3O8BA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus
total genus 219
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8bA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8bA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA03
1BJVA 1DAMA 1QBKC 1W46A 4O97A 4F92B 2RGNC 1FX0B 1T8MA 5L2ZH 2OBMA 2H2ZA 4L8GA 1QB1A 5TV2A 1NVVR 4EPVA 2ZG0H 1NVWQ 5FAHA 5KDOA 2CLSA 1QRAA 1UJ2A 2VWOA 1UEJA 4PQFA 1GFIA 4NA7A 3UK6A 5JI2E 3W6PA 4WXVA 1K6MA 1DDJA 1ZMJA 4WZAE 5IYTA 4NYIQ 1FY3A 2A5AA 1YZLA 3T28A 2PLXA 3KTAB 1D4PB 5C5OA 1QL7A 1GDNA 4YLUA 3ZZ9A 3SJAA 1Q0UA 4KITB 1SVOA 4IC6A 1QHXA 4M9XA 1HIAA 3S1AA 3WBKA 2O8BA 1QL9A 2GETA 2YVUA 5JI3E 1GHBG 1RRKA 1GJAB 4CREA 3F3YA 3OSYA 2J7KA 4WH6A 5DP3A 4B6FA 3ONWA 4HB3A 1ESTA 4Y8XA 3O8DA 2E1RA 4K8BA 1W4AA 5DH9A 1G1MA 2UZ3A 4KSCA 1JR6A 1O2LA 4A6LA 2ATXA 3AVTA 4A0GA 2FOGA 2BLQA 1NRPH 1QHRB 2W00A 1DT2A 1ZVQA 3CH4B 4JL8A 1DSTA 4X2WA 3EZ9A 2SNWA 1Z7KA 3VB4A 2ZFTA 4DB4A 2C90B 3QBVA 4MDSA 4GNKA 3MNSA 1QHIA 3B8HA 1DITH 1VCMA 1XEXA 2H7VA 4JZEH 3Q85A 2YNAA 3I4LA 1ZMLA 4CEJA 2F9LA 2C03A 2GA8A 2Z4SA 1O39A 1T4VH 3REGA 2BV3A 2IYQA 5FPYA 2FOEA 2ZVPX 3GFOA 3MNBA 1W13U 3FP7E 1AWHB 1ZM9A 2PGQB 2OEPA 2BBOA 3GY7A 1GJBB 4PR0A 5EZ6B 4GOKA 1ZGIA 2PSYA 5JBQA 4OK5A 2VINA 2HYDA 1AS2A 4L9WA 4R9UC 4AFUA 1HBTH 4V0ME 3AVWA 1N5JA 1YPHE 1GVLA 1E9EA 2HLDD 2NTYC 2WSMA 3SEAA 3C1KA 2QGNA 1NY5A 2O8LA 3Q8XB 1EZSC 1IHTH 1AVXA 1TQ0B 1DANH 5C3NA 1RRCA 4KODA 3CNNA 4OGXA 3TSOA 4CRGA 2XZOA 3SN6A 2QSYA 2QA9E 3P20A 2VSOA 1FMLA 4O9VA 2C5LA 3A58B 3UQOA 3KIDU 1IY0A 2IHBA 4MG3A 4ESHA 1Z8IB 1IN7A 1KTVA 4PAOA 2PEZA 1M1YE 1E2EA 4X1RU 3ZZ5A 421PA 4I8JA 1C5MD 4WVFA 2PCLA 1AKSA 2QP4A 4TYNA 1R10A 1MRSA 1SGNE 2ZI2H 3Q5EA 5D3MA 2NPFA 