3O8BA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
total genus 219
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8bA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8bA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA03
1BIOA 1XU4A 1G3EA 4LHYA 3RS3A 2Q21A 1H8ED 4HLCA 2PX0A 5CM8B 3WY8A 4IC6A 4I4LA 1UK2A 2FOAA 4FN5A 2FZLA 5AFZH 4K8OA 3RRNA 3AAVA 2FLBH 2K1QA 1D2EA 2ZIAA 1B7XB 1Z6TA 1UTNA 2W3IA 4G5QA 2W2TA 4E7RG 1A1RA 1Z0DA 5FTLA 1YPLH 3B1VA 2GV6A 2FOHA 1KMQA 3CF6R 2ERYA 3EZ9A 3TRFA 4HUQB 4K69A 2FPKA 2LWIA 3U44A 5HKKD 4LHWA 4I1SA 3A4NA 5PTPA 3HPTB 1Z1IA 1UCYH 2QA5A 3T28A 4CVNA 4UQOA 1EFHA 4XD7D 1NVWQ 2J87A 1G8FA 3H0KA 1D4PB 1LCYA 1T4UH 1YBWA 3BN9A 4TL8A 3EE0B 1KZGB 2H5EA 1ZM9A 1KSGA 3PMHB 2ZCKP 4DJZB 3T61A 1K22H 1JBKA 2JJ2A 1I4TD 2XNIA 3PROA 1OB5A 1RJ9B 1CJMA 1W36D 2GXAA 4MRNA 2ZSBA 4M8NE 1TX8A 3LX8A 1Q44A 1MQ6A 1PPBH 2RHMA 5DHAA 4GL2A 3C41J 4JZFH 1GSIA 2W2VA 2PV9B 3KUDA 4YTAA 1GITA 4OBEA 4DUGD 1QB6A 2P0EA 1CA0C 3A83A 2OC7A 2Q3FA 4LJAA 3I62A 4D4LA 2ASEA 1P62B 3AEZA 4JLKA 5L3RA 4GP6A 2GMTC 1TONA 1ZMJA 2F3RA 2A7JA 1IY0A 4R9UC 3B9PA 4PC7A 1U94A 2ZGXH 3TQCA 4MYCA 1TADA 3A4MA 3QF4A 1RIWC 1W0YH 2XBXA 1U0JA 2NG1A 1ANEA 121PA 2YC2C 4PC3A 5EQQA 3LA6A 1TNLA 3OF5A 1MZAA 1UTKA 2AR7A 3ZZ5A 2NWNA 1KO8A 4TLAA 2BC9A 3QXJA 3ZZCA 3ZYEA 1D6RA 1YGCH 4US2R 2SGQE 3BTME 2REXB 3EPJA 2QSZA 2W7SA 1U8AA 4UNQA 4I8KA 3Q76A 2VVVA 2PKAB 2ZUCA 2F9PA 2RKOA 4IOKA 2PEZA 1UM8A 1XMJA 4B3BA 3P4YA 4CBOA 2R6AA 1SVMA 3VB3A 4U30A 1GBTA 1B23P 3IEUA 4WIAA 1FZZA 5M04A 1GMDF 2XZLA 4NCJA 1ZTKA 3BH6A 2VH0A 2N1BA 1E2PA 1J16A 1TIOA 5JDUB 2I6QA 4AFZA 2QQ0A 4JLVA 2ZU2A 5CIQA 1CHGA 1L0ZA 1IY2A 1YPEH 4AC9A 2JJ2D 3HKIB 2HOBA 2OLGA 2BD9A 2EYQA 2GVDC 4B2PA 3D6TB 2IS2A 4ON9A 4LWZA 1G3QA 2R3UA 1TUIA 1VHTA 2WWXA 3VR4A 1PJRA 1VCPA 4AK9A 4BGDA 4GOJA 1Q1ZA 3BXZA 2EFCB 4I1VA 3RC8A 1PPFE 2RDLA 3NDPA 2CF8H 2FS9A 3HPQA 5EUMA 1KSNA 3DMDA 1BTWA 1UTQA 1YCPH 3SU6A 1DWBH 2ZDKA 3Q3YA 4DLWA 1KAGA 1T8TA 1Z8RA 2W5EA 2F3TA 4EJSC 3EXAA 2V9PA 4HDCA 1GL0E 3QBVA 4MKFA 1UVUH 3QE0A 1GI6A 3R7WA 2ZANA 2AMQA 4FVBA 1BB0B 1GI2A 1IAUA 3KB1A 2A0QB 4QNRA 1FI8A 1E0FD 1H4WA 1FL9A 1A2BA 2J46A 4X8VH 1AN1E 1BZXE 1EAWA 4RFSB 1RVDA 3GLIB 4BE7B 3GJ0A 1V2MT 1DAIA 4XJXA 3A36A 1M7HA 4D76A 4E03A 2GBLC 1TNIA 1JR3A 4AORA 4DLRA 4JSYA 5K7RA 2CHAC 1K9OE 4R0IA 4MYHA 3RHFA 1Q2WA 1BRBE 5JECA 1O30A 3SZRA 5CJ2A 4XVUA 1N0WA 2O8LA 5TB5A 5SGAE 3P32A 2HLDA 2XC4A 2JEOA 3RMMH 4B2BA 3WNCA 2OHFA 2PJZA 1TQ6A 1CT4E 1YZTA 5SZJA 3CZQA 4GPTA 1Z7KA 1OH8A 4Q19A 4URVR 1IOEA 5LPFA 5C18A 2GZ9A 1A0JA 4QM6A 4BTTB 1OXVA 5G53C 1YPKH 1SVPA 2BCJQ 4DSUA 1GKUB 1G64A 3LGVA 1U0HC 1O3JA 1ZW6A 4GSYA 5DISB 3GEIA 3ETLA 3GLFB 3CPHA 2ZETA 2ODYB 5EU8A 2FX4A 3AKEA 2SGAA 4K46A 1IQJA 4BFWA 2XX3A 4BAHB 1KIGH 3LQRA 4PO9A 4AFSA 1OPHB 1PPZA 4GNKA 5LDDC 4QC2A 4K1SA 1K1JA 4Q47A 4DJTA 1AKYA 3PMBB 1CR0A 3SU5A 3AGQA 2FEQH 4FUHA 4MKGA 4YXWD 2X19A 4TPYA 2KJQA 1GMHF 1W5SA 2ZPRA 4E07A 2X1VA 3K0EA 3OU0A 3BB3A 1ELTA 3BTGE 2H16A 5JWOA 1HXFH 3PMAB 1MO5A 4HB2A 2FPMA 3VFEA 4AY2A 3RLFA 1C5VA 4BANB 1GDDA 4WH8A 4DLXA 1ACBE 4NH0A 4HTCH 3ZVFA 2PCJA 1IQNA 1MO3A 2QM7A 2ORVA 5HCNA 5JFGA 1RYHA 1ZU5A 5FBRB 1S3GA 2R0LA 2BD3A 4RD3A 1OH7A 5FX5A 1S85A 4B33A 3BSQA 3C4JA 1RKBA 1M9UA 1YVDA 5BPEA 4GBMA 1W0JA 2C5LA 1SQ5A 1AZZA 2A2ZA 2QC2A 4IXNA 3BTKE 4QBFA 2HJVA 1FMJA 5DN6A 1WTGH 2RGNA 4LZ4B 4E22A 1OXXK 1XUIA 2ULLA 4D7FA 2P3SA 1U0LA 4FMCB 2J0QA 2WSMA 2XTTB 4LHXA 4PO8A 3R9WA 2KI5A 4NFEA 3QY0A 4V0LA 1N6HA 4FU7A 221PA 1SHKA 4IW4E 3U44B 2BXTH 1OWJA 1C1OA 4XSHA 1PPHE 2EU8A 4ZCMA 3OX7U 3E8LA 2Z4RA 4JT2A 4GZMA 4DB4A 5FL7D 3LD9A 4YMWA 2Q6FA 1RGQA 3U6KA 1EAXA 1YC0A 1EFUA 3RC3A 2GVFA 3GJ3A 3QGNB 2LKDA 4HSEA 3LONA 1EPTC 1BTZA 1MT0A 5FOSA 1J14A 1EK0A 1MZDA 3D7MA 1ZD1A 3TUIC 1G17A 2ZI9A 3SC3A 4C30A 1C2MA 1P7CA 1L2EA 2ZAMA 2OSBA 3M37A 2ORIA 1KXCA 3U5ZB 4MVNA 1H9HE 4D4KA 4B6FA 1F2SE 4SGBE 2I4IA 2IYXA 4JVNA 3ZYCA 1UO6A 3ZIAA 1C5XB 1H8DH 4TTPA 2EWWA 1JPJA 3FVQA 4K8YA 2FSFA 2O0KA 1MTUA 3MOCA 2Z0MA 1YPHE 1W7XH 2Z9IA 1E2NA 3RC5A 1O31A 2J92A 1TMKA 3TAHA 4OK5A 4QOSA 2WMOB 1JAHA 4NYJR 5A8ZA 1JQLB 3QF4B 1DARA 4PC1A 4PFSA 1QJ6B 3UWKA 3TVDA 1GVLA 4I1UA 1W0JD 1C5RA 1ZM4A 4F93B 4I33A 5DP9A 1HXEH 5FTMA 2AFQB 2F9VA 1KTVA 1KK1A 1ZIOA 1QVRA 4FIDA 1SVSA 1NBMD 2JETC 4PQRA 3RLYH 4U5XA 1IQGA 2WSSD 3VB7A 1W7AA 2B7CA 3SS8A 4CRFA 3QGJA 3T27A 3LRPA 4YDSA 1SGFA 5GJVC 2FYQA 1GBMA 3VGCB 2ZRHA 4MYTA 1W49A 5FPTA 1ZHPA 2QBYB 4KTCA 2F6RA 2C99A 3SHCH 4ZHLU 2GRJA 4Q03A 4ZV4A 1KI3A 2IF2A 3V12A 3F5FA 1MTSA 2P59A 4TL6A 2GILA 2XSZD 2P95A 3GICB 1FNMA 1Y63A 1OW3B 4V02A 1Z63A 5JJKA 1E38B 2O9QA 1O2JA 1PPGE 2WM9B 1WXRA 1ZLRA 1QJ1B 5JI2E 2VA8A 4D9RA 3W95A 1P9WA 5C1UA 1EQ9A 3RRMA 4PAQA 2JASA 3P70B 3DZ8A 1P11E 2QXIA 3DEFA 5KSZA 5JBQA 2QMEA 3EW9A 2HXYA 4HB4A 4P4UA 3EA7A 5JLJA 3ZIAD 1N6XA 3ZVLA 3ZVRA 2STBE 3QBTA 1P2IA 2I1QA 3TIFA 3X1ZA 1VJAU 1GHAG 4B3DA 1K28D 1OF1A 1QL9A 1O39A 3VB4A 4F38A 4Y7AA 1BOFA 2QUZA 2QGRA 1LTOA 3RXEA 1A5IA 3W6NA 1G18A 2GDDA 3LOXA 4PC6A 1O32A 1A0LA 1DBSA 4W9MC 1KK0A 1Y5UT 1GBIA 2AN9A 2ZHQH 