3O8BA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords HCV NS3 protease/helicase
total genus 219
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8bA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8bA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA03
4UFDH 4RKFA 4UQOA 5EU8A 2W6JD 1SHZA 3CBQA 4V0NA 1E38B 2ZS7A 1RJ9B 2XTMA 5A5GA 1ZTLA 2Y5FA 4H4FA 2QMEA 1SGRE 2IK8A 3Q3KA 4BFSA 4WOPA 5FUXA 3A37A 4MKHA 4LYAA 2OXSA 1A5TA 4TYNA 3F3YA 3OFNA 1DARA 1IN4A 1CRQA 1PVOA 2WIAA 4X8VH 1O87A 1IONA 5JECA 3LW8A 2V9PA 1C5MD 1VZQH 3IKJA 3KN2A 5EP3A 4KLZA 1BOQA 3TJVA 3HP1A 3KKNA 5AJZA 2Z9IA 3SYJA 1C2KA 4B6FA 1DPOA 4ILEA 3IPYA 4NA8A 3C7KA 5AJXA 2VLIA 3G82C 1S84A 1KI3A 3QIAA 1C2DA 1C5ZB 2QMOA 1TE0A 4NA7A 2A5AA 1YPEH 2RGNA 1RYHA 1ARCA 3GCTG 1DSUA 3QBVA 1CTQA 1TNKA 3KQKA 5GWZA 3RXGA 2PZGA 4JVNA 1XMJA 2NG1A 5J4KA 4KBGA 3IBGA 2CCGA 3DM5A 1XEWY 4AFSA 1TPAE 2VPPA 2V0BA 1X1SA 1O2XA 3SHFA 2G1JA 2QT0A 1YCPM 3PMJA 3J81k 4KI0A 5EXMA 1TNIA 4RSPA 3TE6A 1IM2A 4A2QA 5EXNA 2E9SA 1CQQA 1TAWA 1LHFH 2STBE 3CLVA 3PV2A 2VH6A 1K2I1 1C1YA 2BBWA 1GJ6A 1BMNH 3SZNA 1G18A 5HM9A 1UKZA 1V2TT 3DEFA 4IMQA 1D5CA 1G21E 1W2KH 2QYIA 3RM0H 5FTLA 2QMHA 1KI1A 1O3BA 2DHRA 5F9HA 2GMTC 5KTYA 3REGA 421PA 1F5LA 1K5DA 2E87A 4IW4E 1EWRA 3B82A 5HPYB 1TX7A 4MG3A 1P9WA 2XNSA 3VKGA 3KKMA 2XTZA 5DYIA 1MO4A 3BG8A 1OWIA 1HH4A 1V2QT 5FHTA 1KJYA 2AKAB 1AK2A 1AS3A 2WMOB 4ZIRB 1RS0A 1T5LA 1YLCA 1SI5H 5FL7D 2VEDA 1WXRA 5TY0A 1EJAA 3D23A 4EJSC 3LO5A 5E4FA 5TMPA 3Q5DA 3IIJA 5EUMA 1SXJD 4DVAU 3BTKE 5DO4H 1AS0A 2VYFA 3A8BA 3SJBA 3D6TB 3WRXC 3E0NB 4QT8C 3GY4A 4WVFA 4HLCA 4X6PA 1MAYA 2BXUH 1J14A 2VINA 621PA 2CV3A 3K9XB 4DUGA 1TPPA 6LPRA 1GI3A 4WF8A 2PMDA 1ANEA 1A7JA 2GT7A 2ZC9H 5AUNB 1XCMA 3VB6A 2OQ5A 3PVSA 4KJZA 3P32A 1SFQB 3MFJA 4GZMA 3V4RA 4DJZB 3DUXH 1ONBA 2VO1A 7KMEH 4DT7B 2VIDA 4GMXA 4AYWA 2GILA 1ZU4A 4B74A 3SNBA 3ZVDA 4L9SA 2F9VA 5D3QA 4MKFA 3GDSA 1LFDB 1IY2A 5IK2D 1TF2A 1TTTA 1ZM9A 4LV8B 1W0ZU 2GAAA 1PJPA 1CR2A 1XXHE 1A2BA 2ESTE 4JZ1A 4ZKDA 4JZEH 2QBYB 1EAUA 3AKCA 2CF8H 1FQKA 2MSDB 2PEZA 1TBZH 3ZZAA 4CR9A 3A7TA 4X2YA 5FBEA 4KCGA 1PPCE 1UCYK 2R3YA 2BLWA 2WPMS 3WBJA 5FL3A 4FN5A 2W2XA 3OX7U 1COWD 5C46F 4C4PA 1B0FA 4XVQA 3QY0A 3P6ZB 1Q3HA 5HTKA 1G64A 2P3FH 1OE0A 1VITG 2RA0A 1GKIA 4V0OA 2R3UA 1C2HA 3BWDD 2KWIA 1CVWH 1G16A 1M1YE 3KXKA 3K09A 1WP9A 2G81E 1S1MA 1C1SA 3OEEA 2VJ1A 1QBOA 2ULLA 3HU3A 3O8RA 4M1TA 2JH6D 1FDPA 3RXSA 5DI3A 4IVPA 2F7SA 2IYRA 4GFDA 3P8OA 2XBXA 5EQTA 1CR4A 3QKRA 3BFKA 2ZJ5A 4MKGA 1UMAH 1XTIA 3CNLA 2ZROA 4AYYB 1JAIA 5GIBA 4CZ2A 4ACAA 2BZAA 1GSIA 1O30A 5FUYA 5EJEA 1Z63A 1AE8H 2PKAA 1SVLA 4DLRA 1MKXH 5JBTA 1NRPH 1RW4A 2QXGA 1NFYA 1DAGA 5JEDA 3HU2A 1U9IA 5LBIA 5TDHA 4B6EA 4DWJA 1XX9A 1VGCB 3A1UA 2ZE8A 2GNOA 1K1NA 4ZUHA 1FJSA 1P4SA 4JT2A 1FLEE 1N3BA 4BZXA 1VCPA 1P9SA 1HQYE 2F55A 2DE8A 3BFXA 1G37A 2JDIA 4NL4H 2BDTA 2IYXA 3M0EA 3U6KA 3BK7A 1LHDH 1II9A 4WXPA 5TXGA 2EQBA 1BBRH 1ESNA 2ASUB 2UUYA 1TGNA 1SG8B 4VGCB 2QMUA 2RGGA 3M36A 5LH8A 2SGPE 2FGJA 2AH4X 2F1IA 3CS7A 3QUMP 1FNNA 4IOKA 1TADA 2ZFTA 3EWSA 2JIZD 2PX3A 3NVAA 3BV9B 5DP3A 2XXAA 1XMNB 1GJ7B 3KXLA 2LKDA 5EXTA 2C5LA 2ZUBA 5FOXA 1DWEH 4BFZA 4D4LA 1XD2A 2BJWA 1IY1A 1FPMA 2OBLA 5F03A 1RXPA 1DOJA 3VR2A 1JOUB 1TGSZ 1BITA 5GXPA 2BVRH 2IHBA 2XSZD 1KNQA 4G01B 1QF9A 2D26C 1MD8A 1RRKA 3QF7A 3CRRA 3BXZA 5HXFA 5DO9A 3PTBA 3KL4A 4P4SB 3R8CA 4JLDA 2VF7A 3QI2A 3GJ7A 1K1PA 4KTCA 1HAXB 3Q3XA 6GCHF 3PEVA 1TF5A 4DLVA 3D49H 1G3IA 2ZREA 1MBQA 2TGPZ 4D0LB 1S6FA 1NRSH 1UK3A 1KTVA 2QZ4A 1AD8H 2GDJA 2BD7A 1EFCA 4URYR 3KJEA 4D81A 4YOJA 3NWUA 3K1JA 1GBEA 1O35A 2YINC 1VCOA 2FLBH 1DITH 5BYKA 1GBJA 3F9EA 1O3JA 2F1JA 1KSNA 4TQAA 4M4SA 1E1RA 1DPFA 3BTHE 1E0JA 2Q3HA 1H8EA 1ZRBA 1VG1A 1G3RA 2GV7A 3BS4A 2HT6A 4KBFA 4L9WA 2VP2A 2O8UA 2V6JA 2GXSA 3K70B 1AI8H 1AN1E 2J46A 3LW7A 2WVJA 2CK3D 1GGDC 6ESTA 3W8NA 1G7CA 3DHKH 4YESB 1OFTA 1EP5A 4EDHA 1RTKA 2CHAB 4BRWA 2FS8A 1EK0A 2ZJ2A 4H9GA 3KQHA 4A1FA 2GDDA 2HJGA 2IYUA 2KI5A 3W95A 1VKJA 3VGCC 3KX2A 2XOKA 1HAHH 1E9AA 2VVVA 4F49A 1ZRKA 3NDPA 1W1WA 3TJOA 1EUFA 1XEXA 1E37B 2XCFA 3RXEA 4DLTA 4YDHB 4KO8A 4MDFA 1J17T 4FU9A 1E35B 4JLMA 2RGXA 2ERYA 2BXTH 2AD1A 1JR3D 4B71A 2A30A 2QAGC 2OT3B 1NIJA 2XTTB 5AFYH 4ON9A 5GPIB 1TL7C 1N8OB 1SGIB 4LHZA 4QGAA 3L3TA 3IIMA 1UTNA 2IOTA 2YKGA 1DAMA 1G30B 3ZYEA 1KI6A 3VXEH 5TJXA 3LY5A 1C5YB 2AR7A 4Q4JA 4TQUS 3RXCA 3GP8A 1KTSB 1AGRA 3OIWA 2SGFE 2RGBA 3RS3A 4PTLA 2FYRA 1FTNA 4O2RA 2J3EA 1OXGA 3M37A 4IVQA 1HA3A 3Q3YA 3PUVA 1K21H 1CS4C 3MU4A 1OWKA 1XKAC 4DSOA 3MWYW 2J41A 1I2DA 1C5QA 4US2R 1XF9A 2GCPA 1TMTH 2GZ7A 2UUFB 1E2GA 4N0DA 1LTQA 4NYMR 4WW0A 3IQWA 3LKWA 1HJ9A 1T8UA 2IC5A 4URXR 2ZTXA 4FWIB 1THRH 1F0UA 4WIAA 1XJQA 4URVR 3HYTA 3KHVA 4NDZA 2Q6FA 1XTQA 2OE2A 4F4OC 1GITA 1O39A 4M1MA 2VVUA 2GJ8A 1WBGB 2QY0B 3CZQA 1TAGA 3RDPA 4KSCA 4CH8B 4RSGA 1GBTA 4W5WA 1W0YH 2FI5E 4NSVA 1HUTH 2WPDA 2XZOA 2ORVA 2Y6TA 1HURA 2O8WA 1NSFA 1GBDA 2ZE5A 5KDOA 1KAOA 1Z08A 5CLLA 4ZKSU 3QPUA 3L2OB 2B6HA 4I8LA 3QUSA 1E9BA 1XTKA 4RZXA 1C9TA 2XZPA 4GVUA 1PUIA 2ANWA 2ZI2H 1AB9B 4XFQA 1CO7E 