4Z51A 2STAE 1SGWA 4LDJA 5P21A 3CW2A 1DXPA 4C0AC 2N42A 5SZKB 4B2BA 2BDAA 1HNEE 1QJ7B 4JKIA 4BZPA 3UUZA 3GJ5A 2B9LA 5GPIB 3PM3A 1P2MA 2OQUA 1K5DA 3KXIA 2YWEA 1W11U 4IMZA 5C1YA 1BBRH 1COWA 3BORA 2QZ4A 2GEVA 1GVZA 1QBNA 4DLYA 3E2IA 1BOQA 1GBFA 3S9AA 3LKWA 2O0JA 3M7QA 4I32A 4Q4LA 2W3IA 1UTJA 4G5QA 1R0XA 1SLVB 3L43A 4X8VH 3R9WA 1NN1A 3SNCA 4Z6AH 1WYKA 4MPXA 4M1MA 1JMOH 1FJSA 3QXHA 1KXCA 3MD0A 1MT0A 3TJZA 4LOAA 5JCPA 1GHXH 2PBRA 3ZVFA 2IC5A 2E9SA 1MTNB 4HLUA 4XFQA 3Q7QA 2KBEA 2QTVB 1O3DA 1ELBA 1CE5A 3SHWA 5JLJA 3AK5A 1PUIA 2FODA 5AR1A 4B2CA 1JOUB 1ZUIA 1KYIA 3THWB 3ZZ3A 1G7TA 2A7QA 2FEQH 4RKOB 1N6OA 5BWMA 4GZLA 3MMPA 1GBCA 2QROA 3SJOA 1FUKA 4A8JC 4OK3A 1A2CH 1ZAKA 2ZRMA 2FTLE 4CT5A 1NKTA 1J2JA 4IEEA 3ZIAA 1TOCB 1O2JA 3T1VA 1MH0A 5JBAS 1E9AA 3KKPA 1MABA 2ASUB 4XVUA 2F55A 2C8WB 3OAAA 3OZXA 2ZU5A 4D81A 3KQHA 1P72A 2ZO3H 5BYKA 5DP6A 2PZEA 2BMGB 3AUXA 4KLZA 3PLBA 4YT7H 1C5VA 1KDQA 1N2CE 1Z47A 3LC5A 3MO3A 1PPCE 4JLJA 4WA7A 4BASA 5LH8A 2ZUCA 2OBOA 1HJAB 5L3QB 1W14U 1MBQA 4OJKA 2ZSBA 4M1KA 4YMWA 4PPQA 3SNAA 3PEUA 2VHJA 3PMHB 3DVLA 1ZC3A 4NPHA 1U8AA 1TQ6A 2BC9A 2AK2A 2O8UA 1GDUA 1YBWA 2J95A 1CIPA 1S85A 2ZHQH 1NMZA 1XXDA 2GAAA 4MTBA 4PPNA 2NZJA 3AQ4A 3QSYA 1KNXA 1AN1E 2Q0HA 4Q9KA 3C16C 4HAZA 1GBEA 3ZZ7A 3U44B 1XWIA 3GJXC 3NUMA 4ABEA 4VGCB 1OX1A 1VHLA 2VJ1A 3GCNA 1FXYA 2F3CE 2QAGC 2OLGA 1P61B 2BCJQ 2QAJA 3IBGA 1TIOA 4HLQB 5G3ZA 5JWRA 3ZVLA 3HP1A 3MWLA 5LPRA 2BDYA 2R6AA 2CBZA 4JYTA 3AP2A 3ZD6A 1D9XA 3PV0A 3U6BA 1KI2A 4DLRA 3HU2A 2ZI5A 4GI7A 3T12A 3DHWC 4US1R 5KSYA 4UFFH 4OQNA 3T29A 2IYXA 3RSOA 4WMEA 4JLAA 3LQQA 4JT4A 2BEJA 4ZKSU 121PA 1NRQH 3VR6A 2QGRA 1RRPA 2O8WA 1GI2A 2QE7A 4TL6A 3SU8A 4BLPA 1X1SA 4Y8YA 2DR3A 5GCHG 4B71A 