3O8BA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
total genus 219
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8bA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8bA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA03
2XOKA 3U44A 2V6NA 1G3QA 1MT0A 3A81A 3LKWA 2VIPA 1E1RD 4D0NA 5GXPA 1DAIA 2X1VA 5FPTA 1AS2A 3N7OA 1DARA 3SZEA 2PEYA 2RGGA 4HUQA 1G9IE 4ZO4A 1KGDA 1WOFA 6GCHG 1E4VA 2J0QA 1FLEE 1LPKB 5F9FA 4TYWA 4OS2A 1MMJN 2P8OB 4YC7A 1LNZA 2KJQA 3TJZA 4J1YA 2DYKA 3OYPA 3LVRE 2BMEA 3QPUA 2OAP1 1C2MA 3BFKA 2FMJA 1QL8A 3MH6A 1EP6A 1Z07A 4B3BA 3R8FA 4X2WA 3PTBA 2NWNA 2H8KA 1QL9A 3PMAB 4FW9A 3BXZA 1O2WA 5A5GA 3LBIA 4PSKA 2WAYA 2QG6A 2OBMA 3ND8A 2QGZA 2OFOA 4O3TA 1TUIA 4X2XA 4OQMA 1PV4A 1EFRD 4BANB 1R7RA 4NE2A 4LBVA 4ASUA 3K09A 1RE0A 3HR7A 1JQJC 1V6DA 1II9A 2B7BA 3S7HB 1CBUA 3ZVBA 1IQFA 1YP9A 1Q3TA 2O0KA 2GVFA 2QXJA 3SHAH 2ZI5A 3OE7A 2ZTYA 2GZDA 4FMBB 5B64A 4VGCB 2HT1A 4BFVA 3PUYA 4Y8ZA 1O3LA 4BAKB 1OW3B 3C1KA 3MRSA 1XEXB 4TT3D 1OP0A 1KXEA 5GJBA 4B2AA 3U1IB 2B8OH 3LGWA 3QN7A 4Y8XA 1GRQA 3LH1A 1WQSA 1P60A 1UVOA 4CH8B 1FL9A 4TLAA 1AFQC 1NSFA 2ZDVH 1RRGA 4KU4A 1OF1A 3BJIC 4CEJA 4Z8YA 4LJ5A 3QEJA 2I1QA 1QHIA 4Q9LA 1AGJA 2WHXA 1JPJA 2A4RA 3SGBE 2WJJA 3OEED 4I1OA 3QVUA 2GX4A 1AVXA 2PGQB 3AVTA 2P6UA 1HAZB 3JZ1B 1MO4A 3TU7H 2ZU6A 1FY3A 2BMDA 2UWPA 2ZECA 4CREA 1GI2A 1KIGH 1HAPH 5B6LA 3PEYA 4BE7B 1XUFA 5JJLA 2R65A 4EPTA 2VP5A 1H8HD 1O3YA 2A3RA 1AE5A 2N46A 1DBSA 1BTXA 1TWXB 2PKSC 1OFIA 4F4OC 4US2R 2IPHA 3VNUA 4NCNA 4NHOA 4ITRC 2XX3A 5BW8A 2WJIA 2YWGA 2WSMA 5FTNA 1UJ1A 3RU4E 2WYGA 2VWLA 3I4LA 3ATLA 1ZJDA 3E3TA 1VG1A 2CVHA 3KXLA 4L4UA 2BQWB 2ZI4A 1DAKA 4BRUA 2P6NA 4S35A 2OBNA 1HIAA 2W7UA 1G3BA 1D2MA 1C5XB 2J38A 2GEDA 4AWXA 4QBIA 3M3TA 3C27B 4I1SA 1TA6A 1E79A 2JCSA 4PPGA 2AFQB 3MJHA 3PCRB 1Q31A 1KOFA 1NZQH 1E2NA 2WM9B 4I7YH 5HMAA 4LRWA 1C4Y2 5C1UA 2NPFA 1XCGB 2NZJA 3C14C 4R9UC 2BVXH 3OIWA 2JJ2A 2ZSFA 5DK1A 1GNRA 2IA5A 5L3SB 3S9BA 4W5JA 1V2UT 3E0PB 1AUTC 4EJSB 1NLFA 3BTGE 2SFAA 1ZUIA 1QB6A 3A7TA 2ALPA 1FX0B 3G5UA 1A82A 1SQTA 1VECA 4WF8A 3ELAH 1EOJA 1FIZA 3RU4D 1WBDA 2G3YA 5DP3A 2Z9IA 2GCPA 4DLUA 2BY9X 3HGNA 3NVAA 1EQ9A 2G0NA 1EB2A 2ODNA 2HNTF 2QORA 5GCHF 2J41A 3QIAA 3LDAA 4OBEA 3MTYA 1SKYE 3FP7E 3RXSA 1CBWC 2NO9A 1T8NA 1XTQA 2ZRFA 2GAAA 3MNBA 2AX4A 1GGDC 1O87A 4YT7H 1TNHA 1XD8A 1G5PA 3LWNA 3KGPA 5CE1A 3SJBA 1OYYA 1AVWA 1RTFB 3FFGA 1PJPA 4V03A 2IX3A 2HF8A 5G53C 4OYHA 2FOHA 2JLWA 1LHEH 1DVAH 1XEWY 2EWWA 4PC1A 1LV7A 3KQKA 1GBTA 4Z1MA 5HCIA 1C1RA 3MHWU 3GD7A 2R9VA 5CMXH 1QGFA 1VCQA 3M36A 4HB4A 1D9ZA 3DMDA 2FOCA 2CCGA 3NPSA 1HQYE 2A5DA 2REXB 3ZZUA 1Z8FA 5FHTA 3WMFA 1G291 2Y5HA 4C2UA 3UATA 4RCZA 3ODFA 1X86B 5F2EA 1A61H 2ZUDA 2MSDB 1BQYA 3R3GB 1ARBA 3PLKA 3ND9A 1DANH 1AKSB 1SKYB 4POAA 2ZU4A 3QGNB 2HLDA 3HPTB 2ZI3A 3PEWA 2IN2A 2HRVA 2JH0D 3RS4A 1EUFA 1FAKH 2YNBA 1MKXK 3BTTE 1S9HA 4IVQA 5FUXA 1BJVA 1O5BB 4B71A 3U5ZB 4X8OA 1C1TA 1R5OA 3FANA 1G3CA 1DDJA 4Q03A 2FEMA 2ASEA 4M1SA 5CJPA 1TGCA 2AKAB 3ZD7A 1N6OA 5FUYA 2G0TA 1HYQA 2JLZA 5KDDA 4ON9A 3MNSA 5G3YA 2IYRA 2QAJA 1X6VA 2IJD1 4AN7A 3RRNA 4CIDA 1YZUA 2EU8A 3IITA 3GY8A 4WVPE 1P12E 3C16C 2BC9A 2F9MA 1O2KA 1RFNA 1TQ4A 5AUOB 1TQ2A 2ZZUH 3GLFA 2GDEH 2PJRA 1QVRA 2QMHA 1G9XA 1W46A 3M5MA 1P8VC 1XNJA 3QTOH 1DFPA 1W0ZU 1S96A 2G55A 4HB2A 3U6BA 1LF5A 1T8LA 2FYQA 2JLYA 3FKSD 5CM9C 2YHSA 5I25A 5LPRA 4I32A 2OC7A 2OFWA 4N0EA 1GHVH 1IAUA 1G19A 3V3MA 3UMRA 1E38B 3BEUA 2WIBA 1DTSA 3RLWH 1F0RA 3AVOA 1CKEA 1JXOA 3RC3A 4BAHB 1IY1A 4OHVA 5E0GA 1XUHA 4B3GA 1KYNA 2EVWX 4BGDA 1MTVA 5IF9A 1YR6A 1SQAA 2QTFA 2V3HH 3SUFA 5DGJA 4G3XA 1AIPA 1TYNA 1IOEA 3R20A 4BECA 4D4KA 1NSTA 4C0SA 2CV3A 3HATH 1OHHA 3U1JB 1YPGH 1FV9A 3ZVEA 3W8NA 1GILA 4GSOA 3AB3A 4NONA 1KSHA 1O3HA 1NVWQ 1HY3A 1NN1A 4TLCA 2XC0A 4CYMA 1AY6H 4Y7AA 4YO9A 3BSQA 1FTNA 2QE7A 3QVVA 4UXJA 3OIYA 5KNCA 1SI5H 1V2QT 2ZM5A 4KP0A 4D6PA 2IXFA 5JBQA 1ETRH 4AFUA 1JECA 3BWDD 3SI7A 2O8LA 5EQTA 5AJXA 1GNQA 1T32A 2FEOA 3AUYA 3BEFB 4XWKA 3FZDA 3PUVA 1VG8A 1LVYA 5DPAA 2OESA 2WAXA 1G3UA 1GSIA 1Z29A 3K0AA 2WVJA 1WCZA 1CA0C 4P4TA 4Y0AA 1W4RA 1WMSA 3T1OA 2BMGB 1F6BA 3SJAA 4LXBH 4M9FA 2QENA 1DICA 2ZS9A 3SW2B 3A87A 1OP2A 4X8LA 2FF7A 4F93B 4DY7B 1DOAA 1Z0KA 3F9EA 3UIEA 2R6FA 1OPHB 2JEOA 4JLVA 7ESTE 4G5SA 1F3OA 4TMWA 4E07A 3RP2A 2HVXA 1FQ3A 3RXPA 2XTTB 3K0CC 2XWBI 5CLQA 2ZE5A 3WMEA 3A7WA 4O03A 2ZI6A 2IJOB 2FZZA 4A8JC 4LWZA 1QHHB 1NS3A 3A8BA 3GLIA 2MSEB 4XVRA 4BXWA 1N6XA 2IS4A 4XSKU 1KXFA 1IN5A 3NUMA 2BIFA 4KJZA 1KJYA 1GP2A 1ZOMA 4EIWA 1E2IA 2FLBH 1ZHRA 3KUCA 5C4GB 2ZPSA 2HXSA 1X8JA 3CS0A 2Y80A 1E2JA 4XH9B 1CR2A 3RABA 1SGCA 3P4YA 1SVKA 1NKTA 4RD4A 2BLOA 2XZPA 3HPRA 1E34B 2FX3A 1BTYA 1MR3F 1GL9B 4D81A 4BFZA 3RXOA 1ZNXA 1NF3A 3VEQB 3RNLA 3EWSA 5HTKA 3RS0A 1S81A 2CHAB 1CR0A 2UVQA 3B1XA 1EFCA 5FX6A 2A4OA 4JLDA 4MA4A 4IKEA 5J4YA 3K8YA 3RMMH 2DE8A 3T62A 3X2SA 1A0LA 3GCTG 3EIEA 2UUKB 1Z6EA 1UPTA 3PFIA 1EK0A 5DGXA 1EFHA 3GQBA 4P33A 3P6ZB 1P57B 4NYIR 2EI8A 1Q21A 2J87A 2AH4X 3VB7A 2HDNB 5C20A 3AF1A 3GYMA 4IEEA 2NZ8A 1KK3A 1XTKA 1HURA 2KBEA 1YE8A 4GAWA 