2ZRMA 2OESA 1BMFA 3WMFA 4XDEA 1G5TA 3MAAC 3GLFB 3D31A 1BOFA 3BIVH 1TQDA 1KDOA 3CRMA 3FMIA 2XJ9A 2QAGB 3KFVA 2K5UA 1V2MT 3ASZA 1GBAA 2RGEA 3SU3A 2OILA 1GVKB 1TWXB 3KIDU 4Y0YE 2LCFA 1N6NA 2GMTB 2D7DA 2OCAA 1K9OE 1UCYH 1TA2A 2FX4A 4NE2A 1C5SA 3M7TA 3ZLJA 4Y0VA 5PTPA 3CF0A 3T26A 3K70D 3OE7D 4LBZA 4RKEA 1E1QD 3AW0A 5FX5A 1J8YF 4A2WA 1G3QA 3LGVA 1TALA 3ZZ7A 1MKWK 4OQXA 4OM9A 2HLDD 1SBWA 4CRAA 4D80A 4NTZA 1DELA 5ETXA 3GOVB 3H1TA 4Q7LA 2A2ZA 5K7RA 3EQ0H 2IJD1 4JSYA 1F5NA 2FI3E 2AX4A 2Y5HA 1SVSA 3PMHB 5CJPA 3K0EA 2XWAA 4B35A 5B2ZA 1TGCA 1BHXB 2ZHWH 1NVWQ 5KOYA 3MHWU 2XNDA 3MWKA 3TU7H 2A5DA 4OS5A 3LH5A 2PJRA 2A45B 3ESTA 1B0UA 4ABJA 1P06A 4YMUA 1BQYA 1QR3E 4Q9HA 4K3JA 5FOTA 4Q7XA 2QXIA 1FAKH 4E03A 1S3SA 3ZZ3A 3CR7A 4NMMA 1CRPA 1ZTJA 1G3BA 4DDVA 1NLYA 2GKSA 2ZYWX 1QRAA 2O8DB 2O9QA 4M2LA 1DE7H 1MABB 1ZNYA 2ODYB 2WYJA 4Q03A 4TYYA 2OZEA 3CW2A 1N5KA 1MT0A 5CIQA 3FFBA 3KF2A 1U9IC 1W2HA 2WIBA 1ZPCA 1OH5A 4RFVA 3UTUH 2P2LA 2KB0A 2ONKA 1KLTA 1P2JA 1IQMA 1P11E 3BTDE 5GJBA 1PPZA 4IOLA 1E2JA 3EX7C 4E07A 5HZKA 4F91B 4MPUA 4WMFA 1YR6A 2QQEA 3SUGA 2C98A 3DOFA 1J8MF 4MNXA 2ZE7A 2ZGBH 4U02A 4TYQA 4WXIA 1CJUC 5JZVA 3K0CC 4JCNA 3SUFA 1NFXA 3WHLA 3TLXA 1KO4A 3ICQB 1KMHB 1I4TD 4TLBA 3WNCA 1VR1H 2AK2A 3ZVMA 3ZYDA 1GRQA 1FONA 1SQ5A 4I4LA 2G77B 1U99A 3T28A 1C5RA 3ECCA 3GLFE 2ZU5A 5EXXA 1YPGH 1UJ2A 4PSVA 2ZU1A 4CEHB 3P8GA 4DLWA 2I4IA 5D3MB 2VA8A 4C0BA 1KDPA 2XB4A 2ZDLA 1BTZA 5HE8A 1A0LA 2EI8A 1JR6A 5CYOA 1OWHA 1T8OA 2I1VB 4PSKA 5HM2A 3FYHA 4SGAE 1ZZZA 1U8ZA 4BFVA 1R5BA 1NPMA 3ITIA 4H42U 3PMBB 2QL6A 1O3OA 3NCLA 6CHAC 1LPZB 2HYDA 2ZR0A 1P12E 1N6HA 5HMAA 5L8VA 4JMPA 1Z0KA 3AUYA 3DMDA 4OI0A 4IXMA 4KP0A 5C2JB 2FZZA 3ZVFA 1T5IA 1YZGA 1S82A 4NP6A 3SR0A 2WUCA 2YNBA 1SSXA 1QA7A 3OE7A 5DN6D 2X19A 1O2QA 1Z7KA 1US8B 1NY5A 3B9FH 1SXJC 3OEHD 3UKDA 4B34A 2JJ2D 1F6BA 2WPIS 4ACBA 4MGYR 1Z71A 1XWIA 4C3ZA 4B3BA 1YKTA 4CBNA 4O3MA 3WXMA 2QV1A 1EAIA 3ZVGA 1C5LH 1QIXB 1CJKC 4EJSB 3RLWH 1NLZA 4F92B 4UNQA 1XPRA 4J2YB 4BE7B 3VMFA 3VGCB 5IRCD 1IXRC 3E90B 4Y71A 5JWRA 1WXQA 2BDCA 3LX8A 4HLQB 1WCZA 4FW9A 2ZQ1A 1KZ7B 2ZDKA 1R7RA 2BCJQ 3TGPA 1SLXB 3SJOA 5E2PA 5DE3A 1DFPA 1NZQH 4I8KA 1OYTH 1BYUA 1AGJA 1LVMA 2Z43A 2IUSA 1NN6A 3UXMA 1R8QA 1FIWA 3SYLA 1NT1A 3R9XA 2F9OA 4NIYA 1Q21A 4Q66C 2V1XA 1EGAA 2ZECA 4XBBA 3X1WA 1SR5C 1ZC3A 2IS4A 3MU0A 4R9UC 4UNSA 3HKJB 4ZHAA 1C2FA 1EXFA 5L3QA 4KYUA 4S35A 4NZQA 2F43A 2Q0HA 2P94A 4HYYA 3MI4A 2ZRCA 1YR7A 2P59A 3D7MA 4Y7BA 2CCKA 3FKQA 2FYQA 4X8SH 1KY3A 2FGKA 1G5PA 4A5TS 1U8AA 3Q3JB 4WMDA 5LPFA 2F6RA 2ZFRH 5G41A 5DG6A 4UNRA 2QN6A 2R6CA 4PO8A 3RDZA 4ZH8A 4E7NA 1Z2AA 1Z0DA 3EPHA 2FEQH 4DJTA 1AZ8A 1DAIA 1GBMA 3GDUA 2EI7A 3RS0A 4Y7AA 6CHAB 3FP7E 2HXYA 1O2UA 2PKAB 1MMJN 1O5DH 3HK6B 5ANRB 2OC7A 1CGHA 4C0LA 2THFB 2WV9A 3M61U 4TTPA 2BHGA 1YPHC 1C5OH 1YU9A 1MQ6A 4ZDKA 1NU9A 3VHLB 4LWZA 5FCRA 5FTNA 3KGPA 4PPGA 4R7ZA 4PFSA 2VP5A 4QXAA 1NM6A 3LGUA 1UF9A 1W3CA 1M74A 5DLQC 3SW2B 1LDTT 1BHXF 1TONA 3U8TH 5F6MA 2GZ9A 1GHYH 4MYCA 3RRNA 2YC4C 4FWTA 2GETA 4X2VA 5H70A 2IT1A 3NXSA 1EZQA 1Q1QA 3RAPR 5AK0A 3T34A 3LC5A 4PPNA 5DN6A 3A58B 2Z7FE 1JJVA 3A7XA 2PCJA 1KI4A 1W0JD 1GAJA 2H2ZA 1FZQA 4TMVA 5DGXA 1G3EA 1G8HA 4CHAC 1GRNA 4XTRA 4RKOB 1MU6B 2F3CE 3NXPA 3URCA 2ASEA 5JB9S 4MKIA 3HJNA 2BD8A 3K09C 3SC3A 1LS6A 5K8LA 4TL6A 2H1LA 1SQOA 5C5OA 3C8UA 4KODA 4AY2A 2OEPA 4RCYA 5AHGH 1P0SH 3B1XA 3U6BA 1M8PA 4XVRA 1OSSA 3SZEA 3AF0A 2QNRA 1Y63A 3S9BA 4WAUA 4CRCA 1II0A 1ZINA 5DPAA 5FBLB 4HLUC 2ORWA 2XNIA 1EXMA 3RMMH 3PQCA 2J2UA 3W94A 3PTNA 3MLEA 4BZPA 3VKWA 4MNWA 2JKHA 3PV0A 2R65A 4QM7A 2FDAA 1FNIA 1RTFB 1U2RA 4OS1A 3PO1B 1WAYB 3A8CA 1ELBA 3RXTA 4MPWA 4X1PU 2J9RA 4ISOA 4ISHH 2WPDD 4X8MA 1H9HE 4MGKR 2KSQA 1O36A 5M04A 4ABGA 4UDWH 2O8EA 2QAJA 4D4MA 2ZZUH 4I8GA 3HGNA 4YOIA 2XZLA 2AMPA 1LHEH 1CP2A 2LNCA 3SQXA 4TSFD 3ATLA 3HPQA 2TMKA 2TPIZ 2AD5A 3TVDA 1FP7A 2DFLA 1ZYUA 2NGRA 3IEUA 1G8YA 1B7XB 3EA8A 1GHAG 1UDWA 4M22A 4PXAA 3UR6A 3UR9A 1W36B 3ZVBA 1P2MA 4OI1A 2Z0MA 5JBBS 5J4VA 5JYIA 2ZRKA 2NO1A 3QXSA 2P6UA 3PLPA 3FHTA 2AFQB 3KKQA 3GYLB 3VR1A 1L1NA 3ZDQA 1P9RA 4ARZA 1CHGA 1XUHA 3TIFA 4J1YA 1W4RA 1AVXA 4F4JA 5LDDC 5HE9A 2C95A 3WNDA 9ESTA 2RHDA 4TY7A 3TH5A 1EKBB 3M4YA 5DGJA 1DBSA 1LY1A 1OW3B 1QHHB 1IQPA 1C2JA 2QAAA 2JETC 4W5JA 1O3GA 4M1YA 3CKLA 1LQEA 2P6NA 4TLDA 2PL3A 4D7FA 1W2GA 4ZXYH 4PAOA 4MRRA 1KI8A 2FZLA 1YCPK 1SVPA 5LPRA 2G88A 1HV8A 1ELEE 2ZDMA 3Q72A 1O3EA 4BAQB 1DICA 5DP4A 4MGIR 2OTVA 1G6HA 2C9OA 2FFHA 3AVQA 3CWQA 4Q4AA 2X77A 2OINA 1BTPA 1GKUB 3ZD7A 5J4LA 1P3CA 1HDTH 2REOA 4C0QC 1O3PB 4PQRA 3EGKH 3RXKA 4A0HA 1E98A 1A3BH 4Q18A 3F9FA 2CK3A 2AXNA 2ZO3H 2ZRJA 2P16A 3EYDA 1ZSJA 3RC8A 1E79D 1RVDA 2QM8A 3L0SA 1BA8B 3U4QA 3B2EA 5CLQA 1SQAA 3EZ9A 2QRZA 4OS2A 4DC9A 5DNYB 1IQEA 1UKEA 3LX5A 1VECA 4ERNA 1Q12A 1MV5A 2BVNA 5GCHF 2Z6BD 4EUNA 3Q00A 3B85A 2F9PA 1EAWA 4P4TA 3GLGA 1G9IE 1YZTA 2XAUA 1Y59T 3TSWA 1HAVB 1CR0A 1WTHD 4B43A 5BN4A 1SGCA 4YXWA 1OOKB 2ZU0C 5EOKA 5FI0B 4WWYA 3UK6A 1TPSA 1NY22 4UD9H 3RRZA 2D74A 2GZAA 4GT1A 1QY6A 5IDKA 1P02A 2Y8EA 1BTYA 3RLFA 3E6PH 4LX0A 4UJ3A 3QBTA 1SVIA 