3VB6A 1O0DH 2PCJA 2VHCA 2BLOA 1S82A 1WDTA 2OAP1 3K70C 4LHWA 1W2HA 1U94A 2OHFA 3IUYA 5JDUB 3LGYA 2ANWA 4YMVA 1W1WA 1LNZA 1GMDF 1MRNA 5LB2A 4Q48A 3STIA 2P8OB 1BMNH 1ZPBA 3SJKA 1GG6C 3V13A 2BD9A 1NIPA 4P4SA 5C2ZA 3RM0H 1PYTC 2FWRA 3UPUA 3GLIE 2V7QD 3RXEA 1LPZB 2WUBA 4B6EA 2OO7A 1SGYE 5L2YH 1D6JA 2QP9X 1C2GA 621PA 2OCPA 4K8OA 2QP3A 3PUXA 1QBOA 1ELOA 2P6NA 3AKDA 4M8NE 2V6IA 1H9LB 2DYKA 3SYLA 1KI8A 3REFA 3UNRA 2FZ4A 3PEVA 1AGJA 2ZVQX 4ZROA 4XSGA 1UCYH 3LH3A 4TLCA 5ESTE 4YTAA 1HIAB 3S1AB 2A0QB 4OHYA 1TNGA 3SI3H 1R0WA 3H7OA 2F3RA 4MKHA 4JCNA 4KXFB 3AKEA 1N5KA 5FBRB 4CEHA 1SGEE 2SHKA 1KXDA 2BQWB 3NC0C 3TR0A 1K1MA 2BOVA 4Y8ZA 4JZIA 1JWTA 2QCYA 3B9PA 1NVXQ 3QY0A 1N25A 5DN6D 3RXPA 1U81A 5B6OA 3BB1A 3BC1A 2NMVA 1TNLA 2ZU1A 2IYVA 4X8TH 3NPSA 1P9UA 1OV4A 1NESE 1KHTA 3EA5A 2CJIA 3TVTA 2XCNA 1X8KA 1HEIA 4B2IA 1TUIA 1O2ZA 4FUCA 4HZIA 3PTBA 3SHFA 1XEXB 3PWCA 3KB2A 1OYTH 4CEJB 3SYJA 1X8LA 4G5GA 4GOXA 1C2HA 4AGJA 3FE2A 3U61B 3K6ZA 1G18A 2A1DB 3BTGE 1GM5A 3IO3A 1ELTA 2J34A 3GCTF 4PZYA 3FP6E 2ZZUH 4MVNA 4D25A 1G3IA 1EFUA 3SC3A 3LXRA 2ZDNA 1NIJA 4OI2A 2ZRIA 3ZZDA 5FOXA 2P95A 1NJFA 4Q1BA 5C5NA 2XGJA 1GGDC 1CA0C 3ICQB 2VBCA 4IVPA 2HNTF 2GJSA 5CE1A 3EZ2A 1P05A 2ZA5A 1GMCG 3UNSA 1VECA 4I99A 1GDDA 1M7BA 3P95A 4JYCA 2GTPA 3GDSA 3U4QA 2I1QA 3NZIA 1Z2CA 1Z2AA 3C5HA 1P02A 1U6QA 2C3SA 3K0FB 2FO9A 1B5GH 1TAWA 1TQ2A 1II8A 4FWTA 4NKRA 2H5CA 3PYHA 4MQAA 3SI7A 1NKSA 2VWMA 2RCEA 4LJYA 4A92A 5KYKA 1C1WH 1V2NT 1E9BA 4D0LB 1HPGA 4UXHA 1ESBA 3AVQA 1HB0B 4M21A 3AVVA 5C2JB 3EARA 4XBDA 3CLVA 1N6HA 1ZNYA 2JATA 3LY5A 1ANDA 4NYJQ 3GLIA 3NKVA 1AB9B 1HLTH 1NO9H 1HT2E 1RD3B 3FMPB 2B8WA 1G21E 3W5IA 3L0OA 3SV6A 1KNQA 3LX8A 1F0UA 2QQEA 5FOVA 5EE1A 4PZZA 1KLJH 3MGCA 