4DG4A 3AB3A 4INKA 1M1YE 4A1VA 2GNOA 1C5OH 4JL6A 5A09A 4TMKA 2J4IA 3Q7PA 1EWRA 5IHPA 2C04A 4INLA 1C5PA 2BLVA 2H9HA 1MTNC 2E87A 3QXCA 3NEYA 4AKGA 1ANCA 3BAFA 2R6GA 4OHYA 2C3SA 3I5YA 2BHGA 2VHCA 4OK6A 4PSKA 4ZDIA 4RKEA 4JYBA 1PLKA 4IDQA 2XC0A 1TB6H 2EFGA 3OIUA 1NU7B 1F0RA 3BV9B 3F8TA 2GJKA 3M3TA 1E6CA 3RC6A 3CS0A 2IYRA 2JDIA 4DRZA 5GJCA 3KFVA 2B92A 3WMFA 3NBZC 3PV0A 2CCGA 1AM4D 2A7CA 4Z8YA 5DP3A 4QGFA 2VSOA 2FOEA 2FE4A 4XTCS 2XBVA 3GLGA 1NL3A 3AH8A 3N7OA 1BYIA 3TUZC 3E90B 2ZXUA 4YMTA 5EE3A 4KFUA 4FXGH 1O3AA 1QNJA 1N8OB 3AVWA 4CRWB 3R8FA 4JL8A 1WMSA 1GM5A 1NTPA 3SBKA 3RS4A 3SE0A 1R0YA 4XWOA 2ZR7A 2ZQ1A 4Q4HB 4WZBE 3AVPA 1ZMNA 1ANDA 3KX2A 1QIXB 3MWIU 1JOUB 2ZGBH 4KFTA 3THYA 1O2OA 1LS6A 5JBBS 2O0HA 1Y5BT 4Q9LA 4OHZA 5FTNA 3HR8A 1UCYK 4DIDA 2GD4B 1NG1A 3V9PA 4ESVA 1GVKB 3KTAA 1EP6A 1OSSA 2QAAA 3U1IB 2ILNA 2YKGA 2LCFA 3RNLA 4WH6A 3Q8XB 4AN7A 3PEVA 3P26A 3TW4A 2BY9X 1E9BA 2VL7A 1AA9A 2AFHE 3K9NA 3QX5H 2V1XA 1VCWA 3KQUA 2PFEA 1HYLA 2QA9E 4LJ8A 2BLWA 3QZRA 1JIRA 3QNUA 3QQ5A 4FVDA 4DLVA 4H9GA 1AS0A 1GG2A 2NU4E 1WE2A 1G5RA 1OFTA 3NKVA 1E9RA 1NVVQ 1IXSB 2DWOA 1SI5H 5GNDA 1QHSA 3KQNA 3N5CA 3WHLA 4EFMA 5EXMA 4ESHA 3SGQE 2H17A 3ZVBA 5HYOA 2ZS7A 5HXFA 1BTUA 2GCNA 1FX0A 5TARA 3BTHE 2FOFA 4WA7A 1ZMLA 4DIIH 2QI9C 1Z6JH 4ESTE 2ZO3H 2JDID 3X1DA 2ZFQH 4IOJA 4JZKA 2G00A 2BEKA 1OE0A 5H8WA 3NUMA 2PCLA 3K0FA 3W6PA 1S6FA 1GMCG 1G16A 1Z8GA 3QK1A 1AD8H 3RMOH 4FUJA 3UREA 2YHSA 5C1YA 3K0AB 1P2JA 2ZPSA 4B48A 1CF4A 4C0KA 1O2MA 3LGTA 4NIWA 1AK2A 4IDHA 1QQ4A 2IEYA 4UJ5A 3PUVA 1X1SA 3RXSA 1LVGA 4JCNA 3SNEA 2GKSA 5E7IA 4D9QA 1XTQA 2ECKA 2YWFA 2ZRAA 1VITG 3M36A 3LVRE 1ZPZA 5CJPA 1JALA 4TN1A 1QBNA 5KSOA 1C1SA 3NHAA 2QP9X 1DITH 2V54A 1FLEE 2ZRIA 2V0BA 2HCJB 1KNXA 5ELXA 1T32A 1N5LA 5L3QB 4ASUA 1W4BA 1XD9A 2D2FA 1J90A 2FSHA 4OK3A 4P4TA 3UMSA 1TAWA 2QSYA 2ZTYA 1CA8B 2J0SA 1EESA 5HMAA 2FJUA 3EX7C 4LZZA 1YE8A 3BG8A 3BE4A 4PC2A 2KWIA 4Q4AA 1ZCAA 1T6NA 3QXSA 4R71A 5FI1B 2SGPE 3B6EA 2QXHA 4RN6A 4KODA 3QJYA 1OKKD 4G5RA 4URXR 2O8EA 1AFEH 2O8TA 5EP3A 4TYQA 1GL9B 4FXPA 4EPTA 4B73A 2JJ1D 4GOXA 1MBQA 3AVZA 1LTQA 1YJ5A 3PITA 3A6PC 4X1PU 2JATA 1TNHA 3BB4A 2CCKA 1PJPA 2AD1A 5JS7A 1RJXB 4EDHA 1L1GA 3A1TA 2HALA 1E3MA 2ZM5A 2O0JA 2F9UA 1YCPK 5HPYB 1TNDA 1MU8B 5DNYB 3TH3H 2V1UA 4DIEA 2Q3MA 2BV3A 1O2IA 3KJEA 4JMYA 1C5LH 3ODFA 1JAIA 2J94A 1E69A 1Q1EA 3V0XA 1VR1H 4BECA 1L7VC 4MPUA 2RGEA 4A7IB 1GJDB 2BDBA 1CXZA 4HZIA 4Y79A 4EPYA 3BBPA 1OYYA 1E2JA 1OB2A 2FS8A 1XB2A 1TGTA 4I7YH 3SR0A 1SXJB 2ZI2H 5A0BA 4LHVA 3VX3A 1O37A 3PB1E 1KZ7B 4ERNA 5JCPA 1ZHRA 4DW2U 1Y5AT 1MMJN 1YLCA 2CE2X 1XJ0A 3I1FA 3ATIA 3EAJA 3KJGA 3UQVA 1NC6A 1ZUHA 1LPZB 4MQBA 2W83A 2GEVA 2QT1A 4D0GA 2Z7FE 2IYTA 3QKSB 4ASUD 2F7SA 1SGPE 4ZKSU 4L9SA 5L2YH 4HLQB 5AVDA 4LYFA 1XMSA 3A88A 4YM9A 4LPKA 1DUAA 8ESTE 3RXAA 1TPZA 2OTVA 1Z6AA 2YZ2A 3KQLA 1EJMA 5HTKA 4V0ME 1G6HA 3WBJA 1WBBA 2UWPA 3UPEA 3EPHA 4K2YA 3THOA 1BHXF 5F03A 1F48A 1NS3A 3AVOA 1Q0UA 3LBHA 1V5WA 5BYJA 2OFXA 1GP2A 3N2IA 4AGJA 1RTLA 3TIUA 5BYKA 1XCGB 1Q31A 2ZRCA 4N0DA 1GL7A 5DO4H 2B7DH 2ZFRH 4MPWA 2AFIE 4IDPA 2J2UA 2OO7A 1DAMA 3U9AH 4DCSA 2A4RA 3FMOB 1W0KA 1ZPBA 4YOIA 1DPFA 4OJKA 4IGDA 2VPPA 2IJD1 4WMFA 2BM1A 4EAQA 3DZDA 5KU1A 2QEQA 2QG6A 4TY6A 4DC9A 4ZAEA 2FOGA 5LPNA 5GPIB 1YPJH 3PUWA 2A7HA 3FP7E 3M61U 3UWJH 3ZV9A 1WA5A 2ZJOA 5GJBA 5EW2H 3ZH9B 1B0EA 1RXPA 1HE1C 1S0UA 4XDEA 1TABE 2W3KA 1A4WH 2ZVQX 4O3TA 4UJ3A 2ZJBA 1ZRBA 1Q21A 3SJIA 3TJNA 2Q6TA 2HNTE 2IT1A 3KEEA 1MUEB 3WY9A 3DO6A 4QJ3A 2GBLA 1UEJA 1Z0KA 1OV4A 4LJ6A 2CJWA 2A2XH 1Q1QA 1HAZB 3B9FH 3WNDA 2FMJA 4CRGA 1GI5A 1BMFA 1NJFA 2QAGC 5DI9A 3JVVA 4A1TA 3DMNA 3GLFE 4J1YA 2XB4A 2PLFA 1HCGA 3UFAA 2GKVE 2ZHWH 3A80A 5EXSA 4A5TS 2C8VA 1BBRE 1G7CA 3BIFA 2VIOA 3AVQA 2GCHF 1IBRA 2RCNA 4H6TA 1AY6H 2J7PA 4DSNA 2VH6A 1Q3TA 2HNTC 4TLDA 4ZDJA 2W7UA 1CEEA 3IGFA 3BIVH 3SYLA 4AWXA 1GGDC 4C7OA 3AAUA 3ZVDA 1C5YB 2ZE6A 1ZYOA 1XUGA 1CHOF 2F9LA 3UUZA 4HAXA 3CH4B 2A5JA 5CDFE 5SZHB 1V2JT 2GT8A 1RFNA 1NRSH 4UNPA 2BD7A 3SI7A 4ZXXH 2P5TB 1KI8A 5A5GA 4CYMA 2OLKA 4AX9H 5ESTE 4ZDKA 1NY5A 3EZ7A 1GVNB 4WF8A 3URDA 3G82C 1W0KD 4GZLA 4UE7H 2BX4A 4R8TB 3DUXH 3TNSA 3UR9A 2ZSEA 5FOVA 1LHCH 3RWMB 2TMKA 1O3YA 2ODWA 1O33A 2IEZA 5ABWA 2Q0HA 3ZZAA 1Z08A 6CHAC 1N6LA 1SBWA 1XZPA 1XPRA 2JH0D 2P5SA 3CNNA 3K0CA 2SGEE 1HLTH 4QXAA 2XGJA 5LD2C 4FMDF 2YJTD 4RD1A 1NLFA 3OIYA 3L2OB 2ZQ2A 3E16B 2OESA 2WBLC 3M5MA 3VKWA 1W0ZU 4LYHA 2FF7A 3URCA 5K8IA 4QM7A 5DP6A 8LPRA 2HV8A 1TFXA 2P6UA 4PAOA 2E9SA 3B82A 2PLRA 3AW0A 1FX0B 1NIPA 2GXQA 3LFUA 2NU0E 5EP2A 1BMFD 4WXIA 2ZSFA 4ZXYH 3WXMA 5TDHA 2R6FA 1UDWA 2GTPA 1DLKB 5JS8A 2OCBA 2Z3CA 1ZMXA 1XM1A 1T3SA 4X8UH 3VR6A 3BFVA 1KLTA 3U2QA 2FGKA 2C96A 3AASA 3K0FB 2ZYVX 3SJZA 2F1JA 4A8JC 1TPOA 2OAP1 3BEUA 3RS7A 1ZGIA 4Q4JB 1LHEH 5TCCA 4F7WA 2FDAA 2J7PD 4CHAC 1V2RT 1OFHA 2AGIX 2IYVA 2AWNA 2ZHFH 1BTYA 3OTJE 1N0VC 4KELA 3SJ8A 1YKTA 4NBSA 4C0QC 1W13U 1E0AA 2PUXB 4M1TA 3SV7A 1V43A 2ZPQA 2VEDA 3SYNA 2SFAA 1AMHA 1GI9B 1YM0A 1E79A 2FZ4A 1Y3VA 2OCPA 4AG2A 2ZITA 3UK6A 1A61H 1EOJA 3ZZBA 3T1QA 2FO9A 2O8FB 5C2ZA 5DPAA 1YCPM 