3O8BA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
total genus 219
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8bA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8bA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA03
1QJ6B 1O2PA 2AMDA 1WAYB 2P95A 4MPVA 2GZAA 3SBDA 3M5NA 1PLJA 2ZAOA 1VCOA 2BY7X 4TYQA 3A8CA 3KQCA 4YDSA 2JDID 2OESA 5EQRA 1IN4A 4M7GA 4JVNA 1QTFA 1CJTC 3KFXA 2STAE 2IS4A 4JJKA 4GCHG 3BBPA 1U0JA 1XFAA 4RKJB 1YJ5A 1KO1A 5T6FA 2IF0A 5AF9H 3SJ9A 1O3YA 2BY6X 3NXSA 3AF0A 3B1YA 3E0NB 1E2FA 3CRW1 1P73A 1FUJA 1RIWC 1YRAA 5DP6A 1E9EA 5EJEA 3NPSA 1KSFX 2XSZA 5A2MH 1FP6A 4NSYA 2Z83A 4PHFA 1BBRK 2REXB 1QDEA 5TDHA 4BANB 4H4FA 2PWXA 1GG2A 3MU4A 4RSPA 1ZYUA 3DHKH 5DJ7A 1O34A 2CK3A 3A86A 2QGRA 3U3MA 2DWQA 1GI6A 3RC6A 2P94A 3X1XA 2VYFA 1ZNWA 2WTUA 4K8YA 1O3NA 4BZQA 2Y5FA 4N1AA 1ABIH 5ESBA 3LRPA 3KZ1E 1M6NA 1KI9A 2GXUA 4BFUA 1UKZA 4IDPA 5FPHA 1LNZA 1G3IA 3R3GB 2VTKA 3AW1A 2IYUA 3ADDA 1EX6A 2NIPA 1RZ3A 3RRZA 3TGKE 4PSAA 1GMHF 2WYJA 3JVVA 2ORWA 1KTVA 2ZFFH 1XUHA 4NYJR 2I3BA 5TB5A 5BYJA 3EA7A 2FDCA 3RXGA 4K1EA 4WJG2 4WF8A 2NQ2C 1US8A 3GP8A 1GDUA 3U3JA 3EA8A 2XCFA 4JZKA 3A7TA 3AP3A 1TX4B 1B0FA 1HFDA 2V9PA 3B6EA 4XD7A 4AKGA 5ESTE 3RLYH 4D4LA 2VF7A 3E5HA 4QRHA 3OAAD 1CHGA 3MMPA 3VR3A 4S35A 3WRYC 8OHMA 5BN4A 1DWBH 5EZ6B 2VH5R 2A5DA 2HDNB 1WMSA 1A0LA 2ZQ1A 3GDSA 4Q4JA 3H5CB 1A5HA 4J2YB 4W5WA 3X1WA 3QUMP 1WTGH 2WSSD 2QTVB 2FZLA 4QJ3A 5A09A 5L8VA 5CK4A 4HB4A 3SV6A 2BDIA 4L16A 1MTNC 4AK9A 5JMTA 2W3IA 4HZHA 1QZXA 4JYTA 5FL7D 1C5UA 2A4GA 3RXSA 2GJKA 1O3GA 4KFSA 2JJ1D 2J59A 3L33A 4CEHB 5AJYA 1R5NA 5JWOA 3MH5A 4ABHA 2BD2A 1HB0B 3AF2A 2BD3A 1NFWA 1VECA 2QF3A 3C14C 1TEVA 2HUPA 1T4VH 1JB1A 4NCYA 4DLYA 5LD2C 2REOA 4CRDA 2IYVA 5B6OA 1AUTC 4IJMA 2D2DA 2P6RA 3OIWA 2BVXH 5CMXH 4MRRA 3MTYA 1G64A 4FUFA 4R9UC 2PKAB 2OCAA 4NONA 1S81A 5HMAA 1ZOMA 3RMOH 1TQDA 3HKJB 3TVJB 4LYHA 4QHSA 1G9XA 2OP9A 1CLUA 4B71A 1FY8E 1TRMA 1G3QA 1O31A 1IY1A 3QXCA 5FR2A 1HJAC 1V2NT 3R20A 2P5TB 3DFLA 1H65A 1QHHB 4LOAA 1UTNA 2FOMB 3QVUA 4JLDA 1CEEA 4AFQA 5CE1A 1G7TA 1XZPA 4OJKA 1NMYA 1GBDA 4TYYA 3DA9B 3NK8A 3AVVA 1UMAH 3WYAA 1BTWA 3QN7A 2R0KA 1MRNA 2WWHA 2ZE7A 1E94E 1W4AA 4MA4A 1GJDB 2Z3DA 2QGZA 1UTOA 1H8HD 3PUWA 2CLDX 3B78A 2Q21A 3URCA 1QVRA 1BMNH 1P5ZB 2BM1A 5E3HA 1PPHE 1VG8A 3D49H 3SU6A 2P93A 1AIXH 3C8UA 1RJ9B 1O3BA 1ZMXA 1LDTT 2XB4A 3TH4H 3PMAB 1RPZA 1G3EA 4G0NA 2FPKA 1E0JA 2ZXUA 1IM2A 2X2FA 3U4QB 1QJ1B 3ZQJA 1OIWA 4G1UC 2P8OC 2HPQH 3GYLB 4Q9HA 5D3MB 1MO5A 3VB6A 4DSTA 2ZPQA 4PXAA 4TPYA 4B3FX 4YM9A 5SZJA 1VCIA 1BB0B 3QK1A 1LV7A 2EFDB 3BTEE 2Y8EA 1MCVA 1O3DA 1OPXA 1LO6A 2G0TA 3FP7E 5HKKA 1Y5UT 1TIOA 3KQEA 3ZIAA 1A0HB 4PFSA 2J34A 4DRZA 3UTUH 4CEJA 5JJKA 3OHMA 1UKVY 2OBNA 2ZGHA 3E91A 3ZVLA 2FFQA 3L43A 1A0JA 1VGCB 3VMFA 1Z8FA 1FX0B 3CPHA 5C18A 1FJSA 4UNPA 2C4FH 1QA7A 2EVWX 5HGGA 1V2ST 1O3AA 1KTSB 5K0HA 1BMLA 4WMFA 2BBTA 1HJ8A 1E79A 3TGJE 1TUEA 1GRNA 2A2QH 2AMQA 2CEAA 3QUSA 1ZNXA 3PV5A 2BMGB 1EXFA 2G55A 1W44A 1SVIA 4NCIA 1Y8TA 4MDEA 1O5EH 1E1RD 3KCGH 5JBAS 1Q44A 4US1R 5C46F 1NU9A 1DS6A 3SJ8A 1DVAH 1C1SA 3T2NA 4UNRA 4Q2KA 3CRVA 2GJSA 5EE9A 1BJVA 1B0UA 4NSVA 1AI8H 2VHCA 2ZCKP 2OXSA 3STIA 1WU1A 2FYRA 3UUZA 1O38A 1MAXA 1EG7A 3A7VA 2H7VA 4Z8YA 5AVDA 2VWMA 2VVVA 4MPWA 1J9CH 4JZIA 5GJ4B 4Z54A 3SOPA 2J46A 1C1WH 1XD2A 4NZQA 2ZHDA 2I1QA 2O8MA 1CS4C 2ZPTX 3AF1A 1S0UA 3WYFA 1WF3A 4BAQB 1CR0A 1RTFB 2BY8X 3DUXH 3LO5A 2A2ZA 5J4VA 4JMYA 2GWHA 1KAOA 2ZS9A 4QJ4A 2FWWA 1E1QD 2B5TB 1BBRE 1OHHD 3FZDA 1P72A 3UNSA 3SW2B 1Z2AA 3F8TA 2ZM5A 1K5GA 1NIJA 3AW0A 3TK9A 5JLJA 1W0JD 1OWEA 2O8EA 1EWQA 5JB9S 3TBKA 1EB2A 5EXSA 1CQQA 3RHFA 1NESE 2HJVA 4UNNA 2ZJBA 1AK2A 3THYB 2BZAA 3AGPA 1ZPCA 1EFUA 1IXSB 4RCZA 2ZTSA 2I1VB 4U02A 3R9XA 1FOEB 2VSOA 2HGTH 1OLOA 3LW8A 1KK3A 4ZI3A 4X6PA 4CRBA 1JWTA 3RRYA 1HIAA 2ZFTA 1VCNA 2BKEA 1KAGA 3P8GA 5JJIA 1GHXH 1OE0A 1D2MA 1D3QB 3H09A 5EOKA 3BRWD 1KJWA 1RFLA 4DLSA 1TX8A 3EX7C 2FLRH 5FR1A 3MNXA 4Y8YA 2EI7A 3V4FA 1SVWA 4TZ6A 1ZD9A 3CF2A 2GAOA 3ZD6A 1TAWA 2PBRA 1C5WB 2F1HA 1OYTH 1YQTA 2YKGA 1EZXC 3LH3A 2JETC 3C4JA 1GBHA 2ZR9A 1ZRBA 2OILA 3I1FA 2RGXA 1P9UA 3S7HB 3GCHB 1WV7H 4GPTA 3BIFA 5DO9A 1OB5A 2HLDD 2DFTA 2Y7XA 3U98H 2BOVA 2AXNA 4K8OA 4DOQA 2J1LA 2ZSAA 3SORA 3E90B 2CVFA 3MUFA 4OM9A 1TF2A 3R8FA 1HE1C 4PROA 2ZTZA 4WH8A 2Q3MA 1CJUC 1X1SA 1F0SA 2AX4A 4Y76A 3RXEA 1BRBE 1GJ5H 2O8FB 2C04A 2L0XA 4KODA 2ESTE 3SU0A 1GJ4H 3SNCA 4GLYA 4B2AA 1TPZA 3NHBA 4Q66C 1DOAA 2F55A 5DPAA 3PEYA 2V7QD 3FFAA 1TMUH 2F9LA 1OXVA 5C5OA 3V0XA 4XFQA 4A0HA 3GLGE 3BN9A 1W5TA 4Q02A 1BMFD 2DB3A 1E6CA 2R6CA 1U8ZA 3NEJA 2UUKB 3VR6A 2K5UA 3BTME 1CT4E 1AQUA 5F8XA 1V2KT 4NU0A 2GXQA 4GFDA 3T1VA 1EFCA 1R2QA 1TAGA 3JVUA 3VAAA 2ZSDA 3U6BA 4GOJA 3ODFA 4CRFA 1W2KH 4CT5A 4AI6A 5HCIA 4URUR 4Q7YA 4KYIB 3IUYA 1G4AE 5IHPA 1GDQA 1RRGA 3CNNA 3DM5A 2PJZA 4KELA 4M0LA 1QBKC 3K53A 2ZRNA 1Q3TA 1U94A 1PQ5A 4P32A 2KBFA 4X8VH 1G8HA 5KUTA 2VWLA 4TTPA 2HXYA 4ZKEA 5H1YA 3ZLJA 1KXBA 3L0SA 4HZIA 5CDFA 4IRUB 4OK5A 1NT1A 1DOJA 1ZGVA 2B7BA 5JECA 3TAUA 4HATA 4URXR 1L2EA 3RMNH 2PUXB 2IXFA 1XD8A 