4D0GA 2H9EH 1UKYA 2QBYA 2K5UA 4LHVA 4K46A 4RY2A 1C4V2 4N0EA 3QI2A 2JLSA 3ZV9A 4JBYA 1K1JA 1C5OH 2ZKSA 3T35A 4DVAU 3FZDA 2HXYA 3RC8A 4NDZA 4NYIR 2O52A 2HPQH 1SHKA 4PX9A 2CCKA 2ZJOA 4GOJA 2A4QA 2SFAA 5F98A 4TL9A 2XBYA 1W10U 3PUWA 3V12A 3RDPA 4JL5A 4TLAA 2NG1A 4ARZA 2BM1A 4YDSA 4WXPA 5BRRE 3U8TH 4HTCH 1O5AB 2GNOA 1C5WB 4D8NA 4Y0YE 2GCOA 4TLDA 3C15C 3MHWU 1KY2A 2ZHEH 2OC0A 4UFDH 4N3NA 3N7OA 4WY3A 3MUFA 4KHZA 1JRSA 2DE9A 1YR9A 4ABGA 1O2VA 1JXPA 1ZJDA 1GIAA 1TE0A 3M61U 1Z6GA 4QBFA 4K3JA 4E22A 4TQAA 4C3ZA 4EJSC 5AVDA 5JEEA 4IXMA 1E2HA 4AYWA 1A3EH 1TADA 1WV7H 1P0SH 3W3AA 2LWIA 5CHAC 5DP9A 1C1MA 4TMXA 1HQCA 2G0TA 1QHNA 3PEYA 2WV9A 3KJIA 1EGAA 2WPMS 2GXUA 2OAQ1 2BD7A 2ZEBA 5BW8A 1TB6H 1EG7A 3AP1A 2OTVA 1SGFG 1SHHB 1DY9A 1KDQB 2D8WA 2ZE6A 4Q7JB 3LLMA 4HATA 5GWZA 2I1VB 2O8EB 2RGNA 3ZS9A 1ZRBA 5AJXA 1SQOA 1BYUA 4QJ5A 2HDNB 1QQ4A 3N2IA 1P62B 2GVDC 3U2QA 3O47A 4QBIA 3B5JA 2C99A 3L0IB 4I8LA 1G3DA 4TZ0A 1XKBC 1IQPA 4H1VA 1BRAA 3B1WA 2BD8A 4QG7A 5SZIA 3EXAA 4LBVA 2IJD1 4EPWA 4TYYA 1OP8A 1T8NA 3V00A 2BYAX 4W9MC 1MAXA 1IQIA 2MMGA 5IK2D 2BOKA 2FS8A 3LGIA 3OYPA 2AH4X 3M37A 2A5KA 1HAVB 2JJ2D 4QT8C 1HCGA 2OC7A 1EZXC 1TQ7B 1S3SA 1HXFH 1S6FA 1Y5UT 1I4DD 4H9GA 4LUCA 3ZQJA 1G5RA 2VA8A 1T8TA 5BQ5A 1KI1A 1MKWK 4ZIRB 5DGXA 3TUJC 2UUYA 2Z7FE 5E2OA 4JLDA 2VF8A 4Q21A 1Q3XA 3QGJA 2WVJA 1E4YA 4IFEA 4W5WA 3WHKA 1KAGA 2QIQA 2ZJBA 5FBIA 3AEZA 4DC9A 1U98A 2QY9A 4HB4A 3Q00A 4ABFA 1DAGA 2JIZA 1DAFA 2FH5B 4XJXA 3RRYA 1D6RA 1G6HA 3SW2B 5CB8A 3VHXA 3NG1A 4KO8A 4UEHH 1ZYOA 4XTCS 1GJ7B 1CJTC 2CCJA 1G3CA 4NU0A 3TNSA 4O0MA 4BFUA 4B47A 2Z43A 3ZZCA 1JXOA 1DWBH 4A0RA 2EW1A 5KPDA 1GMHF 1F5RA 1HQYE 2RGEA 5H8WA 4CR9A 2GRJA 3B78A 3QPWA 2ZUDA 4F4OC 1E9RA 2B5TB 