4X6PA 1TMBH 3LAWA 4DSTA 3PCRB 1AIXH 1TQ0B 2XTMA 1GMHG 4Q02A 1EPTA 1ZTJA 1GBKA 4M9XA 3V00A 2EQBA 2FG5A 1HB0B 3ZZTA 2P6NA 3RANA 5HZKA 1INCA 4P0TA 1OPXA 3D65E 2VHJA 5JEEA 1Y3UA 2R6CA 4F4IA 2OCVB 5FTJA 2I6SA 3FHCB 1P2TA 2GCPA 1Q12A 5KSYA 3I3SR 3UWOA 1P2QA 4YESB 2ZRKA 4JLPA 6Q21A 1KO4A 4NP6A 2UZ3A 2AS9A 3T26A 5D3QA 1QR3E 3GCGA 4IBLH 3DOFA 4HYYA 4QGGA 1GL1A 2J9NA 4SGAE 4RSPA 2BMDA 3IIMA 4ZHAA 1LQDB 4HFPB 2CN0H 2GMTB 1J8YF 4FUBA 3TW8B 5E0GA 4MGKR 4A1FA 1FAKH 3PEWA 3PVSA 1TOCB 1RIWB 3G01A 1Q57A 7KMEH 2F9BH 2YOGA 1IXRC 1P2OA 1D2NA 1FN6A 1UHBA 4YZUA 1ESTA 4GVUA 3P17H 3RU4T 3LH3A 3ITIA 2XZOA 5F9FA 5E7JA 3VEQB 4CRCA 3I77A 3UATA 2FV8A 4PZYA 3K9HA 1KO7A 2H1LA 3ATKA 1GL6A 2EI7A 2G5NA 1BYUA 2MSEB 3GJ4A 1E79D 1A5GH 2MMGA 1MKXH 3EPLA 4U7DA 4P4SA 2EWVA 3SQWA 1DVRA 1LW7A 2GCTB 1U6QA 5DP5A 2H5CA 2HT1A 3TAUA 1MO6A 2Z83A 4JYCA 5JYIA 4GT1A 2RGDA 3CO5A 2Z9LA 1E4VA 4MRSA 4AFUA 1WQSA 1W1WA 3I78A 4A0GA 2QN6A 2O52A 3F9GA 3VU9B 5H4IB 3HR7A 2G9NA 3KHVA 3R20A 3MO9A 2IYWA 1G8YA 6GCHG 2G5VA 3VQTA 2FI5E 2CNWA 1A7SA 2B8TA 3LLUA 5SZKB 3ZJYA 1K1IA 4KYUA 3GLHB 3UIEA 2RG3A 4TLCA 1TEVA 1UTJA 2XRCA 1DAFA 3RRYA 4UKDA 1AHTH 4HGCA 1KXDA 2X2FA 1Z6GA 2ZU0C 3NC0C 3U7EB 1HUTH 4HATA 4MDEA 2ZJYA 2C93B 4EJSB 4DURA 2QYIA 3MG9A 4NPHA 1X1RA 2XB2A 1GILA 4RCYA 3NWJA 2ANCA 5FOTA 4HLDA 1HGTH 4C4PA 2F43A 1O2UA 1EZUC 4JJKA 5TVKA 1O5BB 3AVXA 1A0HB 2WPJS 1A82A 1XVOA 4XOIA 1AWHB 2YV5A 2NTYC 4A82A 4ZMAH 5DSZA 2KE5A 1XJCA 3S1AA 4NYMQ 1TA2A 1ZM7A 4GOKA 3CH5A 6LPRA 2Q3HA 3ZD6A 3PTNA 4GRAA 1YLDA 2C8YB 4ISHH 1XF9A 1KMHA 3P6ZB 1EX6A 4B3GA 1F6BA 1IQIA 1MABA 1NU9A 2YOFA 3SV9A 4H1VA 3SN6A 2D7DA 1WSSH 3QIAA 1S1CA 3H1TA 2BOVA 4A6PA 4LJ9A 2A7QA 2FOMB 4Q1BA 4BAKB 1O2VA 1EFCA 2QZ4A 4EUNA 3AVYA 1Z6XA 2BXUH 4C7OB 1GJBB 4EQ6A 5EXPA 4URUR 2CNWD 4RD6A 4GSOA 5FUWA 1J9CH 2FYRA 1F3OA 4XWAA 3P4XA 1Z2CA 1J7KA 1GHBG 3EDXB 4Y0YE 1W2KH 3GJXC 2ZI3A 2HF8A 3TK1A 3TU7H 5EQTA 4JLDA 2BMJA 2VIPA 2VIDA 5CM9C 3RRZA 1FUKA 3FE2A 3DKVA 4MGZR 3NPSA 3DFLA 3QN7A 2A5YB 3B1ZA 3T29A 4ITRC 5AFYH 5F8XA 3IHWA 4HEJA 1VG8A 4LYJA 5EE1A 1VG0B 2IYLD 4PZZA 1T9HA 2OQUA 3AF3A 3QTVH 3C5CA 1O2NA 4BFSA 4PANA 4DT1B 5FPSA 1T8OA 1BH2A 4DLZA 3B5JA 2VSXA 1AQYA 5JSZA 8KME2 4URWR 2C9OA 1O2TA 2NO9A 2ZRBA 1WUNH 1VITH 2G3YA 4IRUB 3KQEA 4QHTA 4MNWA 4ZKOU 1KK2A 3FMFA 1SLVB 1U98A 4M9QA 1Z71A 4PPFA 5FAHA 1BMMH 1GHYH 2BDGA 1SGDE 2SNVA 5F6MA 2YOHA 3N70A 5ESBA 3SQHE 4LDJA 2B8OH 1L4YA 2F1IA 1PYTC 4DLUA 1NT1A 1P10A 2RGCA 4DEXA 1A5TA 4C0JA 2Z9JA 5EXXA 3K0SA 2G77B 1AIPA 2QROA 3MWLA 1Z28A 3W94A 1GAJA 2ANKH 1C1UH 2Q9AA 5EUQB 2OCYC 1NRPH 1O2SA 4BRWA 3VR1A 3TVTA 5L2ZH 2D06A 4MQAA 4B47A 2ZI6A 1KXAA 4RKJB 1NRNH 1D9XA 1E2EA 4Q7YA 3QVVA 1JMOH 3PG5A 1GDUA 9LPRA 2OG2A 2REOA 5DI3B 1AN0A 2YWHA 3QPVA 3Q72A 2J34A 5KNDA 2FU5C 3LO5A 1P9SA 5JBAS 2H9TH 2YC4C 4HUQA 1Q20A 2ZDAH 3PUZA 2F83A 2G83A 1W4CA 1G291 4Q9KA 2NGRA 4JS0A 2GCOB 2WPHS 4JLAA 2FLRH 1O3IA 3AP1A 4QBHA 5AJVB 4WXRA 3QENA 1G5PA 4XSGA 4OJQA 2FESH 1PV4A 3U6BA 3RXIA 1FNIA 4A1XA 3HGPA 1EPTB 2UUKB 1C5WB 3ZLJA 1LPKB 2GAAA 3VR5A 3IQXA 4HLUA 5CYOA 3K70D 5TV2A 1S81A 1ZRHA 3NCLA 2QTHA 4B32A 5EQRA 3RXJA 4NCNA 4TMXA 1K1LA 1NF3A 2YNAA 4QT8C 3FANA 1JI0A 4G01B 2IX3A 1D8TA 5EPNA 1M6NA 4CEJA 5C3NA 2PZGA 5IF9A 3FKSA 1F7ZA 1RJ9A 2GWHA 3SI4H 2VP9A 2QPOA 1XUJA 1TBZH 1NRRH 5B6OA 3RAPR 1AJEA 5CIWA 1LKBA 1DPOA 1CGJE 2G88A 4YMSA 5DLQC 5JHHB 4GUXA 4FWTA 3QKTA 1CJKC 2P65A 2CF9H 1KI7A 2VIVA 5IDVA 4CW7A 2BQ6B 4AGKA 4M1OA 1E1RA 1SXJE 3WYAA 2H6MA 2RA3A 1S6HA 4JLNA 1D3TB 2WJIA 5J4YA 3W3AA 4NCIA 4KCGA 2UZIR 2Z9KA 1O3BA 4I8HA 3LY5A 1UHBB 2GDJA 1ELVA 2AL7A 1HURA 2J59A 4ABYA 1P9UA 4NKRA 2JETB 1MOZA 2A3RA 3TGJE 2CK3A 3C1KA 1FP6A 2Y6TA 1R0XA 1SG8B 3B1WA 3MFJA 4DDVA 1P5ZB 1T5IA 1GBFA 5EXTA 3GJ6A 3GPLA 4XBDA 3ADDA 4X1QU 4P31A 1P3CA 1KTTB 2FX3A 2VHTA 1SHYA 2AGEX 4WJG2 1G3CA 4YT7H 4NG9H 1W12U 2A32A 1R5OA 5EZ5A 3ZZ3A 3STIA 2F1RA 4B1TA 1MQ5A 2BHRA 5J4LA 2CXVA 1G4UR 4MGIR 1Z8IB 4TWZA 1UTPA 2WV5A 1CT0E 4JYUH 3RS5A 3AVVA 3CRW1 1SVOA 1QDEA 1ZNYA 4OS4A 3LXXA 5GXPA 3U4QA 1OP2A 3TGIE 3NIBA 1I2DA 2W00A 4FMBB 4ISLA 3FKSD 4Y76A 4Y0VA 2DBYA 2IC5A 1ZNWA 1J99A 3EIHA 1O3DA 1OXGA 1QHNA 3ATLA 1GTVA 4BUJA 1F0SA 1VYUA 1W10U 2BMFA 4Q1FA 2JA1A 2YINC 1DAEA 2O8MA 3B8JA 3BEIB 1EAIA 3KN2A 1UBGA 4ZHMU 3CWQA 2XCNA 2ZNKH 2QP4A 2BMEA 3GEHA 1AQ7A 3QWCH 2C98A 1SGWA 3KJHA 3CONA 2VWLA 3PXGA 5JI3E 5LB4A 1ELAA 5JMTA 3DHWC 1XP8A 1E1RD 2VIWA 3SEAA 1R7RA 1ZD9A 1ZD8A 2YNMA 4TWYA 3SUGA 2BCGY 1HJ9A 2GK7A 2PMKA 1O3GA 2IS1A 5ANRB 4AKEA 3RXUA 1QBVH 7GCHG 3SQEE 1EASA 1FMLA 4OS7A 4V0MA 3LW8A 1Z8JB 2JIZA 1VTKA 3FFBA 2PX3A 3H84A 1ZSKA 1HPGA 4RFSA 2P3FH 4XOJA 2CK3D 3AM1A 1XBTA 4A36A 1MTNB 4NA7A 4XH9B 1T0JB 2QGNA 1CULC 5CYPA 4N0EA 4RFVA 4F4CA 2Q6GA 1HT1E 3S1AB 3L8YA 3JZ2B 4JVSB 4IHQA 2A5GA 5JZVA 1W48A 1E9DA 4D80A 1BTXA 3MRSA 2R2AA 1GJ5H 1NG9A 3CZPA 1SGFG 2SNWA 3P8GA 4U02A 1KMHB 2FMXA 3BH7A 5EODA 3X1YA 1GBJA 2ZE7A 2CL6X 2N42A 1TRNA 1TYNA 2PJRA 1TGNA 5E95A 1A2KC 1VECA 3SU8A 3S9AA 3MWJA 3TR5A 3CKLA 1NPMA 3REGA 4NIYA 3HYRA 3LGUA 4X1NU 1SGRE 2PKSC 3DHKH 3GYLB 2MSCB 2Y7ZA 3OY6U 3PEYA 