1MRSA 4YLUA 3KZ1E 4KXFB 3FVFB 3AQ4A 5TVKA 1YF4A 4H1VA 4YT6H 4U00A 3T62A 2FV8A 1SXJE 2ZU6A 4AG2A 4IHQA 2YJTD 5JWOA 1UHBB 4LZ4B 1YZNA 3P1JA 5ESTE 1O33A 4M1OA 3AVWA 1LPGB 1W36D 3F0TA 1D2NA 1P2OA 1EZUC 2QE7D 5C1UA 1PQ5A 3SE0A 3HKIB 2BWJA 1S5SA 5GVSA 4TL7A 3SI7A 3H7TA 1DAFA 2EC9H 2HNTE 5CYPA 3A6PC 2IHYA 4PR0A 4FINA 2FSFA 1Q0UA 4DCTA 3TH2H 2EFCB 1CE5A 2ZFQH 3ND8A 3KL6A 1M6NA 1VTKA 2XITA 1QHNA 1SLUB 3H5CB 1TNLA 3OY5U 4NBSA 2ZG0H 3S1AB 8KME2 4L5BA 2AGIX 1UBCA 1ZCAA 3BG4B 2QBYA 1N25A 1S3GA 2ZPRA 1G3UA 2OCPA 2C8XB 3R7WB 3AVPA 3VB5A 2Q1JA 1GJDB 3MG9A 3NG1A 1W4BA 3WBKA 3QG5A 5EPYA 3I61A 5BYJA 2OG2A 1GVNB 1EWQA 1L8QA 1P03A 2HGTH 4NONA 3EC1A 3U3JA 4NKRA 2ZI5A 5SZKB 1OYYA 3DA9B 5AUQA 2WWWA 2P8OB 1H9IE 1BTXA 4ASHA 1QJ1B 2GF0A 4C7OB 3RWOA 1P57B 2RGAA 4DW2U 3QGJA 2WKPA 3T35A 1WQSA 1MO5A 2OAQ1 2ZU3A 1NSTA 4X1NU 1T8MA 1SMFE 4JBWA 1EPTB 1BRUP 1ETUA 3VR5A 4IKEA 5DP7A 1FPHH 1GGDB 2NZ8A 1KJWA 2GAOA 4PROA 3PUYA 5F8XA 1GJ8B 2PCLA 1COWA 2QA5A 1GIAA 1GCDA 3K70C 4INHA 3UNRA 4C30A 2C90B 5KNDA 5JHGB 4P4SA 5IHPA 1E34B 1GMDF 4GHQA 1YR9A 3CRQA 2FS9A 1KI7A 5DHFA 4ZMAH 4GOKA 1XBTA 3TIUA 3SI3H 3CP7A 1TQ6A 5L6NH 1E99A 1Z6AA 3T25A 2ZDAH 3I62A 2B5TB 4D4JA 4FCTA 1N6RA 1C1QA 1FPCH 3NDBB 4OHVA 1GJ5H 2H57A 2A78A 1DUEA 1LPKB 4LUCA 1MRNA 1IQLA 1K22H 4II7A 4QJ3A 1NTPA 4FUJA 3QPWA 4RKJB 1YZLA 4PO1A 1RIWC 4ASUA 3RMLH 1ESTA 3UPEA 4I31A 1XMSA 5FUWA 1P09A 3GFTA 2JLSA 4N1AA 3T1VA 2ZIAA 1O2PA 2P3UB 3OSYA 3FKSA 2G9NA 1JQLB 1KKMA 2IBMA 3QEOA 2A4RA 4I8JA 3SU2A 4DCVA 4ASUD 4OKSA 1TA6A 4JYTA 2BCGY 2TIOA 4A6XA 4AX9H 1EG7A 5FPSA 2O8BB 1SB1H 4PPQA 2LKCA 4QNMA 2EFGA 1T3SA 2V3HH 3FMOB 1NBMD 1XVMA 1UADA 4Q7ZA 2PKSC 1DANH 2JLXA 5SZJA 3AF1A 4OS7A 1SHYA 2BBTA 1MD7A 1M7BA 4HZHA 1Z6XA 2PKSB 4JKIA 2VP9A 3ZZCA 1FL9A 1LHGH 2WWHA 5AR1A 4IW3B 4IS5A 3HR8A 3AK5A 3AF4A 3F8TA 2BMJA 3A8TA 2JH0D 2H9TH 1D2MA 5J4YA 2EW1A 3I1FA 2CL0X 4TMZA 4D4KA 4PC6A 2M5TA 1HUQA 2C4FH 1EFRD 2QENA 1LV7A 1EX3A 2IPHA 1QVRA 5ABWA 2ZETA 3HR7A 2G5VA 1G19A 2YZ2A 4DUGD 3QG1A 2J4IA 3TRFA 2W6IA 1L1JA 1S83A 3SDZA 4U7DA 1A0JA 4M9SA 5L3VA 3ADCA 1W4AA 1E4VA 3LQRA 3MCAA 2XNDD 2GCTB 4NG9H 1FFHA 3CNNA 4MRVA 4K5ZA 1FN8A 1C1TA 4ZCMA 4HAZA 3QOFA 5EW1H 2O5VA 4HSEA 1C5XB 3FHOA 1A4RA 4QNRA 4YMVA 2ZJ8A 3UUZA 4ZKOU 4IDNA 4CF7A 4YO9A 4Q9IA 3OIVA 3VNVA 2JCSA 2WJVA 2ZGHA 3PLKA 3DOEA 4RD6A 1TFXA 4PZLA 2G51A 2VB0A 1PQ8A 2IYYA 1K5GA 3TW8B 1SLVB 3UWIA 1EFTA 4XSGA 3EA0A 4NCNA 4V03A 5EE1A 1JWTA 4EPXA 2HCJB 1XCPA 2ZSDA 1H8HD 3RS2A 4NCJA 4NCKA 2J0QA 1K1IA 1OF1A 1HE1C 4FMCB 3JZ1B 4ZHMU 1T7CA 4B1TA 2BHRA 4I99A 1JR3E 2NPIA 4U2WA 2O8CA 5IDVA 1JQJC 3EZ7A 5A2MH 3EXAA 2D2FA 3W5IA 1XEFA 4ABFA 4LYHA 3SGAE 5IYTA 4HB0A 4FCVA 1V2LT 3LDAA 2N1BA 1XD2B 5FOUA 3X1ZA 4U32A 1QRZA 4BECA 1E69A 2VHQA 2ZRHA 2ZKSA 1NIPA 2A5KA 3VQTA 2G8TA 1QRXA 1TYNA 2ODWA 5BWMA 4A9AA 1Y3UA 4K1EA 2GD4B 3MUFA 4B48A 2BY5X 1TNDA 1ELOA 8GCHG 5HKKA 2X2EA 2A7HA 1OJLA 2EU8A 3GJ6A 4TZ0A 4CVNA 1G4UR 1C4U2 3PM3A 1I4LD 4LC1A 2H5CA 4JBXA 5JI2E 5KU1A 4TWZA 1A5IA 3ZZBA 1YKSA 3UIEA 1ZRHA 4P32A 4Z8YA 3I73A 3B13B 3MWIU 1CT4E 2Y82A 5CHAB 2P0EA 1Y3WA 4JL5A 4A36A 1BH2A 3TNSA 1BRAA 3I8SA 1V6DA 2NZJA 4NZYA 2Y80A 4M1SA 1MO3A 1YJ5A 1VCWA 3H84A 5SGAE 3RVBA 3SS8A 3THWA 1MO6A 1N6YA 1O0DH 1AWHB 3OTPA 5UKDA 2CE7A 2H7VA 1RRPA 3CNOA 3N2EA 1UVSH 1QL8A 1UK4A 4PC1A 2PV9B 3LRPA 2ZPTX 1C1PA 1AKSB 3PMAB 1T0JB 1BKDR 3CPEA 3M3TA 2VSOA 1QBVH 1PUJA 2HRVA 4X2XA 3NZIA 2BDBA 4KGAA 1U90A 3G0HA 3DPUA 2J45A 3M1IA 2CHAC 3TJZA 1XMIA 4D2IA 2A4QA 3K0AA 3FHCB 1GMHG 4JZKA 4MPVA 1RFLA 1U81A 5E7JA 1RYFA 1BMFD 1LNZA 4DLZA 4GZLA 4FVDA 4AOQA 3QGNB 1HJ8A 2XCNA 4IC5A 4XE4A 1VYUA 3VB4A 4GAWA 1ZD8A 2QP4A 4A0RA 3U7HB 5CB8A 1KDQA 1W0KD 5H8WA 1QB1A 1BMAA 1S2MA 2ZQ2A 1O2YA 2JDID 4C0SA 4NFFA 4LJAA 4CH2B 4JVSB 1SOTA 4HAXA 2A2QH 1BRCE 1ANDA 1RJXB 4HZIA 4NGAH 1M2OB 3DDCA 2ZQ5A 1AZZA 1WYKA 3SFVA 2XC5A 1EB2A 3RXPA 1W12U 2ERXA 2NIPA 3PFIA 3SUDA 2JLYA 2HLDA 3S1AA 3U61B 4V02A 1F5KU 1PYTC 3MH5A 3CZPA 1CF4A 2CGAA 4HB2A 3EG5A 1C1RA 2BM2A 1V2OT 5KDLA 1HYQA 2JLRA 1UVPA 4JT4A 3I8XA 1NVVQ 4FXPA 1TUEA 2FZ4A 2GK6A 3DL0A 5H4IB 1XPUA 2QGRA 2FOGA 2VIVA 1HT1E 4TYPA 3I72A 4JL6A 2W83A 5CIWA 2A2XH 1KSHA 1SL3A 1M7HA 1A82A 2ODEA 1FUJA 3B6EA 1P73A 3WRYC 3AP3A 1QA0A 3BAFA 4CDGA 1TEXA 3T5GA 1OWDA 5F8ZA 1E94E 4DSUA 3AASA 5TCAA 4RFSB 4UFGH 2RMKA 1O34A 4BTUB 1D2EA 2V4ZA 1D4PB 2ZAOA 1GCTC 2FOHA 2ZU2A 4TYWA 1ZMXA 1J8AA 3KB2A 1FV9A 2HPPH 3VX4A 2P67A 4ESVA 4LOYH 3Q5EA 3FDIA 1WE2A 2FTMA 5KUTA 2WWYA 1QNJA 2B21A 1X1RA 2C9YA 1DG1G 1OSNA 2BEKA 2VQSA 4TN1A 1C1MA 2HCBA 2VHCA 2BVXH 4PC3A 4XOIA 4HUQA 4L4UA 3E70C 3EA7A 3I32A 3M6AA 1FIZA 5JI3E 4JLJA 3PUXA 1P2SA 2VBCA 4K1TA 1NNEA 2J34A 1NN1A 3RS7A 4HI0E 3QKTA 1KK2A 4JJZA 1AA9A 1J99A 2FOMB 4KITB 3TK1A 1C1OA 1O3MA 5C5NA 4FMDB 3AV0B 3U69H 2JLZA 1XCGB 4BTTB 4CHAB 2YOFA 2GKVE 3TNTA 1HV7A 2BBOA 4L16A 1GBIA 1XUGA 3RLYH 1HPGA 121PA 2GJ9A 3V4FA 2Z83A 2UWLA 1QB6A 2QORA 4DCUA 3GCOA 1GVZA 3MNXA 2Q6DA 1RD3B 1H9LB 4HFPB 1L7VC 2PTNA 2UWPA 2UZ3A 3UG7A 4FMBB 4FUBA 4C2TA 2IS1A 4TLAA 1VMAA 1U0HC 4Q02A 4D6PA 3JVUA 1I2MA 1VITH 4O0MA 1X8JA 1FZZA 