3EPJA 4DW2U 4F91B 3VX4A 1EAUA 4DJTA 2A5KA 1FFHA 1O3NA 4A6XA 2J94A 2CLSA 2EA3A 4WH8A 3MO6A 1QRWA 2VHTA 4UE7H 4ZMAH 1R4AA 1XKBC 4INLA 3W5JA 5FL7A 4K8BA 3QXCA 3SJOA 2QF3A 3CH4B 1GNPA 1TMTH 2Q6TA 3FGNA 3QBVA 3NEYA 2GT8A 2GK7A 3KKPA 1ZD8A 3UR6A 3KQDA 2F4LA 4RZ3A 1A0JA 1L1NA 2XBYA 4XVUA 1XX6A 5F98A 1SSXA 3UNQA 4A36A 1W1WA 3UOPA 4A1TA 1UBGA 3SNBA 3CX8A 3DDCA 3WXMA 4A82A 3KQNA 1P3EA 1THPB 3D62A 1UCYH 1E2QA 1UDXA 4PPQA 1P9NA 3LV8A 1L4YA 4GOKA 1GMDF 1V5WA 4DIIH 4GMDA 5JEDA 5JMTA 3BIVH 4NU0A 3ZZDA 3T28A 3UNSA 1IOZA 4ZDJA 3HJNA 1N6YA 3RXKA 1EXMA 1IQIA 1SGNE 1EWRA 3OAAA 5DG6A 3QKUA 1P11E 3KKMA 1A7JA 1DADA 5KDLA 2PLXA 1GCTB 4Q4HB 3ENSB 3ECCA 4JZEH 2VHCA 4C2TA 1IXSB 2D1JA 3O8BA 2Z9JA 2PW8H 1ZCBA 3DFLA 3EAQA 4I1VA 4QL3A 3ZVLA 4Y0YE 1OLOA 4FCWA 4JZDH 3B2EA 2W3KA 2WPLS 3P92A 4DUGA 1AKSA 1BIOA 3LH5A 1Z47A 2FPLA 3ZVGA 2FX6A 2FMXA 1JXMA 1G2MA 3RANA 4RFSB 3V12A 1ZTJA 1TGSZ 3SJ8A 3UG6A 4BFTA 3LGVA 1UTOA 1YR8A 2NU0E 5EE5B 4JS0A 3QJYA 1Z8GA 1VR1H 1QB9A 2P8OC 3CW2A 2XYAA 1NNEA 1Z0AA 4OS7A 1RYFA 2ZRMA 1VYUA 2YOHA 2O8EB 2ZU1A 4DCTA 1C2IA 4HLUC 2WJHA 1FMLA 1ZMXA 3PV2A 4B32A 2BDCA 1XVOA 4PO9A 1F0SA 3CRMA 2Q9BA 1BRUP 1YLDA 5CITA 2BD4A 4NIWA 4ZXXH 1SC8U 3BGWA 3GDVA 1MQ6A 2OO7A 1FY4A 1G6OA 3IBGA 2VQSA 5GCHG 4AYWA 1W7GH 2PCJA 4ABYA 3O8CA 1A2CH 3RS7A 1ELAA 4E22A 1NIJA 2F9LA 4X6OA 3LBHA 1A3BH 1ELVA 1A7SA 2UKDA 2VLIA 2I6QA 1F2UA 2CK3A 3QG1A 1ZSLA 2V55B 2R8RA 2Y7XA 1PUJA 1HT1E 5CYOA 3OFND 3VGCB 5SZHB 1N8OB 3RRMA 2IL1A 4MKFA 3AQ4A 3RS2A 5KO2A 4MYUA 5SZIA 3C7KA 3JZ2B 1YU9A 1V2ST 4XE4A 2P3UB 3I5XA 4VGCC 3RM0H 4QGAA 1P9UA 1RTLA 2BVRH 4WY3A 3CNLA 5E95A 2ZS7A 1O2LA 4RY2A 4K3JA 2Z0MA 1TLDA 4MNYA 3CZQA 1FNIA 4JJKA 2RGBA 1GBFA 3LA6A 2GZAA 2F9BH 1B7XB 1GBMA 1C2EA 2VTKA 1N2CE 2Q9AA 5HE9A 3ZVRA 1OIXA 1R0XA 4QHTA 2CGAA 1UK2A 4PX9A 1XVMA 5AHGH 2XNIA 4NFEA 3SS8A 3OF5A 1C1NA 3GY4A 3SUDA 1DWBH 3F9HA 3QSYA 2G4UA 4ZI2A 4IVRA 3F6UH 4K5ZA 4FVDA 1ZM7A 2AFIE 3NWJA 1C9TA 1Z2AA 4JMYA 2O8TA 3NHAA 4DXAA 1DSTA 1P9RA 1VITH 1O30A 1O5AB 1OE0A 3RXCA 4KSCA 1QJ1B 3VR5A 1W12U 2ODQA 2ZRIA 1GHBF 2W7SA 1AHTH 3TMKA 3QG5A 1KYIA 4DLWA 4F4CA 4TYQA 1UHBB 3A36A 2IUUA 2GCHF 1OXSC 1MTWA 2ODYB 2RDLA 1F5NA 3M7QA 1FPMA 1NN3A 4IOJA 1V2OT 1EATA 2QP9X 2QT0A 3K9HA 6Q21A 5HKKD 2BY8X 4B6EA 4KBFA 1Z06A 3BN9A 1HAOH 1VMAA 4YMTA 1KY3A 1WCV1 1UTLM 1JRTA 3EZ6A 1JAIA 2Q3FA 3B7GA 1UMAH 3PUZA 4PSVA 2R9PA 2ZGHA 3IQXA 4F4IA 3LQQA 1P2TA 5DI3A 1K21H 1KI7A 1VIAA 5FTLA 5K8TA 5EPYA 2Q21A 1KI2A 1RPZA 4KFRA 1U81A 4PAOA 4FUGA 5BN3A 2VYFA 2IYUA 2ANCA 3SUEA 2V7QD 2BLVA 2ZTSA 3P1JA 1SVIA 2BM0A 1QJ7B 2B7CA 2IHBA 3U2QA 3RLYH 3NBXX 1ZIOA 3TRFA 2ZWLH 2FG5A 1OSSA 5EZ6B 4YESB 4UKDA 4RZ2A 4ARZB 1RS0A 4EPXA 4EJSC 5B2ZA 3MAAC 2WWIA 4JKYA 4NZYA 1W5SA 4ISLA 3B8HA 2GETA 3LNCA 3S0NA 1BBRK 2BY7X 2DPXA 3SUGA 3EG5A 1AA9A 1TX8A 1Z63A 4Q1FA 4YQFA 3F0TA 2C8YB 2ZGCA 1XUJA 2WKRA 1W11U 1K1OA 2AXPA 2IOTA 2PUXB 2ODWA 1TTTA 4ABEA 3ZGXA 3UK6A 2UZIR 1E2FA 1EZXC 2ZO3H 1KLTA 4A1FA 1YVDA 1OV4A 4URVR 3LT3A 1RGQA 1MTNB 3FTQA 4NIVA 5DYIA 3MFJA 1PPFE 2R44A 3SNDA 1E2LA 4AY2A 3LGTA 2VP0A 2ZEBA 3A80A 3UPUA 1LKBA 3FHTA 1GBCA 3CNOA 4K8YA 1W5TA 1BMNH 1P03A 1OH8A 2QXGA 2J9RA 2ZTZA 2MSCB 3I8SA 1ESNA 1AZ8A 4MYHA 5JWOA 3M61U 1TNDA 5JJKA 1ESTA 1CS4C 3QKRA 3L8ZA 2ATXA 2G1KA 5AK0A 4NPHA 1ELEE 1FONA 3VKGA 1XTSA 1ID5H 5FH9A 2XXAB 4CEIB 3VB6A 1ABIH 5F03A 4NYMQ 3GFOA 2Q6GA 1KSNA 2GCOA 1GI7B 3NHBA 2BBSA 2FTLE 2TIOA 4DJZB 2ANBA 5BYJA 3ZIAD 4K69A 2WTUA 4LBWA 1MH0A 3A37A 1H8DH 1XF9A 3CR7A 2A32A 4BUJA 8LPRA 2FI5E 4FU8A 1OP8A 4TL9A 3I3SR 1BIFA 1F7ZA 2AMPA 2D2DA 1D9IA 1KO7A 5FL3A 2OE2A 3BTHE 2UWOA 4AZ2B 1IM2A 3T1QA 3QGJA 3OIUA 1OKKA 4OQXA 5EQQA 2ANMH 3BE4A 4IMZA 4DG4A 2WINI 2WV9A 3ZVFA 1C1MA 2IYSA 2J45A 3KQCA 1UKVY 3H84A 4WXIA 2G81E 1K28D 1GCDA 2ZEJA 3FHOA 3PV0A 4H1VA 3SJIA 2OFXA 1Z0FA 4FXPA 3U60B 3VNVA 5AWFC 2BOHB 1TBRH 3FMIA 1OKXA 1KMHB 4M0LA 2PTNA 3HK6B 2C77A 4PZZA 4ZDIA 2VIIA 4O9VA 5ESBA 2J5XA 3AVWA 1O3PB 4ZV4A 4GDFA 2WZQA 5EQRA 3E1XB 2RCEA 1QQ4A 3SNAA 4CW7A 2GJAA 5JHHB 2H5DA 1GBHA 1O2YA 1R8QA 1P2VA 3IEVA 4LJ4A 5TJXA 3M6AA 3IIJA 2FFQA 4DC9A 5HPYB 1K5DA 4A6PA 5F8ZA 3VU9B 3SOSA 2Z9KA 2Q0HA 4P31A 2CJWA 2VF8A 1JIRA 3LGIA 1THRH 2VRWA 4US1R 3CRRA 2R2WU 2BYAX 3AM1A 1L7VC 1IN4A 3AKEA 2GZ9A 1E69A 3U6KA 3G01A 1DAHA 3GY7A 2LKDA 2EC9H 3B5JA 1MO6A 4OJQA 4MRPA 1G64A 1XXHA 2O8UA 1SFQB 5GPIB 1XRJA 5DNYB 5ANRB 4CRDA 1W0YH 2D7CA 2ZGJA 2OC1A 1IBRA 2ANWA 3ZVDA 2WWYA 2XCFA 2Y8EA 3U7GA 2K5UA 1Y59T 2IF2A 4BLOA 2ZGBH 2G6BA 4NIXA 3KJIA 3WP1B 4A1VA 2YJTD 3UMSA 3C8UA 2RHDA 4RD0A 3TBKA 3CB4A 2RCNA 1K1MA 5C1YA 1BRAA 3ATMA 2KI5A 3WYFA 1D9XA 4M22A 2CN0H 2BJVA 1JPNA 3QPWA 1Z8IB 1V43A 1BOQA 3B1VA 1C5TA 1GG6B 3NBYC 2P6RA 1BHXB 4JT2A 4JIMA 1Z6GA 1G16A 3V4FA 1G8YA 5JI2E 3IIKA 1O2JA 3MO9A 2G4TA 1FOEB 2GZHA 3LLMA 3GCHB 1RW4A 1C5NH 3NXPA 3U8RH 3ATWA 4XBCA 3ZVCA 4D0GA 2ECKA 5C1XA 1VZQH 3NWUA 5L2YH 2OCAA 3X1XA 3KTAB 1W4CA 1LY1A 4HLDA 4GSYA 3AP3A 1KXDA 1GZSA 3EXAA 3MWYW 2AR7A 2ERYA 1ZYOA 3THWA 2AIQA 2R2AA 4JLJA 4BTTB 3WY9A 4C0KA 2OEPA 1GBDA 4L9WA 3F1SB 2EEKA 2CE2X 2O5VA 2ZFFH 4CRWB 1XCMA 3AAUA 