1FUUA 2CEAA 2ORWA 3HJNA 2Z5FA 4NDZA 1ZCBA 4K1EA 3X1WA 5CLQA 1S0RA 5KDLA 1GJ7B 3RXPA 1U2RA 4WMEA 3BJIC 4IMZA 1QBOA 3DFJA 4NA9H 2OXCA 1KDQA 4LJ5A 3MH6A 3U98H 4Y0AA 3FVFB 4OI1A 2B6HA 3PLKA 3GLFA 4OGXA 5A0AE 1C1PA 1HAHH 4WVPE 1UCYE 1NFXA 1V3XA 2XXLA 3B1XA 4JLMA 1WF3A 5JJIA 3A8DA 4GPGA 1J2JA 5AUPB 1ZSJA 4PXAA 2OCAA 1CJVC 1BKDR 3SHWA 1VG1A 3GY8A 3HU3A 1GCDA 1OFUX 4IDNA 2QF0A 3EC1A 3T1VA 2XTZA 3THXA 3W90A 1MV5A 1UKZA 3SHFA 1FZQA 2ODQA 4GP7A 4MNVA 1W36C 2WYGA 2ODEA 3JVUA 2WPIS 5TY0A 2DE9A 1UVSH 1ETRH 1T3LA 5JSZB 4E09A 2PSYA 2OC0A 3WYFA 3TLOA 1EFTA 4E05H 1CQQA 5CDFA 2AWOA 1YQTA 1HTWA 1P0SH 4DIHH 2XXAB 3GDSA 3O8BA 2CLSA 1KJWA 1LY1A 1S9DA 4L16A 3A7TA 3BERA 5LGOA 1G8HA 5GVRA 1E9AA 4HAZA 1DO2A 4V0NA 1T8LA 1DSTA 4UNNA 1YZUA 4WZAE 1BJUA 3EASA 1PQ5A 4CGZA 3SN8A 1RFLA 1ARCA 4J2YB 2QXGA 1XUFA 3ZZ7A 1MCVA 1V2UT 2GCHG 1F5RA 1N6NA 2C2HA 5CK5A 1SVIA 3LGYA 4M21A 1C2DA 5L8VA 4BFVA 3B8HA 4X2VA 1V2LT 2VP6A 4NL4H 4QFMA 4C0SA 4D2IA 3HU1A 1CHOG 5HGGA 2FODA 1D3QB 1IN8A 5K8UA 2JGNA 1X6VA 2GXSA 3E2IA 5FFMA 3I61A 3E3TA 3MH7A 1QG4A 1Y3WA 3SU2A 3RXCA 3K9XB 3G5UA 2JLQA 2DHRA 4C9BA 1BMNH 2LPRA 4X8SH 1AKSA 1MKXK 1NKTA 4NIVA 4D6PA 3VPKA 3SZNA 1DUEA 1G5TA 3O8CA 3D62A 2ZKSA 4AG1A 5HM9A 1GBBA 1CGHA 3B9QA 4YOJA 2RHDA 3X2SA 2AH4X 3FP8E 2C9CA 4DCDA 2IYUA 3PO1C 1LF5A 4JZ1A 4BLPA 1QURH 3BG4B 4ABIA 3FB4A 2VWNA 4CEJB 4Q7LA 1NMYA 1ELBA 4WZ6A 2ZGHA 1DE7H 3UG7A 1C5NH 1KK3A 2ATXA 1C1YA 2G1JA 1YRBA 1SGEE 2TGPZ 4X8HA 3A7VA 1VHLA 5HCIA 2WPLS 5HR5A 4JIMA 3K6YA 2UVQA 4NMMA 3C15C 2UUJB 1BUIA 4NZLA 5J4VA 3ZVGA 2P93A 1MAXA 3QPWA 3CM0A 4F4OC 1HAYB 3Q5DA 3NKKA 3QEOA 2CL0X 4LYAA 3WP0A 2VYFA 4ABBA 3QO6A 1GBDA 4PPNA 2VP4A 2VTKA 3T35A 1S2MA 1E2DA 3VHXA 2D4HA 3U7HB 1D6JA 5AJXA 4DT7B 1BRUP 1RIFA 1NFUA 4GCHF 1IN5A 1Z07A 2IWRA 5IRCD 5EP4A 1D5CA 4LV5B 4N3NA 4RKOB 4RD0A 1SOZA 2SHKA 1G8PA 1TRYA 1F0TA 2EEKA 2WWFA 3AGPA 821PA 2BLOA 1QBKC 2I3BA 1EX7A 4HI3A 3VGCC 1DELA 2VB0A 2X77A 1J70A 1XEWX 1SFIA 1TQDA 4I8LA 1TRMA 4OHXA 4DXAA 4IOMA 4XIGS 4KP0A 3T1TA 4MUAA 3LGIA 1OS8A 3CBQA 3RXGA 3GY7A 5L3SA 3OTPA 1Z22A 3GLHE 2QBYA 3TK6A 5T1VA 1ZM2A 1VCOA 3M5OA 5DG6A 3ADBA 3FAOA 3T06B 1UF9A 1V2OT 3QEJA 2ZCHP 1NFWA 4HAYA 1T4VH 4ZCLA 3E0NB 1O2YA 5DO9A 2WKQA 5JRZA 3DKPA 3U4QB 1ZNZA 1NZQH 3BTQE 4DB2A 1SKYE 3A4LA 2DFNA 1AO5A 2B5TB 5DYIA 5T6FA 1GHWH 2J0UB 4ZCIA 2ZR0A 3A58B 3SNHA 3RM2H 3WHKA 1ONBA 3A8BA 1UTLM 1NMZA 2H8KA 4MPXA 1ZYUA 3KKNA 1R5BA 5LBIA 2GDEH 2YNBA 4Y7BA 1LVMA 3NK8A 4I8GA 2ZRNA 3F6UH 5IDKA 2ZJ2A 1G21E 2P94A 4W5WA 2R0KA 3PFIA 1WRBA 4BZPA 2ZTSA 1C5QA 4WXPA 2WVJA 3E1XB 2V7QA 1HUQA 3CRMA 2AKAB 1E9EA 3T34A 3SOPA 3ZS9A 4NCYA 1R0WA 5J5CA 4BXWA 4LJ4A 3TPIZ 3KCGH 1H8IH 2YVUA 2JLZA 4OS1A 1XKBC 4BAQB 4PX9A 1B0FA 3MU0A 1C1MA 3EZFA 5GJWC 3WYGA 3SYJA 1L8QA 2VWMA 3OYPA 2XWBI 2NU3E 1CVWH 3LBNA 1GKIA 2HLCA 1DAGA 3F1SB 1N0UA 4UXIA 2R44A 1G3UA 4LC1A 1R0ZA 3ASYA 3IDQA 2C95A 2XAUA 2EYUA 3GCHB 2IW3A 3A1SA 2FSIA 3T1OA 2SGDE 3ZZDA 3D23A 1MKYA 2WAXA 3VTKA 3V7TA 1KY2A 2BBTA 2SGFE 4KITB 3BORA 1JXOA 4B76A 1QFKH 1T0HB 4WVFA 3AKCA 1XJQA 4TMTA 3PV4A 2FIRH 2CGAA 2RCEA 2JAQA 5G3ZA 5CE1A 2QAGB 1GDNA 4LXBH 2VIQA 1NY6A 4PR0A 1OIXA 1QHYA 3PMJA 3CRVA 2Y5HA 1GWAA 3TK9A 3TMKA 2OD3B 3FP6E 2FI4E 3DD2H 3LPRA 1F5KU 1N8OC 2BQ7B 2DY1A 2GF9A 1NRQH 2VO1A 1O5FH 2QU8A 1GGDB 3AP2A 3I73A 3SBEA 3A8AA 5A0CA 5IYTA 1UEIA 1XTIA 1AFQC 1DOJA 4FUDA 1P2NA 4HZHA 4M22A 1TLDA 2KB0A 5I25A 1SHZA 1KDQB 5TMPA 1VMAA 2BWJA 3F68H 2IN2A 1T91A 1CTQA 2H5DA 3OZXA 4Q4HA 3BS4A 3MU8A 4JKYA 4Q1AA 1NROH 2Z94A 1D3PB 1C2FA 4O97A 1PLLA 2PT5A 1TAGA 1D3DB 2V7QD 4AOQA 4UONA 3L3TA 2KAIA 1JXMA 3A82A 3THXB 1O3NA 1QVAA 3NDBB 3KKOA 4TLBA 2J3EA 6ESTA 1KLJH 4H4FA 3MU4A 3I4LA 4IEIA 1AZTA 3SU3A 1XEWY 3DDCA 4AD8A 3VHLB 3LBIA 1LO6A 1NBME 3KKPA 4Q7MB 2IYQA 4YOGA 1OP0A 1HQYE 3WMEA 1IQMA 2V3CC 4X1RU 2LNCA 3QXXA 2QGZA 2OFOA 4QBGB 3S7KB 5CITA 1TF7A 4M1MA 1ABIH 3PWCA 3RXHA 1JR3D 1FQ3A 1GRNA 3IKJA 1II8B 3V4FA 4HZUA 5CB8A 2F1HA 3EA0A 4CEIB 3EC2A 2ZDVH 1EP5A 2A2QH 1E2FA 4KI0A 4O0MA 3RXLA 2HDNB 4OS6A 1JEDA 2Y82A 5K8LA 1ESNA 1DG1G 2QENA 1U9IA 1WBGB 1FY1A 1ZZZA 2D7CA 3KL4A 1UJ1A 4Q4LA 1G41A 2HLDD 1TPAE 2TGDA 2ZFSA 3TSZA 4MRVA 2RGNC 1LVBA 3BTDE 2V35A 4NZYA 1LQEA 3C16C 4A8JB 1JRSA 2CVHA 5AUOB 4EPWA 4CHAB 721PA 2ZI4A 4AG5A 2OC8A 1VYVA 1N6OA 4OGYA 3OAAA 1AVXA 3K0AA 1C1TA 5AWFC 3Q5EA 4B3CA 1IQKA 2BMGB 1LFDB 4A2WA 1XDBA 2BM2A 3GFOA 1UJ2A 1O2QA 3Q85A 3RABA 2Z9GA 3HU2A 2GV7A 4MKIA 3ECCA 3IQWA 2R3YA 4HB0A 2PBRA 4M1KA 2VQSA 4FMCF 1AKSB 4AKIA 1P02A 3ZZ6A 2ZCLP 2DWPA 4A0FA 4AIIA 1CKEA 1KY9A 1C5UA 3GY6A 4AKHA 4KGAA 1DTSA 2PW8H 5L3QA 3CW2A 4DDWA 5B58C 1TUEA 3RWOA 1ZNXA 1QF9A 4HAWA 1SLWB 1LPGB 3U7FB 1IHUA 4TLEA 1ID5H 3QVUA 4TQ9A 4TT3A 1CT2E 3ONWA 5FBVB 3IILA 1UAAA 1O35A 1WCZA 4DLYA 6GCHF 2A31A 2NPIA 3SUFA 2HYDA 5DKMA 3MD0A 4J0QA 1JXPA 3K09A 2ZIQH 1OWDA 1FFHA 1O2PA 2Q9CA 1RRCA 3MUFA 1FV9A 4PSAA 1NN1A 3KKQA 3RUOA 1N2CE 1XVMA 1BMLA 5JWRA 4O3UA 4PPGA 4CDGA 2Q6DA 3LKWA 4Y8XA 3MGCA 1Z29A 3H7TA 4POAA 1OH6A 4ZI3A 2BZ6H 1VKJA 5KPDA 2HPQH 3RXTA 1WTHD 4QBIA 3P95A 2D2DA 2BD2A 1IHTH 1HIAA 1HH4A 2G81E 3ZGXA 