1E9DA 1W14U 4K8BA 2WWWA 3OYPA 2AKAB 4BPBA 1Z0FA 1UFQA 1P02A 1P0SH 2O8LA 3A83A 1VYUA 2LWIA 1O3EA 3AK5A 1E2QA 4XSKU 3T12A 3PROA 5KDOA 2HOBA 4EKDA 2DPXA 1M34E 3GEHA 3ADCA 1OH6A 1AS2A 1WBGB 1AU8A 2TBSA 1Z07A 4BLQA 1FY5A 3LOXA 3CWZA 3M36A 4IDOA 4AOQA 2GCOA 4M22A 1ZSKA 2A5FA 3GLHE 2IX3A 3ZVFA 2BQ7B 1EASA 3PFIA 3OIVA 1F2UA 3PLBA 4BTUB 3RSOA 1NY6A 3OE7D 5DGJA 1C5QA 4CVNA 2GA8A 1Y5BT 3CPJB 2XOKA 5G41A 1S0RA 3KDSE 4L9SA 1Z6JH 1HPGA 4YOGA 1XU4A 4ZKRU 4NE2A 5FBQB 3A8TA 2V6NA 5CLQA 1J99A 4KYUA 1WRBA 3GCTG 2GZ7A 4TYPA 2P59A 2QAAA 5LPRA 3VPKA 1Y3VA 1KI6A 1ZVQA 1EFRD 3SGAE 4PQRA 1C5NH 2IN2A 2HT6A 4TL6A 4TY6A 1KZ7B 1XRJA 1FPMA 4AFUA 3SUDA 3WMFA 3ZDQA 3EA9A 2HF8A 3ASZA 4DIDA 1FIWA 4TLBA 1K2I1 4QL3A 2QN5T 2UZ3A 1OXSC 2AK3A 3P20A 5FOWA 1C5RA 3AVWA 4BFXA 4ACAA 3PCRB 5K8LA 2ZDKA 4A8JA 2ZJ8A 1AS0A 3RS2A 2UUFB 3TSZA 2WM9B 1KNQA 5HE8A 1UKEA 1V5WA 5JHGB 1N8OC 2E1RA 2G51A 2R62A 3VR1A 4IW4E 4MQAA 4XVQA 4RKOB 3U3OA 4LJ4A 4Y0ZE 1I2DA 1HAIH 3WHLA 2QXIA 2VWNA 2XB2A 4HLCA 4HI0E 5CM9C 2WV9A 1CJVC 3QG5A 3IG6B 4LBYA 3SU5A 1O3IA 1M1YE 2P3SA 4FXGH 3AUYA 1G21E 1VHTA 2ZWLH 4P4SA 3RC5A 1C2IA 2C93B 2PKSB 1KIGH 3TSOA 4AYVB 1TALA 4N0EA 4Z1MD 2WIBA 2ZANA 2IYTA 4ZKNU 3GY8A 1OSSA 1G32B 4YMWA 1KDQB 5KDDA 1Q0UA 1SGNE 3EASA 3CX6A 2R2WU 2LCFA 3BGWA 4A8JC 4JLVA 2JLUA 5JEDA 5GPIB 1BDAA 3RXHA 1C5YB 2A5KA 1MOZA 1A46H 2D3WA 3HYTA 5LPEA 1X86B 4IOMA 4PZYA 4ARZA 5LPNA 2YWGA 3B85A 1E9FA 3IO5A 1LVYA 1JIMA 2WPDD 2HYDA 1WQVH 2VP2A 5L3QB 2VLIA 2C8WB 3AP1A 2V6IA 1IXZA 2IXGA 5JYIA 3FMOB 4RFSA 1BTZA 4KLNA 3EIHA 2OQ5A 2D2EA 1K1JA 3PMJA 3LDAA 5TJXA 1XTRA 2VVUA 4AORA 5J4YA 1RIFA 3V4RA 1YPLH 1PFXC 1G18A 3MRSA 1GMDG 2VVCA 4Q00A 2YWHA 1QBVH 2EA3A 5FUVA 2ZFQH 1ZC4A 4DSUA 1MH1A 2RMKA 1CT2E 1KI1A 4HLQB 1SGFA 2WYGA 1KMQA 1CJKC 2GHIA 3B9FH 1GJ9B 3WHKA 3Q7PA 4C0BA 1F3OA 4HUQA 3OFND 3P1JA 1YR6A 1QCPA 3LBIA 2KI5A 4ZH8A 1GI2A 1C4V2 2BMJA 3RXVA 3ZYCA 3I77A 1ZYOA 2H8KA 1Q1BA 1BRAA 2RA0A 4GZMA 4ISNA 2NMVA 1XJ0A 1ZIOA 4MG3A 2GV6A 1VIAA 3ZZDA 2FZZA 4CRCA 3NUMA 1JEEA 4PC3A 4E7NA 1UTKA 1BO6A 4M1MA 3DMDA 4HEJA 5M04A 3PYHA 2ODQA 4B73A 2GBLA 4PZLA 1GSIA 4K5ZA 4OK3A 1CBUA 1Q1ZA 3A1UA 5A8YA 4I8JA 3CPEA 4FCVA 2SGDE 2Q3FA 1ZTJA 4ZUHA 2BLQA 1BCUH 1W10U 1V6DA 4URWR 1O2VA 2J4IA 1GHAG 1HAPH 1QQUA 1E4VA 1FAKH 2RG3A 4Y0YE 1KMHB 3QJYA 2WWXA 1GM5A 4MPXA 1GVZA 3HK6B 2B8TA 2PT5A 5G53C 3DD2H 1CGIE 5AHGH 4Q9JA 3KQUA 5FBEA 2ZDVH 4N0DA 2WSSA 3GLFA 4DJZB 1PVOA 1FNNA 3ETLA 4U5XA 3QE0A 4JK6A 3KF2A 4HB3A 2PCLA 2F9NA 5FL7A 3A36A 2ZVQX 2JJ1A 2QE7A 4QFMA 2PTNA 1WA5A 2VP9A 3D31A 2GZ9A 2GBLC 1TRNA 2IF2A 2H5CA 2G81E 4RZ2A 5LDDC 5DIFA 3D62A 3TJZA 2SGFE 2J95A 1E0KA 3W5JA 1YVDA 2NO0A 3WRXC 3QEJA 1F5LA 2QGNA 3R8CA 5JCPA 3IHLA 2Z9JA 1K1LA 1ANBA 5TMPA 1F7ZA 4IC6A 2ZITA 4X2WA 1ZU5A 1MTNB 4KCGA 4V02A 1DXWA 2O8BB 2C03A 2ZKSA 3GJ6A 2FESH 3SNEA 2G3YA 1XUIA 1GBCA 3VXFH 4D0NA 1T31A 2AGGX 1US8B 2HXSA 5JZVA 1IAUA 1S96A 3GEIA 4W5HA 4CBNA 2A7HA 1NFYA 4D9QA 1RC8A 3U5ZB 4UONA 2ZTXA 2G0NA 2A5JA 1N6OA 1AKSA 4X2VA 4JLJA 3T1TA 5GADl 4GP6A 1E2JA 1WXRA 3PXGA 2IS6A 1YCPM 5LD2B 3LXRA 1NMZA 1VZQH 4O97A 2IHBA 4DT7B 4EIWA 2FG5A 4ILEA 1ZMLA 5EUMA 4ISOA 2QPOA 4K3JA 4TLDA 2BJWA 1UVOA 1MQ5A 3UG6A 3H0KA 2NU2E 2JIZA 3PV2A 5BYKA 4HB2A 1FFHA 1IBRA 2BOKA 1KSNA 1Z8GA 3P4YA 4M9XA 1SGEE 2A7CA 2X8AA 3BTDE 2IK8A 4YOIA 3MJHA 3VKHA 4M1TA 4ZI2A 4PO1A 3O8RA 1W8BH 4GSYA 4JYBA 3NIBA 3THWA 2VIQA 4ABDA 1Y63A 3TVDA 4HAVA 1TQ7B 4D0GA 2R2AA 5H8WA 2AK2A 1FNMA 2IJD1 3QPWA 5EPYA 1OKKA 4DBLC 2LPRA 1AE8H 3UXMA 1SGQE 3NDPA 2BZ6H 2PLRA 4Q1AA 1U6QA 4FXPA 2F7SA 1G7CA 3U9AH 4QBFA 1EZUC 1ETSH 1W0YH 1XMNB 1DFPA 2YOHA 2FOHA 1SOZA 3ATMA 2G5VA 1QG2A 4MGYR 2A4OA 1AGRA 1DAKA 5JCZA 1E99A 1P7CA 3HPRA 3MU1A 5IRCD 4JSTA 3BIUH 5G3ZA 4A82A 1VDZA 2CHQA 4OS2A 1OV4A 4GMXA 1GJBB 3PO1C 3AVZA 1G7SA 2Y82A 2YOGA 3S1AA 1X8KA 1UJ1A 2GESA 2TIOA 1S1MA 1KXDA 2BDTA 2WBLC 1CSOE 1PYTD 4DURA 3KQHA 4XVUA 4DCDA 4IDHA 4LV6A 2V8OA 1EWRA 3D3QA 1N6HA 2P8OB 2RCNA 5FXLA 3GEEA 3P95A 1ARCA 3I73A 1T8TA 2B8OH 1N6NA 1E2HA 4KV9A 1J2JA 2Z94A 2OBQA 5B58C 1HEIA 6Q21A 2X19A 4TWZA 2YYZA 2IS2A 1N6XA 3B9PA 2ZU2A 2W2TA 1N0UA 1UKYA 4ASUD 2FMJA 5C1UA 2IT1A 3TK6A 3F68H 2OG2A 2BXUH 2ODYB 1HYQA 8ESTE 2FDAA 2Q9CA 1S0QA 1TPPA 1HY3A 2PHBA 4WXPA 2WPIS 1O33A 4BLSA 1V2WT 5DP3A 5DISB 4V0ME 3MWYW 2FOEA 2ZF0H 3NG1A 3SGBE 4NDZA 4U00A 3B1XA 1W7XH 4AFSA 3HPQA 1O5AB 1ZHPA 2SGPE 3LQRA 3SFVA 2BD9A 1UTLM 1E1QA 1SVOA 2ZHFH 4IMZA 1GKYA 1A7SA 5FBLB 3RDZA 4CEJB 5E0GA 2RGDA 2XBWA 2OSBA 2G88A 1YM0A 4IHQA 3SO3A 4I1UA 3F1SB 2ZDNA 2FE4A 1R5BA 3F9GA 5IK2D 3QY0A 4OQXA 2JGNA 3LGWA 2ZRGA 2YJTD 5LB4A 4VGCB 1S5SA 4LUCA 4CHAC 1ZUNB 5I25A 1E0FD 1GI7B 4Q9IA 4B44A 4UXJA 1EKBB 3RS3A 1IY0A 4ZIRA 1Z08A 2ECKA 1O3CA 1GDNA 2GZ8A 1N3BA 4LSGA 1ZHMA 3BTGE 2H6MA 3ZZAA 3AB3A 1JOUB 5FOXA 2THFB 4UD9H 2FSHA 4Q7LA 4JLKA 3EGKH 2CVHA 2A4QA 3U7EB 2XCNA 5AK0A 1YLCA 4OQLA 3FPAA 5KTYA 3CIOA 4LJYA 1NU7B 2ZI5A 2ZEBA 3V7TA 3LNCA 2WPJS 2WWGA 4RKFA 2WPKS 1A61H 1XJCA 2I4IA 2CCJA 4LX0A 5CB6A 3R7WA 4DDUA 1GCTB 5CM8B 3D7MA 1ZINA 3RXDA 5F8ZA 2GK7A 2BMFA 3QBTA 5JWRA 1HT2E 3TJVA 4Q7KA 4XOIA 