1IOEA 1FY5A 4OI4A 4DG4A 2PR3A 1TU3A 4Q4LA 5EUQB 2FOFA 1GI2A 1GDNA 1LQDB 1UM8A 2EFHB 2ZS9A 1QHXA 4BNRA 1PPBH 1FOEB 3BG4C 3UPUA 1QRWA 3THOA 4DVGA 3SU6A 5KSOA 2IYZA 1UCYE 1HAVA 2EWWA 2TGAA 1QHHA 3QNUA 1KIGH 3F9HA 1U6QA 3RRMA 3V9PA 4YC7A 1GRRA 4K69A 4OHZA 2EFDB 5JRZA 1GMCF 4BAOB 3P4YA 4MQAA 1KO8A 3NIBA 1UEJA 4KVGA 4JMYA 5BPEA 1W10U 2WPLS 4BQSA 1BYIA 4CEHA 1ZHPA 2Z3CA 4IFBA 3AM1A 1JIMA 5GDSH 5DSZA 5KYKA 4B2CA 3RNLA 4B3XA 2D4HA 1E0KA 2PEYA 3ZD6A 4MRNA 2RB4A 1O2OA 2GVFA 5HYOA 3RMNH 3SBDA 1Y3YA 5I46H 3MH7A 3T12A 4D82A 2VP0A 1THPB 3KQBA 2CLCX 6Q21A 1K1MA 3SN8A 1GVLA 1O2IA 4AFQA 1PLKA 3PIRA 4G3XA 3GEHA 4BASA 1N6LA 3LDXH 3LONA 4PHFA 2JEOA 2R62A 1Z29A 1NF3A 4KFTA 1O2SA 1ZM7A 4Q00A 2QM7A 4TYDA 4OL0A 2O8EB 2BX3A 2W6JA 4AG1A 3EIHA 2WPHS 3UNSA 3U1JB 3LOXA 1PLLA 1Z1IA 2V6NA 4PQYA 1NMXA 1E2EA 3U2QA 1TABE 1TQ7B 2ZCKP 4DLUA 4N0EA 2B8WA 4Q2KA 1B23P 4Q47A 1YC0A 4Y0AA 3PEYA 2OHFA 1MUEB 1W11U 4QBIA 4POAA 3L6PA 1QJ7B 4Q1CA 4OK6A 1T9HA 2OFXA 2BEJA 2GDEH 3N2IA 1GDUA 3VFEA 5E8EH 2ZFPH 1FP6A 4DGJA 3TGKE 1OKKA 1AFQB 3FGNA 4RI0A 1O2GH 2SGQE 3BTME 1FW6A 2XGJA 2HF9A 5GCHG 1L2EA 1KZGB 3NKKA 1ZP6A 2HYIC 4TT3D 1ZCBA 4D0NA 2ZI3A 1M9UA 3BTFE 4MYUA 2KE5A 3CENA 3KUCA 1F5RA 1W5SA 2GP9B 1D3PB 3P70B 1TRYA 1E0SA 2OV2A 4DB2A 3B9QA 3L0PA 1GMCG 1JR3A 3QTVH 2C96A 2WICA 4JLPA 4URZR 4FUCA 4X8HA 2WAXA 4QBFA 4RZUA 1HLTH 3ADKA 2FMJA 5L3SB 1Q31A 3H09A 3BBPA 3TPIZ 1T8NA 3GLGE 1F0TA 3RS5A 1Z6JH 3M3SA 3I5XA 5EZ5A 2O8FB 2IYWA 1YHNA 2W7UA 3QJYA 2EI6A 1FY8E 1JECA 3NUMA 2ZRIA 4URUR 4X6OA 2V3OH 3SNDA 1BJVA 2FPMA 1XXDA 3PR1A 3P95A 1TLDA 1VHLA 1QQUA 2H9HA 1G2LA 1V2UT 1L4ZA 2VSXA 4CRWB 1V2NT 1C5UA 4MTBA 5EE9A 1DS2E 2XWBI 4WMEA 2GA8A 4LRWA 1V5WA 1IQNA 3ZVEA 1ZM3A 2RCEA 1XMVA 4DHEA 1PJRA 2HDNB 3OZXA 1GG2A 2PJZA 2PUXB 3GY3A 4GSYA 4UE7H 4DSNA 3ND9A 5JB8S 4Y10E 1FN6A 4X8OA 1F60A 4NHOA 1TQ0B 3A88A 1C2GA 1FY4A 2RGDA 3LVRE 5CM9C 2YHSA 3SJ8A 4LYFA 1FAXA 4HZUB 3E3TA 1QB9A 5EE0A 2RHMA 4ZI2A 3E5HA 2QU8A 4TLCA 1FQ3A 2WJIA 2O8CB 2IS6A 1C2IA 4DIIH 4AI6A 3NPSA 2BBSA 1Y3AA 4MGZR 5KSPA 3TH3H 2A32A 4QL3A 4HUTA 1TQ4A 1MQ5A 2JIZA 1KKLA 1VDZA 5JFGA 2EEKA 2DYKA 3LPRA 4WZ6A 1GHXH 1E2QA 3RRYA 3B8JA 2G1KA 3RWMB 4RJLA 4A92A 4EPRA 3MO9A 4GBMA 2PBRA 2OO7A 4Q1AA 1GBLA 1R0WA 4LV5B 3LH3A 1LHCH 5GNDA 1SXJA 1TBQH 3L8ZA 1JRTA 4QJ4A 2XC4A 2ATXA 3AVXA 4NCYA 3EZFA 2IYLD 5EGMA 3K9GA 2R6AA 1H65A 5KO2A 2OQUA 3RXIA 3OAAD 3ZZ6A 1CJVC 2RG3A 4MLFB 2FPLA 3A81A 7GCHG 1J15A 3SV7A 4H6SB 2XX3A 3Q7QA 4B32A 1DEKA 2ZRNA 3QXJA 2J0SA 1IJEA 4D8NA 2G00A 2JASA 4JVMA 4TTQA 5C18A 5DJ7A 1HE8B 3MMPA 5ELXA 3JZ2B 4UXJA 5LGOA 3C4JA 2XRCA 1XNJA 4E22A 3BJIC 3CRVA 5AVDA 2A1DB 4XBDA 1KTTB 3RC4A 4B76A 4LBYA 2J0UA 2DWPA 1ZNXA 2P5TB 1IHUA 2ODPA 3C5HA 1VJ9U 3MNBA 4IDPA 3AKDA 1DAKA 4DEYA 2D2EA 5B6OA 1E32A 2FM2A 1KDRA 4QHSA 2G4UA 3UNQA 7ESTE 3LVQE 1V2JT 1GNRA 1GCTB 4ABHA 2AK3A 4IN1A 4FUEA 1C5NH 4NZLA 1KLJH 1Z0AA 1HT2E 2ZP0H 2H92A 4LI0A 2FLRH 5P21A 5CMXH 4CR5A 5CK4A 821PA 1DAEA 1KSJA 1JB1A 1GHBF 2SHKA 4HAWA 5FOSA 2ZFSA 2GBLC 2ZYVX 3ZVAA 2BOVA 5JRJA 1SGFA 3GLGB 3RXHA 4L15A 1H1BA 1KIMA 2AMQA 3DO6A 4AC9A 2EYQA 4G5SA 3W6OA 4IDOA 1OXUA 1P2NA 2ZTYA 4L8GA 1P3EA 2JLVA 1O3IA 4PAMA 2HNTC 2CXVA 4F4IA 1TB6H 1G8GA 2C8ZB 4US0R 3ZIAD 2PT7A 1QHIA 3OY6U 1EX7A 3K9NA 2BX4A 1SVOA 1ZD1A 3KKOA 3LBNA 1F92A 4ZDIA 3HK3B 1P05A 4OI2A 5HGGA 1IQIA 1Z6TA 4O9VA 1AU8A 5FFMA 1DE0A 1NBMA 2GZHA 3MU1A 3O8BA 4JKYA 4LJYA 1G7RA 4NU0A 3VR4A 1XTRA 1P6XA 1JEEA 1TRMA 721PA 2A7JA 3RC6A 3QXHA 2WHXA 1EOJA 1ZJ6A 1PPFE 3ODDA 3S69A 3V7TA 2A9KA 5ESBA 5EPNA 2BV3A 1GJBB 1T8TA 1O3FA 4DLYA 1E6CA 2JJ1A 2AFHE 3T1QA 3TVJB 4Q7JB 4EFMA 3GQBA 3WHKA 5T6GA 1Z2CA 3RXFA 2YWGA 4WY3A 1HAZB 4FUGA 1D9IA 3EA9A 3U3KA 1DO2A 3IHWA 3X1YA 2GHIA 1MZDA 3E16B 4BLRA 1AMHA 2C8VA 1HXFH 4LJ9A 2NO7A 2ZYTX 4JLVA 2XC0A 1ZYOA 4MPXA 5L30H 1P2VA 3ZZ9A 1OYWA 2JJ1D 2CVFA 1MH0A 5DK1A 4MDEA 4GOXA 2PHBA 1NVXQ 4O3TA 5JBQA 1NJGA 4M9XA 2ZITA 4PSAA 1W8BH 4P0TA 1A46H 1KDQB 3FAOA 1GHZA 2ANMH 3GY6A 1Z06A 1OXXK 2BDHA 3VR3A 3K6ZA 8OHMA 2PX0A 4B3FX 2QPOA 3KDSE 2MSCB 4RD2A 1XU4A 3SORA 2REXB 3UFAA 3GLHA 2A5GA 2FF7A 4BPBA 1Q1BA 5T1VA 1IQJA 3R3GB 4AKEA 3K0SA 1HQCA 3IHLA 4XWAA 3OIYA 2D7CA 4DURA 3VHXA 1N0VC 4Z0KA 3QX5H 2FMXA 2WBLC 2ANBA 1TQ2A 4Y11E 2ZVPX 1KI2A 2FPZA 1GBHA 2ZSAA 4PAQA 1AHTH 5TB5A 3A84A 4OQLA 3PV4A 3SNHA 1CJMA 3SJKA 1M34E 3W5JA 4BZQA 3S9CA 3AH8A 4KLNA 4HGCA 1E96A 1W49A 4LY6A 2ZDNA 2WJHA 4D26A 5A8YA 2A5YB 1HAIH 4JZDH 1DXWA 3ZZDA 3MH4A 3UQVA 1J90A 1SQTA 1G6OA 4VGCC 4UFFH 3WY8A 3F9GA 3RYTC 1MCTA 3EAJA 5BRRE 4NYMQ 4Q9KA 4HTCH 3MU5A 3TKLA 1YZUA 1NL3A 4UNNA 1O3KA 4BFYA 2GTPA 3R7WA 1ZPBA 2OXRA 3AKEA 4A4DA 3GCHB 3Q8XB 1O5EH 2BD5A 2MMCA 1O3AA 3W3ZB 3DT0H 1WTGH 5B6LA 4H1UA 2F9MA 1F2TB 1V43A 1VIYA 1K8RA 2DWQA 1KY2A 3S7HB 2GXUA 2ALVA 2IYQA 1QZXA 1WQVH 4KVAA 5LPNA 4CRGA 1ZSKA 2IWHA 2WAYA 2RCNA 1VGCC 4KV9A 3TLOA 1KO1A 2BZ6H 3ZVCA 3A4NA 1C5TA 3GEEA 3CS0A 1UK2A 2F9BH 3MMGA 1P2IA 2GRJA 2AHOA 3DHWC 4Q01A 1MTWA 4HB3A 1EFUA 5L2YH 2QQ0A 5FCKA 5E0HA 1QTFA 1T4VH 2PT5A 1GG6C 4A2PA 3OEED 2IUTA 3WNBA 3KQCA 3ZV8A 5JLJA 2VGCC 2PWXA 4BANB 3FWYA 4GPGA 