1C1PA 1CGIE 3H4MA 1GI6A 1S2MA 4YMUA 5H68A 3RXFA 2ZPTX 3UWIA 4P0TA 2YWEA 8GCHF 4GT1A 5DHAA 5FBIA 4DT7B 4C7OB 2OBOA 1JMOH 621PA 4DSUA 4MRVA 1WUNH 1C5SA 1DOJA 4FU7A 1OWDA 5FBQB 4PFSA 5K0HA 4CDGA 4TT3A 1V2VT 1S6HA 5LH8A 1MRSA 2FGJA 2GK6A 5LDDC 1FUKA 1TPPA 1VIYA 2Q3MA 1TL7C 2D74A 2WPKS 1JI0A 2FV8A 1K6MA 2QRNA 3FFBA 4V02A 5L3QA 2ZJ2A 5JZVA 1T4UH 2GF0A 4FD2A 1LMWB 2AK2A 4J2YB 4LYAA 1C2GA 4HLQB 3GY3A 1F92A 4WMFA 1UTPA 4O2LA 1Q22A 3ZVAA 4TWWA 1SXJE 1C2HA 3C15C 3IKJA 5P21A 3RS5A 4ZPXA 3BERA 4M9QA 3UIRA 4HB3A 2O8BA 2WPDA 4UNQA 3TPIZ 5FCRA 3SGQE 3DOEA 3EA7A 3SZNA 1A5TA 2AK3A 5JECA 4GNKA 3U3KA 2CHVA 2J7KA 4PO8A 3WNCA 3X1ZA 1COWD 4D9QA 1NC6A 3QQ5A 2DHRA 4KVAA 4YZUA 3RXTA 2OUKA 1QZXA 3T61A 2F1HA 3B85A 2PR3A 3SI3H 3NK8A 5J4QA 4LOYH 2FWWA 4FUCA 1YPEH 5F8XA 1ZMJA 5T6DA 4RD3A 5FI0B 1VJAU 3RUOA 5A0BA 1O2OA 5FBRB 1SOZA 2XBVA 3B78A 2RA0A 4DEXA 2IUSA 1SXJB 4UFEH 4Q2KA 121PA 4CR9A 2GJSA 4MRNA 2QROA 3WRXC 5FXLA 3EIHA 1GMHF 3MD0A 4D8NA 1CJVC 1ELGA 4AGJA 1RRCA 1U0LA 3QF4B 1O0DH 1M6NA 3TW4A 2WSSD 5L6NH 1GCTC 1CT2E 3UPEA 1QHXA 1ZJKA 1AZZA 2FE4A 2WPJS 2ZKSA 3PV5A 1HV8A 3SU3A 1AI8H 4BLRA 2AMQA 1C2DA 1ELCA 2WYJA 1NN5A 3A6PC 1Z8RA 1KNQA 3LY5A 4N3NA 4DT1B 3LC5A 4ESVA 1LTQA 4K2YA 3W6NA 1DUAA 1X7AC 5E2PA 5FOUA 1AO5A 2AMDA 1G18A 1KDRA 2ZU0C 4Y71A 3ZS8A 3S9AA 1PFXC 2QBYB 4Q4AB 821PA 4QM7A 2MMGA 1SMFE 4B34A 3FB4A 2VIOA 1G30B 3MO3A 4V0ME 2SGFE 1ZM2A 1GAJA 4O3MA 1IXRC 4NCHA 4UNPA 1CJUC 2GTBA 2HOBA 3MWIU 4JL6A 4KCGA 4IW4E 4EPRA 2A7JA 5LB2A 1LQEA 3TIUA 1HJ9A 3CBQA 5A8ZA 1OXTA 5JRJA 1BHXF 2BD5A 5EXNA 2EI7A 2VHUA 4ZAEA 1N6HA 4BZXA 2KAIA 1XZPA 3K0FA 2OTVA 3BH6A 1TQDA 4UNNA 2ASUB 1GJBB 4JLOA 2H1LA 1H8ED 4PTLA 3H09A 4HDOB 2A30A 5CYPA 4W9MC 4F92B 2IWRA 1I4LD 4DEYA 1OFHA 1YZKA 3K9LA 4JVNA 1GJ6A 3AP2A 1GUAA 1GRRA 3MWJA 1O36A 1NESE 3I62A 1R0WA 3FAOA 1N5LA 3VGCC 1N8OC 4DLYA 4M1MA 1UVPA 1OPXA 3U4QB 3DPUA 1WU1A 2ZF0H 1ZM4A 3AW1A 2ZDLA 1NJGA 4CEHB 3BB3A 3SYNA 3U9AH 3M1IA 2X2EA 5L30H 4W7SA 1AB9B 3AGPA 1ZNYA 4AG2A 4DOQA 4BFUA 1BT7A 5B6OA 2ZFRH 2PCLA 4TQ9A 1EPTC 5JB8S 1PPCE 5AFYH 4NTZA 3RC8A 2Z9LA 2BXTH 2K1QA 3HP1A 1ZHMA 2CNWA 4PC3A 3L82B 1EB1H 1Z6AA 2HF9A 3BTDE 1ELTA 1P73A 3K2UA 1P10A 5IK2D 1XUIA 5IDVA 2BMFA 3H7OA 3U61B 1GBLA 4U5XA 1KDOA 3UMFA 3RXEA 1Z5ZA 4M21A 5DH9A 3VR1A 1IQLA 3P8NA 1RRFA 2DCUA 1A2KC 1Y3AA 2WJYA 4NWLA 2J46A 4RCYA 1ZD1A 3RXVA 2YNMA 2ZGXH 1TPAE 1AGPA 5A09A 2ZVPX 2Q6FA 2V0BA 2C90B 2SHKA 2GT7A 1W36D 1MABA 5DYGA 4KLZA 1W36B 4MPVA 3RRZA 5CB6A 2OCYC 1ZC3A 1BTPA 3TJVA 2PZGA 3EA9A 3BG8A 4D2IA 4ZHAA 3H2YA 1DXPA 1YKSA 3TNFA 5JHGB 5FBVB 5EUQB 3SV2H 3MCAA 3IO3A 5K8UA 2V3CC 1WP9A 1TNJA 2GF9A 4GZMA 4ZXYH 1J15A 2PHBA 2RGNA 4Q7XA 2ZFSA 1U0JA 5T6FA 8KME2 4LZZA 4X6MA 1TPSA 2XOKD 4I99A 3E90B 4IC5A 3U44B 2RKOA 5JB9S 3GCGA 5HYOA 5EW1H 1S83A 1PUIA 1SZPA 4C3ZA 3PMJA 1P2UA 4ESHA 3AKYA 3LU9B 2BLQA 4IOMA 1MAYA 2OM2A 1D3DB 1G8HA 1T8MA 4O97A 2YOLA 4HUQB 1UO6A 5A8YA 1E9FA 2G88A 4DDWA 1PPEE 3IHLA 1GM5A 2VL7A 1PQ8A 3QBTA 4DRZA 2BEJA 1IN6A 1HYLA 3V00A 4KITB 3V4RA 3EAJA 1R6BX 2XBWA 1GBIA 3TE6A 2BQ6B 1II8A 1PQ5A 5DLQC 4TYYA 2J4IA 1FDPA 1FN6A 3ZJYA 5TARA 5C5OA 3R7WA 2ZJZA 3ZV8A 4C0HA 3KF2A 2FA9A 2EFEB 1HAGE 3CF2A 1GBAA 3OEHA 4JSTA 3NBZC 1T8OA 3OSYA 2Z83A 3ZZ5A 1ZP6A 1E96A 1GL1A 2CXXA 1BBRH 3EPKA 3Q3KA 2ZCHP 4FUJA 4A1XA 5C2JB 4ASUD 2O8FA 1S84A 4NBSA 2XJ9A 1DT2A 3OTPA 3FMPB 4TQUS 1GG2A 4HAWA 4LUCA 1WA5A 2F83A 4KYIB 2A5IA 5A8XA 3DZDA 1LW7A 1MTNC 2ZDAH 3OE7D 2A9KA 3B60A 3CX7A 4UD9H 1GHYH 3RXLA 3QUMP 3P8GA 2FI4E 3RXRA 4K60A 5AJWA 3ZYDA 3S1AB 4BTIB 3LOXA 1NTPA 1MZDA 1H9HE 1ANEA 2ZJOA 2GCTB 3URCA 1TAGA 1AN0A 2I4IA 2R6AA 3EZFA 2JJ1A 3BTWE 2ZRHA 2ODEA 1KAGA 2BD8A 1QBNA 4CEJB 2GCNA 3GLHA 1N6NA 3P70B 1IQKA 1QRAA 2JH5D 3LXRA 1LS6A 3D8BA 1BTWA 2PMDA 1RVDA 4TQAA 1U8ZA 4DLVA 3JVVA 4E5UA 3BS4A 2G5NA 4R0IA 3P8FA 3GJ7A 3U7FB 1TA2A 4GRAA 1RFLA 2FDCA 2KB0A 2TPIZ 1Z83A 2F9OA 1QFKH 3DD2H 4CT4B 3N2IA 1T8UA 4B76A 3SBKA 3B82A 2YOFA 5E7IA 2IT1A 1GI9B 1DPFA 3QXXA 2ZSAA 2XRCA 1Z8JB 2R6DA 1E36B 2VPPA 3L0IB 5EP1A 3KKQA 2O8CA 4PC7A 3QLPH 1P7CA 3CWZA 4FUIA 5BPEA 1M74A 1UBCA 2JJ8A 4MPXA 3KZ1E 1KTVA 1WF3A 1N6RA 2P59A 1KO4A 1OIWA 3QZQA 2KE5A 5KNBA 1JXPA 4IDPA 1CP2A 2J0SA 5FUWA 3N70A 1HIAB 4LCBA 2VVCA 1E79D 3JZMA 4PQRA 1FAXA 3A1VA 1G3MA 1BA8B 1E3MA 1U9IC 1EFUA 1G8GA 2QBYA 2OT3B 4LZ1H 1W0KA 2XWAA 2JAQA 4PHHA 2L0XA 5AUQA 4PZLA 1TF2A 4P3YA 2JJ2D 1UF9A 4X8VH 5EXLA 5EZ5A 1OOKB 4DIDA 2FM2A 2ZI2H 4BAQB 3HK3B 1VCNA 3SU2A 2C9YA 4H9GA 5KHOC 1CHOG 1VYTA 3UY9A 1NVVQ 3TGKE 5HCNA 3M4YA 1E99A 2BZAA 1KDPA 2WICA 4HI0E 4THNH 1YRBA 1GI3A 3VAAA 5G41A 1HRTH 2SGEE 1F2TB 1P2IA 2TGPZ 3TR5A 4XTCS 2X77A 1KI6A 2GBLA 1C5MD 3GISB 3FVFB 1W49A 4NDZA 1KJZA 1SQ5A 3IDQA 2H9TH 1VCMA 2CDNA 4OM9A 4AG5A 3K1JA 4Q21A 2CL6X 3EQ0H 4NH0A 1GTVA 4JLAA 3EZ7A 4QG7A 7GCHF 3LBNA 3DA9B 2O8WA 2DFLA 1GHAG 2FSGA 2PUQH 2QPOA 5EP3A 3ZZAA 1X8LA 3GYLB 1UVSH 4MPWA 1U8AA 3UKDA 4Z1MD 2PZFA 1ZNWA 2W6IA 4TPIZ 5K7RA 2H9EH 2QN6A 4IGDA 4KO8A 2ZRDA 4DBLC 4PSAA 1BTHH 3SO3A 4IMQA 3WHKA 1FQJA 5KSPA 2Z3DA 1O3MA 1GJAB 1VITG 2ZR0A 4WXVA 3VR6A 1JR3A 1J99A 4BLQA 1ESBA 