5AUPB 5C1XA 3U61B 1TONA 2SHKA 1Z3IX 2C8ZB 3KFVA 1Z0KA 3CS7A 1FP7A 1GL0E 1IN8A 1XMSA 2GMTC 4ZHMU 2QNRA 1O2UA 1JEDA 4MDSA 1NRQH 4A6PA 1UPTA 3CKLA 1AVWA 1MH0A 1LTQA 1C5ZB 1MBMA 3PTBA 4O0MA 1P2IA 2F83A 1NO9H 1H1BA 1NJGA 3T5GA 2FSFA 2XZPA 1ORFA 2O8EB 4BEBA 2XZLA 1YC0A 2RGBA 3SI4H 2JETB 3B1ZA 2A1DB 2V7QA 4AKEA 1SQTA 2FPLA 4AFZA 1O3JA 4CZ2A 3VB4A 4HSEA 3SHAH 3IEVA 2RHMA 3FKQA 4I31A 2AFIE 3IITA 2XSZD 2JLRA 1P12E 4E05H 2ANCA 1KSHA 3T1OA 3KTAB 3BG4C 2BD8A 3SJZA 4EJSC 3PMBB 1J90A 3CF6R 4TQUS 3A85A 4Q1DA 4KVGA 1KXAA 3V00A 1YZTA 3PENA 2NO7A 2Z7FE 3BORA 4A6LA 3GD7A 4TPIZ 4MH0R 1FMJA 3ZZBA 3PR1A 2CK3D 2EWVA 3A7YA 2IYRA 1VITF 4SGAE 5KPJA 2VP5A 4H42U 3SU3A 4JJZA 5J4HA 4I32A 2XBYA 2J92A 1A3EH 1FI8A 3CRMA 2WMOB 2Z0MA 5GJBA 1K28D 5CLLA 3CW2A 3HU3A 2Y5GA 1OX1A 2BXTH 4BZPA 2ZZUH 1MZAA 2VP6A 3LBHA 4OHWA 1W11U 3M4YA 2R65A 3A87A 3AQ4A 2PSXA 3S7KB 1G3UA 1P2SA 1WOFA 1L1GA 2QF0A 1IHUA 3VTKA 5DYIA 3U8TH 4M9ZA 2CNWD 3K09A 2PR3A 3LPRA 1NVWQ 1JRSA 1UAAA 2BEKA 1OPHB 2I6QA 2VA8A 2H9HA 3QPVA 5GVSA 3E70C 4XSHA 1TGTA 4PZZA 3PJRA 2ANMH 2XW9A 2QA9E 3Q72A 4YTAA 2H5EA 3VHXA 2BBOA 1O2XA 2QMEA 2A32A 4IN2A 1IQPA 3GJ4A 3PMHB 4ABGA 3W8NA 1HAHH 4GSOA 5K8TA 2ZTYA 3U7FB 2AWNA 3NBYC 5FUWA 1TOMH 2EQBA 2EYQA 1OF1A 2JLVA 1KOFA 1QVAA 1SR5C 4JL5A 1HAGE 2AGEX 1NP6A 2JEOA 1O2QA 3OE7A 1XX6A 2GT7A 3QKRB 1U0HC 3H7TA 3I32A 4B32A 2O8TA 2F1JA 1GHWH 1OJLA 2JATA 1ETUA 4AD8A 4BTTB 1C5SA 4O2LA 2YNBA 2QTFA 3EWAA 4TZ0A 2PGBB 1DAFA 1EFRA 1AMHA 2ZYWX 1UBEA 4HB0A 3GCOA 3SUGA 1GHAF 4MKIA 5B2ZA 1KY2A 3N5CA 3IIMA 3ICEA 5F8TA 2Q3HA 2JAQA 1OB2A 5J47A 3PM3A 2ZYUX 3AAUA 5B64A 1R0ZA 2FOGA 3TE6A 1AJEA 1RW4A 2OK5A 1XB2A 4B3XA 1II0A 3O8CA 2O0JA 3SV9A 3T15A 4X8TH 1TF5A 5FX6A 1BOQA 2AMPA 1CF4A 2SGEE 1ZNYA 3IEUA 1NVVQ 1GI8B 3TNFA 4QC2A 5KSOA 5KO2A 4I7YH 5P21A 2ZU1A 3T62A 2CXVA 5L3RA 1OWHA 3L6PA 2NPIA 2VIDA 4HLDA 1XUJA 5JI3E 4D2IA 521PA 1HAXB 1PPEE 5AR1A 3ZZ9A 1GBBA 1RRCA 2A4RA 4NCNA 1G3BA 2FYQA 3HATH 1D4PB 1G291 3FP6E 4F49A 4JLNA 5DHAA 2IHYA 2V35A 2CXXA 2OUAA 2CL7X 1IN7A 1JAIA 1DWDH 3Q8XB 3K0CA 4Z1MA 4EPVA 1GRQA 3U1JB 2W2XA 1UCYK 1GI0A 1OXUA 1GWNA 4R8TB 5CIWA 2GCOB 2QXJA 1K1PA 1SQOA 1Q2WA 1F2UB 2WAXA 3A4NA 2FSGA 4JIMA 4E5UA 1WTHD 5HYOA 2ZI7A 1LVOA 1SVPA 2ZHEH 1A1VA 5TCAA 3TH2H 4HAWA 3RS7A 1K1NA 1OIXA 4WZ6A 1XTJA 4UE7H 3BTTE 1BMMH 1KI6B 4MRNA 4CRGA 1N1LA 3FMFA 4JYCA 2ZRFA 4ZDIA 1T9HA 1MU8B 2ZI4A 3CH4B 3SBKA 2ZDLA 4B1TA 1BMAA 5DK1A 4NHOA 3RS0A 5HPYB 1W0KA 4PPGA 3ZS9A 5JPMH 2ZAMA 3KUDA 5F03A 2GP9B 1NKTA 1F6BA 4MRSA 3QTVH 3KGPA 1ESNA 4CT4B 4P31A 1P8VC 3PUYA 4A8JB 1COWA 4RD1A 4X8MA 1FLEE 2RA3A 3PV4A 1VCQA 1W13U 3K0AB 1TPSA 3E1SA 1EX3A 3GLGA 4X0WU 3EAQA 5IF9A 3AH8A 1GMHG 1DICA 4TLEA 3RC8A 5BN3A 3URDA 5DP7A 2IYQA 3ZIAD 1KLTA 3TGIE 2IYYA 3RXUA 1FY3A 1GJ8B 4US0R 2FEOA 2QSZA 2JCSA 1DT2A 4OQNA 3GICB 5CDFE 1DE7H 5KOYA 2EWWA 3Q3YA 4CW7A 5G3YA 2OINA 2C78A 2ERXA 4CGZA 1ZM2A 4UNQA 1V2QT 2ZU5A 3KHVA 4FMDF 4B34A 3MO6A 1KHTA 2W3KA 1CP2A 2J45A 3BAFA 2V3HH 1ANDA 1VG0B 3E2IA 1AGJA 1LQEA 4OQMA 3WY9A 2PLFA 3SYLA 4ISHH 4XDEA 5A4JA 1A2BA 1I4TD 2CL6X 5GNDA 1UCYH 2KAIA 3GY2A 4DSOA 2KWIA 2LKCA 3SJBA 4EPRA 9ESTA 2IW3A 2Z9GA 3WNCA 1YE8A 1JALA 2XNDD 2D06A 2J38A 2G77B 5EODA 2AIPA 1MKWK 2HJGA 4O25A 2ZUBA 3BWDD 2ORIA 1PPCE 1RKBA 1E35B 4NIWA 5EW1H 3K65B 3MOCA 4WXVA 3LVRE 2GZHA 4IFEA 1P60A 4AG2A 4QGHA 3FAOA 1HUQA 3HWSA 2QM7A 2Q9BA 4U30A 3WP0A 1EUFA 3BB4A 1FONA 8LPRA 1WYKA 2G4UA 1U81A 1RYHA 1IOEA 3CONA 2V4ZA 5FTJA 4JVLA 3UQOA 3GLHA 4V0NA 4DDVA 3UWJH 1H4WA 4B6EA 3VEQB 1P2UA 1SHHB 2QP9X 2GTBA 3HGPA 3N7OA 3GISB 1F5RA 3KKMA 4PAOA 4HUQB 1L8QA 4GNKA 3MD0A 4ZDJA 3BS4A 1V2MT 1WCV1 4Y0VA 2PW8H 2WKRA 2RCEA 2C99A 4P4UA 4XOJA 4PHGA 3I5XA 4JYVH 1KDOA 2JLYA 2ALVA 5H68A 3FKSD 2DYKA 3W95A 1XVMA 1P9NA 4JLPA 4OS1A 4A92A 1T8NA 3UPEA 2VP0A 1O87A 3WY8A 3NWJA 2VH0A 3SQEE 4AIIA 4LGMA 3RXKA 4QHTA 4IVRA 1KYIA 3ZVEA 4OK6A 3KQLA 4L4UA 4ZPXA 3M35A 3HP1A 1C4OA 3AASA 1Y3WA 4DCUA 3VGCC 4AKIA 1YPGH 3T5FH 4G5QA 1T3SA 2P3UB 1NLFA 5AUOB 4GRAA 3PTNA 4FUHA 1LB1B 1U9IC 1RFNA 2V6JA 1KKLA 3NBFA 1KXFA 2B6HA 1MKWH 3AF4A 2HNTF 1M7GA 5FI1B 1PZNA 3BFKA 4XVRA 4LJ6A 2F9VA 3MI4A 1GBTA 1UM8A 4ZKOU 1EK0A 5CITA 1E34B 3LC3A 4LPKA 5GIBA 2UWLA 2JASA 1CKEA 1DPFA 4E09A 3GY4A 4QBHA 1ANCA 3EC1A 4M1KA 3F6UH 5EXNA 7GCHG 5FX5A 4GT1A 1UTJA 4Q4HA 3ND9A 1D9ZA 1VG1A 4WVPE 1T0HB 1T5LA 1P3JA 2F43B 3NKVA 3SFZA 1ZPBA 5JBCS 4PC1A 3FFBA 1SHYA 2A5AA 1SXJA 1IQIA 1NRRH 3IBYA 4DW2U 1XPRA 2XWAA 3KB1A 1C1TA 5EUQB 1D2EA 2W58A 4QGGA 3NCLA 1CBWB 4BRUA 1RS0A 4AB9A 1Y3UA 4UXHA 5J5CA 1FTNA 4ZAEA 5J4LA 1GVLA 1EPTA 3RXJA 4AGKA 4X8SH 4UFFH 4Z0KA 2YNMA 3BC1A 4TN1A 1C1MA 3W94A 5UKDA 5F9HA 1V2TT 2ULLA 4JSYA 3A82A 4FUDA 1TU4A 1ELAA 3ZZ8A 3MU0A 1SZPA 3AUXA 3LVQE 4NYIR 3TU7H 4AYXA 2IYSA 2NTYC 4I8KA 1NRJB 2CBZA 4DLVA 4F91B 2OT3B 3P92A 4RI0A 2GD4B 3BOSA 4G5RA 1HAZB 3BD9A 4M4SA 3TNSA 2RHDA 3SUEA 3SNAA 1ZCAA 2G6BA 4LYFA 5F6MA 4ERNA 4AX9H 4BZXA 2IOTA 3ZVBA 1AZTA 2VL7A 1WXQA 1UCYE 1AWHB 3PO1B 3ZS8A 5A0AE 1KYNA 2O52A 3SU2A 4TL7A 3THWB 3SHFA 1W3CA 3B2EA 5LH8A 4NIYA 2VF8A 3WYGA 1BTPA 1EPTC 1O3KA 1A5TA 4JLAA 