1HAYB 2Q9AA 3A8DA 3HWSA 3B78A 5DIFA 4DXAA 2C03A 3GDVA 4B2IA 2WWIA 5C4MA 3KQUA 3X1XA 5A0CA 3FFGA 1P60A 1A2CH 2VRWA 4Q1EA 1QHGA 3JVVA 1BJUA 1X7AC 3C41J 1D3TB 3RXJA 2QTHA 2Y81A 5CDFE 1BTUA 4DIDA 2JA1A 3A36A 3M7QA 4GCHG 1GI8B 4QHTA 4E09A 2B7CA 4QJ5A 3LGYA 1WDTA 4LXBH 3A8AA 2ZEJA 1O2MA 3B1VA 1T0HB 2ZPQA 3OESA 5IF9A 1Q3XA 3L0IB 4D76A 2ZI9A 1XTJA 1T3HA 1C4V2 1YZKA 3DZDA 1VCMA 2FH5B 2IXFA 2ZR7A 3H0KA 2ZIQH 4LHYA 3W9YA 5C67A 1FI8A 2EFEB 3LD9A 4XBCA 1UEIA 2STAE 2W00A 1Z07A 1LO6A 2BDGA 2ZR9A 1IXZA 1E2FA 4ZIRA 4HAUA 1Y5UT 2OD3B 1G8PA 1ESMA 1N1LA 2ZWLH 1KI9A 4Q7KA 3U7FB 4MH0R 4P31A 2QF0A 1S6HA 1HY3A 3LAWA 4D7GA 1Q1EA 3E1XB 3U1IB 2R6DA 4G5OA 5GADl 3LLMA 2P3TB 1MBMA 5KSYA 2HWLB 1YM0A 3X2SA 2RH5A 4CEIB 2RA3A 4WZAE 4NCHA 1S8FA 1WV7H 5FTJA 3PV5A 2FFQA 1GZSA 1DADA 4R2HA 1KK3A 5FX6A 1AGPA 3ELAH 2BMEA 3BIFA 4A0GA 1E1RD 3FB4A 1RJ9A 3PCRB 4IDHA 4HI3A 1I4DD 1S96A 4RD4A 3ZYCA 4BLSA 3OTJE 2OFWA 2CE2X 3TW4A 4HB4A 2JJ2A 1ZTKA 2GJAA 3GCGA 2GJKA 3QEJA 3QE0A 3LNCA 4FUIA 1XTSA 3I29A 1US8A 2BKEA 2TRMA 1YGCH 5T3HA 1AJEA 1O3CA 2VSFA 4ZPXA 4FVBA 1J9CH 2W7SA 3UMRA 3S7KB 1T31A 3TBKA 1YQTA 3UOPA 3RC5A 1AKYA 3TITA 4LHWA 2OLKA 5EQQA 1ETRH 4GCHF 4ZKRU 1BTHH 3NBXX 4Z54A 1E2KA 4JLKA 1BIOA 5EG4A 1SHKA 4OGXA 4CYMA 3D8BA 4DDWA 3R9WA 1J16A 2NU4E 2VWNA 3BB4A 3EASA 3AUXA 2FDCA 3WYAA 4OGYA 2ORIA 4TPYA 1KSFX 4AFZA 1UFQA 2QC2A 2R9VA 1ZNZA 4UONA 2J92A 3JZMA 2JLWA 4KKDA 1DOAA 4K8BA 1B5GH 4ZV4A 4K8YA 1XM1A 2K1QA 5BXQC 1P7CA 1IN7A 3RM2H 2H1UA 1SVKA 3LGTA 5A0FA 1E9RA 1THSH 1G7TA 2R44A 2V3CC 3SU1A 3MNCA 1HJAC 2UKDA 1H8HA 1T3LA 1NC6A 2W0SA 4LBVA 4JYUH 3A7YA 4B3DA 1DY8A 2TGDA 4LJ4A 4FUHA 3ATWA 2ZM5A 3R8FA 3HYRA 2X8AA 2OSBA 4Z1MD 3H2YA 5C1BA 4AGJA 4QBGB 3TJUA 1OFHA 1AO5A 4AG5A 1TRNA 2FFAA 3K9LA 2PLXA 1TMKA 1QG2A 5CJ2A 1AFQC 4ABEA 2O8TA 1EX6A 3NKVA 5CHAC 4EQ6B 1P2QA 4LOAA 2I6SA 4DCDA 3P4XA 5EP4A 1PPGE 4S2EA 3EW9A 4WBSA 1C2LA 3S9AA 1TPOA 1IXSB 2VH0A 2H17A 4BFXA 4M9FA 2BYAX 1GBFA 1CA0C 1Z0FA 1W7GH 2FX6A 5CITA 1RZ3A 4BFWA 4C0HA 4ZKNU 1V2PT 5AJVB 2H9EH 1GDQA 2ZXUA 4OHWA 4BFUA 3KFXA 2BD9A 2ZCHP 1W44A 3LXRA 1QL9A 1Z22A 4DT1A 2B9LA 2ZRBA 3BEUA 1SKQA 4IVRA 4X2WA 3RC3A 1H8IH 1FY3A 3GLIE 2ZUDA 5T6DA 3K9HA 1MKWH 3ZZUA 5C2ZA 2I1QA 1X3SA 2ZGXH 1WU1A 2IS2A 4Y8YA 4LYJA 1OIVA 1OH8A 8GCHF 4MNYA 2B8TA 1FNMA 3WYGA 4DB4A 1YR8A 2WKQA 4IBLH 1LF5A 1SGFG 3RXVA 3W6NA 3GFOA 5L3SA 1DM4B 1R6BX 4IC6A 4U5XA 2OC0A 3P27A 1YE8A 1V2ST 3TSZA 4BLTA 1ZAKA 1MH1A 2PZFA 4DLXA 3B8HA 1T8LA 2C2HA 1ELCA 4ARZB 2XSZA 1HFDA 3SGBE 4DIHH 3U5ZB 1H8DH 2BIFA 1O3YA 1TIOA 4TQ9A 5JCZA 1DO0A 2BQ7B 1G3CA 3BFVA 4LJ8A 1CBUA 3TK6A 2D2DA 4M1KA 1IY0A 1E3MA 4UXIA 2CMKA 2YWEA 1ZW6A 4ZDWA 1OWJA 4XIGS 3SEAA 1FX0A 2NPFA 1LVBA 4ZI3A 2GEUA 3CR8A 1XX6A 2BOHB 1SGTA 2RGNC 5FPHA 2F43B 3P17H 4P33A 1NRNH 1KDTA 3U98H 1YRBA 2CNWD 2HOBA 5GVRA 3QVUA 2X2FA 1MR3F 2ANKH 4Y8ZA 1SVWA 2G4TA 4Q7MB 5K0HA 1KO5A 2OAP1 5AUOB 2DUCA 1NY6A 3DKVA 4DOQA 1E2LA 3AAVA 1V2RT 1ELGA 3P8NA 4TY6A 2V1UA 5F98A 1C5PA 3PUZA 3NWJA 1FTSA 1MTSA 3UY9A 2CNWA 1ZJDA 3TH4H 1LKBA 2XEXA 4I32A 1ANCA 4LC0A 1XJCA 2XB2A 5J4HA 5HKKD 1O5CB 1EATA 1PZNA 2Z3EA 3DKPA 3T06B 3ATMA 4FMCF 4CEJB 3GCTF 3SU8A 3X1DA 3PYHA 3PITA 4B3CA 4ABYA 1JXPA 3VAAA 3N5CA 3GY2A 5B58C 5GJVC 4MUBA 4LK2A 2SNVA 1KSGA 3URDA 4AYTA 1RC8A 3QXXA 3LA6A 3TUJC 2C8YB 3BERA 2ZEBA 4AD8A 1E9DA 3GLIB 1F3OA 1RE0A 5E7IA 2VGCB 1DWDH 2A5IA 2IF0A 3B5JA 7LPRA 2IF2A 3VXFH 1EJNA 3TQCA 2AEIH 3M5MA 1K28D 1OV4A 4DCNA 2NQ2C 4UJ5A 4NYJQ 2F9NA 2ZJBA 1EJMA 1WRBA 2BMFA 1W48A 5J5CA 2JGNA 3SNEA 4DIEA 5JDUB 4OQFA 1NG1A 4LHVA 2Z4SA 2SGDE 4YZUA 3CONA 4HEJA 2R2WU 2VNTA 3EIEA 1EB1H 3NTUA 4DRZA 3QXCA 3M5OA 2V55B 4JS0A 3QKUA 1CT2E 2ZA5A 1KAGA 4XH9B 1LVYA 1DLEA 1UTKA 1O31A 1MKYA 2ZJOA 3M3VA 1KXBA 3OIUA 5E95A 3T2NA 1CJTC 2HT1A 1O2HA 1AFEH 1GOTA 1T6NA 4E5UA 2IYVA 2YWFA 2C04A 3RSLA 3SN6A 2P5SA 5K8TA 5FR1A 1SGWA 1OXVA 2UUKB 3IQXA 1Q20A 2QI9C 4DT1B 2FN4A 3A4MA 2UZIR 4AWXA 3PROA 1O3DA 5L3RA 3DMNA 1SHHB 1G3DA 1Z83A 5J4QA 1UVTH 3ZJYA 2V7QD 3DD2H 1D8TA 1O3NA 5J4SA 1FXYA 3BN9A 1SGYE 3I77A 3RXUA 1O2KA 4CBOA 2BOKA 2YC2C 1O2WA 1F7ZA 2QRNA 5A09A 1YP9A 2ZJYA 3ONWA 4LBWA 4KFRA 3UWOA 1KXCA 2ZHFH 1NG9A 3ENSB 3U4QB 3VX3A 2FOCA 2IUUA 2QGZA 1UPTA 4U30A 1A5GH 3NEJA 3UOUA 3GICB 1RFNA 2PH1A 3M7UA 3IO5A 1FX0B 2GXQA 1L0ZA 4K46A 2OC8A 3TK9A 4K2YA 3QKSA 3STJA 1YLDA 3PEUA 4M7GA 1E2IA 2BKUA 2QROA 3K6YA 4NYIQ 1EOLA 3DVLA 1A1RA 1GL9B 2OXCA 1G17A 5AJWA 3IEVA 5F8TA 3LFUA 2IWRA 3H86A 4BRUA 1GWAA 4TLEA 1O5FH 2D06A 1GHBG 5DH9A 4FU7A 4Q7YA 3SBKA 4UEHH 2CCJA 1II8A 1U94A 1HBTH 4W7SA 2HLCA 1R2QA 4EPTA 1JMOH 2O8DA 1GWNA 1QHRB 3CM0A 4HDOB 3SO3A 2ZNKH 3A83A 1XDBA 3MH6A 3Q77A 1QBKC 3N7OA 4KTSA 5BW8A 1WA5A 1G36A 1R0ZA 2C99A 2J38A 4WJG2 3ZS9A 4XSKU 4M0LA 4P3YA 5EQRA 4A8JA 4NWKA 5JS8A 2KAIA 4I7YH 2AERH 2P65A 8ESTE 5G53C 4GP7A 3CWZA 2FOEA 4G0NA 4B73A 1EAXA 4GMDA 1NO9H 2BDYA 5GJCA 1N6KA 3CIOA 5JSZA 1UVUH 3A87A 1C4Y2 3WYFA 1VPLA 5DI9A 3TUIC 2J87A 3IO3A 4DDTA 2B8OH 3VNUA 2W2TA 3UIRA 5B30A 1O5BB 2F9LA 2O8BA 2IXEA 4LDJA 2XXAB 3TNFA 3KQLA 1CEEA 4BXSA 5FBWB 2FG5A 1GHVH 3B1YA 1OPHB 1NFWA 3L82B 