1XTIA 2BQ7B 1FMJA 3M7TA 3GLFE 2ZP0H 4AFSA 3GCHC 2A0QB 3V0XA 2HLDD 4DCDA 3K65B 5CB8A 2HNTE 4BZQA 1P61B 2VH0A 1EAIA 4AFQA 1N6KA 5B57C 1DAGA 3KNXA 2CXVA 2JASA 2ZRAA 2HYIC 4I4LA 1LTOA 2QV1A 4HATA 4A0FA 7LPRA 1ZPZA 3Q76A 2AYWA 2BY5X 3T25A 3THOA 1E0KA 4KSBA 3RM2H 4DHEA 1EAXA 3HKIB 2VGCB 2V3OH 1H9LB 2GKSA 4A2PA 2C8XB 3ZZ6A 2ZU2A 3P26A 4WMDA 4I8LA 2LWIA 1X8KA 2W0SA 1XD2A 4IDQA 2OP9A 4L16A 3ICQB 1CHGA 3OTJE 4DIEA 2AS9A 5C5NA 5EOKA 2WJGA 3GLFB 4Y0ZE 2TGDA 5ABWA 5DI9A 4CRCA 5IT5A 1YPKH 2VIQA 3W5IA 2B92A 1GBBA 3P95A 3EZ9A 3VXFH 4R71A 1LFDB 3E8LA 3M0EA 1Q1BA 2CBZA 1GIAA 3SEAA 3Q5EA 3DL0A 2NTYC 4HAUA 3MJRA 4AYVB 2ULLA 3TW8B 3JVUA 2VWMA 4Q47A 1WQVH 1J9CH 1LPZB 1CGHA 1G3DA 1S4QA 2QSZA 3DM5A 4XIGS 4PHTA 2FN4A 2HUPA 4BLPA 1LQDB 2BDIA 4YLGA 2ZSBA 3L0SA 1OFTA 1XTRA 4BAMB 3KL4A 1FI8A 1NRJB 3A8CA 4UJ3A 5JEEA 3ZZ4A 2GVZC 3THXA 1SGFA 1EGAA 2P5SA 1FNMA 3A86A 3RXMA 2HPQH 2PH1A 4DSOA 4A6LA 4UJ5A 1QIXB 4CBNA 1YJ5A 1UJ2A 2ZFPH 3L6PA 4Y0VA 3GLIE 1FW6A 5LPFA 2XTZA 2ZI9A 3T1TA 1HT2E 4M4SA 4I8KA 3GCTF 2ZHEH 5KDOA 5KPJA 3TH5A 2BWJA 4YONB 3A82A 3B8JA 5LPEA 2D62A 3PUXA 4C0AC 4G1UC 2AIPA 1NJFA 1DWDH 1EP5A 4QGFA 2ZR7A 1OWJA 3K0AB 2NU2E 3R0FA 3KEEA 3NIBA 4MLFB 2PT7A 3B23B 2UWLA 1SXJC 2D2FA 1MD8A 3DHKH 1K1PA 1Y3YA 1WXQA 3CR8A 5GVSA 4UONA 2H57A 3S1AA 3RXIA 1G8FA 2O0HA 1M7BA 3WY8A 4AKEA 1W10U 4WXRA 4P32A 2B0FA 1XTJA 2JLQA 3L33A 1UTQA 4US0R 4LPKA 5A4JA 4GHQA 4M53A 3VMFA 1KXCA 4IDHA 2VBCA 1O37A 4HTCH 3GLIB 4RVCA 1GI1A 4JVLA 3KB1A 2ZI7A 1C1SA 4LHXA 3KFVA 1CU1A 4TZ0A 4ZKRU 5C18A 3KJEA 1ZHPA 1II0A 5CHAB 2IS6A 3TJOA 1Y5UT 1HAYB 2X2FA 3TQFA 5TB5A 1G2LA 2B6HA 2V1XA 4Q80A 1MQ5A 5FBLB 3LAWA 4XJXA 3T27A 5J4LA 1KY2A 3QX5H 1ZR0A 1ONBA 3LW8A 1C1WH 4ZCLA 4K1SA 1O2NA 2RB4A 2IYVA 3FZZA 1O5DH 5JJIA 1YZQA 4ABBA 3AVXA 1TX6A 5DP4A 2FFBA 4DDUA 1J8MF 2WMNB 4Q02A 4U02A 2W83A 1LPGB 3MI4A 4GOXA 1S3GA 3H86A 1KDTA 3EDXB 1ZTLA 4IOKA 3P20A 1DAMA 1RYHA 3WYGA 2F3RA 1AGRA 4AYTA 1K9OE 1NKSA 1OH7A 1SBWA 2EI6A 3PIRA 1JB1A 3LRPA 3RHFA 1Q1ZA 1C5LH 3ADCA 4Q7LA 1MZAA 1RD3B 3U3MA 2HCJB 1S9DA 1G3IA 4B6FA 1YCPM 3RSOA 1PLLA 3FMFA 2B8WA 4LSGA 4L5BA 2IEYA 1CRQA 5KSOA 3I72A 4KAXA 2ZJ5A 2VU8E 1H65A 3SHWA 4CRGA 2G5VA 3LGUA 2GJ8A 1C5YB 3Q00A 3CPJB 2GKVE 3MGCA 1IN7A 1G3RA 1C4V2 3E70C 2ZROA 5TDHA 1G8PA 2CF8H 1K1JA 4FMDB 3AVZA 4AB8A 1TALA 3GCOA 2RGDA 3F68H 5HR5A 4QC2A 1I4TD 3QOFA 1AB9C 1TQ7B 5KYKA 5AUPB 2QGRA 2R3UA 4BOHA 1RJ9B 2STBE 1XM1A 3SU6A 3GEEA 2W26A 4ZUHA 2QXIA 2VP9A 3GY2A 2C99A 1LF0A 5G40A 2QP4A 3SNEA 1PPBH 2JGNA 5FTKA 5FL7D 1C4OA 1F2TA 1LHFH 1QNJA 3W94A 2PKSB 1E9DA 2QN5T 2QU8A 3U8TH 2DB3A 1C5VA 3E0NB 3AF4A 1E9RA 3E6PH 4ACAA 3ZZBA 3D23A 3K0SA 4LJ9A 2NG1A 2BB4A 4E09A 2GJKA 1GDDA 1Y3WA 2FESH 3ZZ9A 1LVMA 4DB4A 1GL0E 1GHZA 4JYUH 1XMVA 1V2RT 3VR2A 4OI1A 3P8OA 1W36C 1P2OA 2RG3A 4NCKA 1DAEA 5JSZA 3KN2A 2NO6A 4OHWA 2WKQA 5FFMA 3FMOB 3BIUH 5C1BA 1CR4A 3IBYA 4YXWA 1QRXA 4ZI3A 4K1EA 1BMAA 1SGDE 1L1GA 4KFUA 1SVMA 4QJ5A 5A0FA 4M1YA 2ZYWX 5CDFA 3BH7A 2CMYA 4LHYA 1ZINA 3SQWA 3CLVA 3NKVA 1Y3VA 1SGYE 1AQ7A 3KQEA 5A0CA 1VCOA 3HR8A 1VCWA 1TNKA 2SGPE 4G5QA 4LHWA 4DUGD 4Q9KA 3TIFA 3M5LA 2J34A 1XEWX 1US8A 3ATKA 3PVSA 1SLVB 1KNXA 4B73A 2VP6A 4Q7YA 5DJ7A 4WVFA 4IBLH 4YMWA 3RAPR 1NN6A 3T1VA 5L2ZH 4RI0A 2BOKA 1NRPH 2IYYA 2V8OA 1LS1A 4RSGA 1BMFA 5FPSA 1YPLH 3RS3A 1VHLA 3T34A 1CEEA 1HUQA 2PJZA 1KI4A 4LYFA 1GGDB 4H4FA 3K70D 3FVQA 4A5TS 3K70B 1GWAA 2JKHA 2J92A 1KSGA 1TMBH 3GEHA 1Z7KA 1WTHD 1G1MA 3A83A 3ONWA 3VHLB 4U30A 2QYIA 5AFZH 1R0YA 1GI4A 1AQUA 3HKJB 4YMSA 1JWTA 4WJG2 1IN8A 2VSXA 1ZGVA 1DEKA 3KX2A 1W2HA 2C3SA 4BTUB 4HZUA 1E2EA 4FI3C 1HE1C 2ZFQH 5JBBS 3EIQA 2FI3E 1R0ZA 4WZAE 4ZKOU 3MMPA 4QNRA 2CK3D 3T26A 5HM2A 1CR1A 4LZ4B 1F2UB 1HCGA 3K09C 7GCHG 9ESTA 1D2NA 1U90A 4Q66C 3RC4A 1TMKA 4BZPA 1SG8B 5GJWC 4FU9A 1XXFA 1ZNZA 3PXGA 3P17H 4HZHA 2CCJA 3ZZ7A 3THYB 5C46F 1PPZA 4RD6A 3KXIA 5BWMA 1YCPK 2FOAA 4I81A 1NO9H 1XZQA 3GOVB 2ZANA 1M1YE 2IWHA 1SVPA 1QBVH 3C4JA 1X1RA 5E7JA 2GCTC 1W44A 2ILNA 2QAGA 1ZCAA 4OI0A 3A84A 1FPHH 1NT1A 2VINA 2O8MA 4QXAA 4FUBA 1ZM3A 2GZ7A 1HUTH 4WZBE 4MGZR 5PTPA 2XW9A 2CLDX 5FOTA 1O39A 1OT3A 3UTUH 1RXPA 4QT8C 3GDSA 4U32A 2GMTB 2PL3A 3PR1A 3W6OA 5T6GA 2ZPQA 3AF3A 1L4ZA 1OYWA 4FMDF 2JH6D 5GJ4B 1A2BA 1K2I1 2ZIQH 3EA5A 2PZEA 4Y6DA 4OS6A 3X1WA 5K8IA 2GZ8A 1P01A 2ZRNA 2WIAA 4HAZA 1PPHE 4RKJB 1L2EA 5L3RA 2QY0B 2QPTA 2Z3EA 5JBTA 3VTKA 1SHZA 1V2MT 4EUNA 4N1AA 2WPIS 1Z6XA 1A3EH 3PJRA 1T91A 2G9NA 3KKOA 4TY7A 2XC5A 4UQOA 5C3NA 4ZHMU 3AVPA 2BOVA 5FX5A 3KDSE 4QBGB 2JIZA 4YOIA 3G82C 4K1TA 1PQAA 5J40A 2A45B 2JATA 3H1TA 5CIQA 1TNLA 4NL4H 1KTTB 3DT0H 4DLZA 3NC0C 2QA5A 1P72A 2BCJQ 5DI3B 1HJAB 5KUTA 2QIQA 5JS7A 1O33A 2W58A 3KQBA 1Z1IA 5G3ZA 2A2ZA 3VX3A 4NMMA 1E6CA 1KI9A 1I4DD 2NU3E 1T8TA 4DCUA 2P2LA 2ZHDA 2D2EA 1E0SA 2CF9H 2ZA5A 2CL7X 4A2WA 1KO5A 5L3VA 1G32B 5DN6D 3CX6A 5TY0A 3GJ8A 3OY6U 4QRHA 4Q4JB 1DG1G 2VHQA 5HXFA 1G36A 2XNDA 1NROH 1E35B 8OHMA 4J0QA 1ORFA 4TL8A 5A0AE 2Z9GA 3TJUA 4V0NA 3MFYA 4DURA 3SBEA 1KDQB 3TVJB 1NN0A 1GVZA 1MU6B 2IC5A 3W95A 3BC1A 1EJNA 1AS3A 1NPMA 4O0MA 3TH2H 4AK9A 2E87A 2FS9A 4LHZA 