3THOA 1PYTC 3BK7A 3EIQA 4ABEA 4FI3C 4ZCIA 2O0HA 3A1TA 3GLFE 1Z47A 4HAUA 2GEVA 3CRQA 5KPDA 4X2XA 1RD3B 2C77A 4UNSA 5HXFA 3QVVA 1IQEA 1ELEE 2GRJA 1W2GA 2ANBA 2FSIA 4YT6H 1GTVA 2VNTA 1TF7A 2BY9X 3PEWA 4TQ9A 2VHQA 4IGDA 1TX7A 2GNOA 1HXFH 1CHOG 4DLZA 1FAXA 1TADA 4YMSA 2XOKD 3SQXA 3HDTA 3PLPA 1E9AA 3RANA 3T28A 5JFGA 4Z6AH 2BQ6B 3S1AB 2QAGA 3N2EA 2BVRH 1XTQA 2O8CA 2CHAB 3RXAA 2QMOA 1ZMJA 3D8BA 5T6DA 1IN5A 2OV2A 5J4SA 1GJ6A 1VPLA 2KBEA 4PSVA 3IPYA 4Y8ZA 2BDGA 2WIAA 2XJ9A 3X2SA 1GI1A 1O2RA 3TLXA 3FVFB 1KJZA 5HM2A 1TUIA 3ZZCA 1CR2A 4H1VA 1ZCBA 1FXYA 2J0UA 4CREA 1BH2A 1LF0A 2ZJOA 1AZZA 1XX9A 1H8IH 1SGWA 2GJ8A 4Q4AA 5EW2H 3UY9A 3A7ZA 4D4JA 1JIRA 4Q4LA 1YPHC 2ZJZA 3K70D 4BOHA 1R0XA 2IUTA 1X7AC 3ZVAA 1MZDA 3FYHA 1ARBA 4P3YA 3M7UA 4CHAB 1RYFA 4UQOA 4DCSA 1LVBA 1P75A 4ON9A 2BD4A 4FMCB 3BH0A 3LU9B 2C98A 1CGHA 2QAGC 3KQDA 3RP2A 4GI7A 1GL9B 3RMMH 4URVR 5JSZA 2D74A 2H57A 1AKEA 4QOSA 1E2GA 1N25A 5LGOA 3HU1A 2ZROA 5DYGA 1UDXA 1ZIPA 3UANA 4AB8A 3SQWA 1ZHRA 1P2MA 4RVCA 1FN6A 1JXPA 3FE2A 4NCHA 1K1OA 1Z7KA 2V55B 2DCUA 3LJOA 1TMKA 1RRFA 2QYIA 4URYR 1OXXK 3SV8A 2OLJA 2VBCA 4SGBE 2F3TA 1Q1EA 2R9VA 4NKRA 2ZP0H 4DCNA 5DLQC 4MITA 1UHBB 1PQAA 2GV7A 5FHTA 3H1TA 4YLGA 2WPMS 3UNRA 2EFCB 1U2RA 4TTQA 4LYJA 1EP6A 1C5MD 1DG3A 1IQGA 3SI7A 3PEUA 1H8EA 2FEQH 1QA0A 4GDFA 4R98A 1OXTA 1BZXE 1S3SA 1GBLA 1CA0B 1ZU4A 4WXIA 4OHVA 2GMTB 1M9UA 4UFDH 2VRWA 1HQYE 6CHAB 5TXGA 3EPHA 1TRYA 1GHBF 1MTVA 1R8SA 4MYHA 3EAJA 3BB1A 4XWKA 1M74A 3VFEA 1EXMA 1NN1A 1XNJA 5IDVA 2ANYA 1ELVA 1ZTKA 5E2PA 1W46A 3R7WB 4MNVA 2Q1JA 4TL8A 5AUQA 1XVOA 4BTIB 1T8OA 3DM9B 5FOSA 4DUGD 3FTQA 3TGPA 1TBZH 3U8OH 1KO8A 3B1WA 5E7MA 4W5JA 4Y7AA 2OM2A 2RDLA 2VEDA 1YR9A 2WPLS 3BG4B 3FB4A 4EJSB 1G1MA 2CMYA 5ANRB 4ZHLU 3GQBA 3GLIE 1UVTH 1GNQA 5KNBA 3CLVA 2AWOA 1E98A 3EG5A 2CNWA 3T25A 3F5FA 4C0SA 2P2LA 2W2VA 1UK2A 1MTSA 1NVVR 4ZV4A 2R44A 1KXCA 1EAUA 5H4IB 2OFXA 3LLMA 1HH4A 2C9CA 5JBQA 5HR5A 3MFYA 1LS1A 3RNLA 3IKJA 1QHYA 2WMNB 5HE9A 3SJKA 4A1TA 2O0KA 2ODNA 2UUYA 1O32A 1OOKB 1OP2A 3NWUA 3NC0C 3M0EA 2BWJA 1HV8A 5BXQC 4V0MA 2HV8A 2P3TB 1GGDC 2XTNA 4ZMAH 4C0LA 3EPKA 1TNIA 1EZSC 3OSYA 2PZGA 2FS8A 3ATKA 1SSXA 2V3OH 1D3TB 4NFEA 5HM9A 2SGQE 3HJNA 2QE7D 1P3CA 1YPMH 3QGNB 3U44A 3K0SA 1YP9A 2HLCA 1BOFA 4OS5A 3VB5A 2OLGA 1E2DA 4TT3D 1ESMA 2DE9A 2VWOA 2QQ0A 4XWAA 4RSGA 4L9WA 3CNLA 4DDWA 2P6UA 1Z22A 2VP4A 3RXCA 1OYWA 2QCYA 1L4ZA 1AY6H 1GNRA 1EJNA 4UJ5A 1QHXA 4EDHA 3BV9B 5C1BA 1O3LA 5FPYA 4FCTA 2R9PA 1O2LA 3B5JA 1L1NA 1A82A 4MGZR 1GUAA 3WP1B 2OBMA 1GKIA 1QJ7B 3EW9A 5EXTA 4IKEA 4TMXA 1RJ9A 3CR8A 5FBRB 1MD7A 1Z28A 5BW8A 3LBNA 1BITA 3WNDA 5A8ZA 3ZZUA 2OD3B 2VB0A 1G37A 4ZROA 4BFWA 5F9FA 4LC1A 1ZSLA 1LPKB 4QT8C 1OKXA 3U4QA 2XAUA 4D7GA 1CIPA 1A7JA 4UDWH 1O5CB 2RGEA 4JMPA 2D2FA 1XM1A 1B0EA 3TR5A 5DHFA 2WKPA 1YBWA 1J14A 1II8A 2VGCB 3F3YA 4F4IA 4AURA 1YKSA 4LXBH 3P70B 4CBOA 4TSFD 2IWRA 2JIZD 1C4Y2 2FTLE 4LJ8A 4U32A 3AVOA 1W7GH 3RSLA 5E0JA 1E32A 1MKXH 3HKIB 1Z63A 3LGYA 2CF9H 1C1OA 5H70A 4DT1A 1Z8RA 4LK2A 4WAUA 1DSUA 1HAOH 3LY5A 1THRH 1ABJH 1J15A 4QG7A 5JWHA 2EI8A 5D3QA 3R0FA 3AEZA 3AVXA 1OKKD 1Q20A 1BKDR 3T27A 1KO7A 1K6MA 4WH6A 1LHEH 1VJ9U 2FX6A 3ZZ7A 4M9FA 2E9SA 2X77A 1C9KA 4PQYA 3UREA 3WNBA 3GMTA 3ADKA 2GX4A 1FIZA 3BTWE 1HT1E 3RM2H 1BYUA 3CM0A 7GCHF 2CCGA 4TQAA 2ZI2H 2HCJB 1Z6TA 5EG4A 3A88A 2C90B 1V2VT 2JA1A 4B3GA 3MFJA 1FZQA 3OEHA 3TIFA 3MNCA 1C2DA 4ABBA 2F6RA 2VINA 2J5XA 2QP3A 3DOFA 2FP7B 1NFXA 1YU9A 2YHSA 3CZQA 2BX3A 1ZUHA 3BXZA 1VG9B 1GAJA 2B8WA 4Q1BA 2MMGA 4M21A 3UWIA 4E03A 1NRNH 1THSH 2FOCA 2VIOA 1IAQA 3MU5A 3P8NA 5KU1A 1DAHA 5TCCA 1QRWA 1NSFA 4FWTA 4B6FA 5FH9A 3QIAA 2R3UA 5C1YA 1HDTH 1MABA 2ZS7A 2JJ8A 1MR3F 4PR0A 4D0LB 1QB9A 2VHJA 5FPTA 4HAZA 3DKVA 1LTOA 2RGNA 3DOEA 3A80A 3UFAA 1HURA 1SLWB 4KHZA 2IUUA 4D4MA 1OS8A 2XNDA 2M5TA 5J40A 4R2HA 4AZ2B 4IN1A 4FMCF 4RD2A 3P6ZB 3V9PA 1A5IA 3AKYA 2ZGXH 5EU8A 1G19A 4OGXA 3KXIA 3MMGA 1QRAA 1W49A 4F4OC 2VIVA 3KKQA 3SC3A 1FPCH 5FCRA 1G36A 4VGCC 3MG9A 1JR3E 2PTCE 2VH6A 4G5SA 3QKSB 4PC7A 1E9SA 2ZR7A 1T91A 4DLUA 2GJAA 5AJWA 1D6JA 3BTHE 2FTMA 1LHCH 3PITA 1XKAC 1PJRA 2BY5X 4LI0A 2UKDA 4X8LA 3ZZ0A 3TK1A 2FPZA 5C3NA 4BLTA 4FU7A 2XTTB 2IPHA 4HGCA 2C8VA 3FWYA 1O36A 3E16B 2Q6FA 1MT0A 2P6NA 1T0JB 2RGNC 3ZZ4A 1NNEA 2ZRKA 3KIDU 4IFBA 1DAIA 3LC5A 3WMGA 4LK4A 2Q6DA 1MCTA 2WKQA 2P16A 2ZDMA 4Q9LA 2QROA 3QDZB 2XTMA 1GCTC 2VSXA 1ESTA 5EGMA 5FPSA 4FMBB 1SGYE 1IY2A 2Z3EA 4CF7A 1JAHA 1TMBH 3FKSA 1YYY1 1ZJKA 1ZD1A 4X8OA 4NL4H 3BFXA 1GG6C 3WMEA 5DSZA 1CHOF 2EI6A 5KSPA 4F92B 1B7XB 3BEUA 3F9FA 1QIXB 2OBLA 2OBOA 2KAIB 2ZS8A 2NU3E 4C0AC 2VIPA 2CF8H 1TGBA 2HVXA 3GDVA 1QHIA 1NRSH 5JDUB 4YXWA 3X1DA 5G4BA 3L3TA 4QGFA 3RXFA 1KI7A 1FDPA 1BTHH 2VHUA 3SZEA 4NTZA 5AJVB 1NZQH 1B5GH 7KMEH 3UMFA 3L8ZA 4FUIA 1D9IA 2ZIQH 4INLA 1QFKH 1GMCG 5L3SA 1AQ7A 1S6FA 3EZFA 1AO5A 1KK2A 4JK5A 3GFOA 2A31A 4DSNA 5DH9A 3LH5A 4GUXA 5EZ5A 1PQ8A 1N6IA 1NL3A 2TGTA 3ZYDA 2QIQA 2ONKA 3P4XA 1VCMA 4O3UA 2GVFA 2XX3A 3E6PH 1W7AA 5AJXA 2WZQA 2AHOA 4TWYA 2W6ID 3PIRA 1G6OA 4C7OA 2PMDA 1NMXA 4H9GA 3KL6A 1ZAKA 1Q57A 1S9HA 3PUVA 4Q7JB 