3RXMA 3PLBA 4LGMA 2ZU4A 4IN2A 3VR6A 3BF6H 3FFAA 4KELA 4OJKA 1N5IA 4JL8A 4R8TB 3T15A 1JI0A 2GCOA 4NA9H 1P75A 2HV8A 4FCWA 2Q9CA 4INKA 2ZANA 4RFSA 1LS1A 1IHTH 4KHZA 4C2UA 5LB2A 4FUDA 2Y7XA 2O0KA 2V7QA 1S1CA 1ZNWA 4X8TH 2NO6A 4BEJA 3HU1A 4ABDA 3BTQE 1N6OA 4I1UA 2FJUA 2RKOA 3K53A 1BZXE 4PPFA 3LWNA 5K8UA 1SVMA 4K81B 3E91A 2WSSA 5FR2A 1P61B 3GLFA 4A6LA 4D0GA 2JJ8A 1CU1A 3MOCA 3MFYA 2GCTC 3UATA 3WY9A 3BB1A 5EP1A 2FP7B 2BM1A 2QGNA 1W13U 4AKIA 3P8FA 2P93A 4CW7A 4QG7A 4JLBA 3H4MA 1NLFA 5C1XA 4XWOA 4WA7A 3C16C 4RVCA 1YVDA 4NIVA 1P72A 1G32B 2J0UB 4FI3C 2W2VA 4M9QA 1Y3VA 5KPDA 2WJJA 1UDXA 4M9ZA 1NFUA 1GI1A 4R71A 5KHOC 1ELTA 4TT3A 1Y5BT 2F1HA 4DDUA 1BDAA 3ZZ5A 4NPHA 2AGEX 1D9XA 3G5UA 2AWOA 2J5XA 2DBYA 4HATA 6GCHG 2FE4A 1Y3XA 4DCSA 1YPLH 2NU1E 2BM0A 3SV9A 4KTUA 1P62B 1GI4A 1MTNB 1JRSA 4DEXA 5JJKA 1ZJKA 3MTYA 3WMEA 3FANA 3SV8A 3TR5A 3LU9B 3NHAA 1UTQA 4MYTA 1S9HA 1KK0A 3EPLA 1JEDA 1CBWC 2D1JA 2R9PA 2SNWA 2WSSD 4EPYA 2WTUA 1ZLRA 3E8LA 3CX6A 2G83A 4YONB 1XP8A 1LTOA 2G0NA 1K1LA 2GV6A 1XUKA 1AVWA 1XUIA 1GMDG 4Q1DA 1KYNA 3QVVA 2ANCA 2NMVA 2QXHA 2CEAA 2X1VA 3THXB 4K60A 4JJKA 4IEEA 2RGCA 2GX4A 1UBFA 5EW2H 1XEWX 1AKSA 1IQGA 2FSIA 3KEEA 1FMGA 4ZXXH 5C1YA 3D3QA 1FQJA 3GJ0A 2VWLA 2ZUCA 2SFAA 1FUKA 4GRAA 3AVYA 1XZPA 1VG8A 2P95A 1A1VA 1GL1A 2V8OA 5JMTA 1C5WB 2A7QA 2FODA 4ESTE 3F5FA 1HNEE 1SGNE 4F7WA 4KSBA 1KO7A 1OP8A 4OJQA 1JBKA 4LCBA 1E2NA 1ZVQA 5DP5A 3QQ5A 4HUQB 1ELFA 3ZS8A 4OQMA 2HUPA 4BUJA 2XBYA 3W8RA 3MYWA 1VG0B 3CH5A 1ZHRA 4A1XA 2GEDA 2QIQA 1OP0A 4AYXA 1C1VH 3GCNA 1LF0A 1EPTC 2FA9A 3RU4T 1C5VA 221PA 3MJRA 3QPVA 2FX3A 2XOKD 2GEVA 3FP6E 3AVUA 5HCIA 3VB3A 2QF3A 5JJLA 1O3HA 3LV8A 5TCCA 3BEFB 1P2KA 4WH8A 4RD3A 4QC2A 5AWFC 1S9DA 2ZE6A 1D3DB 4R98A 2NU3E 2WSMA 4GLYA 4ABAA 2FESH 3PENA 2W58A 3LJJA 4A6PA 2EWVA 4THNH 2VTKA 1KHTA 1D3QB 5JCPA 3OHMA 2Y5GA 4X1SU 2Q6GA 3KCGH 4XD7A 2BDAA 4Q19A 1QURH 2WOJA 4IFEA 3UREA 1OB5A 4M21A 3ZZ8A 2JAQA 5E0GA 2ODQA 5B57C 2JLQA 1GFIA 1WB9A 1E1QA 4ZDJA 4LV6A 5HCNA 2NWNA 2BD4A 3W90A 2H5EA 2VWOA 4I8HA 1CULC 3BGWA 1YCPH 2BY7X 3HGPA 4OHYA 3SNCA 3SYKA 4UNPA 4DY7B 1TF7A 4TMWA 1KOFA 2KBEA 5HZHA 1ZUHA 2KBFA 3UMFA 3TR0A 1PFXC 3U44A 1TU4A 5FBIA 3RUOA 1NRJB 5JBAS 3KQEA 2HF8A 5EQSA 3A7VA 3SBEA 1NVUQ 1XFAA 1INCA 5FTKA 2BQ6B 3VEQB 3GY7A 1H4WA 5DYGA 5JS7A 2NTYC 2HVXA 4D9QA 2CDNA 2WYGA 4CREA 1KMQA 4FU8A 3M5NA 1HAGE 2IYSA 3LXXA 2Z9GA 4B2PA 4BAKB 1RKBA 1HAPH 3O8DA 3MO3A 4JLAA 5C4GB 1UBEA 4A0FA 3CPJB 5A0AE 4M1WA 1XXHB 4X0WU 4TMKA 1SGPE 3ASYA 3DM9B 2VP4A 5CDFA 1DWBH 1P01A 1ZMLA 4Z1MA 2WINI 3LC3A 2C93B 2GVZC 1BB0B 2O0HA 1CSOE 4JVLA 5FH9A 3UWJH 1UTMA 2YNMA 2ZFFH 1OFUX 4DKXA 1E2PA 2CVHA 1C1UH 3GD7A 3KB1A 4JLOA 3N70A 2WJGA 1YPKH 3F68H 3FZZA 2R2AA 3PWCA 1AZSC 2CLSA 2GBLA 1E0FD 3ZGXA 3GISB 4TZ6A 1HYLA 1D6JA 1JNYA 4A8JC 4RD1A 4Z51A 1HIAA 3QDZB 4Q4HA 1GI5A 4LPSA 1UVOA 1F2TA 4I81A 5LB4A 1TOMH 4JSTA 1F2UA 2FU5C 1NMYA 3MGCA 1S0QA 3EZ2A 2ZHQH 2BB4A 4AZ2B 2ZGJA 2YV5A 1MKXK 1DG3A 4NYIR 3QZRA 3V0XA 2YNAA 2E1RA 5BN5A 2FOBA 3ZVLA 2IX3A 1XEXB 2QUZA 4X1RU 2TGTA 1YZQA 1L4YA 4IMZA 1EP6A 2R6FA 2CHQA 4AORA 1QGFA 1JIRA 3V00A 3GLHB 2GCHG 5LPEA 4HDQB 1W0JA 4UXHA 4GHTA 2WWGA 3TGIE 3R20A 2H8KA 1ID5H 2FSHA 3MRSA 4XTCS 2CJWA 2CXXA 3Q9LA 2PFEA 2ZI6A 4Q4AB 2BVSH 3TAHA 3EPKA 2WM9B 5AF9H 2W6ID 4O03A 2B7BA 1WQ1R 4ISNA 3G01A 3ZZ4A 2C78A 9LPRA 1LKAA 3K8YA 2ZVQX 3SZRA 1UAAA 1ZC4A 1G5RA 3GJXC 4GI7A 1Y5AT 1WF3A 5EXPA 2WMNB 1XUJA 2XXLA 3KQNA 3QLPH 3KTAA 1SULA 2W0MA 1E2HA 3WP1B 5T6FA 3QZQA 4PO9A 1PYTD 4LSGA 1BBRE 2J7KA 3RXDA 1UO6A 3BE4A 1ZUIA 3OAAA 1SC8U 4C0AC 1Z0IA 1GI0A 2LWIA 1V2VT 2IW3A 1AZTA 3GCHC 1GTVA 1Y8TA 1Z47A 5A8ZA 1JXMA 3FPAA 1DY9A 1VCIA 3EA5A 1OH7A 1E36B 4RN6A 3EAQA 1GBBA 5KPJA 4WH6A 3SHCH 1JBUH 1Z8FA 1NROH 1HGTH 4BLQA 3MJHA 4G5GA 4GSOA 2JLUA 1OFIA 1AQ7A 2AIPA 2ZSBA 3LIWA 1ZU5A 4BTIB 4LHXA 2FEMA 2EA3A 1AKEA 3TGJE 3K0AB 5G40A 2F9UA 2GGVB 4TMTA 1Q44A 2OC1A 3A4LA 1DAHA 5HR5A 3MWLA 3L8YA 4O97A 2BJVA 2F83A 2FEOA 3QKSB 4G1UC 2DY1A 3ZZTA 2WJYA 1DLKB 4Q4JB 1WCV1 3SQWA 4TWYA 1KXAA 3AF3A 2DCUA 1S0RA 2SGAA 2QAGA 1FY1A 3SUEA 4RZ3A 3E0PB 3I3SR 4KFSA 5FTMA 5AJYA 4BLPA 1GJAB 2W5EA 3VU9A 3DZ8A 1O2VA 1ETSH 3ADBA 1Z0JA 1AM4D 1ZGIA 3RP2A 1E2MA 1N2CE 4CGZA 3ATKA 4DZZA 4JBYA 1Z8GA 1MTNC 2PW8H 4R2IA 3NC1C 4LK4A 1NRRH 1HTWA 4TMXA 5FBQB 2HEIA 2H18A 3LBHA 2PSYA 2GK7A 2KJQA 3C14C 3RXBA 4B75A 2VVCA 3ZIAA 1KNXA 2BMGB 4JZIA 4QFMA 2OBOA 1P3JA 4F93B 1AB9C 4GL2A 1KYIA 3BTWE 2EVWX 2JH5D 1O2TA 4D25A 1GHWH 1DSTA 2BQWB 1AQUA 1XXHA 2L0XA 2MSEB 4MVNA 1W7XH 1BT7A 4NIXA 4F4CA 2GZ8A 2FOLA 3O47A 4E7RG 1Z28A 4GPTA 2CF9H 3SQEE 2J94A 1O5AB 3SJZA 2C8WB 1CA0B 1VCQA 4MYHA 4IOMA 1NESE 4IEIA 5K8IA 2UUJB 1L4UA 5DKMA 2AXPA 1HCGA 4C7OA 1E9FA 2BY6X 2AWNA 1GJCB 3RHFA 3W34A 2NOAA 2GVDC 3GJ8A 3ATIA 4K8OA 3EDXB 1X6VA 1GP2A 2WWFA 3ZVRA 1G20E 1L4DA 1Q22A 2G0TA 1E4YA 3A7WA 4AFUA 3U9AH 4EAQA 1TEVA 1WMSA 2G6BA 2DFKB 3GFPA 4GNKA 1ZD9A 1Q57A 1DVRA 1IN8A 3AVZA 4EQ6A 4FIDA 2Y7ZA 4TPIZ 2QT1A 1OH6A 1ZOMA 2VHUA 1PV4A 521PA 4W9MC 2FXRA 4QKQA 4YMTA 4TTRA 3U3MA 3IUYA 2QP9X 4X6NA 3TMKA 4NYJR 5GJWC 3EC2A 3THWB 1TNJA 3UQOA 