1F2TA 4B34A 3FKQA 1XKAC 5JWHA 4FW9A 5DN6D 2WJJA 1SGCA 1AVWA 2V6JA 1QTFA 1G20E 2D1JA 3RXQA 3OAAD 3HWSA 2QMOA 1CRPA 1DT2A 3IIJA 3TH2H 4CRAA 3PYHA 4B3FX 4UD9H 1FUJA 1QG2A 4KFSA 2C4FH 3KQHA 4URZR 1GCTB 4OQNA 1O3FA 1N6IA 1QL7A 1L4UA 3EZ2A 3I8XA 4Y10E 1ELEE 2OXRA 1HV7A 5H68A 3PIRA 5FOXA 1M7BA 5L3SB 1SXJA 4OQFA 1AVGH 3A37A 4ZUHA 3O8DA 2CBZA 3GY5A 1DEKA 3FPAA 2FSGA 1GJ8B 3EAQA 4UXJA 3ESTA 1E2MA 1W44A 3QKSA 1XXHE 3DVLA 3HKJB 1OWHA 3RXOA 4IW3B 1M2OB 5EG4A 2VP2A 1YR6A 1CO7E 1ZIPA 4O25A 3QUSA 3LC3A 1YZLA 4C0LA 5JRJA 3ZVEA 2RB4A 2G55A 1K1OA 1WQVH 3ODDA 4TT3D 3U3KA 3MSXA 1O5CB 1WV7H 1S82A 2CXXA 1M34E 3A7YA 4OS2A 1T3HA 3TVJB 3EQ0H 1R8SA 1E36B 1YZQA 5KOYA 3CIOA 2ZDNA 3PWBA 2DYKA 3SV2H 3FGNA 3BTEE 3U3MA 1LHGH 4DSOA 1GHBF 4NU0A 2A5DA 1ORFA 4KJZA 3O8RA 3O47A 1EB1H 4URYR 1AU8A 2BDYA 1KI6B 2OC1A 1IAQA 3AV0B 421PA 3S69A 3Q3XA 2EFEB 3P92A 3EWSA 1IN4A 2ONKA 4LX0A 1O5EH 1O38A 4A0RA 3UPUA 1Q3HA 2ZUBA 1GG6B 4QJ4A 1NVUQ 2XTNA 1D9IA 1HE8B 4IN1A 4Y8YA 2C77A 4UDWH 4IFBA 4XWKA 3MMGA 3IHLA 4I99A 1HAGE 1NN6A 3DL0A 1QHRB 1UK3A 4TL7A 1BQYA 5DGJA 2VHQA 3NBFA 1HAXB 2ODBA 2Y5GA 1N5KA 2CDNA 4DDUA 3CUEF 4MTBA 1ETUA 3BB1A 2VH5R 2GEUA 1GOTA 5BN5A 1S84A 1ZTLA 2FI3E 5F2EA 1O3KA 3ND8A 2G4TA 1SXJD 4Y71A 4FCVA 4JMPA 3MWYW 3P1JA 2IHYA 1FMGA 4MPVA 4TYDA 3U69H 3GMTA 3AF1A 3PM3A 1V6DA 5FX6A 2Z6BD 3ASZA 2J1LA 1SVLA 2BBSA 3QSYA 3E1SA 1IM2A 1Y3AA 4AYWA 3CR8A 4XE4A 1JRTA 4TWWA 1AZSC 1VG9B 1C1NA 1F2UA 1QHHB 2WKRA 4IEEA 4X1SU 1XTKA 5A2MH 4YMUA 3U8OH 2WAYA 2O8DB 2H18A 4QL3A 4NWKA 4AG6A 4AB8A 2UUFB 3GISB 3FMIA 5HKKA 2ZA5A 2F9MA 1FTNA 3VKGA 4NE2A 1UKYA 1BOQA 1KI2A 1A5HA 2EW1A 1AS3A 3CPEA 3KIDU 1ZJKA 4ISNA 3ZVMA 2ZRFA 1K6MA 1S4QA 4KLNA 2BB4A 2EA3A 1NRJB 4Q1DA 2BBOA 5GADl 1PFXC 1T31A 2FP7B 2XCFA 1HAVB 1Z0JA 4EPXA 4JBWA 4IXMA 2ZG0H 2KAIB 5FPHA 3RXDA 3B78A 2IA5A 1V2WT 1HBTH 1TF2A 4YO9A 3U3OA 1OX1A 5G41A 2QV1A 5C2JB 4IVQA 1THSH 2FEOA 4CZ2A 1TX6A 2BDIA 3T12A 2D26C 1E35B 3C27B 1SGTA 2RA0A 3JZAA 3NXPA 1TWXB 1YRAA 1LS1A 2FOLA 3A7XA 3MTYA 4LSGA 2ZRLA 3I5XA 4U2WA 2FPLA 4OYHA 3WBKA 8OHMA 1KI4A 3MHWU 1E98A 2ZJAA 3IITA 4Q7ZA 5I46H 3SUEA 3GY4A 4GAWA 2VVUA 1PPEE 4Q9JA 1NESE 1XWIA 3P8OA 1GKYA 4HZUB 4F92B 1ZP6A 4OI4A 4JK5A 3KZ1E 5AUNB 2GJAA 1AS2A 5G40A 2HGTH 3GDVA 2VF7A 3BWDD 3K8YA 2Y80A 4BTUB 1NVVR 4JSTA 4R7ZA 3IO3A 1G37A 3UOUA 5ETXA 1DY9A 5FHTA 1AE5A 3MAAC 1P2VA 3TGKE 2AEIH 2ONJA 2WHXA 1AB9B 2BIFA 4OM9A 3OEEA 3FOZA 1T7CA 2D2EA 2GA8A 2ZRPA 1ZHMA 4FU8A 1WAYB 3U3RA 2GF0A 2PUQH 4ZPXA 4F91B 4Q4JA 4TSFA 4ABAA 4INHA 3PR1A 1E0JA 1IQFA 2PGBB 1ETSH 2XITA 3OHMA 4OL0A 2B0FA 2QPAA 4B2CA 3EG5A 1PPCE 3J81k 2BY8X 4TY7A 2IUSA 1G3BA 4ACAA 2XJ4A 3SFZA 2HJGA 4X6MA 3AK5A 5DP4A 3E0PB 3SDZA 3ADKA 4LHZA 2UWOA 3CLVA 1GI1A 2O8FA 1MRNA 5LPRA 1C1VH 4WWYA 2AGGX 3PQCA 2Z43A 3SQXA 2H92A 5EE9A 3A89A 4M9ZA 2WUCA 4GDFA 1QHGA 1MD8A 2LKCA 3ND9A 1II0A 3LDXH 2Y81A 1O2ZA 5FH9A 1COWA 1ABJH 2ZZUH 3BC1A 4DKXA 1DXWA 1K1PA 1AUJA 4MITA 3BTFE 2V6NA 4UXHA 1QGFA 1LB1B 2XNSA 4G3XA 5K0HA 1MH1A 1CU1A 1GNPA 3ZQJA 5E2OA 1G32B 4NTZA 1IQHA 3SGAE 5H70A 4MA4A 1P75A 3WRXC 1O0DH 2ZTXA 1OIWA 2ZS9A 4BASA 3KGPA 1TALA 3B1YA 2ZVPX 4BZXA 2OBOA 1Z06A 2EI6A 3D31A 1QB1A 1SMFE 4IVPA 1HIAB 2VRWA 3OEED 1FQJA 3NH6A 1J17T 2ZWLH 1I4LD 4DEYA 4YLGA 4ZKDA 5DJ7A 1F2TB 3NHBA 2TGAA 1TPSA 3KF2A 3C7KA 3L0PA 2L0XA 7GCHF 3K9LA 1E2IA 2J0VA 1FPCH 1TA6A 1XCMA 4TSFD 3IBYA 1P72A 2KSQA 2ZFTA 3FHTA 4ZO4A 1G30B 4FUFA 1QRAA 2VBCA 1E2LA 1UBFA 2FA9A 3AF0A 3RYTC 1E9SA 1P6XA 2GCTC 3E6PH 1S83A 4L5BA 2ZHEH 3GFPA 1XUKA 3EA5A 1BCUH 2V3OH 1WQ1R 3LV8A 1Q3XA 8GCHF 1CJUC 1WP9A 1XEFA 1RTKA 1SSXA 4BFUA 1E96A 1Y3XA 4DZZA 2F9OA 4WXVA 1E0KA 4AYVB 4ARZB 3A86A 1CGIE 3V3MA 3FYHA 2V55B 1GI7B 3VU9A 1HRTH 2HRVA 4KU4A 4MG3A 1C9PA 2WKPA 1Z0IA 3SNAA 5EP1A 3Q3JB 1AUTC 1BTHH 1TOMH 4Q21A 1ZBDA 1COWD 1GI4A 3QUMP 5FTKA 4CR5A 2Z3EA 2H7VA 2OFWA 1A4RA 4DGJA 4BXSA 3GLHA 1DICA 4K5ZA 1CBUA 1ARBA 1BO6A 4MNXA 2O8WA 4A2QA 2XYAA 2OBNA 3W9YA 3ADCA 1TQ2A 4WW0A 4YXWA 1RPZA 1LKAA 1GI0A 1AKEA 2GZDA 2ZFPH 1DM4B 1TNJA 3RDPA 4EJSA 2P67A 4VGCC 2TGTA 4GCHG 5IK2A 4HDQB 5BXQC 5BN3A 1UVOA 2AIPA 4A92A 2OILA 4B35A 4A6LA 1KXBA 4ABGA 1U90A 1FNNA 4CEHB 3X1XA 1IN6A 1R5NA 4PHGA 2NZJA 2IUUA 1XX6A 4RZ2A 3K65B 3T5FH 4CR9A 1CLUA 4M4SA 2ZJ5A 2EVWX 4X6OA 1E94E 1CP2A 5D3MB 4FWIB 4YDHB 2ZR9A 5C67A 2GT7A 3HK3B 3UOPA 3ZVAA 1HYQA 2WJYA 5FR2A 3M35A 4Q9HA 4W5HA 1TU4A 2FN4A 5EXLA 3REFA 1YZGA 5DIFA 2G1KA 1E34B 2BY6X 5C20A 2ZYTX 1JWTA 2QF3A 1GJ6A 2ANMH 3BIUH 1AE8H 4BAOB 2RAPA 1GHZA 3THWB 5E4FA 2O8CB 2ZSDA 2J95A 1O2RA 1F2UB 2O8BB 4Q5IA 4RCZA 3PJRA 4RSGA 2PKSB 1FTSA 4X6NA 1T8MA 1TEXA 1NY22 3CX6A 1SPJA 1C2KA 4LV8B 2R6DA 2WMNB 1TNGA 1B5GH 4JYTA 4A9AA 3AUXA 5DHFA 1DS6A 5AHGH 1S8FA 3ZDQA 1AGJA 1D2MA 4XBBA 2ZYUX 3MJRA 4QRHA 4D0LB 4DCNA 5FL7A 1A1VA 2G8TA 1AQUA 2OZEA 2FPZA 1MO4A 2RGBA 4CT4B 1P01A 1FPMA 4M1YA 3PV5A 1KSHA 2NZ8A 2ZPTX 5GVSA 1A3BH 1C4OA 1MAYA 3HPRA 1XEXB 4CH8B 5L3VA 1SQTA 4B6EA 3MNXA 1KTSB 5IK2D 4E06H 3PV2A 2OE2A 4HI0E 1W36B 1UVPA 3AVUA 4K60A 3BF6H 4TYPA 3UTUH 1GRQA 4OQMA 3SHAH 4DT1A 3K0CC 3H7OA 5DK1A 5FUVA 2V3HH 3EA9A 1C5MD 