3GLHB 1DAMA 4YZUA 4YDHB 3VGCB 1C2JA 1GJAB 5A0BA 1VTKA 2GCNA 4ABJA 5C67A 3RLFA 2JLXA 1CT0E 2J7KA 2NGRA 1W5SA 1Z83A 3DKPA 4LHYA 1KI8A 1R4AA 4DKXA 1XXHE 5GDSH 4DG4A 4L5BA 4IOLA 2OTVA 4WWYA 5DG6A 3SHWA 1GOTA 2BD5A 4LZ4B 1B23P 1EZQA 1I4DD 1C2KA 2WWYA 4A2WA 4X2YA 1DARA 2OZEA 3REGA 3KUCA 3IO3A 3ODDA 1AM4D 1OFUX 2G8TA 2QT0A 3K9XB 1NLYA 3PUXA 1KGDA 4CRAA 3GJ7A 2HNTC 1J8MF 1IQMA 2A5IA 5FBIA 5L6NH 2FODA 2VIIA 1L4YA 4FUEA 4OJQA 2Q6TA 2FV8A 2CL0X 1J7KA 1MO4A 2JJ2D 2AR7A 4KLZA 3RVBA 1S8FA 2F3CE 5FUXA 2Q9AA 3O8BA 3EZ9A 1ESBA 3LX5A 4JKYA 5DI3A 1FQ3A 2BM2A 4JLBA 4KBFA 3SNDA 3QGJA 1OWKA 2Z6BD 1CU1A 4LJAA 3R9IA 2ZIAA 2JH0D 3RXLA 1O2MA 3PUZA 4CEIB 1XEXA 1HAVA 3M37A 4RN6A 4DLRA 1LHGH 1Z6XA 3LXXA 3VKGA 1T7CA 1DUAA 2BVNA 2AS9A 1D6WA 1KIMA 1DY8A 1S83A 2BYAX 1LPZB 4B35A 4KITB 1XZQA 1G8GA 5AJZA 4UJ3A 4YQFA 3U6KA 4U2WA 2RAPA 4FD2A 1G3DA 4AN7A 2O8UA 2GEDA 3VQTA 4DB2A 4V03A 1DY9A 4MLFB 1AS3A 2GDEH 1AVXA 4NA7A 4KTSA 1SVSA 2MSCB 1OYYA 2ZGJA 5A5GA 4C2TA 3QX5H 3VX4A 1YPEH 3SHCH 3K9LA 1O2KA 2IC5A 5BRRE 2G1KA 5DGXA 2F9PA 2PT7A 1H9HE 1PLLA 4IDNA 2PGQB 2BDHA 1JR3D 1EJMA 1QBOA 2BX4A 2AL7A 1EPTB 3RRMA 3SN6A 2QPAA 1YZQA 1BJUA 2BLOA 5ABWA 2V3CC 1C2GA 4GP7A 4I8LA 4HFPB 3P8FA 1DS2E 1KI3A 3QWCH 4RZ3A 4OI0A 1EJAA 5SGAE 4V0KA 2UWPA 2IEYA 1VYTA 4HDCA 4XBCA 1JMOH 5I46H 2XRCA 3TH3H 5L2ZH 1TNGA 3VKWA 1NM6A 4QGAA 4A1XA 2E87A 2Y5HA 3TAHA 4HAXA 1FMLA 2QQEA 2GCTC 4A1VA 3B23B 1GI4A 4O03A 1OSNA 2D7CA 3NZIA 3QO6A 4FIDA 5EXPA 4MKGA 2R3YA 3K0EA 1FW6A 1T3HA 1GWAA 1H9IE 2W7SA 2OC8A 3QKUA 3UMRA 5ELXA 4NCJA 1MTUA 1PV4A 4Q03A 1X3SA 4C4PA 1LQDB 1SG8B 1F60A 3K8YA 2R6GA 3C5CA 1N5JA 4OHXA 1SI5H 1A4WH 4OS6A 3MAAC 1M7HA 3NBXX 2ZPSA 1YCPK 1TU3A 3FANA 1D8TA 1DM4B 3RWMB 3NKKA 2HALA 4X8HA 9LPRA 1P11E 4DIHH 3A7WA 3I8SA 2YOLA 4X8UH 3RM0H 3ZGXA 2AYWA 1TGSZ 1F5KU 2Y80A 1JRTA 4AC9A 1JPNA 4FU8A 4XWOA 1QHSA 1WP9A 3UR9A 1SKYE 3QXJA 4AYWA 2A9KA 1YZNA 2Z9IA 4FUBA 1U8AA 2OXCA 1KI2A 1E0AA 4H6SB 3M3VA 4I99A 1OWIA 3UIEA 1LKBA 4IMQA 3WBJA 4BGDA 2QBYA 1KZGB 4KVAA 3GJ5A 3RABA 2VPPA 1UF9A 1Z06A 1NBMA 2QAGB 4A36A 3BSQA 1DE0A 2O8CB 1SXJE 4X6OA 3CX7A 1YRBA 4D76A 2RB4A 3LGUA 1VITG 1TTTA 1SQAA 1O2NA 2QC2A 4II7A 1YLDA 1THPB 1Z5ZA 4MPUA 4MNXA 1U0LA 1V2OT 5FPKA 2G5NA 1W0KD 3HK3B 1O5GH 4WVFA 3T34A 1NY22 1BA8B 1P05A 1S6HA 3QBVA 1AFEH 2FGKA 4KTCA 2ZJ5A 3ZZ3A 4JLOA 1SL3A 1G5PA 1COWD 2J0UB 1Q1QA 4BLOA 3EIEA 5PTPA 1G2MA 2XNSA 4IEIA 2BLWA 5BQ5A 4Q4AB 2BTCE 1C2EA 4Q1FA 2VJ1A 3M7TA 2ASUB 5DP5A 1Z71A 3A84A 3SJOA 2ZRIA 2BD7A 3RMLH 1KO4A 3UR6A 1E69A 4HZUA 1KXEA 3OEEA 1KMHA 2FNAA 4DUGA 1NRPH 4KAXA 2FFHA 3DDCA 5JSZB 4K69A 1G8YA 4QHYA 4ABAA 1TA6A 1Y3YA 3ZVCA 2DE8A 3BERA 3Q5DA 1E3MA 2R6FA 1YCPH 2ZSBA 1FNIA 2QRNA 2GVDC 4YESB 3EPJA 2GCHG 1F48A 1E4YA 1G5RA 1C4U2 1BUIA 4IXMA 4KO8A 5HCNA 1FL9A 2MMCA 3F9HA 2P67A 2GKSA 2O5VA 1C9PA 2ZRMA 3NBZC 4HLUA 2NWNA 1S9DA 1XPUA 3KEEA 3A1SA 1XEWX 1XMJA 1KY9A 4O3TA 1JR6A 4WMEA 3TIUA 1IQLA 4NH0A 1ZM9A 4G3XA 4N3NA 3LH1A 4PANA 2WUCA 3I92A 1Z6GA 4KFUA 2Y81A 3L82B 1XJQA 4LZZA 2FN4A 4KP0A 4P4TA 4JBYA 2O8BA 4TWWA 2ZU6A 2ZFPH 3K2UA 1P57B 2ZUDA 3FHOA 1VR1H 1BTXA 1Z1IA 1YKTA 3RS4A 1QHRB 1YR8A 1A5GH 3KKNA 4DB4A 3BH6A 1S2MA 5GJWC 1PPBH 3CZPA 3TR0A 1ANKA 5KNCA 3Q9LA 3AP2A 3GCNA 5KNDA 1J70A 4AKHA 1F0UA 3BTQE 5SZHB 2B7DH 1GILA 5B57C 4E06H 4HLUC 2J87A 3BEIB 4RJLA 2ATXA 1GBKA 4MRVA 1WSSH 4B2PA 1NFUA 4A2PA 4TT3A 3SE0A 3FMIA 3P17H 4MUAA 4TMVA 1I2MA 1UK3A 1P6XA 1C2HA 3ZJYA 4BAHB 1LVMA 1C2LA 1ELDE 1GGDB 2ERYA 3N70A 3NHAA 4V0LA 3E8LA 2H18A 2BOHB 3PWBA 3B60A 1E2NA 2ONJA 1W36D 3FP8E 1BBRH 2NO6A 4HTCH 3H7OA 1SULA 3BIVH 6GCHG 2TRMA 1KSJA 2P3FH 4WMDA 2ZREA 4F7WA 1C5VA 2ZCHP 5AFYH 4NFFA 5J4QA 2H9EH 3FVQA 2BKUA 3D65E 2ANWA 1GL7A 4AG1A 1T4GA 2H17A 4BLPA 8GCHG 4LHXA 4K46A 3K0FA 1QQ4A 2F9MA 2ZQ5A 5FFMA 4G5OA 3M5LA 3I61A 1O2JA 1DLEA 4Q4JB 3AVTA 1R5OA 2IYLD 2J9RA 2ZYVX 4QBIA 1DWEH 2OC1A 1SBWA 4TSFA 2GCPA 1A2KC 3OU0A 3QEOA 5C4MA 4FU9A 2EU8A 3U1IB 1CBWC 2DWOA 1GJCB 2P65A 4PHHA 4OHZA 4AY2A 3TLOA 4R71A 2ZRJA 2NO9A 4QKQA 1UK4A 4M1WA 1HE8B 4JT2A 3VR4A 5JI2E 5FTKA 3LWNA 1UBCA 2F4LA 3M6AA 2ZFRH 3U44B 1G3RA 2W5EA 2P0EA 4WZBE 1W4RA 4IVPA 1O2IA 3PV0A 4U7DA 4ZKSU 3TSWA 1GMCF 1NY5A 1OW3B 5FTNA 2J0SA 2CE7A 3L0OA 4FUGA 1ZLRA 1CA8B 2QPTA 3ZV9A 4MRPA 4BUJA 5AFZH 2QORA 4I8GA 2W26A 2PV9B 1X1RA 5F98A 1N0WA 1SXJD 1ELBA 1NVUQ 1GI5A 1HGTH 4MVNA 3MWLA 1OXGA 1M8PA 2ZJ2A 4X1SU 4X6MA 3NTUA 3W34A 1JBUH 5EP1A 2AFHE 3SS8A 5EP3A 2FMXA 2R0LA 3G01A 3LGIA 3RXTA 1FY4A 3ZVRA 1NN6A 1RE0A 4C3ZA 4YC7A 2ZVPX 1OYQA 2GJ9A 1BT7A 4U01A 1SQ5A 1BHXF 1YZKA 3M61U 1AHTH 1ZJ6A 3PVSA 1X8JA 1SLVB 3M1IA 3S9AA 4Z8XA 1ZSJA 1P03A 1LHDH 3JZ1B 2FU5C 2QM8A 4NZYA 4M8NE 2FX3A 3AF3A 3ZVNA 2AD1A 3RU4E 4JZDH 2OFWA 2ZHQH 1II8B 3OIYA 1GL1A 1MQ6A 1O2WA 4A0RA 2N42A 4LV8B 5FL3A 3SU4A 1XUGA 1WQSA 5JBBS 1NKSA 1OH5A 4YO9A 3RXOA 3KQNA 2WINI 2FI5E 2NO1A 2QEQA 5EQQA 4GHQA 1O2TA 5FTLA 3GLIA 3D6TB 2NG1A 3LAWA 1RVDA 1TQ0B 2XC4A 4RCYA 4DT1B 1Q3HA 4XJXA 2ZR0A 3ATLA 3M7QA 4Q7ZA 2XWBI 1KJYA 4D4KA 4O2RA 4RFVA 4F4JA 2CHAC 4NGAH 3KJGA 4LHVA 4RD6A 4UKDA 4D80A 4X1PU 2C2HA 3TUIC 2AEIH 3C15C 