1Y63A 3SR0A 4MRPA 4TSFA 1XUKA 4IFBA 1Z22A 1YE8A 5G4BA 2YC4C 4P4SB 2G83A 3IHWA 2GCHF 1SHYA 4A2QA 2THFB 2VHUA 1EZUC 1VCWA 3QG1A 2RH5A 2QAAA 1YR6A 1N0WA 1SVLA 2RAPA 1Z1IA 2ZI3A 1NSFA 3KQLA 3CWZA 1V2UT 3CRRA 1E9FA 2AR7A 4L16A 4X1SU 3VKHA 2H8KA 5B6LA 1IXZA 3NBYC 3DO6A 1CJKC 4WF8A 1OH6A 5T6GA 2DWOA 4YZUA 3OEEA 1FAXA 2ODQA 5FBEA 2ZNKH 3PLPA 2IHYA 2J9RA 4YONB 4AFSA 1Y59T 5DYIA 2NO6A 3E3TA 1GHYH 3DZ8A 1WBBA 2H17A 2H1LA 4TYDA 3QOFA 2ZUBA 1K1IA 3RXRA 4JJZA 5KSZA 4DOQA 2IEYA 4JIMA 3Q3XA 5EE9A 5AUNB 1FY8E 3TNTA 4GCHG 2WJJA 1CGHA 3F9EA 2ODPA 3ZYCA 3A84A 1X1RA 3K53A 4FCVA 1UJ1A 5JBBS 2A4OA 3SU3A 3GFPA 1O37A 2FE4A 2RGCA 1F7ZA 2R65A 4LJ8A 2MSEB 2EI8A 1L4ZA 1OOKB 2ZQ5A 2LKCA 1O5FH 4FUIA 2QA5A 1DPFA 1E36B 3QXCA 1E9SA 1W4RA 1O2WA 2PKSB 1TTTA 5DHAA 1KI4A 4JK6A 1JEEA 2J0SA 2WWHA 5H1YA 4AG5A 5J4SA 4DCSA 5TARA 2RGGA 5J4KA 3RXIA 1Q31A 3EZFA 1FFHA 3HDTA 3WBJA 1FQJA 4ZHMU 2CMYA 4JVMA 3D62A 1YRAA 3LX5A 1O2OA 5EXMA 4JLMA 4JVNA 3UIEA 3CR8A 1VITF 4XWKA 4Q4HB 4AIIA 3KN2A 5HGGA 2CF8H 2DUCA 1TU4A 3AVYA 1XMIA 3RXJA 1RYFA 3A1UA 1FNMA 3S9CA 1SGPE 1G8GA 3QXJA 1CA8B 1TGCA 2DE8A 3ATKA 3U6KA 2CHVA 2WZQA 1ZMNA 4LK2A 4CHAB 2SNVA 3U4QB 1MO4A 1XDBA 1VTKA 3RXFA 4MUAA 3GY5A 5CMXH 5GJ4B 1PPHE 3VXFH 3PQCA 1GCTB 2RHDA 5HCIA 3RVBA 1G4UR 2JA1A 1DTSA 1ZUHA 2QTHA 3WMFA 2Z4RA 2CHAB 4GRAA 1C5XB 1O2TA 4A8JA 1DM4B 2QE7D 3MH5A 1HAXB 1F0RA 3BTEE 2F91A 1SGRE 5AJYA 1QVRA 2YWFA 3R9IA 1KY3A 4KELA 2GVZC 4KVGA 1NT1A 4KYIB 5TCCA 3ELAH 2OSBA 2ZU0C 3A89A 1ZSLA 3RYTC 4A1FA 2PJRA 3SQHE 2PT5A 2F9VA 1QTFA 3AUYA 3GCHB 4OGYA 1Z6AA 3WHLA 2P6UA 2V9PA 3GLIB 3GQBA 3ZVCA 1TRYA 2V0BA 1XTJA 5JZVA 2OE2A 4PANA 1V2PT 3EA0A 2GX4A 1CT4E 1G8FA 1RTKA 1K1LA 4Q1DA 4W7SA 2QBYB 1FLEE 3H4MA 4B43A 1P3JA 