2SGEE 1G8FA 4JYBA 1JAHA 1T32A 1XKBC 1VYVA 4OK5A 1RGQA 4AURA 2F4LA 3IPXA 1V2WT 1IQFA 2VHJA 1ANKA 3THYA 4O3UA 2ZPSA 4EFLA 2BLVA 4EIWA 3GEIA 3CX7A 4HAVA 1QCPA 2Z3DA 2QP3A 5LD2C 2PTCE 1ZSLA 3QN7A 1L2TA 1SPJA 2FNAA 4I33A 4GUXA 3K0CA 3L43A 1O2JA 1Z6YA 3I78A 1YRAA 3RS4A 4CEJA 2W26A 5SZIA 3SJAA 2QPAA 1MTUA 4TSFA 1M7GA 4PC7A 3GJ4A 3LBIA 3AAUA 3SI4H 2NU2E 4Q21A 4TL9A 1MAXA 3LT3A 2PGBB 1G9XA 5G3YA 2J7PD 3D65E 4OHXA 1U0LA 3ZZ0A 3FE2A 4Q80A 2VU8E 2QY9A 4RZ2A 3SYNA 1XPOA 1U98A 1UKYA 4GOJA 4Z6AH 1MCVA 1O38A 1DTSA 3U8RH 1ZUNB 3RANA 5F9FA 1W7AA 5JEEA 3VFDA 2IN2A 1TX8A 3T29A 5EE5B 3IDQA 1Z1JA 3FP8E 4LJ7A 1U0JA 1C2MA 2CLDX 4ZCLA 1QQ4A 1ELDE 5L2ZH 3AGQA 4G5QA 3A89A 3OU0A 3B9PA 1ZM2A 4V0ME 2ZSFA 3CX8A 1DT2A 1KK1A 4TWWA 2MMGA 1S0UA 1UTJA 4X6MA 2ILNA 4XJXA 4CIDA 5DI3B 1B0EA 4QM6A 1C1WH 4KYIB 3RXRA 4E06H 1UTLM 4Q5IA 4A8JB 3NC0C 4IDQA 1ZIOA 2VWMA 2H16A 1OB2A 3NH6A 4M8NE 3AKYA 5FBRB 2HNTF 1XD9A 3BSQA 1BUIA 2ATVA 2FTLE 3U3OA 4A15A 3RU4D 1NN3A 2FO9A 1TUIA 4B2AA 4OYHA 5E7MA 2QCYA 2OLJA 3LLUA 3OFND 2O8MA 1KXFA 1XUFA 1GG6B 3EWAA 2OCYC 1Z6GA 2A5JA 1P2TA 1QHSA 4ZHLU 4QBHA 5IT5A 1W0KA 1AY6H 5EXLA 1SGQE 3LGWA 1T4UH 5FOVA 5SZHB 3NBZC 5AUPB 4GP6A 1JPJA 3BIUH 1RRFA 1NRQH 2BTCE 1YPMH 4PC2A 3NK8A 1X8KA 4HDCA 2A4GA 2VIOA 2WV4A 4PANA 1R4AA 4EPWA 3IILA 2ZS8A 3RXOA 1S4QA 3HPTB 4Y8XA 2D8WA 4LZZA 1CT0E 1TPZA 4B2LA 1C9PA 2OUKA 3IITA 4JYVH 2ANYA 3P26A 2F91A 3W6PA 1OWEA 4NWLA 1CHOF 3UMSA 4HZUA 1HRTH 1H8ED 4ZAEA 2Q6TA 4X8LA 3O8CA 3RXQA 2OFOA 4D9RA 5BQ5A 1J70A 3TJNA 2CJWB 1DUAA 3GLIA 2ZYUX 3U44B 1ACBE 1TNGA 1WUNH 5FPYA 4FMDF 3FZDA 2D62A 4EKDA 1RTLA 2CBZA 5A0BA 3LJOA 1CGJE 3REFA 1EFRA 4JLNA 4JK5A 1TGTA 5J47A 1O32A 1ZBDA 1R5OA 3HPRA 2ODBA 4YOGA 2J9NA 1SZPA 4BWYA 3P92A 3QKRB 3GY5A 1YPHE 4AN7A 1NU7B 2I3BA 1OKKD 3EPJA 3F1SB 4OK3A 1IQKA 2BC9A 4G5RA 3MWJA 2OCVB 3LH1A 2ZI4A 2Q3MA 4MRSA 1QVAA 1XB2A 4ITRC 1EZXC 3OEHA 3V12A 3KJGA 2Q3FA 1RRGA 3AVOA 2Q21A 1ANBA 2Z5FA 1EESA 1OS8A 1GI6A 2DE9A 1QJ6B 3L0OA 1D6RA 3AW1A 1C1NA 1C4OA 4SGBE 5FL7A 2H6MA 1N6XA 1W47A 2HXSA 2V54A 3WMGA 3U3RA 2Z9JA 2FFBA 4NSYA 5TV2A 3BORA 4AKHA 3TSOA 5FUVA 5CB6A 1AQYA 2XTNA 1R5NA 5JSZB 4Y79A 2C3SA 3CF2A 2WKRA 3NBYC 1CIPA 4ABIA 1VYTA 2ZRAA 1TOCB 2QSYA 1EFHA 4YM9A 1BMMH 1ZMNA 2GTBA 1QFKH 3PJRA 3RXLA 2R0LA 5H1YA 3NEYA 1BCUH 3SHWA 2EYUA 5CK5A 4RCZA 4ZKEA 2F1RA 4A1VA 1WBDA 2W3KA 4UFEH 3S0NA 3B7GA 1MZAA 1AWFH 4B44A 5D3MA 7GCHF 3GLHE 5E0JA 3ADDA 1ORFA 3PB1E 3T1OA 2AN9A 4X8UH 2ZAMA 3R9IA 1ZM4A 4CEIA 1OYQA 2AKYA 1CHOG 4WZBE 4A7IB 3AEZA 4B47A 4PHTA 2OM2A 1FMLA 1NN5A 1NI3A 2QPTA 1P2UA 2UVQA 2G52A 3BH0A 2A0QB 2HPQH 1K6MA 4QHYA 3PXGA 8LPRA 1CLUA 1G41A 3CRW1 3SNAA 3NBFA 3Q7PA 4QGGA 3KKPA 1SKYB 2ZHDA 4MRPA 1ETTH 3FKSD 2IEYA 4Q48A 1MTVA 2ZTSA 4W5HA 3HDTA 1QHYA 4Z8XA 3H7OA 1IJFA 4A82A 1QG4A 1GKYA 1LVGA 2BMDA 4O25A 1DDJA 3STIA 2F3RA 4HAYA 1JALA 3U7EB 4RY2A 4Y0ZE 1GILA 1SFIA 2TBSA 5JJIA 4V0LA 2WPKS 4RD0A 3K0FB 4JZFH 2I6QA 1N0WA 1UKVY 4I1OA 1KMHA 1GL0E 2FWWA 3T5DA 3HATH 1VHTA 3AF2A 4LPKA 5JHHB 4NH0A 4BAHB 2HALA 1LVOA 3FTQA 2FPKA 4YLGA 3IIKA 3QK1A 2QTVB 3T61A 2O8LA 3L33A 4AIIA 2ZI7A 2NO9A 1CGIE 1Z3IX 5F2EA 1R0YA 3MO6A 2IJOB 4QRHA 3T1TA 1TMBH 5DP8A 2FOAA 1E2DA 3B1ZA 2B7DH 4BOHA 5AFZH 3CO5A 3SV2H 2XBVA 1T4GA 1VITF 2AL7A 4ZROA 4EFNA 1VJAU 2GCOB 1AS2A 3SU0A 1Z8RA 1A61H 1Q2WA 2FIRH 1Z8JB 1E9SA 1GDDA 5KDDA 2XYAA 4PHGA 4PZYA 1SGDE 2OLGA 3A85A 1MABA 3KQDA 2FSGA 3ZH9B 2OP9A 1O3LA 2R6GA 2AS9A 3AGPA 1IQHA 4INLA 5TARA 3SU4A 3KUDA 1P9UA 1LMWB 4BEBA 3BOSA 5BN3A 3TAUA 2ECKA 1K1OA 3LGIA 1N6IA 4WVPE 4MITA 2J59A 1C2EA 1OKXA 1P8VC 3K0FA 2B0FA 3KXIA 3BRWD 3DFJA 1NP6A 3KJHA 2VH5R 3SOSA 2BD2A 3GJ5A 2DR3A 1AVGH 3EE0B 3SOPA 2VIPA 2ZRPA 1X86B 4J0QA 1BBRK 3VKHA 1PPHE 3EARA 2Z9LA 2WOOA 2KAIB 1DWCH 3IBYA 1V2KT 2ZF0H 4AB8A 2IEZA 4YMWA 1HAOH 4CRBA 1BS1A 1SOZA 2OUAA 4HLDA 2PZEA 5G3ZA 1S81A 1ODFA 4HLUA 3QF4B 1RIFA 5GJ4B 1WSSH 1CXZA 4QGFA 4KU4A 2B92A 1DX5M 3QF4A 2YOLA 4US1R 3A1WA 4XD7D 5CE1A 1HEIA 4KFUA 4CRDA 2QEQA 1LW7A 2GXAA 1Z8IB 1O2RA 1IN5A 1A4WH 3AP2A 1ABIH 3CH4B 5H68A 1G3MA 2FWRA 1O2LA 2ZSEA 1J2JA 4Y6DA 1OX1A 2C9CA 4CRFA 2GCNA 1YYY1 1PLJA 3PEWA 3PO1C 1GJ4H 1E9CA 1GBKA 2PLFA 3ZV9A 4O2LA 4FD2A 1UTOA 2J95A 4MUAA 4FXGH 2IA5A 4BAMB 3CPHA 1OXSC 2CHGA 1O2ZA 2QA9E 3BC1A 4ZCIA 3K2UA 1BMLA 3THYB 1R8SA 2OBQA 2YYZA 3T5FH 1P10A 1OXTA 4OBEA 2GJSA 1OP2A 3VU9B 1AUJA 3Q76A 1CA8B 4EPVA 4LJ5A 1O5GH 1R10A 3U8OH 3TK5A 1W4CA 3AVTA 2GCHF 1Z6EA 3B1WA 2Z94A 1GPZA 2CMYA 1XXFA 1TNHA 4NCIA 2Q9BA 4A1TA 4YT7H 5DP6A 4LZ1H 4IRUB 1TBRH 1CBWB 4XSHA 3C5CA 2J7PA 5FXLA 2ZCLP 1U8YA 4AKGA 2AGGX 3KJIA 3U7GA 3F6UH 1R0XA 4JIMA 4ISIH 4LJ6A 1FMJA 3T27A 1N5LA 1J7KA 1OPXA 3OYPA 4GDFA 2YOGA 1AIXH 4CT4B 2A7CA 3DFLA 3UANA 4YLQH 3MD0A 1AN0A 1IBRA 2Z9KA 2P3SA 2REBA 2O8FA 5EP2A 1F0SA 4N3NA 2GZDA 5CM8B 2NU0E 2Z4RA 3BH7A 1O37A 1XD8A 1WBBA 3ZQJA 3BTEE 1KGDA 4AYVB 2ZTZA 1LCYA 4PHHA 4KAXA 2ZJAA 3VB7A 2XBWA 1GL7A 3SU5A 3BH6A 2QN5T 4C9BA 4IGDA 3A1TA 2A31A 3RABA 2DFNA 3ZQ6A 1GJ9B 4C0JA 2ZRGA 2DWOA 2WUBA 1CKEA 4OS6A 4DBLC 3I92A 2AIQA 2DFTA 3A86A 1QDEA 1MOZA 2ZJZA 1RRCA 4MA4A 1A2KC 4X1QU 1PQAA 