4YMTA 2D26C 2ODWA 2IYWA 3PQCA 2OLKA 1ZZZA 1ZGIA 4IS5A 1PPZA 1AE5A 1D3DB 3SJIA 1TE0A 5EQTA 3KJHA 4JBWA 1Z6EA 2WJJA 3X1ZA 2FO9A 2EFEB 3HPTB 1QL7A 4B43A 4WBSA 4A0FA 1KK0A 1LF5A 1KSGA 1F92A 1SLXB 1JI0A 1NS3A 1N5IA 4TYWA 1LS6A 4OI4A 3L0PA 4I1OA 2QI9C 3W6OA 5CIQA 2ZG0H 4ESTE 1E0SA 2O8DA 1O2HA 1EFTA 2J41A 1IQHA 4YMUA 1C1NA 2BDBA 1KLIH 3EC2A 4MYCA 3VB7A 2B21A 2DY1A 1Q12A 4EQ6A 3M3TA 1BIOA 3MH7A 3OTPA 1G9IE 1SGRE 4FMDB 2PL3A 3EPLA 4HI3A 3UQVA 2SNWA 3MNBA 1MABB 2WJHA 2IUSA 2ILNA 721PA 3FFGA 1CR4A 2C8YB 3A7XA 3GY6A 2FOBA 3EARA 1BYIA 1TBRH 2OFOA 1UJ2A 3L0IB 1SC8U 1HAYB 3JZMA 5K8UA 3G0HA 2QZ4A 4B2CA 4ABYA 1CR1A 1O2YA 2QL6A 4RZXA 1TA2A 2XC5A 2ZQ2A 1E2KA 3EQ0H 1KNXA 1HNEE 1TQ4A 1XCMA 2WICA 4B2LA 2FFAA 4EUNA 2VU8E 4Q01A 3AKDA 2ZPRA 2CLSA 3UMSA 1GG6B 1XD2B 3KTAA 3ZVDA 1K21H 1MRSA 3ITIA 3THXA 5GCHF 2W6IA 3S69A 2KE5A 1G20E 1ZD8A 3ICQB 1CA0C 5EPNA 5G40A 2BHRA 4TMZA 3IPXA 2ZJAA 1E2EA 5EE1A 6CHAC 4H1UA 4X1QU 5T3HA 2J0QA 4Q7XA 1Z2CA 2ZRCA 3G82C 3SYJA 2FEMA 3OZXA 3B82A 2J94A 1AZ8A 4G5GA 1NN5A 1P9WA 4CIDA 1C1QA 4CR9A 4GVUA 3NH9A 3VU9A 5E8EH 3TMKA 1ELOA 1DUEA 3SNHA 1TMTH 1AKYA 5DP9A 2GEUA 3LDXH 4NZLA 3A8AA 2TMKA 1H8ED 3CS0A 4JYUH 4K1TA 3QQ5A 2ZDAH 1D2NA 1GITA 1HIAB 2ZRHA 4CDGA 1GBFA 1XTIA 1GHZA 1GVKB 4YLQH 3A1VA 4FWIB 4I1SA 2BB4A 3Q7QA 5DE3A 5E7JA 3CH5A 4FW9A 4R0IA 1G17A 4C0HA 2C3SA 3AGQA 3C41J 4ABFA 2J3EA 4YT7H 2DBYA 1OH7A 2JJ2A 8KME2 3GDUA 5BWMA 1BRCE 4TMWA 1JQLB 3SNBA 2XXAA 2QTHA 5L3SB 3U7GA 1R0WA 2C9OA 2PSYA 2D7DA 1DANH 1GHYH 3BE4A 1E36B 3QKRA 1P2KA 4NMMA 2D1JA 4RD3A 3T29A 3CO5A 3KXKA 4C7OB 2QU8A 3EZ7A 2DHRA 4GCHF 4YLUA 1DO0A 1JPJA 2H16A 3DPUA 1UVUH 2H2ZA 3RU4D 3AVUA 4B3CA 1T8MA 1ZRHA 2JLWA 1ZC3A 1G7RA 3MSXA 3UOPA 3TK5A 3GJXC 4OI1A 1SHZA 1AN1E 1E2PA 3LIWA 3S9BA 5K8IA 3ND8A 5JJLA 3B7GA 1ZW6A 1G4UR 3OY6U 1INCA 3KKPA 2BHGA 3AVPA 1HA3A 1P06A 3CNOA 2GCHF 1AIPA 2A2XH 1TFXA 2QXGA 1ELGA 2H5DA 4AWXA 1TB6H 4PHTA 1Q22A 1FTSA 4IVQA 4RZUA 1JR3A 2CJWA 3NDBB 2IYZA 3OX7U 4WY3A 2V1XA 2F91A 1W12U 1RRKA 1E38B 2FJUA 2J9NA 3SV2H 3K09C 3RDPA 1OFHA 1S1CA 2A5GA 1BQYA 4MYTA 4Q9KA 2RKOA 3MH4A 1CO7E 3DT0H 1DTSA 4DEYA 2FXRA 2R2MB 5DI3B 1AZSC 2QRZA 1Z8IB 4WIAA 2ZE8A 1SFQB 1P9RA 1R0YA 1G3MA 1GFIA 1L2TA 2ZYTX 4BAMB 2FPMA 3P32A 1O0DH 5CYOA 1PJPA 1ELFA 2QENA 1XEXB 1HAVB 2HPPH 4JZEH 4Y6DA 3RC4A 4KFTA 2J7PD 2QMHA 2VGCC 2W6JA 1CGJE 1GI9B 4EFNA 4DEXA 2RGGA 4KI0A 1WBDA 5FOVA 4OL0A 3B9QA 1XF9A 1G8FA 4M9QA 3FMPB 4BXWA 1O3MA 1N6KA 4BFZA 1C2MA 1F2SE 2Z9KA 2FOFA 1NN0A 4IC5A 1AN0A 1D3PB 2JH6D 3JZ2B 4M1SA 1SMFE 2GCTB 1XTSA 3IIKA 1QRXA 2X2EA 3OTJE 4LJ9A 4K1SA 3K0AA 5A8XA 5CHAC 2AXPA 3MU8A 1FN8A 3IQXA 1GZSA 1LW7A 1DXPA 3HR8A 2MSEB 621PA 2WJGA 3IBGA 1T6NA 5EXLA 6GCHF 5FI0B 1QF9A 2YV5A 1OP8A 1OP0A 4XTRA 1AWFH 3PEVA 3A4MA 1BTUA 4UFEH 2GGVB 2NZJA 4AYTA 2FWRA 4OYHA 1K1MA 1GHBG 1J8AA 1ELTA 1AUJA 3Q3KA 5EXMA 1SGFG 5FUYA 4JT4A 4C0JA 2GZDA 2ATVA 3W9YA 5DNYB 3LGVA 2WV5A 1EATA 2FZ4A 4MDFA 8GCHF 5FAHA 1AB9C 2ZGBH 4TMTA 1UVSH 2YOFA 1D6RA 2BEJA 2H1LA 3RAPR 1GBAA 4D82A 4DCVA 3W3AA 2B92A 1UADA 5EXXA 2QUZA 4NYMQ 2AIQA 5SZKB 5KDLA 1KY3A 2A45B 1LFDB 1SHKA 3A37A 3K0CC 1Y5AT 1XXHA 1EB1H 2JDIA 1F0RA 3EE0B 1O39A 5IDKA 2IWHA 1DWCH 1ZP6A 3MLEA 4OQFA 2XEXA 3K70B 3HR7A 5DN6D 1FUKA 3M5MA 3LKWA 1WUNH 2CLCX 5EQSA 3GY5A 3UKDA 1S84A 1DAEA 4K2YA 1GIAA 3CF0A 5E7IA 2AN9A 3M3SA 3TJNA 3OEHD 1JXOA 3LQQA 2ZE6A 4BLRA 2FGJA 1OWJA 4Q7MB 4B3BA 4P4SB 3CP7A 3T35A 3KKOA 1P3EA 2QY0B 4A1FA 1ZJDA 1XDBA 5CJ2A 4DVGA 1N5LA 1GI3A 1IN6A 2GDDA 1L7VC 1MAYA 5JHHB 1QURH 1YZUA 3MH6A 3U7HB 1SOTA 3K9HA 1J16A 1VITH 1TGNA 3TPIZ 2Q6GA 2LNCA 4JL8A 4JVSB 3MO9A 1DBSA 1FQKA 2YC4C 3IIJA 2C96A 5GVRA 2QBYB 4NA9H 4ARZB 5EE0A 4C0QC 1RIWB 5BPEA 3CX8A 3OESA 4Z51A 2JKHA 1M7BA 4A9AA 1XUKA 2BMDA 4OS4A 4A0GA 2HCBA 1C5TA 2GVZC 2QN6A 4EFMA 4JZ1A 3QF4A 2PEYA 1YZGA 4LV5B 2NU0E 2ZETA 1CE5A 4EFLA 4RFSB 2XBVA 5GXPA 4CH2B 3SUFA 2CGAA 2D62A 1LKAA 3KJIA 2ZI3A 1A4RA 2NU4E 2TPIZ 3AVYA 1K9OE 1ZNZA 2VO1A 4NA8A 1IHTH 4US2R 3ZVMA 5JEEA 3QSYA 1NIPA 5AWFC 1HBTH 1DDJA 4PC2A 3LA6A 3OAAA 3F9EA 1K8RA 1DX5M 4W7SA 3IILA 1S82A 2PH1A 2A7QA 1YGCH 4HZUB 4DXAA 2HEIA 3I4LA 4BE7B 4JBXA 1M2OB 4B76A 2R6DA 4PTLA 1UBGA 3BG8A 1YPHE 2W0MA 2G9NA 2SFAA 1TGCA 3ZZTA 2A78A 3WBKA 4D9RA 2ZRBA 2MSDB 3DZDA 1LVGA 1DEKA 4P0TA 1SB1H 3MWIU 3E3TA 4IDQA 2WJIA 2AGIX 1T3LA 3ZQ6A 1SPJA 5BN5A 1U99A 1R7RA 3P26A 4M1OA 1ZR0A 6LPRA 3TRFA 1JXMA 4MKHA 5JS8A 1O3HA 1TNJA 4A2QA 2FM2A 2WJVA 1H9LB 3QTOH 1IJEA 2ZJYA 1KDRA 2F43A 2FIRH 1WB9A 1Y3XA 1XEWY 3AKCA 5TVKA 4A7IB 4DLTA 5TARA 4YXWD 1MD8A 1QB6A 4INHA 2VIWA 2TGDA 1G2LA 1O2SA 2N46A 2ZGCA 4M2LA 2A3RA 1KDPA 2ODEA 1C1RA 2G52A 3UIRA 4PAQA 5DO4H 1FUUA 1BIFA 2DFLA 3U3RA 1QNJA 5E2OA 2V1UA 3W5IA 5KHOC 4KXFB 3TUZC 3A58B 3G5UA 5K7RA 2ODBA 4JL6A 3I29A 3IWMA 2ZHWH 3GLFB 2Z43A 3RRNA 3M5OA 3B1VA 3Q85A 3B8JA 4M53A 3QLPH 2G83A 1QL8A 1NBME 1SGCA 2SGAA 4DWJA 1KLJH 1W36C 2BMEA 4A6XA 3EA5A 4OHYA 3BH7A 4ZDWA 1Z0IA 3K9GA 5E0HA 4YONB 1MMJN 1W2HA 1N6YA 3SBEA 2IYXA 3BB3A 1FPHH 1XD9A 4ITRC 1QL9A 2WOOA 4EPTA 4AYYB 1VIYA 1ZMNA 1TBQH 4LJ5A 4FVDA 1P4SA 3RS5A 1GJ7B 2AKYA 5FCKA 