1AA9A 1AS3A 2VIQA 2ZITA 3SBKA 3L8ZA 1L8QA 1TFXA 3OY5U 1FPCH 4HI0E 2XJ9A 1OKXA 2R6GA 2P0EA 1TWXB 1XD8A 3KB1A 4LWZA 5EXXA 1P2NA 1E2IA 1BZXE 2BD4A 3H2YA 2OCVB 2V54A 3GJ6A 4ZDIA 4KJZA 1BHXB 3RS5A 1RJ9A 4NIYA 1E0SA 2BXUH 3KKOA 1EQ9A 2HV8A 2ANCA 4OS7A 4KLNA 2G88A 1C5TA 1L1JA 1TLDA 4C0SA 1RRGA 5HZHA 2BX4A 4IDNA 4R98A 4L4UA 1QB6A 3THXA 3BTQE 2VVCA 3ITIA 2QAGA 1BMLA 2J9NA 4D82A 1NY6A 2ATVA 3BB3A 4DLTA 3UWOA 1ZHMA 1MTNC 1EK0A 1DWEH 3RRZA 1CHGA 2TIOA 4H6TA 2A4GA 3Q72A 1T5IA 4WW0A 2OBLA 1SXJB 3RS7A 3ZVRA 1O5CB 4DT7B 4IHQA 4M53A 4O25A 5A0FA 1A3BH 3SV2H 4FD2A 2C8YB 1Q3TA 1LF5A 1A2KC 1HAIH 3EPKA 1JQJC 2C9CA 5CYPA 2R3UA 1G2LA 2FDAA 1ZCBA 4JK5A 2J4IA 4PC1A 5A0AE 1F2TA 1GDQA 1HAZB 1MH1A 4I1VA 1BMFD 2GILA 4YLGA 2D4HA 5AWFC 2TGPZ 4A1TA 1CBWC 2R6DA 1YC0A 1V2QT 3VHLB 5HR5A 5KTYA 3BSQA 3JZ2B 4CH2B 2AKAB 1VG1A 3IDQA 1P2QA 3DFJA 5C20A 4GDFA 1J9CH 4URYR 2ZGCA 5FL7D 4IOLA 2RHMA 1EFRA 2RGXA 1J7KA 1SKQA 2CNWD 1MUEB 3RLWH 2E87A 3PV2A 1HJAC 3PITA 4WH8A 1GVNB 2JJ8A 4A2PA 4LGMA 4WZ6A 2QN5T 4TL8A 3N70A 2EEKA 2V6NA 3TE6A 5L6NH 3IPXA 4QFMA 1AFQB 1P2VA 3G5UA 4MGIR 3UG6A 1GBAA 1YZKA 4HAXA 1GHWH 1W47A 1E1QD 1XM1A 2YOLA 3BFXA 3NWJA 2P2LA 1OWIA 2WPLS 3UQVA 5T3HA 3CNLA 2ZU2A 4C7OB 2IF2A 4QL3A 4LHZA 2R44A 4DLUA 4RKJB 4ASUA 3TUZC 2Z6BD 5EUMA 4D4MA 2IS1A 1GNQA 4NYJR 3H0KA 4B1TA 4F91B 1NC6A 1ZJKA 3BTDE 2B7BA 2ASEA 1YLDA 1X6VA 4VGCC 1EFCA 1BJUA 2PZGA 4Q00A 3KQEA 2Q9CA 1AE5A 2XOKD 2A78A 3R7WB 4FCTA 4CBNA 4KAXA 4CW7A 3U5ZB 4GFDA 4GSOA 4AKEA 4KBGA 1FNNA 2EFHB 4NCIA 1T0JB 3W94A 1NRSH 4KP0A 2A2ZA 3VX3A 3A1SA 3A7ZA 2AXNA 4A82A 1O2MA 1A61H 2WM9B 3KDSE 2R9VA 1LTQA 2NPIA 4ZDJA 2AIPA 1AS0A 4AC9A 2BJVA 1E3MA 2A7CA 1E0JA 1JPJA 4V0NA 5HMAA 3U3JA 2VPPA 2Q6FA 3HPRA 5DE3A 