3TLOA 4UFDH 4F7WA 3DUXH 3BD9A 1QA7A 1HA3A 3AKCA 3GICB 2EYUA 5EXPA 2ZR9A 2QMEA 4DLTA 2WSSA 2CE7A 4BFXA 1K1NA 1OIVA 1E2DA 4X8SH 1C9KA 2DFTA 4KFSA 3DKVA 1QBOA 3AAVA 3TR0A 1KSFX 2IUTA 4MGIR 1V2PT 3T15A 2F55A 2W3IA 1C1VH 1OXXK 5EG4A 2TMKA 5JBAS 4OK3A 4KV9A 3MU4A 1T4GA 2IBMA 2F43A 1AQYA 1GJDB 4Q9HA 4JLNA 1AZSC 4M8NE 2OILA 5D3MA 3NXSA 1Q0UA 1B0FA 1EWQA 1YPJH 4XFQA 2JLSA 1ZU5A 4YM9A 1TNGA 1RJ9A 1IQGA 2QMOA 3KIDU 1R8SA 1BKDR 3VR4A 1AU8A 2C98A 4BLTA 2PKAB 4Y76A 2NGRA 3TK1A 1T31A 1MAXA 3QKRB 1ZJ6A 4SGBE 2A1DB 3RU4T 1XDBA 3MNXA 2H5EA 3TKLA 4HYYA 1ZUHA 3HU2A 4ZIRA 1K5GA 1YPMH 1ZM9A 2XSZA 2QT1A 1UTJA 3J81k 1IXZA 1WV7H 2C8VA 1GMCG 1ZVQA 2GCOB 5G4BA 3FP6E 4TSFA 1GRNA 3T35A 2WKPA 1YRAA 3M37A 1T6NA 3LJJA 4RN6A 5T1VA 2GGVB 3EASA 2VGCC 2W6JA 4GI7A 2D26C 3PENA 1Y8TA 4P4SA 4AKIA 1TRYA 5J4HA 1P9SA 1O2PA 5EE9A 1OB5A 3SHFA 3HGPA 2V4ZA 1YR7A 1OKKD 2R62A 1C5WB 4JL8A 4AX9H 2QEQA 5FUVA 2P93A 1O3DA 2A7HA 1A1VA 2FIRH 4YLQH 4INHA 1TU3A 4OGXA 1Q3XA 1G6HA 1T9HA 3AUXA 1R5BA 2XTMA 2P3SA 3W3AA 3LQRA 5EE1A 1TQ0B 1ELFA 4IDNA 3LLUA 2AWNA 2HNTC 3I1FA 4AI6A 1XB2A 1CE5A 1HTWA 3Q85A 2NO0A 3I78A 4D80A 1J16A 3UWOA 5FPYA 5IK2A 5F9HA 1BDAA 4WOPA 3S7KB 3WBKA 4AYYB 1QBKC 1KZ7B 4GBMA 4LV5B 4MDFA 4B35A 5FOVA 1M7GA 4IOLA 1E94E 2FOGA 4G0NA 5FPKA 3R9WA 1BOFA 1Z2CA 4EFMA 3IG6B 2OG2A 3EGKH 5ETXA 1A5HA 3PEVA 2CJWB 4OHXA 2IF0A 2R3YA 2ZJBA 1PVOA 4C30A 1V3XA 5E0JA 3BTFE 4DLRA 4L9SA 3SORA 4M1TA 5E2OA 2A7QA 1BRBE 2Q3HA 1XXHB 3W9YA 2A31A 3BORA 1NBME 4U01A 5J4KA 3RWOA 1TBQH 4B33A 4CHAB 2W0MA 3BF6H 2ZDMA 1RC8A 4JLMA 5EXXA 4C0LA 1VGCB 2DY1A 1DSUA 1GJ9B 5EPNA 1WAYB 1LVBA 3VR3A 3V9PA 1IQJA 4EPWA 2HYDA 3RXDA 1D8TA 3IILA 3GLGA 3VHXA 3NDPA 3F8TA 3K9GA 3TLXA 1TGTA 4H6TA 1QHRB 4FMCB 4JMPA 4JZFH 4EQ6A 1FP7A 2CL0X 3THYA 4TMZA 1O2MA 1E1QA 3PEUA 2R6GA 3PO1B 1N6IA 1NI3A 2B5TB 1XJ0A 1IY2A 3QE0A 1GPZA 2CLCX 3U7EB 1X3SA 3AF0A 3E91A 2F1RA 1U2RA 1J14A 4PO1A 3FDIA 1KKMA 4B2BA 2SGQE 1W4BA 5AR1A 3OZXA 1CF4A 1EG7A 221PA 1NBMD 4NYJR 2BKUA 3D65E 2IS2A 2J9NA 2TGAA 1YBWA 1K1IA 4ABDA 5CHAC 1FY8E 2C8WB 4XBBA 1UBEA 2BVSH 4WBSA 2P67A 1TUEA 1C5RA 3THWB 1YZLA 1XPRA 1CULC 2QI9C 3RXBA 1IHTH 1F2SE 1HNEE 1K22H 3Q8XB 5HE8A 3RDZA 2QA9E 3A1SA 2OD3B 1LHDH 1FUUA 3U3RA 5TCCA 5JBCS 1N25A 1MBQA 2WWFA 3OESA 4ZKEA 1KTSB 2J0VA 2ZC9H 4CRAA 6ESTA 4UFGH 1GJ7B 3KKNA 3TGJE 2XJ4A 1TE0A 1T3LA 1LVOA 2OAQ1 5DE3A 3PWBA 4MQBA 2TRMA 2WWXA 2J0UA 3O8RA 1BRCE 5CK5A 1N5JA 3I32A 1U6QA 4NYIQ 1NFYA 4OL0A 4OHZA 5L3QB 1EX6A 3E2IA 1AS0A 2REBA 1HAXB 1TGBA 1UCYE 1ANKA 4LPSA 3WYAA 4AGKA 1AJEA 2GRJA 1SGQE 1BZXE 4X1NU 3Q3YA 2Z43A 3RXAA 1P2KA 2ZJYA 4R2HA 3CF6R 4Q9IA 3AP1A 1NMZA 1AMHA 2ANKH 1OH6A 3LH3A 3NTUA 1QJ6B 3X1DA 4Q7JB 4Q4JA 1T3SA 2BTCE 2R0LA 2BKEA 3A1WA 5EE0A 2C9OA 1YZTA 1JR6A 1FNNA 1BH2A 1DLKB 2WPDD 1Z6YA 4TYNA 2O8BB 2RGAA 2ANYA 4Q5IA 2YC2C 2AL7A 4TMTA 4Z6AH 1QHYA 2NMVA 4EDHA 2E9SA 1AWHB 1KDQA 1F5KU 1E9EA 4B3FX 1WRBA 3HU3A 4LYJA 4URWR 4BEBA 4B43A 5C4MA 2Y6TA 3A4MA 2GEUA 1LHGH 4GHTA 3MG9A 1FZQA 1O3KA 2J7PA 3BRWD 2Y82A 4EKDA 2ZNKH 3VPKA 1BO6A 1GBKA 4K81B 2XTNA 3W34A 4GCHG 3V7TA 4G5GA 1XMIA 1SLUB 1G7RA 3K0CA 1UVUH 2O8DA 1DS2E 1S6FA 1Y5BT 3LIWA 4A8JA 1O2QA 2Q9CA 4AYXA 3SU8A 1ZLRA 2HGTH 2LKCA 2BV3A 1W0JA 4ISHH 1XX9A 5EP2A 2BX3A 2DWPA 2GAOA 1S1CA 2IYQA 5GADl 1V2TT 1UK3A 1S0RA 4B74A 3U8OH 5AF9H 4KTUA 4DCNA 2DE9A 5J47A 2VH6A 1XXDA 4PAMA 3GEIA 2CCKA 2H16A 4HDCA 4C0BA 3MU5A 3M35A 4H6SB 2PKAA 2FWRA 3RSLA 3TK6A 5GNDA 3A7VA 4LJAA 2C93B 1P2NA 1SR5C 2FS8A 2C78A 2XC4A 2GTPA 2W00A 4MPUA 3REGA 4Y8YA 3SU1A 2BD9A 1AUJA 1BCUH 1BYUA 4XD7A 4BXSA 2YC4C 1KKLA 4KHZA 1YM0A 1OXUA 3L0PA 3U69H 4URUR 4HEJA 3QENA 2ZSDA 1N0VC 2ZHFH 3CS7A 2HALA 3SN6A 3B13B 1MKXH 4FMCF 2UUYA 1SHYA 4MKHA 4MNWA 5AJYA 3MMGA 1HAVA 2EQBA 4RD2A 3ZZCA 2OXSA 4Q18A 2ERXA 4FXGH 3K70C 3VXEH 3BH0A 4GOJA 2QNRA 4B2CA 3RMLH 1Z0DA 2A4GA 3ZZ3A 3IO5A 2QXHA 3TSZA 4DVAU 3KCGH 1YR9A 4KVGA 4QBHA 1AD8H 1H4WA 2KAIB 1BTUA 3K0FB 1ELDE 2ZE8A 3REFA 3KL6A 1O2SA 2PFEA 2J59A 2H92A 2HJGA 5BRRE 3UQOA 1N3BA 4FUDA 3K6ZA 4JBYA 3CKLA 2J2UA 1R5NA 3ESTA 3B9QA 4OQFA 2QZ4A 2PWXA 1ABJH 3AVQA 4TWYA 2D3WA 1NFXA 1AFEH 1L1JA 1W8BH 3QKSA 1O2IA 3M5NA 1B0EA 4JLKA 3GFTA 2ZETA 2AGGX 3IGFA 3B1ZA 2ZXUA 2YNAA 2XAUA 2EFCB 1CVWH 1UVTH 1XWIA 4W5HA 1JQLB 5GDSH 2F9PA 3SR0A 3FP8E 4UEHH 4C0QC 2LNCA 1MUEB 4BPBA 3R8CA 1YCPH 2CNWD 3AH8A 4FN5A 3RXUA 3FHCB 5BXQC 2KSQA 1N5KA 1OH5A 3PMBB 1FUJA 3B1WA 4NYJQ 3T12A 2FEQH 2IYWA 4O2RA 5C2ZA 3LVQE 3EARA 5FTMA 1N1LA 1IAQA 1Q1QA 3LO5A 1Q1EA 3EPHA 1VPLA 5BN4A 1V2LT 4B47A 2IYZA 4LC0A 4OKSA 2QQEA 3GJ5A 4X6NA 1XFAA 1ZBDA 2GMTC 3QPVA 4JZIA 2IXGA 4UFFH 2R6CA 1HXFH 2P16A 1GKUB 2Q6DA 3EW9A 4WIAA 1MABB 4LK2A 1Y63A 4LC1A 3ASZA 2X8AA 5SGAE 1QL7A 1CRPA 1KLJH 3Q3XA 1O2VA 4B44A 3VKHA 1E1RA 3QXSA 4WMEA 4RZUA 1AVGH 2EWVA 4HAVA 4LI0A 3BFXA 3K0EA 4MNVA 2ZFTA 1BMLA 1O35A 2EFDB 4II7A 3TSWA 1A4WH 1KZGB 1W4AA 1SGWA 1ZU4A 4EFNA 6CHAB 5FOWA 3ICEA 1TAWA 4X2VA 4JK5A 3BTKE 3SJ9A 1Q3HA 4HLUA 4M9XA 2PGBB 1HJAC 4RSPA 2FPKA 4ABFA 3TK9A 4V0KA 2AD1A 3QF7A 1P0SH 4NFFA 5DP9A 2XB4A 1MBMA 1QHGA 2FOLA 1E9BA 4AC9A 2BDHA 1A1RA 1QF9A 