1W0ZU 1H8HA 2UUJB 1F2TA 1E9BA 4JZFH 1HLTH 3GFTA 3W8RA 1TL7C 3AV0B 3NH6A 3TW8B 4ZCLA 4QXAA 3Q5EA 3BEFB 4LDJA 2JLZA 1ZPZA 2ZRAA 1HJAB 2ZRDA 4TYDA 1IQJA 3RWOA 3SV7A 5DI9A 2BLVA 3TUJC 1DLKB 2KSQA 4POAA 4GOKA 1O37A 1FV9A 2JH5D 3PG5A 2QG6A 1AGPA 4PAMA 4GL2A 1AKSB 3SZNA 1O5BB 5IT5A 2H1UA 2GILA 1R8QA 3K0FB 1XXFA 2FF7A 3P27A 5FBVB 1TNLA 4CH8B 1BS1A 3SQHE 3BJIC 1YPKH 2NOAA 1E2IA 4DIIH 3SGQE 1UBFA 4HYYA 1LMWB 2HYIC 1SXJC 5LPFA 4OGYA 3UPUA 2PCJA 1TWXB 4I1VA 1O3PB 5C4GB 4NIXA 5JRJA 4ACBA 1SKQA 3ZH9B 3QPUA 3PLKA 4LZ1H 3K9NA 3X1YA 2B9LA 1V3XA 2GT8A 2ZE5A 3QKTA 4JKIA 2OQUA 3EXAA 3QXSA 2ZECA 3QZQA 3EZ6A 3UNQA 1OT3A 4DLXA 1AFQC 2DWPA 1C1PA 3TNTA 3JZAA 5SZIA 1ELCA 2UWOA 4L15A 1E1RA 4XE4A 2FI4E 3PB1E 4D6PA 4PPFA 1D5CA 4R2IA 3LONA 5J4KA 5HTKA 3CB4A 2WPHS 2ZU4A 1DELA 2ZA5A 2A5YB 2GK6A 4MYUA 3MWJA 4X6NA 4BASA 3T5DA 3UG7A 2XC0A 3ZV8A 1EAWA 1NN3A 4Q19A 1X8LA 3TVTA 1Z6YA 4QM7A 2PUQH 4NG9H 3FGNA 4IBLH 1RGQA 4K60A 1ONBA 4FCWA 4C2UA 2Y6TA 2PLXA 3CENA 1NI3A 4ISLA 2WJYA 4BFYA 2GKVE 4C9BA 2LKDA 1MBQA 2NZ8A 4PC6A 3FOZA 1P2VA 1S4QA 4F38A 3TQFA 4ISIH 3MO3A 4JVMA 4BXSA 5CK5A 1KI4A 1MO3A 3RXRA 1ZBDA 1RJXB 1OHHA 3F0TA 3AVQA 4KJZA 1XKBC 1DITH 5JBTA 3AM1A 1U8YA 3TJOA 1W0JA 1XP8A 1UTPA 4UFGH 1K5DA 1UHBA 4NYIQ 3GLIB 3Q00A 1HCGA 1WCZA 1P2QA 3RUOA 3KQKA 1TYNA 5EE5B 2IJOB 3W6NA 3GFPA 4NWKA 4TY7A 1WQ1R 5FOTA 1VKJA 2CHVA 4EPXA 3H84A 2UZIR 2STBE 1PPGE 1Z0JA 4OKSA 1HJ9A 2OE2A 1QY6A 3SEAA 5C2JB 4O9VA 3DFJA 3VNUA 4XIGS 5TV2A 821PA 1V2JT 2OUKA 2TGAA 1XMVA 1IONA 4EPYA 1C1VH 2OHFA 4YOJA 3GCTF 1T32A 2TGPZ 2JLSA 1W4BA 2D8WA 4HAYA 4C30A 2CCKA 4DZZA 1V43A 4BAOB 2XNIA 4KSBA 1RRPA 3C7KA 2VHTA 3U8RH 3LJJA 2F1RA 4LHZA 2EYUA 4BNRA 3UWOA 1LY1A 3C16C 1SGIB 3EZ2A 421PA 2XYAA 2B0FA 4TTRA 1TABE 3KNXA 1NBMD 3ATIA 5C2ZA 4BEJA 2OXRA 2W7UA 4QNMA 4I4LA 2O8DB 2ZUCA 4IOKA 4DGJA 3H4MA 2HLDA 4EJSA 1UEIA 1MV5A 7ESTE 5KYKA 1T8UA 3GY7A 1MKYA 2ZU3A 3TW4A 4ZIRB 4EQ6B 2BC9A 1UVPA 2ANKH 3UWKA 2EC9H 1L4UA 3QENA 2YWFA 1EOJA 4INKA 2WSMA 3L2OB 2NU1E 3L8YA 3SYNA 1N6PA 3GJ8A 3GCGA 2YVUA 1UTMA 1P2JA 1ZM4A 4B2BA 1WBBA 4AG6A 3EA0A 3QG1A 1VHLA 1VCPA 2WAYA 4Q5IA 3RXBA 4HUTA 2IBMA 1NPMA 3RC3A 3NEYA 4KSCA 2CN0H 2J2UA 5IYTA 3S9CA 1BMFA 5KSZA 2QV1A 1ZTLA 3A1WA 1FMGA 2Z9LA 1PQ7A 1G8PA 2OCBA 3OEED 3ELAH 4FINA 1MUEB 4LRWA 2D4HA 2XJ4A 3VNVA 1X6VA 4KU4A 1EX7A 1E9CA 3LFUA 2OEPA 3CWQA 1E96A 1C5XB 4GAWA 4D7FA 1KKMA 3THXB 4EAQA 1BTYA 1SFIA 2OCPA 4J1YA 2ZFSA 4Q48A 3QOFA 3S0NA 2FOAA 1XXDA 1ZUIA 4DC9A 3TJUA 4K81B 4CEHA 3ZZ5A 1YHNA 4PPQA 2BQWB 5TY0A 2Z5FA 1LPGB 3LD9A 4F4CA 1CULC 2QA5A 1VMAA 2EFGA 3VU9B 5CB8A 4LYAA 1F0TA 2V0BA 4GBMA 1H8DH 2ZC9H 4ZKDA 1HUTH 1GRRA 1P01A 4A4DA 3DHWC 2SNVA 1GMDF 5F2EA 4KTUA 2HF9A 2I6SA 2DUCA 2WOJA 5T6GA 3HU2A 2W00A 4LBWA 4DVAU 3AAVA 5JS7A 1P2NA 4Q21A 1MKXK 4ESHA 3E1XB 1N0VC 4BFTA 5FTMA 2PKAA 1JECA 1YR7A 3GY3A 1CRQA 1T5IA 2IS1A 1UO6A 1C2FA 5GWZA 2HWLB 1OIVA 4IOJA 2F1IA 1G5TA 1YPJH 4JS0A 3FHTA 4QNRA 1O30A 2PZEA 1YF4A 1Q31A 1G30B 3VFDA 2YNAA 3MYWA 1P04A 4DY7B 4XD7D 1HXEH 5L3VA 1OH8A 1QHHA 1E37B 2IEZA 2EEKA 4MNWA 1EOLA 1AA9A 3VXEH 2XXAB 4ESVA 1W48A 2CDNA 3O47A 1S85A 3SN8A 1XEFA 3OF5A 1R10A 4B47A 1TPAE 1V2RT 3V3MA 4LY6A 3MCAA 1UEJA 1TEXA 4NYMR 3UK6A 1E2MA 2J7PA 4E22A 4RKEA 2FLBH 3DZ8A 1A2CH 3SZRA 1V2UT 1CXZA 1Y59T 2R6AA 3UATA 3KJEA 1NROH 1HYLA 1FY1A 1QHGA 1QRZA 3LX8A 1DADA 2GF9A 2ZSEA 2QT1A 1C5PA 4PSKA 1JJ7A 1EGAA 2AERH 1AVGH 1IJFA 2PEZA 4IXNA 3I78A 3UOUA 1DAGA 4NYJQ 3BTKE 5D3MA 3TITA 4BAKB 3QXXA 3VR2A 3LW7A 3BF6H 1G3CA 4GMDA 4Y11E 1TQ6A 4B75A 1L0ZA 1O2GH 1VCWA 4LBVA 2AFQB 2A30A 4B3DA 1PUJA 4B74A 4MGIR 3KL4A 4AG5A 1NSTA 4THNH 1O5DH 2BM0A 3OIUA 3LT3A 3PWCA 4Y0AA 3MJRA 4Q47A 2CJWB 1ZRKA 4Y71A 5JRZA 4AGJA 3W6PA 1JBKA 3ZD7A 5E4FA 3W90A 2XITA 3QZRA 3R9WA 1SGTA 5LBIA 4XSGA 3J81k 1DVRA 2BDCA 1FX0A 2B7CA 5JB8S 5HZKA 4ABIA 1J17T 4B33A 4LPSA 4M1YA 1NLZA 2HNTE 3FDIA 5FOUA 3WXMA 5E95A 3Q77A 5EP4A 4OI2A 5CHAB 4TLAA 1TNDA 3U60B 1N8OB 1NG9A 1NJFA 4KGAA 3BTFE 2H9TH 4QM6A 4JLMA 4LCBA 1NG1A 4PX9A 1S3GA 3K1JA 4GHTA 1PLKA 1T4UH 3A8DA 1AQYA 3C27B 4MNYA 1A1RA 1C1YA 2QSYA 4CR5A 2BIFA 5DN6A 2V54A 4WW0A 1HV7A 4DCTA 4HDQB 2WPDA 4Q1CA 1OFTA 4MUBA 1O35A 3IHWA 4IEEA 2PX0A 2PZFA 1AB9B 4DJTA 4D8NA 2YZ2A 1D9XA 2FOLA 1ZM3A 5A0CA 2F3RA 3U2QA 1VGCC 3GYMA 1U90A 4PPNA 1TOCB 3QKSA 5F3WB 1EP5A 2OC7A 1CJMA 5LB2A 1G6HA 3TKLA 1P2TA 2YINC 4URZR 2F9UA 2OO7A 2YC2C 3KB2A 3SJCA 3RXQA 5C20A 4D81A 3STJA 1GDDA 2ZRPA 1RTLA 4BWYA 5HKKD 2WHXA 1IOZA 4UEHH 3EYDA 3ONWA 3OFNA 4NPHA 2W0SA 4ZXXH 3KQBA 3W3ZB 4TL9A 1II9A 1UDWA 3SDZA 1CVWH 1Z29A 1ODFA 2YWEA 3THYA 3V12A 4RD4A 1OWDA 4X1RU 1XPOA 4Y7BA 1YZLA 1N5KA 4X1NU 3QNUA 1XCPA 2XZOA 1DPOA 3TQCA 4DHEA 4FVBA 5CJPA 1E79D 4UXIA 2N1BA 4ASHA 5L2YH 1NC6A 1GKUB 3ZYEA 3I3SR 2BV3A 2AD5A 3FZZA 1TLDA 4BRWA 1XXHB 2JLQA 3ECCA 1E2LA 1G16A 1GL6A 4KFRA 3ZVGA 2RGCA 3SYKA 3GLGB 3GJ3A 5L30H 1K1IA 2UVQA 2XGJA 1RXPA 2CHGA 4ZCMA 2CJIA 2QP4A 1PPFE 4S2EA 3T61A 4E07A 2Y7ZA 3DEFA 2HT1A 5FBWB 1DSTA 2C9YA 1ETRH 4XH9B 5GJCA 4PQFA 3DL0A 3ASYA 1LHFH 4TLCA 4D26A 2WUBA 3SI3H 3C5HA 2BBWA 2GDJA 3U3KA 2Q0HA 1V2PT 5B6LA 