2GZAA 3KKMA 3NBYC 3TH4H 1SGQE 4D0NA 2V6IA 4JVLA 1KYIA 3VMFA 3V4RA 2HXSA 1TBQH 2XW9A 4NONA 2A5KA 3UNSA 3FWYA 2IPHA 1PQAA 1MCTA 1K21H 4B75A 3WMGA 1MRSA 1W4AA 2BY5X 4LCBA 2A4GA 3ZYDA 2F3CE 2QAJA 1Z5ZA 3GCTF 3NEJA 3QF7A 1O34A 4PHTA 4LY6A 5A0FA 4ILEA 4Q80A 2NU1E 5J4QA 3M0EA 2WTUA 1HY3A 1NBMA 2HT6A 1TMUH 3FFGA 1E1QA 3EIEA 2WSSA 4Q1CA 3H5CB 5GCHF 1HV8A 3UY9A 5JBTA 2B8WA 2A30A 5FXLA 1NMXA 4AYXA 1FPHH 2OLJA 4QNMA 1V2PT 3U1JB 3HDTA 4C2UA 1O2WA 2QXJA 3GYMA 4MNYA 1P05A 1WDTA 3CENA 1ESAA 3DOEA 3A7ZA 2UUYA 5DI3A 4WMDA 2QCYA 4PHHA 4ZDWA 1E9FA 1IQLA 3M7QA 4TQAA 4GHQA 2ZE8A 2UKDA 5F3WB 3MI4A 1HNEE 2GCOA 2XSZA 1S5SA 1ZUNB 4CRDA 2NPFA 3A1VA 5FR1A 4WBSA 1EX3A 1QQUA 1VYTA 3VAAA 2XC5A 1HEIA 2OBQA 4MGYR 4M1WA 2GTBA 3PO1B 1RRPA 1K5DA 1A7JA 4M1SA 4X8OA 3VXFH 3I29A 4ABJA 5C5OA 2FNAA 4JLBA 3RVBA 1KAOA 2AMPA 4M7GA 2FEMA 3RU4E 4AB9A 3LIWA 4NYJQ 3PENA 1DDJA 4RD2A 2EFHB 3KDSE 3QI2A 1FIZA 5BWMA 3QKUA 5IT5A 1XZQA 1VGCC 4D82A 4Y11E 4AURA 1K8RA 2DE8A 1RRFA 1EJNA 1IQPA 1OP8A 3M5LA 1CA0B 3TE6A 2R2MB 1TF5A 4RVCA 5JBCS 4HUTA 1DG3A 2NO1A 2BOHB 3MH5A 3MNBA 2TBSA 1QRWA 2AHOA 1HQCA 4ZI2A 2PEYA 2Z6VA 1OSNA 4A2PA 2A45B 2XOKA 4B2IA 1CIPA 3M5NA 4DVAU 2Y8EA 5C4MA 2Y5FA 5DYGA 1RD3B 3L8ZA 1GJCB 1E1QD 5AJWA 2ZU1A 3ZQ6A 1OLOA 2P8OC 3B23B 1EG7A 3EA8A 1XPUA 4IVRA 1DOAA 2NO0A 1Z47A 1IN7A 1YPHC 4DVGA 3P8NA 2JLXA 1XRJA 1OYQA 1Z3IX 2ZQ5A 3OIVA 5GWZA 3L0OA 1VZQH 3A85A 1QZXA 1TX4B 1N25A 1B0UA 1P57B 3RXKA 3QTOH 4U32A 2BD8A 4XBCA 2PTNA 4BOHA 2EI8A 4Q01A 1SGNE 2VHUA 4MLFB 3GJ8A 3DM9B 3ICEA 3CRRA 5KUTA 1V2NT 1N5JA 2CLCX 4O2RA 1FONA 1P9NA 5FUXA 3TH5A 5CLLA 3SI3H 2PR3A 5TJXA 1YZNA 5KYKA 4NCKA 3SJAA 2Y7XA 2ZTZA 3KNXA 1OFIA 5KPJA 1C2HA 2OUAA 2FOCA 3UR6A 3GFTA 4TQUS 1KGDA 1TE0A 3A81A 1FIWA 3PLPA 1IY1A 4KSCA 2BOKA 4BNRA 4I31A 4UNRA 1OT3A 1X7AC 3I32A 3A1WA 2AXPA 1QY6A 4S2EA 1KKLA 1W47A 2GZHA 2IS6A 1XCPA 1G1MA 5B2ZA 3TGPA 3VFDA 3DM5A 3R7WB 2I1VB 1LDTT 4XFQA 1XXHA 2GEDA 2TRMA 4QKQA 1VDZA 2JLRA 5F9HA 1ZAKA 1GVZA 5CHAC 2XOKD 1SKYB 4UNSA 4ZIRA 1M74A 3BTWE 2E1RA 4JLJA 4NCHA 1EUFA 3AUYA 4CT5A 1FY8E 1EB2A 1O3CA 1YPMH 4CREA 4W5JA 1GHVH 1JJ7A 3T5DA 3R9XA 1QB9A 2WJVA 4Q00A 3DA9B 4JL5A 1G9XA 1OHHA 4C0HA 2BYAX 1NN5A 5B57C 4F4JA 2ZE5A 2ZJZA 1GFIA 1NJGA 2QT0A 1NN0A 2GETA 3QXHA 1Z6EA 2CHAB 2OBLA 1CBWC 3SJ9A 4TTRA 2ZS8A 4KFRA 3QKRA 2PSXA 2A1DB 3MWKA 2WZQA 3Q77A 1D9ZA 4U01A 2IYSA 3TUJC 4V0KA 3RMLH 4X8MA 2WWIA 1Q22A 2D8WA 3SJBA 1SL3A 2TPIZ 1O5GH 4NYMR 2ZI5A 4IOLA 2ANYA 5KNCA 4KVGA 4TMVA 2F9NA 5E0JA 4DOQA 3OESA 1ANKA 1ELDE 2FOBA 1O3PB 2P3TB 3QOFA 1P73A 1DWDH 3MNCA 5JB8S 3V13A 3P20A 4A0HA 2C8WB 3CF0A 2OV2A 3KB2A 5FBLB 1ZM3A 1ZJ6A 1NLZA 1KJYA 3SBDA 4BFXA 1DVAH 3TBKA 4M53A 1W14U 2CV3A 4ABDA 1S96A 1AFQB 4BEJA 1X8LA 1GDQA 1LVYA 4GHTA 4L4UA 4Q66C 3AF4A 1O3HA 1O3OA 4NIXA 4L15A 1E9CA 1H65A 2PLXA 4I32A 1ZUIA 1SVWA 3GP8A 1E2KA 1ELFA 1XPOA 1HJAC 4WOPA 3RDZA 1AI8H 5EXNA 4S35A 1EZSC 4K3JA 4A4DA 2AD5A 3FHOA 2VGCC 1FY5A 3E5HA 3K70C 3ZD7A 1R4AA 4BFTA 1UVTH 1DSUA 1T5LA 1WXQA 1C9KA 1CR1A 2VP0A 3U7GA 4UFDH 1KXEA 4ASHA 1E0SA 3LQQA 3T15A 4Y6DA 1R10A 4N1AA 5KSPA 2BQWB 1OKKA 4EFLA 4PQFA 1P03A 1KYNA 1Q1BA 5FUYA 1C4Y2 2VF8A 1UPTA 4QJ5A 4KBFA 1Z8FA 5AK0A 4C2TA 4UFGH 1GBAA 1GZSA 1DX5M 1OHHD 4TYNA 1PUIA 2JJ1A 5FCKA 1PUJA 3PLBA 3T5GA 1SKQA 1JB1A 2XXAA 4FCTA 2BDHA 1W2GA 1SLXB 4KLZA 4FUIA 1GBLA 2IWHA 3TSOA 3ZZ8A 2REBA 2F91A 1FW6A 3T62A 4AI6A 1VJ9U 4TYYA 2ZFFH 2D74A 1G4AE 2F4LA 1P2UA 5LH8A 4JZDH 2JLUA 1BDAA 2EC9H 2VWOA 1JPNA 2D62A 3KL6A 2HVXA 1XD2A 1TMTH 5F8TA 3R8CA 1X8JA 5FPKA 1QHXA 1X3SA 4LPSA 2XWAA 4DCTA 1N5IA 1KDPA 3EIQA 2D3WA 2KBEA 3K6ZA 3KQCA 3NG1A 3NH9A 1E2QA 4MRPA 2W26A 1XX9A 3EPKA 4K1TA 1W4RA 4MDSA 2H1UA 5BN4A 1MKWH 2W58A 3Q7QA 4V03A 1E99A 4ACBA 2AKYA 2O8UA 1YHNA 4D25A 2BM0A 5UKDA 1O2LA 2XBYA 4HLUC 5C1XA 3CB4A 3F0TA 1LMWB 2IXEA 4JBYA 4I81A 4K81B 3F9EA 2A4QA 3MCAA 3VR2A 3AP3A 1NKSA 3HYTA 2QNRA 4DLTA 3BG4C 1P04A 1IHSH 2FXRA 2CJIA 5E0HA 2QRNA 4B2AA 3TQFA 1G6OA 2QY0B 4KXFB 3MYWA 5GJ4B 3W8RA 2R9PA 3W5IA 1DFPA 5C1BA 3SOSA 3RMNH 3LVQE 3DPUA 2C78A 5G3YA 3VB5A 4MRRA 3JZ1B 3UNQA 3BFXA 4LBVA 1VCMA 1BRAA 3RSLA 3ATWA 2PT7A 5GIBA 2YWGA 1O36A 2HCBA 4GLYA 1MU6B 2JH6D 4LZ1H 1P3JA 3TR0A 1MBMA 2WPMS 1QJ7B 3EGKH 4G1UC 3ZVCA 5FL3A 1C2EA 2J7KA 4AFQA 1CJTC 3WNBA 5GDSH 3MH4A 3B60A 4AYTA 4G0NA 2PWXA 2WYJA 2RGXA 5HZHA 1SULA 2C90B 1WYKA 4FD2A 1AZ8A 1DY8A 5FPYA 3EARA 2GHIA 1TTTA 4JZEH 1TQ7B 1X86B 4Q2KA 3PEUA 4EPVA 2QE7A 2OBMA 4GI7A 2ZU4A 3M6AA 1S0QA 1XMIA 3SFVA 4KTSA 1WCV1 3H4MA 3CNLA 4TMWA 3U3JA 2FFHA 1P61B 3SJKA 3LWNA 1ESMA 1OOKB 1XXFA 1QL8A 3SNCA 3BRWD 4RY2A 4Q9IA 4IS5A 1QRXA 1S9HA 4M9FA 1FY4A 1XUHA 3GY3A 3R9IA 1BHXB 4BFYA 1EZQA 2BDCA 2PHBA 5J4HA 2A5IA 1SQOA 3W6OA 3OSYA 3QPUA 4ISOA 4IJMA 2FH5B 2OXSA 4OI2A 4DHEA 1KY3A 2JLWA 1P12E 1IXZA 2THFB 1W46A 3IO5A 2ANWA 1XTRA 2XBWA 1NNEA 4LBZA 3GLIE 2OQ5A 2XNDA 3BOSA 1OWKA 2FM2A 4LBYA 2J0UA 1XNJA 5C5NA 2NIPA 2P6RA 2IUTA 1KLIH 4EKDA 1EFRA 4NYIQ 5JHGB 2FGJA 4D7GA 1PLJA 4O9VA 2ASUB 3UWIA 1YZKA 3CWZA 1KJZA 5AJYA 4LUCA 2W2XA 1IJEA 4BZQA 1N1LA 1LF0A 4LJYA 4OQXA 1XXHB 4JLOA 1L4DA 1F60A 5DGXA 