3FFAA 4WW0A 5A2MH 4A4DA 4RZXA 3UWKA 4W5WA 1EFRA 4R2IA 1MCTA 2F9NA 4TLDA 4L8GA 1O3JA 2ORVA 3IEUA 4CRBA 1CJTC 4JLBA 1II8B 5JYIA 721PA 1C4U2 4C4PA 2BDBA 3TVTA 2DFKB 2QSYA 4UDWH 2DBYA 1QCPA 1ZD9A 521PA 5AUNB 2FO9A 5E4FA 4DLSA 3R7WB 1O5GH 2D8WA 1EJMA 4HDQB 4ISOA 2G51A 4WAUA 2CHAC 3P32A 1NY5A 3UG7A 2LCFA 1R2QA 3OEHD 1O2RA 1GOTA 2FOMB 1XEXA 4IFEA 4KELA 2XEXA 1EZSC 2VP2A 2H1UA 4ZHLU 3OHMA 3GLHE 4X0WU 2ZJAA 4DSNA 5CLLA 4OI4A 1TEVA 1TGNA 3RXHA 1AZTA 2O8FB 3GY5A 4Y79A 4ASHA 2YWFA 5EJEA 5H70A 3ZYCA 1SVOA 4BFYA 1JBKA 1DPOA 2M5TA 421PA 4IC6A 1HEIA 2ZIAA 3IIMA 2NO7A 3R9IA 3KQLA 1BITA 2GVDC 3E16B 2ZRGA 1J90A 1OWIA 2V6JA 2RA3A 3OEEA 1OYQA 1YYY1 1VG9B 1CIPA 4TN1A 3Q3JB 4ABIA 4E05H 5LBIA 3TAUA 4BFSA 4N0DA 2BCGY 2EW1A 4GVUA 1GJ5H 1J2JA 4HUTA 2FZ4A 2AHOA 4MNXA 4HZIA 1CHOF 3PITA 4LBYA 2N42A 1XPOA 1ETUA 4A9AA 5JWRA 2H18A 2KWIA 2JJ1D 4F49A 1GDUA 4X8UH 1GJCB 3L8YA 2AD5A 2GILA 2D06A 3GLHB 4D0LB 1H8HA 3A1TA 2I3BA 2HEIA 3RXGA 1CLUA 4TTQA 1Y3XA 3T5DA 3BFVA 2XZLA 1KHTA 2GNOA 4BQSA 4HSEA 4Q00A 2ZDNA 5FOXA 1C2KA 4TY6A 2FSIA 1NM6A 5F6MA 5E0HA 2ZRPA 3CUEF 4JZ1A 1P9WA 2OBLA 2ORWA 1FXYA 4X8HA 1RIWB 3ODDA 1E9SA 4KBGA 4F38A 4X1SU 2F9VA 1OB2A 2FYRA 1IY0A 4IRUB 1GHAF 3PQCA 4U7DA 1SXJD 3P4XA 2P3TB 4D9RA 4X1RU 2P95A 2YWHA 1EESA 1CT0E 3NDBB 1W14U 4LX0A 1C2FA 1E98A 1MKYA 5IYTA 1SKQA 4D7GA 4ZDKA 3TGIE 1Z0JA 2DR3A 1FZZA 5EUMA 5DKMA 1CSOE 3T2NA 1NVXQ 3AW0A 2PLRA 5FBEA 2QP3A 3ZVMA 4I31A 2O8CB 1SGPE 1JOUB 1B5GH 4KTCA 3FKQA 4TMXA 3K9XB 1VITF 2ZYTX 5L3SA 4D7FA 2ESTE 1O5CB 1G21E 4NZQA 5KSZA 4EJSA 1FX0A 4OQLA 2QGNA 3AGQA 3E1SA 4QKQA 4TL7A 1HPGA 4YOJA 1OSNA 4MGKR 3K6YA 1QQUA 4AG1A 1W48A 4IJMA 4M7GA 4GZLA 1E2HA 3KQHA 2A5GA 2C2HA 4Q19A 1TRNA 1W0KD 4OI2A 2QRZA 3PUWA 4JBXA 1S82A 4KI0A 1F5LA 2PMKA 3W90A 2GP9B 4DCSA 2ZRKA 1CJKC 1V2KT 3W6PA 3KUDA 1O2HA 2O0JA 4SGAE 1YPHE 3F5FA 3S9CA 1HV7A 4A15A 1HQCA 3T5FH 1EXFA 5LGOA 2ONJA 3CM0A 1TRMA 1E0AA 1HB0B 5E7MA 2ZCLP 1WB9A 2KBFA 1JR3E 2W5EA 2Z6BD 1KI6B 5JCPA 2HXYA 4KLNA 2VH5R 4M1OA 4CZ2A 2ALVA 1ELBA 1TPOA 2Z94A 2H5CA 3VB5A 2CHGA 5UKDA 3CONA 1SGTA 1XMSA 1ZIPA 2WV4A 2G83A 3SDZA 2G1JA 1P6XA 4CHAC 4FUEA 2C96A 1INCA 1E9AA 3ZZTA 1G7CA 4HAYA 2F7SA 1VGCC 1XJCA 4OK5A 2BDYA 5KTYA 4JK6A 1UM8A 3ZLJA 4K46A 2J1LA 5GJVC 1H1BA 3M3VA 1XBTA 2V6IA 4FIDA 2OC8A 5DO4H 2Z4RA 5TMPA 1KXBA 2W6ID 1S3SA 1KK2A 1N6PA 3O8DA 1G17A 1U99A 1H9IE 1OFUX 1S85A 2RGCA 3PO1C 1EX7A 5B30A 1GI8B 2PSYA 2H17A 1JEDA 4MVNA 3T29A 1NFWA 5KPDA 2OCBA 4OS4A 1JJVA 1ESAA 2OC0A 1ETSH 4RD1A 2CJIA 2WOOA 3QKTA 3UQVA 1JR3D 3AVYA 4NYMR 3I61A 3WMGA 2FGKA 3SQXA 4TZ6A 3ZQ6A 5EU8A 1X1SA 4QGGA 1YQTA 4KKDA 3FYHA 3CPHA 4WH6A 4FUFA 3QTVH 4PC2A 3GJXC 2Z4SA 3RMNH 4F4JA 4TPYA 4MKIA 2GXUA 1DG3A 4B3CA 2EYQA 1EZUC 1VCIA 3BK7A 1HH4A 3QXHA 4ABAA 1GI0A 2R0KA 1KO8A 5SZJA 4C9BA 4GPGA 3G0HA 4AD8A 3AASA 1J8AA 5HM9A 2OINA 2YYZA 1DY9A 1K8RA 2UZ3A 2YVUA 1G4AE 7KMEH 5EXTA 1MH1A 1KMQA 1S8FA 5JPMH 1KJWA 1UTKA 3SBDA 1NMYA 3FKSA 4AG6A 2FDAA 4FWIB 2VWOA 3BB1A 1N0WA 1P04A 1Q20A 4U2WA 1BUIA 3PG5A 4Q01A 5AJZA 2VO1A 1XD2B 1E0FD 2O9QA 2ODPA 2C04A 1P02A 1VG0B 2ZHWH 4RFVA 4H1UA 2AXNA 1ZPBA 4LY6A 1Z1JA 1UADA 1DX5M 4X1PU 1EPTB 2ZQ5A 2JDID 2XITA 4ACBA 1C2LA 2OLJA 4Q9JA 1VTKA 2G8TA 1W47A 2AGEX 1Z22A 2RAPA 4LDJA 4XSHA 4DB2A 3KHVA 2GXSA 4IVPA 4NCYA 2I6SA 4FWTA 5C67A 4CGZA 3GJ4A 1ETTH 3CP7A 1BTZA 4ZKSU 2P3FH 3BG4B 1PLJA 1LDTT 2HV8A 2A5YB 1D6WA 4BAOB 5HGGA 4CT5A 4EPVA 1O3GA 1NU7B 5BYKA 1GHWH 1SHKA 5DP6A 4QBFA 2ZTXA 2BZ6H 1RKBA 3RRYA 4MKGA 2WWHA 1LCYA 4MUAA 2Z6VA 9LPRA 1UDWA 3SC3A 3IPYA 3KJHA 2GEVA 1Z28A 1XEFA 1SLXB 3THXB 5E8EH 4UXIA 3RC6A 1QVAA 2BBTA 4PQFA 3AK5A 4PPNA 1TABE 4IN2A 1JNYA 3SYKA 5BN5A 5DIFA 5LD2B 2X19A 4XSGA 5JS8A 2C95A 4A7IB 3AV0B 2V35A 3SYJA 4AURA 3PMHB 1KLIH 2QM7A 4QHSA 3BIFA 2GXQA 1EAWA 5EQSA 4DWJA 3QO6A 3QK1A 1IHUA 1SPJA 1AE8H 2QCYA 3ZV9A 2ZE7A 3BB4A 1S0QA 3SOPA 1H8IH 1O2UA 4B75A 1QHHA 3T5GA 3WNBA 2ZUCA 1WYKA 2FXRA 2F6RA 1HAHH 1GKIA 2JLRA 4KYUA 1F48A 1T7CA 3QY0A 1KO1A 2JLXA 4OK6A 3BTEE 2IYXA 1OJLA 4HAXA 2V54A 2WUCA 1GBJA 2ZU3A 2BMJA 1FP6A 3W8RA 3RC5A 5TCAA 1JIMA 4TMKA 5CK4A 1T0HB 1GHXH 2SNWA 1CXZA 1YZNA 2SGDE 4Q1CA 5DN6A 1MCVA 1FPCH 2H2ZA 4Z0KA 5K8LA 1P09A 1Z0IA 3KFXA 1MOZA 4XOIA 2OLKA 3CPEA 5JCZA 3EYDA 3A8DA 1ZSJA 4A0RA 2WJVA 1C5OH 4Q1AA 1NMXA 1FY1A 3ADDA 3ZVNA 2VA8A 5KSYA 1LKAA 3X1YA 4PPFA 2F1JA 5LB4A 4LV8B 1RRPA 1F0TA 3U3JA 3RMOH 1MV5A 1U94A 3LXXA 1Y5AT 1AN1E 5H4IB 3GP8A 4YOGA 1NRSH 4TWZA 1P05A 2VSFA 2BEKA 5SZKB 3LGYA 1G4UR 1ZMNA 2AWOA 1DITH 3VKWA 1FJSA 2F3CE 3ADBA 5ELXA 1DO0A 3D3QA 4D26A 1DY8A 3MWLA 4G5RA 3TK5A 4H42U 2BD7A 3AVVA 5FAHA 3A58B 2BY6X 3CWQA 2STAE 2FOFA 1HE8B 2A5FA 4L15A 1AWFH 1ZZZA 2OQ5A 4GPTA 2QUZA 3H0KA 1QHSA 4KXFB 4D4JA 2Z5FA 1G5RA 1A4RA 1MO3A 3MUFA 3WHLA 1AIXH 4X8TH 2BBOA 3EX7C 2WPMS 3V13A 2QL6A 1V2JT 4B3DA 3HYTA 5E3HA 1J7KA 1A0HB 1G7SA 2PT5A 2WOJA 1WBGB 3VFDA 2O52A 4KTSA 3B1YA 4LYHA 1ZPCA 4JYVH 3WRYC 1TIOA 3KJGA 1LB1B 5JDUB 5KOYA 3EA8A 2RH5A 2ONKA 1MKWK 3PYHA 4BNRA 1GBEA 1HDTH 2Y5GA 1EFTA 1P4SA 2D4HA 2R2MB 3STIA 4TLEA 2PEZA 4QNMA 1Z71A 1KAOA 5JFGA 4EPYA 3ZZ8A 2G52A 1JBUH 