2ODPA 3A6PC 5EE3A 4WZAE 5CYPA 1C5LH 1TX6A 3CUEF 1V2LT 4BFVA 1K22H 1ZM7A 1TQ2A 1A3BH 3SU1A 1XBTA 2OAQ1 2PJRA 1SVKA 4I8HA 1VYVA 1R6BX 4XBDA 1NF3A 3DO6A 4WOPA 3CRRA 3FHCB 4Y10E 2C95A 1N2CE 2CMKA 1SVLA 3CR7A 2ALPA 2OC0A 2O8FA 2OCYC 3I72A 1U9IA 5EP2A 4B48A 4MTBA 3RLWH 1XCGB 4TYNA 1E9RA 4YMVA 1KO5A 1QBNA 4NWLA 3VB3A 4NP6A 3ADBA 4WA7A 1ANEA 2ZNKH 3QF4B 2RGAA 3K6ZA 1QR3E 3LLUA 1P2OA 4KBGA 2VQSA 2Z4RA 2ZU0C 4OBEA 1NVXQ 2QMUA 1JJVA 3GCHC 2FX4A 3A4LA 2ZCLP 3MHWU 2C8XB 4R7ZA 3K6YA 1MO6A 3RXPA 3HYRA 3GJ0A 1AD8H 4H6TA 1QG4A 5B30A 3A81A 3H86A 4DDTA 4LC0A 1O5FH 1GVNB 4ZDKA 1HQCA 5DP4A 1MTWA 1Q21A 4XBBA 4MGKR 2OCVB 3SJAA 2O8WA 1W4CA 2FI3E 4DLWA 4LBZA 2ZO3H 4NIVA 1XWIA 3T1QA 3KN2A 1QGFA 1UTQA 3ENSB 2WWFA 2ZRLA 3RXIA 1W47A 4CRWB 3RU4T 1LCYA 3C1KA 3I5YA 2FFBA 3NVAA 1Z1JA 1P62B 4ZO4A 5A0FA 4TMKA 3OY5U 2AH4X 4RD0A 1XUFA 5ETXA 2DFNA 4FUJA 1PUIA 1DG1G 5AUNB 1ACBE 3RXMA 4QJ5A 4WXRA 3HGNA 4CEIA 3QXHA 1FZZA 1P10A 1W36B 4O3MA 5KSYA 1QB1A 4ZHAA 3H2YA 2G4TA 3EDXB 1IQKA 2PMKA 2ZI9A 1RTKA 2F9OA 1CTQA 3NC1C 3REFA 1O3FA 4GOXA 2IXEA 3B8HA 2BJVA 221PA 1XMIA 3P8OA 4LWZA 1TPOA 1Z0DA 3I8XA 2HRVA 1EESA 3SR0A 1FQJA 1F5NA 1EAXA 2W83A 2ZEJA 4IW3B 2BCGY 2BVSH 4XTCS 1GCDA 1IQNA 1WDTA 1N6LA 2GETA 2ZI6A 4NBSA 2ORVA 2VSFA 1MU6B 2G00A 3B13B 2C5LA 1U98A 2QAJA 2GAAA 1JQJC 1TNHA 3QI2A 1XTKA 1O3OA 2BDAA 1HRTH 4KKDA 1Q3XA 4C0KA 3DVLA 4Q1EA 3ATWA 1SLUB 3KX2A 2Z4SA 1GPZA 1SKYB 2XTZA 4P33A 2FA9A 1T8LA 4ZXYH 4Q18A 3Q3JB 4Q4HB 3SU8A 3GPLA 1DO2A 1ESAA 3TH5A 4F93B 3NXPA 1EFHA 3D23A 1GBJA 1C5OH 1ETTH 1ID5H 1C9TA 3VR5A 3V13A 4Y79A 2KB0A 2Z3CA 2EW1A 2Z6VA 1J8YF 2WVJA 1SXJB 4BQSA 2DFKB 2P5SA 1SGDE 3ZZ6A 2GXSA 3IDQA 4L8GA 1F2TB 5C5NA 5GJVC 1TNKA 1W1WA 4ASUA 1KK1A 4OS7A 3DMNA 4G01B 2K1QA 2EFHB 3KXLA 1OFIA 2KJQA 1O2OA 2ASEA 3Q3XA 2RH5A 2BBSA 3VHLB 3IGFA 1I4LD 2IL1A 121PA 1BRUP 1SGPE 3LV8A 3N2IA 5DP8A 2R8RA 2QXHA 4LHWA 4EPWA 1WE2A 1EAIA 2XXLA 3A8BA 4BFSA 2O9QA 3E0PB 1BHXB 1AFQB 2PX3A 2CV3A 5T1VA 3MGCA 4D25A 4Q80A 4NCKA 2XBXA 1G41A 4DIEA 2GTPA 1IHSH 4E7RG 1CRPA 2GXAA 1KDQA 3ESTA 1KDTA 4GPGA 1HTWA 2OAP1 1C1UH 2J0VA 3EWSA 1SVMA 2FH5B 4B2IA 1IXRC 1L4DA 4I33A 1L1JA 3VX3A 4QBGB 5GCHG 1Z0AA 1JNYA 1GBMA 2BDYA 3I62A 2FS9A 1IQFA 5IK2A 1Z8JB 4LOYH 3O8DA 3QF7A 3CBQA 2W6JD 3SOSA 3MWKA 1O2ZA 3BFVA 5L3QA 1VJAU 1Y3AA 4LJ7A 2DR3A 3Q76A 1GHVH 4FUCA 2GF0A 1EQ9A 3MNSA 4RY2A 4A5TS 3AKEA 3IQWA 2ZSFA 1QHNA 4Y8XA 2PKSC 2F9BH 1Z6AA 2WWIA 2REBA 1P9SA 4A15A 2H92A 2A0QB 1KTTB 4JCNA 1NTPA 4CYMA 2WV4A 2X1VA 4MQBA 5DKMA 2QY9A 2CE2X 4PO9A 2PFEA 2BCJQ 4PO8A 4W9MC 4HDOB 4FN5A 3U69H 2NPFA 3T06B 4BECA 1GBIA 4I81A 1GBEA 3LGTA 2A7JA 3A89A 1P61B 1P09A 1N6RA 3K70C 4M9SA 3GOVB 5HZHA 4MKFA 1GNPA 1GP2A 3T26A 2G1JA 4J0QA 7LPRA 2IA5A 4V0OA 6ESTA 4GZLA 3RYTC
chains in the Genus database with same CATH superfamily
1O2PA 4MPVA 2Y9PB 2NXJA 2GZAA 4NCAA 4GH5A 3K5WA 4IXWA 1ZMRA 1PEYA 4TTTS 4TWAA 4W9NA 4FFMA 2BY7X 4KJXA 4TYQA 2F4NA 3A8CA 3KQCA 2JDID 2BYTA 1IN4A 1ZFNA 3JQAA 5AVKA 3SSMA 1CJTC 2IS4A 4JJKA 4YP5A 2ZQYA 4OUKX 5ALEA 2R68A 3F7NA 2HV9A 3ZU6A 1YJ5A 4BQQA 1ECPA 2WHPB 2BEVA 3HS3A 5AD1A 1O3YA 4K2AA 1T0IA 4PIPA 5FNZA 1FDIA 3NHSA 3NXSA 1ULUA 1E2FA 3CRW1 1P73A 5DP6A 4BC0A 3ZGLA 1ENZA 4NSYA 3OT5A 3PE6A 2Z83A 1BBRK 4J0KA 4H4FA 2AUNA 2G25A 2PWXA 3N6VA 4PGFA 4AVYA 4RSPA 1YZHA 2WFMA 1ZYUA 3IQFA 5F1YA 3DHKH 5DJ7A 2CK3A 1DWUA 2AJBA 3A86A 3M6IA 2QGRA 4IICA 1LDYA 4N3AA 2DWQA 1Q0LA 3RC6A 1K3UB 3IODA 3WRYA 3DOCA 2VYFA 5HG0A 3NLLA 3SE7A 3PC7A 2Y5FA 2R8YA 1B6SA 2SECE 3MT8A 1M6NA 3IHKA 3U9LA 1O8BA 1DLJA 4JYMA 2KCYA 1PG5A 3T7DA 3EQZA 2FEAA 2GR9A 1OWOA 3I01A 4CFYA 3P0HA 2NIPA 4RVFA 1RZ3A 3TGKE 3IJEB 1L7MA 3NFRA 2JD2A 1JQBA 5TB5A 5BYJA 2FDCA 3PLNA 3RXGA 4WJG2 4CKWA 2NQ2C 3EA8A 1Q92A 2ZIZA 2FFRA 1QH8B 5I9BA 4BV9A 1XELA 4JZKA 4MWTA 3AP3A 2XUIA 4Q9DA 1CDDA 5HJ7A 2O05A 2QD4A 4FNMA 4MR7B 3IVMA 3RLYH 3HUEA 2VF7A 3E5HA 4G8DA 1TA4A 2VSNA 8OHMA 5BN4A 3LY9A 2H52A 2AS0A 4CDMA 1GTRA 1EB8A 3EDRA 4FNOA 5EZ6B 4HNRA 2BL4A 3RB8A 2FWPA 5KTKA 4Q4JA 1A5HA 2HRZA 4MDHA 3ZBPA 2C7QA 1GSHA 3R3JA 4RPGA 2FZLA 5A09A 3SV6A 3AZOA 4DLBA 4LGYA 3ZCPA 1CIVA 1QZXA 4JYTA 1UEXC 1VZ2A 2J59A 2FLWA 4FK8A 3ORFA 3M6XA 5AJYA 1R5NA 2JI6A 4ABHA 2BD2A 2CMDA 1RXYA 1NFWA 2QF3A 2A86A 3QPCA 2QS9A 1TEVA 4NCYA 4AKSA 4DLYA 5H7XA 2REOA 3R23A 1TYZA 1FYXA 2A9VA 4MEAA 1KU6A 2RK3A 3OIWA 3TD2A 1XRPA 4O1HA 5ALKA 1T0BA 4Y9RA 1DMSA 4DA6A 2OCAA 4NONA 1S81A 4ZHQA 1YQEA 3O2JA 5T6MA 3TIGA 1HF3A 1H1TA 3OP1A 2QUHA 1L5OA 1O31A 2XUKA 2ID7A 3QXCA 1UJNA 3R20A 4M36A 2HI0A 1JQKA 1QHHB 2XHZA 2FOMB 1YTLA 4E5DA 2FQQA 2X42A 1NW8A 1XZPA 1NMYA 1PF7E 4MQEA 4B4WA 1R0KA 5TQ2B 5CX4A 3DA9B 3NK8A 3FCAA 1HG1A 3WYAA 1D09A 3QN7A 4I50F 3RJMA 1MRNA 2WWHA 2ZE7A 3PTZA 1E94E 1WHTB 3I9JA 2Z3DA 2WU4A 1UTOA 3PWKA 1GGMA 4NQZA 3PUWA 2CLDX 4RDCA 3URCA 4JI0B 3Q1LA 5TPWB 3L7JA 1Q0QA 1P5ZB 3LTEA 2BM1A 3DOUA 3D49H 3SU6A 2P93A 4N3BA 3C8UA 1K3FA 1DX9A 2ZTMA 4PHCA 3L3BA 1H6DA 2HF2A 1Y8ZA 4TTJA 3PTLA 1IM2A 4OYRA 2WTXA 1WDMA 3W5DA 4G1UC 3GYLB 4D96A 1U4OA 2CUKA 1MO5A 4N3CA 1XYYA 1C9EA 3IJ5A 2OD9A 4D98A 1DX4A 4TPYA 3QK1A 3PHIA 1KYWA