2PSXA 4BEBA 2BHRA 2IS6A 1XTKA 2BCGY 3I8XA 2C96A 4X6PA 3QKRA 1TGTA 1TL7C 1AD8H 1O3HA 1P2UA 1CQQA 4A2WA 1GI0A 1KGDA 5KSOA 5TJXA 1QCPA 3P92A 2N46A 2P8OC 1S1MA 4M9QA 4THNH 5A09A 2B8OH 2NO9A 4WIAA 5EU8A 4AWXA 3MAAC 1DS2E 1SXJD 4C2UA 4DURA 1E0KA 4TYPA 1C1OA 1U8ZA 1NU9A 4YXWA 4DHEA 2PKAB 5AF9H 3K0EA 1DPOA 2ZPTX 1L1NA 4YOIA 3CNOA 5TMPA 1H1BA 1AKEA 2BKUA 2FSIA 1Z0IA 1NU7B 4BOHA 1C1QA 4CEIB 4GZMA 2D62A 3RWMB 3RXSA 3T5FH 4G5RA 3H7TA 3U3RA 5FOUA 1OXUA 5CLLA 1E9CA 4Q1EA 3IIMA 1GMDG 1VYVA 1UBGA 4NFFA 2BVSH 2BD3A 2QEQA 1EZQA 1CULC 3A81A 5C46F 4DCVA 1GOTA 2BMJA 3UNQA 5K0HA 2HRVA 5E2PA 4UDWH 1UTKA 3T1TA 1B0UA 5B2ZA 2HNTC 2VP6A 1AZ8A 1G3UA 1E2JA 1L1GA 1C5SA 2ZTZA 2DWPA 1MKXH 3BTME 1GKUB 4TTRA 2D1JA 1MZAA 4FUBA 3QTOH 1CF4A 2XNIA 5G40A 2QT0A 1ZPZA 2IK8A 5HTKA 3VPKA 3EYDA 4PO9A 1RTLA 3VR4A 4OI0A 1F5NA 1EOLA 2PX0A 1S0QA 2YV5A 5JYIA 1XPOA 5CYOA 1TPOA 1UM8A 2BIFA 4BFZA 1A1VA 4JZFH 4DSTA 1RFNA 1TABE 4JKYA 1XCMA 3FHTA 2JIZD 8GCHF 3RXHA 2VP0A 2ZTSA 1L4UA 1AUJA 3K2UA 4LPKA 1L0ZA 1TF2A 1QQUA 2YC2C 2PV9B 2XTZA 1JJ7A 2ZRKA 1PLJA 1G6OA 2P59A 2ONJA 4EJSA 3MU8A 1KYNA 2N1BA 2M5TA 2ZPSA 2KSQA 4ABBA 1LHFH 1OIVA 1HAPH 4K2YA 4Q80A 1U90A 1F92A 3U3MA 1HJ9A 1BTUA 1Q1BA 4JBWA 3P17H 5JRJA 1WCV1 1DS6A 1GBIA 3RU4D 3LA6A 1PQ7A 4O03A 1KI6B 3A86A 3L8YA 1F2UB 2ZI6A 1CXZA 4LZ1H 3OFNA 5KO2A 3GCTG 3IQXA 1QHHA 4ZO4A 3AH8A 1T0HB 2NU1E 3WNDA 4FI3C 2ZTYA 1FZZA 3B13B 4Q5IA 4CIDA 1WE2A 3KQUA 2ZJ2A 1EWRA 4Y7BA 1AB9C 4HGCA 3R0FA 2F3TA 4M1YA 4PFSA 2DCUA 1W7GH 2XYAA 2GEDA 1P4SA 1UVOA 3QQ5A 4DDTA 1GAJA 3OEED 4NG9H 2WMNB 5JS8A 4YQFA 3TJNA 3VKWA 4AD8A 3KKMA 1CJUC 4CBOA 3AVPA 1AWFH 2YJTD 2OT3B 3EASA 5FFMA 1Z06A 3QKTA 4RD1A 4OJQA 4LPSA 4ABHA 1GITA 3DOFA 1NS3A 3KX2A 2VVVA 