1IQNA 2FOEA 3SU4A 4QGHA 1F60A 1VHTA 5CDFE 1E32A 1UTMA 1NY6A 3B9FH 2WWGA 4A92A 2ZSEA 1YF4A 4DKXA 2SGAA 1NG9A 4G5OA 4URZR 3TQCA 1CT4E 4NZLA 3NH9A 1KSJA 4B2LA 1GKYA 3DOFA 1OXVA 4XOJA 2EFHB 2F1IA 5HZHA 1P2JA 4Q4HA 2ZCKP 3RWMB 4WXPA 3A7ZA 2OCVB 4YMVA 3CIOA 3I5YA 2YV5A 2BJWA 1PYTD 1JJ7A 4MYTA 4MH0R 3WNDA 1KIMA 4IXNA 1ZRHA 5DHFA 1VCPA 4LGMA 4DIHH 4KFTA 4URYR 4UNSA 4O3UA 4AORA 5JSZB 5TXGA 1CQQA 1A5GH 1I2MA 3TUJC 3LC3A 2AFHE 3D49H 1MU8B 4RFSA 3A7XA 1PZNA 4YXWD 4MRRA 1E2GA 3BV9B 2NOAA 2VHJA 1Y3UA 4Y10E 5TV2A 5EE3A 1GG6C 5EGMA 4Z51A 2RGNC 1BBRE 4U00A 3UWJH 1OXGA 3TH4H 2O8EA 6CHAC 1IJFA 1TFXA 2IS1A 3Q72A 1Q12A 4JVMA 2ZRJA 3TGPA 1HXEH 4X8MA 3OIVA 2VIVA 4XVQA 5LPNA 4BRWA 3UR9A 5ESTE 3I8XA 1US8B 2IK8A 3MU0A 3A4NA 1P62B 3TUIC 3DEFA 1T0JB 1IJEA 3EC1A 1O3AA 1DE0A 2P65A 1O5EH 4I8GA 2CMKA 4AIIA 2CHQA 5H8WA 1HBTH 1TF5A 4NSVA 1BMFD 1DAFA 2CEAA 2OZEA 3UFAA 4ESTE 1MO5A 4CF7A 4Q1BA 1EASA 2JETB 2ZQ1A 3EC2A 3QNUA 3GPLA 3SJZA 3OFNA 1ARCA 1ZGIA 2RMKA 4GFDA 1GMDG 1NIPA 3H5CB 1YGCH 4XBDA 3SV8A 1GL7A 1O3IA 2IYLD 1TQ6A 1ANDA 4KODA 1FIWA 4D25A 1MRNA 4IXMA 1DS6A 1WDTA 1C1YA 1GITA 5CM8B 1CGJE 3ZQJA 4HZUB 3HYRA 3DMNA 2FFAA 1UTNA 4IFBA 1EPTA 2W2XA 3URDA 4CVNA 5EODA 2DFNA 1DWEH 1PPGE 2FSHA 3A89A 3H7TA 1M8PA 1E37B 4PQYA 1TOCB 2OCPA 5EP4A 2XZOA 4YLUA 1Z3IX 2VEDA 3NZIA 3C5CA 3E5HA 5DP8A 1IQEA 4DSTA 1TMUH 2ZPRA 2AGIX 1NBMA 1M34E 3JZAA 2ZS8A 4LV6A 1ZUNB 1DO2A 3VQTA 1HJ8A 3I92A 2A5AA 4CBOA 4JYTA 3MH7A 2NU4E 3QEOA 5HZKA 4MITA 2FOBA 4JVSB 3FE2A 1DUEA 2C9CA 4ZDWA 1OHHD 5FR2A 4Q7KA 4JCNA 1TU4A 4M2LA 2QAGB 1DVRA 2IHYA 3DVLA 1UHBA 3UNRA 3NG1A 3SFZA 2FJUA 2QE7D 4NSYA 4B2IA 2BDAA 3CZPA 1KY9A 1G3EA 2VWNA 5FTJA 2VVVA 3UUZA 4E7RG 1W3CA 5FI1B 4JL5A 3L0OA 2BD2A 1T5LA 3QXJA 4LJYA 1KK0A 5HKKA 3C41J 3GCNA 2J3EA 3Q5DA 3MOCA 2ZITA 3SQEE 3SNHA 1GDQA 3PLPA 1M7HA 1D5CA 1ELOA 2D7DA 1RIWC 3LJOA 4HLCA 3F9FA 1GI5A 1VDZA 4EFLA 4INKA 1TEXA 5EXSA 4NP6A 1BJUA 2LPRA 4Q1DA 4IHQA 3SQHE 1NY22 1HLTH 2ZRCA 1TB6H 1G5TA 2BM2A 3U98H 3CRQA 3LFUA 4Z8XA 4JLPA 4Q7MB 3ZS9A 2THFB 2H6MA 3SU0A 3BTQE 5B58C 1E4YA 3GJ6A 1M9UA 4MGYR 4JZKA 1DELA 2V7QA 2A7CA 4B1TA 2WPHS 2JIZD 3GY6A 3ZD6A 2PV9B 3TNTA 1AM4D 3IUYA 3DZ8A 1P75A 2VVUA 4I8JA 3L2OB 3A8AA 4X2YA 2EFGA 4OGYA 4FINA 4ARZA 2IW3A 5FBWB 3CNNA 3RDPA 1C5PA 1W2KH 2SNVA 1DE7H 2YOGA 5EXMA 1XP8A 3CRW1 3IQWA 3BOSA 1Q2WA 1D3TB 5DP5A 1CA8B 5IDKA 4PAQA 3PM3A 1VKJA 1O32A 3TH3H 3O47A 4RKOB 3KB2A 1D6RA 2NPIA 1ESMA 4ABHA 1XUGA 4JYBA 2DWOA 5J5CA 4D82A 1KI8A 1GMCF 3RLFA 2BVNA 5IHPA 3DFJA 3RXJA 1TF7A 3BAFA 4R8TB 2OV2A 4BFWA 1O3BA 2XNDD 1TONA 4OJKA 2BXUH 2GV7A 2QTVB 4LJ8A 2IYTA 1FQKA 1KK1A 1GHBG 5CIWA 3L3TA 5GIBA 1SOTA 2OSBA 4UXHA 1DXWA 3PTNA 5FR1A 3W3ZB 4DGJA 1GVNB 1GL6A 4GLYA 4FVBA 2RHMA 4TTPA 2GCHG 4BASA 4HGCA 2FNAA 4JKIA 3SYLA 2Y81A 1KI1A 3BEIB 3PROA 3Q7PA 2GBLC 3CO5A 3A1UA 3ETLA 4XDEA 1PLKA 3ITIA 1O2XA 4PHGA 5D3QA 3TSOA 5J4VA 1U0HC 1U98A 1ZAKA 3OU0A 5TVKA 1ZRBA 2ORIA 1D2EA 3SZRA 3SU5A 1N5IA 3ATIA 2A78A 1SLWB 3SV9A 3SJKA 2FP7B 4Y7BA 2PLFA 1AFQB 2C5LA 4LOAA 3MSXA 3GMTA 3FOZA 3SI4H 5F3WB 2NU1E 3A7YA 3LPRA 2ZJ8A 3ZH9B 2F3TA 3N5CA 4IN1A 2F43B 2F9UA 1YHNA 4ERNA 2YZ2A 2GESA 1O2TA 2XXAA 5D3MB 4CEIA 1QURH 4QHYA 1ANCA 2TBSA 2ODBA 1YPHC 3SE0A 2FSFA 1GFIA 1L4UA 1NL3A 2G77B 2GWHA 4QJ3A 1P2MA 1D3QB 3ZIAA 3NEJA 2N1BA 4EAQA 4NGAH 3U3OA 2PX3A 3DKPA 4I1UA 3QDZB 2QY9A 1ZC4A 2BLWA 1P5ZB 3PB1E 1GVLA 4NWKA 1BMMH 2HT6A 2Z3CA 4E06H 1S1MA 1N0UA 1GDNA 2PX0A 2MMCA 2ZVQX 4IW3B 5FOSA 2XSZD 4ZIRB 1VJ9U 5JLJA 4WWYA 1O5FH 3Q77A 3S69A 4M9SA 4I33A 1SGEE 1NG1A 1I2DA 3Q9LA 2TGTA 4TSFD 2H9HA 1RTKA 4MUBA 4YTAA 3DM9B 1JRSA 4URXR 3CENA 1BYIA 1T4VH 3D7MA 4GMXA 1K1LA 2AKYA 3VB4A 2W6JD 1E9CA 1KMHA 1O3OA 2Q1JA 1UKEA 3MU8A 1D6JA 4P4SB 3EA0A 1PJRA 2W2VA 2ZE6A 4O25A 4ABJA 1B0UA 4Z54A 4ZH8A 1U9IA 2F91A 1XUKA 6GCHF 3OAAD 2VNTA 1O34A 3UOUA 2ZYVX 4TYPA 1J70A 1A46H 1XPUA 3M3SA 3SV6A 4V0LA 2XBXA 1UBFA 2XXLA 4XWOA 1AKEA 1RRKA 3LX5A 2ZDKA 4FUHA 1Z6JH 1TPZA 4AKGA 4B2PA 2DUCA 1OYTH 2GJ9A 4PHFA 3VU9A 1UEIA 4NCIA 4PROA 3A4LA 4IEIA 3MH5A 4ZKNU 3AF2A 1T3HA 1QRZA 3BG4C 1J8YF 1GWNA 4R98A 5EW2H 1WE2A 1NVVR 1S0UA 2VF7A 1RZ3A 2ZAMA 4NG9H 3F3YA 1O3EA 3SGAE 3NC1C 2FZLA 1SGRE 5JWHA 2BD3A 3SHCH 1M2OB 3GLGE 4PZYA 3UANA 3QWCH 2PBRA 1CBWB 2H7VA 1O2ZA 4GL2A 1WQ1R 1SVWA 1SL3A 3SN8A 1ACBE 2OK5A 1EZQA 2FPZA 4QM6A 3Q7QA 5JRZA 4D4LA 4PC6A 1YZGA 2FX4A 3OY5U 2BX4A 1IQHA 1XD9A 4NA9H 4PXAA 3SV7A 4JJZA 1G41A 5T3HA 1PQ7A 5LD2C 2IEZA 1MTSA 4X6PA 1OWKA 3HDTA 2GHIA 1NLYA 3NH6A 3L43A 2YKGA 1TX7A 1OWHA 4A0HA 1C5ZB 1T5IA 3RVBA 1JEEA 5FPHA 1XMNB 3TNSA 2J95A 1W13U 1L8QA 2V9PA 1YKTA 1SFIA 1SULA 1RJXB 5L8VA 3RYTC 3QI2A 3GLGB 3NCLA 1F5RA 2QQ0A 1QG2A 3FWYA 1TX4B 2IXEA 4CR5A 1QTFA 2BDTA 1WTGH 4EQ6B 3KTAA 1E1QD 4AB9A 2HCBA 1L4DA 1SGFG 2VJ1A 4NKRA 4Q48A 1ZMLA 1W7XH 1THSH 4K8OA 2UUFB 2ZQ2A 5GVRA 1OWEA 1DM4B 3I73A 2NO1A 3EZ2A 4GP6A 4WA7A 3AEZA 4M9ZA 4QOSA 1WSSH 4CRFA 3QUSA 1O31A 2CVFA 3LD9A 3MNCA 2QPAA 2QM8A 4HI3A 3ASYA 1E2KA 2WV5A 5KNDA 4C7OA 1D4PB 3K9NA 2JLVA 1LHCH 3AVUA 5DP7A 1UKZA 4DLXA 2AEIH 2WWWA 2WBLC 5H1YA 3TUZC 4MRSA 4D4MA 1C9PA 2OXCA 