPGE 1KO5A 1AMHA 5BN4A 3T34A 2RGGA 4Q66C 4IFBA 1VCWA 2IS2A 2AYWA 4ZHAA 1Z1IA 3IHLA 3VKWA 1NVVQ 1AQ7A 1ZMJA 1KMQA 4MYCA 3ZLJA 3CRW1 1XRJA 3QY0A 1NFYA 1UKZA 1P2TA 3QQ5A 4DCSA 1LKBA 4BTUB 2VBCA 2ZGBH 4WJG2 1J2JA 2GK6A 3M35A 1IQFA 2E9SA 2P8OC 1BBRE 1I2MA 4B44A 3MRSA 1C5QA 1GHZA 3N2IA 2Q9AA 2P6UA 4TMVA 4ABIA 2EFDB 1C1YA 4KVAA 3SDZA 2IWRA 3RUOA 3SGBE 2VP9A 1C5VA 4WXIA 2ZEBA 5BW8A 3SU5A 4M9FA 3BTHE 2BDAA 3B85A 1ZPZA 4AG5A 1ZLRA 1RRCA 1H8HA 2QPAA 3SU0A 2Z6BD 4WH6A 5IK2A 1J16A 1T3SA 2XTNA 4I32A 1XDBA 4LJ4A 4F4OC 2BIFA 1OXTA 4S2EA 1ZNYA 4YT7H 4R71A 1HAXB 4BAMB 2FI4E 1SLWB 1NRNH 2B7BA 1D9IA 3HPRA 3L2OB 1SQTA 1MQ5A 4BE7B 3CX8A 5DYIA 4X6MA 5BRRE 2W6ID 3TK5A 2ODBA 5H70A 4DDWA 1C2MA 4JLJA 1F0RA 1E98A 1TGBA 1M8PA 1GSIA 3P17H 1O2YA 1BHXB 1VYTA 4D76A 2Q6GA 1GJ5H 1IXZA 3RXCA 3A87A 2RCEA 3PYHA 1MZAA 5LBIA 2ZYWX 5T6FA 3UKDA 1KSFX 2O8EB 1OKKD 1L4ZA 2P6NA 3NH9A 1GBIA 1O3KA 1ANKA 1AZSC 1TABE 2R3YA 2WPMS 1EXFA 3E5HA 1KI9A 4PSAA 1P8VC 1BHXF 1Y5BT 3F1SB 1CKEA 1HAVB 1OPHB 5TCCA 4B6FA 2B9LA 3D3QA 2AX4A 3RC3A 2G52A 4LHZA 1HAYB 3FYHA 1EJNA 3F5FA 2Z9KA 3ADDA 4DZZA 1PYTC 2VWLA 3DOFA 2A2XH 1Q12A 5F8ZA 3V9PA 1W0KD 3NZIA 2FMXA 2V1XA 2CE2X 1XVOA 1ZW6A 2FSFA 1Q21A 4LJ7A 2KAIB 3ZGXA 5FUWA 1YKSA 3CF2A 2Y8EA 3ZQ6A 4CRGA 3AVOA 2ZUBA 3B1YA 2AGGX 2SGPE 4OL0A 5H4IB 2QV1A 1FUJA 1CSOE 4OI4A 1FJSA 5HZKA 1AI8H 4M1KA 1DSTA 4XD7D 2FX4A 2IXFA 3DT0H 1QJ1B 1EAXA 1OYWA 4QGGA 3E0NB 5L3SB 1O2UA 2RGDA 3U3MA 2P3UB 2QN5T 4U7DA 3WRXC 4Q9KA 3TH5A 3GP8A 3BAFA 3RWOA 3A6PC 2DB3A 1DY8A 3H0KA 2THFB 5KNDA 1RYFA 3U1IB 3C7KA 4D81A
chains in the Genus database with same CATH superfamily
4Q37A 3D2LA 2DKFA 3R8XA 4ES6A 3D1LA 4OXQA 1NY6A 1AZLA 4GI2A 4PGAA 2IEGA 2O0KA 3A1DA 3T7DA 4BAUA 5AVQA 3LK6A 1P7VA 2KFWA 2HIAA 5KUTA 4Y79A 4I1UA 3WLOA 4DWVA 5HJ2A 2F17A 3QI2A 3HQ4O 5KTTA 2F91A 5CHBA 3LUPA 1U0TA 3DCNA 1GITA 1Y3XA 4GPEA 1T91A 1XN4A 2X3YA 4IZHA 2IP1A 3FUUA 4V0SA 3SF8B 3RT1A 1AWHB 