3TQFA 3BB3A 4IXNA 1GUAA 2IXGA 2UWOA 3CB4A 4YMSA 2YWHA 1D6WA 5E2OA 5LD2B 1N0UA 1ARBA 4B3GA 5JBCS 4XWKA 4URWR 2AYWA 2ZRFA 1X8LA 1IHSH 3GYMA 1V3XA 2WV5A 2A3RA 4P4UA 1GI9B 3C1KA 2O52A 1GNPA 1W5TA 4NIWA 2DPXA 5F3WB 4V0KA 2A4OA 2XW9A 1EPTA 1ZPZA 4JK6A 5JWHA 1G1MA 1II8B 1UBGA 1SGEE 1D9ZA 2CL6X 2AFIE 3VTKA 5FAHA 5FPKA 1NBME 3BD9A 1A3EH 1OHHD 3M5LA 1NJFA 5EXSA 3PUWA 2G55A 3CUEF 3A1VA 2AMDA 1GNQA 2GT8A 2R0KA 1WOFA 1OHHA 3R0FA 4Q9JA 2VL7A 2Z6VA 1IN6A 1OIXA 4E05H 3SHAH 1KY9A 3QO6A 1PPEE 4WXVA 2BDIA 1A5HA 3CF6R 3U60B 4I1SA 1RIWB 2R8RA 1RPZA 3QWCH 3C27B 4AB9A 1NKSA 1OLOA 2VIQA 5FBVB 4V0MA 2CHVA 2VIIA 3OF5A 2ZRLA 5J40A 1BO6A 1F2UB 1UJ1A 1ELAA 1G291 3KNXA 2WPJS 1ZR0A 1F2SE 3I4LA 3UG6A 3NH9A 4Q4HB 3SGQE 5DP9A 1ZIPA 1ELVA 3IG6B 2GESA 1NVVR 3QENA 1BTWA 1YPJH 2PLRA 1XRJA 1AUTC 2GF9A 2OBNA 1HXEH 2FI4E 1HJAB 3EIQA 1NMZA 2H5DA 1OT3A 1TX4B 1A7SA 4I1VA 1NN0A 4ESHA 3THXA 3QTOH 1P04A 5IK2A 4OS4A 4MNVA 1TX6A 1ESBA 4BGDA 1QBNA 1EASA 4K1SA 2PSXA 3FVQA 3AB3A 2PMKA 2P6RA 5E3HA 1SXJB 2OCBA 1ZHMA 3EZ6A 1UHBA 3W3AA 4ABBA 2V35A 3ODFA 2D3WA 5KNCA 2JATA 5C20A 5C3NA 3RSOA 2IL1A 1ZGVA 1E79A 1EZSC 3FOZA 2ALPA 4JYCA 1SLWB 1N5JA 3UWKA 5DHAA 1UTPA 1GMHF 1NKTA 2QTFA 4AG6A 1T91A 1TMUH 4XOJA 2P8OC 1CR1A 1NS3A 3A1SA 5EE3A 1IAUA 4AK9A 3V13A 4ISLA 5KSZA 2ONJA 2F3TA 2J0VA 1EQ9A 1E0AA 1AIPA 5EODA 1N6PA 4FUFA 1OIWA 1S85A 4YDSA 4MDSA 3GMTA 1Q1ZA 5FI1B 1SKYE 4QOSA 5I25A 1KJZA 4M53A 2CJIA 1L1GA 5KNBA 1C9KA 5A8XA 2WWXA 3D62A 1GM5A 5A4JA 2BD3A 4CT5A 1VIAA 3RU4E 1W46A 5JPMH 1JJ7A 3PG5A 4Q9LA 1KXDA 1BIFA 2LPRA 3MNSA 4H6TA 2QSZA 1HIAB 1FUUA 3RXAA 2V6IA 4B33A 1DS6A 3AVVA 1N8OC 1ABJH 1GL6A 3A7ZA 3GPLA 4Q1BA 2IYTA 4B2BA 1PQ7A 5FPTA 1VG9B 4MQBA 4OQNA 3TUZC 5EZ6B 3LQQA 1HB0B 2HJVA 4WXRA 2WZQA 1DXPA 2N42A 2ZRDA 3SJIA 4C0KA 4YXWD 1LB1B 1E9EA 5L3QB 1G7SA 3SJ9A 3RMOH 1O2NA 4PZZA 5DISB 1XVOA 2OK5A 1DVAH 3MU8A 4U01A 2VP6A 3E1SA 1TGBA 3Q85A 2R2MB 1K1JA 1VCNA 3SFZA 3ICEA 1XZQA 4XVUA 1IOZA 3B60A 4Y76A 2O0JA 4Q1FA 1GHAF 2CL7X 3BTGE 3VPKA 1YBWA 3ETLA 3JZAA 1KLIH 2BLOA 4DSTA 2VIWA 3B23B 2PGQB 2G3YA 3PWBA 3SJCA 2W3IA 2ZDVH 4BXWA 3KTAB 2JETB 2J1LA 2DB3A 2QG6A 2BLQA 3AP1A 1KI6B 3BTTE 3SV6A 3WP0A 2QXJA 1Z5ZA 2QE7A 2CN0H 1F48A 1QL7A 2BY9X 3QSYA 3C15C 3A82A 4DLSA 3GY8A 2ZGCA 4PQFA 1GBCA 4R0IA 4QGHA 1P5ZB 4EJSA 4IOJA 2YOHA 2RAPA 1A0HB 2PUQH 2RDLA 4IJMA 3K65B 4YQFA 2XJ4A 4BLOA 1GI7B 3MSXA 1XJ0A 3IGFA 3TVTA 5B64A 4NFEA 3NHBA 2ZHEH 2YVUA 1BRBE 2OBMA 3FMFA 4UKDA 3GJ3A 3P20A 5FOWA 4F38A 4ZO4A 1W36C 2G5NA 3M35A 1AE5A 2VHTA 3I5YA 3FMPB 1KXEA 3BEIB 4PX9A 4BFTA 2BY8X 5G4BA 1W14U 1G4AE 3IWMA 3V3MA 3E2IA 1JPNA 1F0RA 1ESAA 4YTAA 2C77A 1JXOA 2GWHA 2ODNA 1G2MA 1ZMJA 1IAQA 4TL8A 3ZVNA 2VF8A 2A5FA 2NO0A 4AGKA 1Q3TA 3A80A 1P9NA 1MU8B 2N46A 3SQHE
chains in the Genus database with same CATH superfamily
1WAMA 4UFDH 2H0AA 4RKFA 4DL9A 1E63A 5C8DA 4UQOA 3RYIA 4LF8B 5YASA 4CKBA 2X8WA 2PH3A 4H0NA 3RTAA 1KYYA 5EU8A 1TECE 2W6JD 2ATIA 1SHZA 2BR4A 1XP5A 3CBQA 3G5AA 1OGIA 2KX4A 4UEKA 4FGSA 5TMEA 1KDYA 4JI8B 1E3IA 1RXSA 1E38B 1G8AA 2AC4A 1BDMA 4RDCA 4V0NA 4O4HF 4OXKA 2ZS7A 3DYBA 1RJ9B 2XTMA 2EZTA 3BD7A 1HDXA 1N8NA 4L8FA 4XSVA 4DBVO 4Z6KA 1VSTA 5A5GA 2FQQA 2YN4A 1ZTLA 2Y5FA 4H4FA 1I6MA 5CPFA 2QMEA 4LE1A 1TW3A 1SGRE 2IK8A 3Q3KA 4BFSA 3BWMA 3DV2A 1EDBA 4Q4CA 5JD3A 5JNTA 3H16A 1G2QA 4WOPA 3V97A 3UTDA 3F9CA 5FUXA 3A37A 1Y8QB 2NN3C 3CH6A 3EZYA 4LYAA 4MKHA 3Q4GA 4RF2A 5I7RA 2EG5A 4HMQA 2OXSA 3S6JA 1R4NB 2Z3ZA 3AV3A 4Y2YA 4WK2B 1MQ9A 1A5TA 4TKZA 3DF7A 5B1HA 1EMDA 5BV2P 4TYNA 3F3YA 3ZNNA 3KPJA 2ON6A 2WD8A 3W05A 1ZA2A 3OFNA 3S7TA 3VKUA 4CN9A 4EZIA 1DARA 1IN4A 1CRQA 4IXDA 4UUAA 4GKJB 1PVOA 3LZ6A 5FI5A 3W04A 2HSJA 2WIAA 3PSHA 1QP8A 1TUBB 3O8LA 4QPCA 4R69A 3WB1A 4X8VH 1KH1A 1O87A 4ZVOA 2VDVE 1IONA 4EJ0A 4QREA 2P1ZA 1M8GA 5IVKA 5JECA 2YMSC 3LW8A 2V9PA 5ICMA 4F3TA 4EJ2A 1C5MD 1SCUA 4X85A 1VZQH 1O58A 1HRKA 3IKJA 4YHBA 3C4VA 4EGSA 2C2WA 3KN2A 2Z95A 3DXZA 8LDHA 3FUWA 3KSMA 5DM2A 3ETDA 2J3HA 3B38A 2BZGA 4ZA2A 5EP3A 2Z2JA 4KLZA 5KVQA 1ZOIA 1BOQA 2ENUA 4I8IA 4MVJE 1BHO1 4ALMA 4DFDA 1QH0A 1X2EA 3BWCA 5AO9A 3TJVA 3LO8A 3QEMB 2XWPA 3HP1A 3KKNA 3SICE 3K15A 2A57A 1GPMA 4MQ5A 1SIOA 5AJZA 2Z9IA 1XU9A 5EMLA 1L5GB 3ZN2A 3SYJA 2BSQA 1E61A 4MVJI 2ZDQA 1C2KA 4MI1A 2A3NA 4IQGA 5TT0A 2XNKA 4R8RA 4B6FA 2GM9A 1DPOA 5ALXA 1EEXB 4ILEA 4KYTA 3IPYA 3E0XA 1T4CB 4NA8A 4NBUA 1H2HA 3B2NA 3PIDA 2IYAA 1QDUA 2O7QA 3FPJA 5JSYA 1GTL1 3C7KA 4KAFA 2V9ZA 3I04M 4TM7A 5E6RB 3U49A 3QV1A 1NF8A 5AJXA 4KPFC 2JPDA 2VLIA 3G82C 2V3VA 1S84A 2HDWA 1JKMA 3AHFA 3ON5A 4FYHA 2HA0A 2Y0EA 1KI3A 3IEKA 3QIAA 4RPHA 4TKMA 1ZZEA 1C2DA 1C5ZB 1XLWA 3DZKA 2QMOA 3HFJA 4EJMA 1TE0A 4NA7A 2QUJA 3RSFA 3UMBA 2AF3C 3WX0A 2XQKA 2A5AA 1GPKA 3EISA 4NQZA 2YMMA 5JH7B 5WRFA 3ICCA 4MS4A 1VHDA 1YPEH 3GW8A 3LPCA 4I9GA 1QR2A 2RGNA 3FR8A 4IO1A 1RYHA 1YI0A 1ARCA 4MX8A 3GCTG 1DSUA 3QBVA 3D2LA 1CTQA 1TNKA 1J21A 1Y42X 2KS6A 4S3MA 4U7TB 3KQKA 4MUEA 3SZGA 4EQZA 1N9KA 1ZPDA 3DEIA 4RANA 3JQQA 2FKNA 3KVYA 5GWZA 3RXGA 4HPJB 1LZLA 2ZYHA 2PZGA 4F3RA 1QF7A 4AO6A 3GFQA 4JVNA 4JMLA 5U4XA 1QLJA 1XMJA 5IC6A 4GWLA