3SJCA 4GCHF 2BHGA 1V2WT 2A2XH 3MH4A 1U8YA 1QY6A 4NA7A 2QTHA 5KU1A 5GJCA 4ZCMA 1FN8A 4A2QA 3KQUA 1E0JA 4DCVA 4P4UA 3NBFA 5DSZA 1UEJA 4JT4A 4YDSA 2Y5FA 1C1OA 1CTQA 3PLBA 4G01B 5IRCD 1L0ZA 1LO6A 4D76A 2YINC 4TMVA 3EPLA 2FFHA 2HPPH 4NCJA 1G7TA 2ZRBA 1J17T 1EX3A 2JA1A 1C5UA 2J0UB 2FH5B 1SGIB 2OQUA 5DISB 2V1UA 1ODFA 1SVSA 1NVUQ 4MDSA 2RGXA 2ZU5A 2ZRLA 1UFQA 3TVDA 4LJ7A 3CF0A 3HWSA 4LHVA 3ZDQA 4ISNA 2NQ2C 1XMJA 3CRVA 1A5IA 1COWA 4DZZA 2B21A 1C1QA 2PTCE 3T06B 5FCKA 3HPQA 2QAAA 4UNRA 2GA8A 4OHYA 4TL6A 2B9LA 4JYCA 4ISIH 1MKWH 4HFPB 2OUAA 4ZKDA 3RXQA 4Q7ZA 2W2TA 3C5HA 4TLBA 1WXRA 3ZZ0A 3MWKA 1CA0B 4ILEA 2ATVA 4V0OA 4WZ6A 3WBJA 4LBZA 4B3XA 2P0EA 1NLZA 3R9XA 1SXJA 1UAAA 3MU1A 4XWAA 1V2NT 2G00A 3BTME 1NU9A 1FMGA 1P06A 8GCHG 4GP7A 4Y11E 3HU1A 1Z6TA 2XGJA 1LVGA 3QF4A 2OLGA 2AERH 5I46H 5M04A 2J7PD 1QG4A 1L2TA 1Q44A 1OX1A 5GWZA 1ZTKA 3UREA 1QA0A 3A85A 4Q1EA 4FCVA 4GUXA 3OX7U 1O38A 5CJ2A 5AJVB 4YT6H 1EKBB 5F8TA 1W2GA 3P27A 1D3PB 2UUJB 2VB0A 1W7AA 3U7HB 2ZHQH 2O8DB 2XB2A 2VIDA 3GJ0A 2I1VB 4A8JB 1PYTC 2FLRH 1IHSH 1W0JD 2A5JA 4LJ6A 4DT1A 4MDEA 1YLCA 3QZRA 3FPAA 3LDXH 1HAIH 1SHHB 3F9GA 4IDOA 2E1RA 3ADKA 2WUBA 3DHWC 2A2QH 4RJLA 2AN9A 1BB0B 4YDHB 1NRRH 3GFPA 4Q4AA 2REOA 4BLSA 2P5TB 4M1KA 2GDDA 3B6EA 4OS1A 2OBQA 2GD4B 3IPXA 1TADA 3B9PA 1ZW6A 4Q4LA 2GXAA 3M7UA 1NRQH 2QF0A 4PANA 1JALA 3VFEA 1KXAA 4MQAA 1Q57A 2WMOB 3TAHA 4TTRA 1OS8A 4NA8A 1Z08A 1SB1H 2FTMA 1P3JA 2HWLB 2BHRA 1NFUA 4NIYA 1MD7A 1ZYUA 2QMUA 1DWCH 5JI3E 4A0GA 2ZUBA 2BBWA 2VSOA 4XD7D 1QDEA 1CJMA 1O2GH 2ZG0H 3EE0B 1B23P 4DVGA 1S5SA 1R10A 2C8ZB 1CO7E 2QC2A 2C03A 1H8EA 3I77A 1C5QA 2VP4A 4E03A 4AKHA 4XTRA 1EJAA 6LPRA 1TNIA 4ZROA 1F0UA 1GJ4H 1AKYA 3SFVA 3SNCA 3PWCA 1QR3E 1XJQA 1C2JA 1HAVB 2JETC 3MYWA 1JAHA 3TITA 3M5OA 2OHFA 1GJ8B 2DWQA 4ABGA 2VIWA 2XCNA 3U4QA 3BBPA 2GDJA 1C1UH 4V0MA 3EWAA 3N2EA 1GMHG 3PV4A 1IQPA 4CEHA 4ZCIA 1DLEA 4I8HA 4QJ4A 4DDVA 3I29A 1P2QA 4LK4A 4DDTA 3CH5A 1QHNA 1XU4A 3TJNA 8ESTE 2OXRA 4MTBA 4KGAA 4TYDA 2HJVA 4S2EA 1SQOA 2FU5C 1FY5A 4AOQA 3GDUA 1IONA 4PR0A 4X1QU 3LONA 3ZYEA 2BM1A 4BEJA 3MLEA 4MYCA 4BWYA 1XXHE 4MG3A 1EOLA 2ZAOA 2C4FH 3AKDA 1XKAC 2ZREA 1RIFA 3QKSB 3D6TB 4IS5A 4QFMA 4AFZA 1TOMH 1ANBA 5J4SA 1P2SA 4HB0A 1ZSKA 3KXKA 4RKEA 1IQMA 3WP0A 2FODA 1VYVA 1NP6A 5AVDA 1O3FA 3A88A 5BQ5A 1UK4A 1G20E 4FCTA 2Z7FE 4RKFA 1O3CA 2XNSA 2BDGA 1N6LA 3UXMA 4M1WA 1FTSA 1UCYK 1XCPA 4C0JA 3A8TA 3LW7A 5DO9A 4R7ZA 3IWMA 3D31A 1G37A 1ZRKA 4E7NA 1YC0A 1E2MA 2QAGC 2GV6A 1AK2A 3GJ3A 3NKKA 4OS5A 1SVLA 3DO6A 2FPMA 1GVKB 2ZYUX 3IHWA 1KI3A 2A4QA 2B8TA 3STJA 2HLCA 1HGTH 1MTUA 1E2PA 2RGEA 3K53A 2JLUA 2P94A 2NIPA 1BS1A 1UKYA 1HFDA 4B48A 4JBWA 4OQNA 1P3CA 2PSXA 4JSYA 2Y7ZA 3VB3A 1NRNH 1TBZH 3LX8A 4CH2B 1QB1A 2JDIA 1WBBA 2B7DH
chains in the Genus database with same CATH superfamily
2FLKA 1Q1AA 4M8LA 3A81A 5JROA 3E81A 3TTYA 4NNJA 5FPTA 1AS2A 1U3CA 4HUQA 4CFSA 3O4IA 1S7CA 1KGDA 4GGOA 4TYWA 3EXIB 4D41A 4EFDA 4WINA 1JAYA 3HB4X 4TKMA 4OH7A 3PFBA 3KAQA 3KLMX 3TJZA 2DYKA 2G9QA 1LEHA 1I1QB 4I1YA 3WKDA 2CB9A 3T6KA 1C29B 1XRMA 1QL8A 3RAJA 3S2IA 3MH6A 3WYDA 1U2QA 3MFQA 1Z07A 2Q8PA 4RZHA 3PTBA 2FRDA 4FW9A 2ROQA 3BXZA 2NXNA 5A5GA 1HDRA 4A2CA 4DMGA 2WAYA 4R7GA 1SCKA 2RHTA 5IAEA 3IUPA 1JL3A 2QGZA 4F85A 1HZZA 4BANB 4INPA 2OV4A 2BKAA 3AJ8A 3MN1A 4FQ8A 5HW0A 1JQJC 3NHLA 2FQ1A 1W5FA 5ARDA 3ZVBA 4WNYA 1YP9A 2O0KA 2GVFA 1TZJA 2QXJA 2ZI5A 1Y48E 4HDMA 1LGYA 1TCCA 3K4QA 1E1KA 2WILA 1TA9A 2VK1A 1FSPA 2HT1A 3IBCA 4HFRA 3C1KA 4U2CA 4PNHA 4TT3D 3U4GA 3MS4A 4P54A 1ZLXA 3I3OA 4U6NA 3U1IB 1D3AA 4NEGA 2XVAA 1GRQA 5BMOA 5ADVA 2GN8A 1N0IA 2ZDVH 1RRGA 2PV7A 1OF1A 4NDAA 2HCTA 2QXYA 4CEJA 1DLJA 3OURA 4LJ5A 5ENVA 1QHIA 4FUTA 3JD1A 2A4RA 1Z39A 2HWKA 2EARA 3QEBZ 3OEED 2B34A 2L2QA 1UJMA 4ES6A 1G0OA 4ZRDA 1XZEA 1AVXA 4U0KA 3WL5A 2LCQA 1CF2O 2PGQB 1HAZB 3JZ1B 2BFOA 4GI3A 1A77A 4QYWA 2DETA 1QVWA 2UWPA 2Z8XA 4ABTA 4PIMA 2ZECA 2HHJA 3PEYA 1T2VA 5IVPA 1JDBB 2PZ8A 1O3YA 2N46A 5TQ0A 2Y2VA 3BM5A 4MI9A 3DVSX 1DBSA 1WOYA 3W8EA 1TWXB 1Z4PX 4IX9A 3BHIA 4QU0A 2P9EA 3MT8A 1DG9A 4ITRC 5CA0B 2C4NA 5FTNA 3RU4E 3VU0A 3OX2A 2Y1CA 3GHHA 3FSEA 2VPQA 4WFJA 3RI3A 3I4LA 3MUOA 2RH4A 1YNOA 3RC9A 3RLIA 3WLRA 1AOXA 1NYTA 4BRUA 3TINA 4DPKA 4Q05A 1HIAA 1RBMA 1XP5A 1G3BA 1M9NA 3K2BA 1XTTA 2QYTA 4AWXA 1QV6A 5FJJA 1E58A 1U8TA 1JJFA 5FF9A 2AFQB 1UH5A 3MJHA 4HDAA 4PV7A 4GPIB 2WM9B 3JPYA 2NPFA 1P8AA 3S2UA 1PR0A 5T3YA 4RV9A 4BP8A 2N3ZA 2ZSFA 2WM2A 3ABSB 1V2UT 3H42B 2FPIA 3O74A 2AMVA 3E0PB 3NNNA 1AUTC 4Z5XA 4EJSB 2SFAA 1ZUIA 1XAJA 1FX0B 3G5UA 3T3DA 1E3JA 1EB8A 4G24A 1VECA 5DM2A 3ELAH 3P8ZA 4E2FA 1WBDA 1DBRA 2P9GA 2ASVA 1TZCA 5ADUS 2G0NA 3NTRA 2O3JA 2ZUUA 2HNTF 5KZMB 3AUJB 2F3QA 3VC2A 4D57A 3E2PA 3LDAA 5DWQA 3MTYA 3FP7E 3RH0A 4MDHA 4RM3A 4LVOA 1U5CA 3QV1A 2NO9A 1T9AA 3BFPA 5BWLA 1VPEA 3MNBA 3O2QB 1XD8A 1G5PA 1UKAA 3SJBA 3KPJA 1AVWA 1M54A 2PUAA 1RYDA 1J1ZA 4OYHA 4TKVA 4PM4A 3M1LA 1HC7A 5HCIA 3GD7A 1BVUA 3CZAA 3SVZA 1TKRA 1MC8A 3DFUA 4F11A 5FHTA 2IQ5A 4J1TA 1G291 2Y5HA 5DIZA 4MPRA 4RCZA 3ODFA 2H5LA 4POOA 1X86B 1UJBA 4KN9S 2MSDB 3GEPA 3R3GB 1O6BA 1R8XA