2DR3A 1QRZA 4NYIR 3EYDA 4MKHA 2BVNA 1WBDA 4DLSA 4ZIRB 2F55A 3VKHA 1EGAA 4HAUA 3Q00A 2VSFA 3KQBA 3W34A 3WP1B 3IIKA 4HB3A 1EOLA 3GCHC 1NIJA 2WWHA 2JKHA 1G3MA 2BTCE 1HA3A 5J40A 3U60B 1NO9H 4JVMA 3W8NA 1K2I1 1N6PA 2QE7D 4R2IA 3HGNA 1JQJC 1G2LA 4PTLA 2ALPA 3M4YA 1GJAB 1Y8TA 4B71A 4G5SA 1IQEA 4NSVA 2GJSA 3M3VA 4IFEA 1RTFB 1E2HA 2ANBA 1Z83A 3H09A 4RZXA 1GMDG 2A78A 3QKRB 4RD4A 2QTFA 3WRYC 3OEHA 1UTOA 8GCHG 3W3ZB 3VNVA 5T3HA 2FWRA 2QAGA 2ZYWX 1GI3A 3GLGB 1BRCE 3NXSA 1SFQB 1T8UA 3OFNA 2G0NA 521PA 2GESA 5E2PA 1JR6A 3KFXA 2ERXA 2RH5A 4V0OA 4EFNA 3GQBA 4AYYB 2W6JA 1BMAA 2ZRDA 1THRH 3TK5A 1G2MA 1DADA 2CHQA 3OY5U 1N3BA 2YOLA 1SQAA 1VPLA 4CIDA 1J8AA 4LRWA 1RC8A 1GI8B 4LI0A 4THNH 2IS4A 1CSOE 3VXEH 2XNDD 5K8TA 1OYTH 2O5VA 1HAPH 5T6DA 5A4JA 3LU9B 2GVZC 3SYKA 3KXLA 2OK5A 3FMPB 3TLXA 4PSVA 3THYB 1ANBA 2VLIA 4LC0A 2W0MA 1EFRD 1K1NA 1H9LB 2AERH 1C1RA 3H86A 4O2LA 1GIAA 3SJOA 2ZF0H 3KTAB 2ZECA 1KXFA 3SGBE 1EZXC 4IKEA 1Z1JA 2AIQA 4FMDB 2ZU5A 3L0IB 4OHVA 3UNRA 1DXPA 1K5GA 3SV6A 4L8GA 2WOOA 3H2YA 1RRKA 2V8OA 2OM2A 2ALVA 1SR5C 1LHDH 4X2YA 2AXNA 2ZSAA 1PQ8A 1AGPA 2H57A 5KO2A 1VIAA 2JCSA 1KDOA 1G3RA 2B9LA 2JIZD 1MTVA 3ENSB 1KOFA 5FBEA 5LPEA 3TJUA 1Y59T 4Q7JB 1O2HA 3M7UA 2CL7X 5BW8A 4TZ0A 2CVFA 1JJVA 4DCVA 3T25A 3LC5A 4BWYA 3U8RH 2BZAA 1HJ8A 5B6LA 1N6RA 3GEEA 5EJEA 4O3MA 3NC1C 2ZC9H 4NSYA 3RXMA 1DE0A 4BFZA 1KSFX 2VJ1A 1H8HA 3LH1A 1F92A 2BDAA 3ICQB 1WOFA 2IOTA 1ETTH 1II8A 3OEHD 2ZU3A 1SC8U 4CEIA 4H6SB 3UKDA 1G7TA 2GZ8A 4US1R 1BBRH 2WJHA 3STJA 2PZEA 1XD2B 3OFND 5HE9A 1F0UA 2ZGJA 4X8TH 2BKUA 2EFDB 2W6JD 2C9YA 4B2LA 1W2HA 3U61B 1ZGVA 4R98A 5AR1A 1YYY1 4TPIZ 4A8JA 3BGWA 1C9TA 3UMRA 3UIRA 1O5AB 3D8BA 4M2LA 3S0NA 3QG1A 1F5LA 2AMDA 1US8A 4X2WA 3B13B 3TSWA 3KQKA 1GBEA 1IJFA 4X0WU 3RXBA 2IYZA 1W11U 2DFKB 1D6WA 3FZZA 5F98A 4KYIB 1TX7A 3GDUA 1C1WH 1ELGA 3AF2A 2Z4SA 4ZKEA 4Z51A 2QL6A 3RSOA 4CBNA 3B85A 3VX4A 4FUCA 2RGGA 3A84A 4YQFA 1OWIA 4ISIH 2QM8A 3ATMA 3F9FA 2C8XB 3CNOA 2GX4A 4D4JA 1Z0FA 2ZU6A 1XMNB 3DT0H 3AKYA 1XTJA 2GXUA 3ZZ0A 1UADA 1KI9A 3VNUA 4RZUA 3ZVNA 621PA 3EZ6A 4Q4AB 2OUKA 3ELAH 3RLWH 2PGQB 2H2ZA 1TU3A 2G0TA 3S9CA 1RZ3A 2O8EB 5HM2A 2GJ9A 3BTTE 5L30H 4MDFA 3Q9LA 1ZJDA 1UFQA 1LVOA 2WIAA 2PL3A 2BD5A 1V2TT 5TCAA 3M7TA 2BKEA 1TGCA 2HYIC 4UEHH 1G3DA 4R2HA 1U99A 1OXTA 4LOAA 4BLOA 1FY3A 3I72A 3SZEA 2JJ8A 1H8HD 3GCTG 3W5JA 2QRZA 2ZGCA 1BTPA 3FZDA 1GPZA 2WICA 4XTRA 1R8QA 4LOYH 3IWMA 3RC4A 1UBCA 1H9IE 4M9SA 2GJ8A 2R8RA 3RS0A 2J5XA 1KKMA 5HE8A 5FI0B 2JLSA 5GCHG 1FAXA 1V2KT 1KNQA 1GBCA 2PMDA 1G36A 4XVQA 1ZRKA 2V4ZA 4DCUA 5FOWA 3GOVB 2B21A 2STAE 3E91A 3MJHA 2ATVA 4QGAA 1P4SA 4JZIA 3TKLA 4PROA 1S3SA 1GCTC 3KQDA 1W3CA 2ZI7A 1NI3A 3FTQA 5JEDA 2QQEA 3TNFA 3D3QA 2WV4A 1L2TA 2BDTA 3KJIA 1RE0A 4BPBA 2DCUA 1DAHA 4JT4A 1W5TA 5FCRA 4B43A 2G4UA 4DY7B 1ZR0A 3HK6B 1CRQA 2WPDA 3B2EA 4PQYA 2FTLE 2MMCA 4JBXA 1TGBA 3NWUA 2BVXH 2ODNA 5E7MA 4YC7A 1C2IA 2W0SA 5KTYA 3CX8A 4ZROA 1GNRA 3GJ7A 1AWFH 4D81A 4D8NA 1DS2E 4JJZA 2DUCA 4UFFH 4E5UA 1RRGA 4RKFA 4MYUA 4IN2A 5EGMA 1C4U2 5E8EH 2P3UB 3R3GB 1HAOH 4I8JA 2G52A 3LJJA 1KO5A 1W7GH 4CRBA 4P3YA 4ZKNU 3SW2B 1DLEA 2GAOA 4G5GA 1JR3E 1FJSA 4GFDA 1O2KA 1TPPA 4NWLA 3CP7A 5KNBA 3TJZA 1UK4A 1DAKA 3GCOA 2BJVA 2IJOB 3P8FA 3F3YA 2NU2E 3UG6A 5A8XA 1MTWA 2ODPA 3MNSA 3R0FA 7LPRA 1OJLA 1GG6C 1KI6A 2BVRH 4VGCB 2Q9BA 3MU5A 3CPJB 5EQSA 1BJVA 1Z6YA 2P2LA 3L43A 5EE0A 2ZDMA 2NMVA 4PHFA 1ESBA 2Q1JA 3HATH 1GJ4H 2ZDLA 2BD4A 4ZKRU 5KDOA 3LT3A 2WWYA 3SU4A 3I8SA 2FWWA 3RU4D 3QZQA 1UDXA 2OEPA 3AQ4A 4B74A 2AYWA 1G7SA 2AK3A 2TIOA 1EKBB 3PUYA 3M3SA 1N6YA 3BD9A 5DP7A 2WWWA 4EPRA 1FQKA 4Y0ZE 1XTSA 2CJWB 2K5UA 1P2SA 1BS1A 3RS2A 2JLVA 3NVAA 1L4ZA 3MO3A 4AZ2B 5AF9H 5TXGA 1E37B 1V2QT 4G5OA 3IEVA 3BFKA 2ZEJA 2WPDD 4L9WA 1ZPCA 4FCWA 2GGVB 3MO6A 1EJAA 4KBGA 1J15A 5J4SA 4IMQA 4OS5A 4D4MA 1OKXA 3RP2A 1QA7A 5BRRE 1GBHA 1J8MF 1JNYA 1QHHA 3K1JA 3K9GA 4PPQA 1SZPA 5J4KA 2HWLB 5F8ZA 4XVRA 3AVTA 2O8DA 3TJVA 1ZVQA 3ZV8A 1KO1A 2QIQA 3IPYA 2DWQA 1RYFA 5FBWB 3I92A 1KDRA 1KHTA 2NO7A 3SU1A 5FOUA 1MKWK 2WV9A 2FFBA 2GZ7A 3CR7A 2HNTF 1Y3YA 3BK7A 2YWEA 2FFQA 3SUDA 4XSKU 1ZC3A 2J45A 1CR4A 4M0LA 1G19A 1YR8A 2P16A 4Y8ZA 1LNZA 4H1UA 4MH0R 1HAVA 2AX4A 1P2KA 1VCQA 3P27A 4K8BA 3FFAA 1A46H 5EW1H 4U00A 4RZ3A 2DB3A 2BVSH 5C4GB 3OIWA 4QG7A 4DWJA 1P3EA 1NLYA 2IYYA 1NM6A 1DWCH 3AW1A 4Q7KA 1O87A 4ABFA 3LNCA 2X2EA 1TGSZ 1GUAA 4FI3C 1C5ZB 2CE7A 3EWAA 5DP8A 6CHAB 1T8NA 3GY2A 4OI0A 3T2NA 1I4DD 2BEJA 1ZC4A 4NHOA 1QA0A 1FXYA 5CK4A 4FUEA 1C5TA 1T4GA 2WPKS 5L6NH 3SU0A 4FINA 5LD2B 1CS4C 4ZH8A 1HFDA 2OAQ1 4KTUA 5JCZA 3A87A 3L0SA 1W8BH 1U9IC 1YF4A 3LXRA 2XEXA 2KBFA 3C8UA 1UBEA 2WIBA 3IBGA 4KAXA 1KI1A 3L6PA 4LJ7A 2NOAA 5AJZA 1AB9C 1MR3F 1GJ9B 2ZJ8A 1YP9A 3MLEA 1U8ZA 1QHIA 1FDPA 4TTQA 3K2UA 2NO6A 1EXFA 4Z8XA 3TJOA 2FFAA 5KDDA 2IL1A 3UXMA 3LH5A 1US8B 3ZZUA 3LLMA 5CMXH 5E3HA 4Q48A 1YPGH 2PTCE 1RW4A 4E7NA 4HDOB 1C2LA 4BLTA 5EOKA 4Z0KA 1O3MA 3K53A 2BJWA 3PUXA 4YT6H 4EIWA 3IPXA 1EAUA 2ZHDA 4X8LA 2OT3B 2X8AA 1SB1H 7ESTE 2CCJA 3BEFB 3RM0H 4UFEH 3G0HA 2VP5A 3LJOA 4A15A 4ABHA 1GHXH 1NSFA 2ZP0H 1IOZA 2PZFA 