1B73A 5J58A 1W581 4KFRA 1GCTC 4FZ5A 2GPAA 5EIAA 3C3BA 4N01A 5FP0A 4EA8A 6PFKA 3E61A 2EYQA 2ZJYA 5C3NA 3BT7A 4KTCA 4IFTA 3HVIA 3DG9A 3N2LA 4R9UC 2RJOA 4Y7AA 4HD8A 5B3LA 3URCA 3DFLA 1F4LA 3CLRD 1H8DH 5ALWA 5PGMA 2BRUC 3X1ZA 1B0ZA 2QXYA 3IIKA 2YWFA 5EE5B 4FXGH 1B2RA 1BVHA 1FBNA 1Q1EA 5LB4A 3BG4B 4ZC8A 4KK3A 2RB5A 3S2ZA 4FGLA 4R8RA 1Q0SA 2DUNA 4X93A 4C6TB 4C0KA 1QHGA 3D6JA 4LXIA 2WD7A 2OC1A 5JQGA 3TTUA 1Q0TA 2I3DA 5DG6A 1UJCA 3KKPA 4X8HA 5LUAA 2XZLA 4XYMA 1O77A 4C4SA 3ZZNA 5F23A 3J81k 1TEHA 1N1LA 4NCYA 2MSKA 1IUOA 3W8FA 2A7JA 1NFUA 2GETA 4UZFA 5KNCH 2GZ8A 4PY2A 3T5TA 1X7XA 3CW8X 1WCIB 4DXDA 1K88A 1PS0A 2DUMA 3IOCA 3OT1B 4Z9XA 3NHRA 3WIEA 5JC8A 3SC3A 2DFDA 3K8YA 1ZN8A 4TMYA 1NSYA 2GFHA 4BNMA 1C3VA 4N8DA 2WJ6A 1XRRA 4M0PA 4PANA 3S9AA 4DIBA 2HK9A 4FHCA 4LXTA 5AF9H 4BVAA 2VJAA 4C0SA 3EPJA 4DR7B 2QUIA 1VOTA 5HIKA 2OLEA 1YCPK 4X65B 1BMDA 1ORRA 2FS8A 1H5NA 1NG9A 3FPGA 3DXXA 2BF7A 4BNKA 3NX4A 3TL3A 2OD7A 4UFOA 5DCWA 3D1VA 4AZTA 1U3UA 5C4IA 3NGXA 2PWXA 2QP3A 5JNSA 1COWD 2I6SA 1MEOA 1LRLA 1D6JA 3AV0B 1T8MA 2VDWB 4OOEA 4TV8F 5F5NA 2JFGA 3BWEA 4JI6B 2IE8A 3PLNA 1IY0A 1ZY2A 3E84A 4LN1A 2BJHA 5GJ4B 4GUAA 4AUNA 1URPA 2DE0X 2HWUA 3PJDA 4NQRA 4ZQCB 5F7ZA 4EA6A 3DFJA 4JL6A 4X91A 4ZHQB 4CDNA 2QR2A 3IUNA 1L8LA 5BNFA 4H7HA 3OUZA 1CLEA 2GVFA 4I5EA 1SBTA 1ZJDA 2VRBA 1KFBB 4WK0B 1K8ZB 1TUBA 2O2GA 2P3SA 4J7XA 3IAHA 4MQEB 4P3KA 1UOQA 2BGMA 4HDRA 1R5OA 1N75A 5LZ7A 5B3KA 3O8DA 1GG6C 4G5HA 4MV3A 2J08A 1O2SA 1VIMA 3KL2A 1UT6A 4DRZA 2WEKA 1KU6A 5EIYA 2JJ1A 3G2NA 5BVGB 4YQZA 3U13A 3FNFA 4ZT3A 3BE4A 3C8UA 4Q1EA 4YMVA 4D3XA 2GF0A 1YK0A 1IUNA 3PK0A 4MUEA 2IIQA 1N33B 2HRZA 2WDPA 4IIXA 3W7AA 2EGGA 2X13A 4F46A 3MVEA 5GPBA 4XD2A 3UH0A 1BQYA 1PGOA 4UEHH 4PIMA 1VECA 1NBAA 4A1VA 1SFRA 4LRYA 3MU0A 1RXUA 3DLBA 2FG5A 3BE8A 2ATXA 2D2FA 1O38A 2D0DA 1A50B 2Q4EA 3OE4A 3J81A 1K9VF 1W9MA 3IKMB 4FT2A 5FPQA 1FUKA 1SVMA 1L7AA 1GR1A 2HJHA 1ITZA 1JDZA 1MPTA 1NXWA