5A8YA 1SGYE 5FBIA 2BBWA 2HF9A 2DPXA 3A7WA 2CHGA 2VINA 3JZMA 3ZZ9A 2CLDX 2WINI 5EPYA 4Q18A 4BLQA 2W6IA 2ZRGA 3S9BA 1MH0A 1XFAA 2QN5T 2RMKA 3RXRA 4F49A 3NBXX 1FOEB 3K09C 1C4V2 5B30A 1O2GH 2IXFA 1L1NA 4LK2A 1WB9A 3MU1A 4WY3A 4Q1EA 3A8TA 1O3LA 4RI0A 1VGCB 2XJ9A 4Q7XA 4WAUA 4OQLA 3A8CA 1OWEA 1YR7A 1SHHB 3HP1A 1GHAF 1II9A 2HPPH 3A1UA 1EWQA 3D49H 3S7HB 1PYTD 1UKVY 1SLUB 2C8ZB 1C1QA 5JPMH 4QHSA 1BA8B 1RS0A 5T6GA 1ZSLA 1FP7A 4LV6A 4C0AC 4GMXA 3GCNA 4QHYA 4BLSA 1XMVA 4FU9A 3UQOA 4A6XA 1F5NA 1NVXQ 1OXUA 1UTMA 2P8OB 4NA8A 2XZPA 3TITA 3SNBA 2JH5D 4P33A 3VB6A 5CB6A 3U8TH 5DE3A 4IDOA 4PZLA 1M8PA 1Z2AA 1K1MA 1H1BA 5C46F 2MSDB 1TQ4A 5B64A 1KIMA 1P09A 2PKAA 4P4SB 1SXJC 3BH0A 2QORA 2VVCA 1C2GA 3NTUA 2FZZA 1LV7A 3C5HA 1BIFA 5J47A 1R6BX 5EE5B 1E2GA 4BTIB 3TNTA 4KKDA 2ZAOA 3RXVA 1C2JA 1V2VT 1N6KA 1SGIB 2QTVB 4US0R 1NSTA 1BT7A 2C03A 4B3XA 3CX7A 2CMYA 1G9IE 1G3IA 2UWLA 4NZQA 4D26A 4YLQH 4II7A 3ZS8A 2FTMA 2PH1A 4ARZA 2GP9B 5G4BA 2DFTA 2W6ID 5JJLA 4DDTA 3KXIA 1I2MA 1E32A 2J41A 3E70C 4IC5A 1DANH 2GK6A 2J9RA 1EXMA 4ABEA 3MFYA 2WWGA 1NP6A 1E4YA 1O2XA 2IK8A 1CR2A 1XXDA 2G51A 2OP9A 4YMVA 4Z1MA 4NFFA 1ZINA 4KHZA 1S1MA 2J38A 2H9EH 1P8VC 3SORA 2BY7X 1DO0A 3OE7A 4C0BA 4TYWA 1QCPA 4QGHA 3SNDA 1U81A 1GWNA 2FX6A 5CHAB 2F43B 1G8GA 3Q3KA 4B44A 3PTBA 4Z6AH 5H1YA 1HDTH 2QMHA 3SO3A 2QPTA 4P32A 2IBMA 4CF7A 2WUBA 4BRUA 2ZEBA 1A3EH 4X2XA 2YYZA 1XD8A 5BQ5A 2DFLA 3GLGE 3GLIA 4KO8A 4TZ6A 9ESTA 4H42U 4CEHA 2WOJA 1TL7C 2IF0A 4BLRA 4BEBA 1TNKA 1OH5A 1NN3A 1X8KA 5FBQB 2G6BA 1EATA 4LBWA 1G7RA 1FN8A 2IHBA 2R2WU 2ZROA 5D3MA 1GNQA 2ZUDA 4JKIA 1BITA 1OIVA 4KVAA 5SZIA 2M5TA 3LW7A 1Z0AA 1CBWB 3NZIA 2R65A 1ELOA 1MABB 2FDCA 3QLPH 3QG5A 1THPB 1ELCA 4KSBA 5LB2A 1LHFH 3UMFA 4BAMB 2QP3A 3F9HA 1H8EA 2ZRJA 4BQSA 4NGAH 2ZREA 1YU9A 2A4OA 1IONA 1JBUH 3LX5A 4W7SA 4OKSA 1BBRK 1JECA 2CHVA 2Z3DA 2BLQA 1GMCF 3THWA 3QDZB 4EQ6B 2O8CA 2ESTE 2O8BA 2CMKA 3CS7A 1HAIH 1P2MA 3VR3A 4DBLC 1P9RA 2WJGA 2VU8E 2B7BA 3C14C 5KHOC 1JIMA 2QMUA 1UKEA 5DH9A 1V2ST 1MD7A 2JLYA 2NQ2C 2IXGA 1A2CH 2A5FA 1L1JA 2RGAA 1P06A 1M7GA 1SOTA 4OHWA 4C3ZA 5P21A 3N2EA 1VIYA 4I1OA 4RJLA 3KUCA 3GJ5A 3L82B 1ODFA 2A9KA 3SV8A 1VITF 3M1IA 2R9VA 1TBRH 1P60A 3CF2A 3B7GA 2OINA 2HUPA 1HJAB 1SVKA 4XD7A 3ZZ4A 5EZ6B 1OXSC 2QY9A 4LGMA 1KDTA 4TL9A 4KV9A 4Z1MD 2VIIA 3FDIA 2VGCB 3K70B 4TMZA 1ZOMA 1KSJA 4FUGA 1AGRA 1XEXA 3OE7D 1UMAH 4HAVA 1YKSA 4CH2B 3KXKA 4LK4A 3LDAA 2ZRMA 1PQ7A 5AUQA 3UANA 1R2QA 4MUBA 1PZNA 4JYVH 3LGWA 1JEEA 4PAMA 1C5SA 3IUYA 2N46A 4PO1A 4O03A 1ZU4A 4GMDA 3IG6B 1WU1A 1O5DH 5JB9S 1CE5A 3MMPA 1O3EA 1VCNA 4JK6A 3SJCA 4YONB 1DWEH 2R62A 3AKDA 4DUGA 3GD7A 3L33A 4YLUA 1HT2E 4Z54A 3CRQA 2A5AA 2BX3A 2VNTA 1U8YA 2HEIA 1NFYA 1GRRA 2AK2A 1VCIA 3RXFA 1PVOA 1YR9A 1OYWA
chains in the Genus database with same CATH superfamily
1PUXA 3K7EA 2P4HX 1U0TA 4LJSA 2Q21A 2OKCA 4M6WB 4IC6A 1JXQA 1UK2A 1V8FA 2FOAA 1B7XB 5CGZA 4G5QA 3IPCA 2NVUB 5ALNA 3EEQA 1VPVA 4E7RG 4JEIA 4DJ5X 1A1RA 1RJFA 2WB4A 3B1VA 4QYXA 4PVCA 2FOHA 1KMQA 2VNAA 5JS1A 3CF6R 5FWAA 2QN3A 3DMGA 3U44A 2BH9A 1IZ9A 2ZAYA 3FSJX 2C7VA 4X95A 4LHWA 3WWBA 1FMFA 4ZVOA 4EW3A 2IVZA 4LMAA 5KAPA 2YN0A 1YD7A 1Z1IA 3MBIA 4CVNA 4UQOA 3KYFA 4C7BA 4ONEA 3NBQA 1NVWQ 4J43A 1G8FA 2WU0A 1YBWA 1LC0A 4TL8A 2H5EA 1ZM9A 2P27A 1GTJ1 3PMHB 4W5NA 2A4MA 4JV5B 1VSUA 4DJZB 3SC2A 1K22H 3CJQA 2JRLA 3RRBA 3JQEA 2XNIA 4RH0A 3PROA 5EG5A 3HJFA 4RQUA 1W36D 1O6BA 3V3KA 5H3HA 2A14A 1MNAA 4M8NE 4Y2XA 3SHVA 1JU4A 1PPBH 2RHMA 5DHAA 1KTIA 4GL2A 1N8SA 2VK1A 3C41J 3IMKA 2AEMA 3E7XA 3KUDA 2ZXFA 4DUGD 1CA0C 4K6GA 4EECA 3OQNA 3D8SA 1Q17A 1A50B 3AEZA 2HIAA 2Y0BA 4GP6A 1ZIYA 5E8JA 1DL5A 1NT2A 1FTGA 2F3RA 2A7JA 2I3DA 3B9PA 4MYCA 1TADA 3A4MA 2XBXA 1U0JA 2NG1A 1ANEA 5C9ZA 3ZWNA 4ND6A 1QB7A 3OZBA 2PSSA 1KO8A 4HOYA 1GNVA 3PQDA 3ZYEA 4US2R 4XYBA 1JVNA 2SGQE 4K86A 3OA0A 2X3FA 4O4LA 2REXB 4P7GA 1OZAA 3EPJA 2QSZA 1U8AA 3VZBA 4H7KA 2PKAB 5AVYA 1IHYA 1UOOA 2HSEA 1U7UA 2XZTA 4O2BF 1SVMA 1VXOA 2PZBA 3M4JA 1GBTA 1Z56C 4QUHA 4WIAA 1GMDF 1ZTKA 1LPAB 3BH6A 1OX6A 1TIOA 3SKVA 1DIOB 1PJAA 3N0TA 3MQ2A 2UDPA 4RPJA 2ZU2A 1PT7A 2UYQA 1IY2A 1PV2A 4R0MA 4AC9A 3HABA 1B2LA 5CLJA 2OLGA 3GDHA 2EYQA 3OETA 2IS2A 4QGSA 2I2AA 4ON9A 3DKIA 5C5DA 3KBBA 1JAXA 3LY9A 4NBWA 3R7FA 1VCPA 3R9KA 3FH0A 4RIFA 4I1VA 3NHWA 1PPFE 3NDPA 4F21A 3V4SA 5A5DA 3HPQA 4L8YA 1J22A 1NM5C 2AGVA 1UTQA 4LDZA 3Q3YA 4PV7A 1KAGA 2CD9A 2DT8A 4P9NA 3TLYA 3MJVA 6CHYA 5AKHA 3SSOA 4BYGA 2V9PA 4HDCA 3QBVA 1O97D 3KWJA 1OVGA 1GI6A 4XFKA 3R7WA 2YJ5A 3E2MA 2WA2A 4MB6A 1E0FD 4D9EA 1A2BA 1CUWA 1A7KA 3MTQA 4CUJA 1BZXE 4OP3A 1TVCA 4RFSB 1V2MT 1Y7PA 3A36A 4L6CA 5KU7A 3N2GA 4IHJB 1EB8A 1ULTA 3WKAA 4BVKA 3AX6A 4Z3DA 3MWEA 4PLZA 3SOZA 3NFRA 3JU3A 1B73A 3VPFA 5BVHA 4MYHA 2R8YA 2FQWA 2VYVA 3OF2A 4XVUA 5T41A 3P32A 1WPGA 2I67A 1ZVMA 2WJAA 4F9TA 5K0JA 4NEGA 2OG1A 1EVIA 1UXOA 1TQ6A 1SCKA 2I2BA 1YZTA 2I6GA 4YEDA 3CZQA 3NR2A 1U2QA 1OH8A 5CNMA 4TV9F 1I7DA 4R7TA 2YHIA 4GKBA 4A1OA 4HBGA 1JP7A 1APBA 4BTTB 2X2OA 2ZATA 1O0SA 5EMNA 2P9HA 1SVPA 1DRWA 1A9OA 4TKUB 3ANXA 2AUTA 4Z4GA 4RVSA 1ZW6A 2G1UA 4Y2UA 1HT0A