1YZQA 2YKGA 1YVDA 4PQRA 1GI6A 3THXB 1O3AA 2VIVA 1FIZA 2QAGB 1ANEA 1AUTC 2ZRBA 4JBXA 5FUVA 2WIBA 4C0KA 4E09A 2ERYA 2ZJ5A 1TPZA 1H8HA 3GFTA 1SG8B 4Z54A 4G5OA 1G4AE 3PMAB 4WXRA 4E05H 4E07A 1T3LA 1DE0A 1UBEA 3TPIZ 1JBKA 4URZR 2V55B 2VQSA 1NZQH 1E2PA 3NEJA 1IQFA 2GT8A 2VP4A 4O3MA 2XTNA 5HZKA 4FUGA 2R6CA 3MJRA 2ZU6A 4Q01A 1HAGE 5KUTA 1D9IA 4NZLA 1D8TA 2JLVA 3UOUA 2WPIS 1YCPH 2G51A 4PSKA 1GI3A 1DO0A 3UR6A 1OH7A 1K22H 2IUTA 2W6IA 1SVKA 1SHZA 1G7SA 1US8A 2MSCB 3ESTA 1J16A 1K9OE 2P16A 4UNNA 1C4Y2 4ZXYH 1NLYA 5UKDA 3B8JA 2JLZA 2Y7ZA 3RXVA 1MTVA 3AAUA 3QE0A 3EZ6A 4NCHA 1EATA 2VH5R 3L0PA 2ZJAA 1G8YA 2CL6X 1FMJA 3A1WA 3T34A 4DCUA 2JJ1A 2V3CC 1MCTA 1B7XB 1LDTT 1CEEA 2ZI9A 2ZS7A 3MWYW 3ZZ4A 4JMPA 1DARA 1TGBA 1FX0A 4LYFA 3HPQA 3KJGA 5TDHA 3RS4A 5LB4A 1UKEA 1MO3A 5EE0A 3TIFA 2QY0B 4TPYA 1XBTA 4XWOA 2PMKA 4BAQB 1HURA 5F3WB 1SC8U 1LVBA 2B0FA 3MNCA 1BBRE 5A0CA 3QG5A 3L3TA 2PLFA 4URVR 2DFLA 2ORWA 3VR5A 1O5EH 2PW8H 1SGIB 1Z6XA 3RC5A 3KTAA 4JLKA 2QI9C 1MTUA 2RG3A 1ZZZA 5C1XA 3C14C 2FV8A 3U69H 1WF3A 3D7MA 1RFLA 1DOJA 2Y8EA 2O0KA 2CL0X 2BEKA 7LPRA 4QNMA 4D26A 4LCBA 1TEXA 3Q9LA 3O8BA 4BEJA 1BTWA 1L2EA 3W6OA 3BD9A 3VU9A 1TA6A 4AZ2B 5FR2A 4RCYA 1G3MA 4EPRA 3DKPA 5EQQA 1QF9A 4F49A 5C18A 1C1YA 3T5GA 1M9UA 3RMLH 3TGIE 1A5TA 3F6UH 1O34A 2Y80A 2TRMA 1J8AA 3BIUH 3TAUA 2W2XA 4OKSA 3I1FA 3K8YA 3BIVH 3THYA 4M7GA 2D7CA 4OHWA 3CB4A 1SGDE 2BDHA 1LHCH 2LKDA 1ZCAA 1MOZA 2ZYWX 1GGDB 1CA0B 4KCGA 2BY5X 3OIYA 2IA5A 4NYMR 5LD2B 4ZUHA 4ZKOU 3KKQA 4OM9A 3IIKA 1P10A 1RPZA 3M0EA 1IONA 1Q57A 1XTQA 821PA 1IN4A 5AJWA 2Q21A 1AKYA 5DLQC 4AKGA 2OESA 5EJEA 3LJOA 2ZRCA 1ID5H 4FUJA 3DEFA 4BTIB 1W8BH 4PPGA 4N0DA 3FMFA 5FCKA 2ODNA 2FI4E 3UREA 1QL8A 1OB5A 1AZZA 1V6DA 1WMSA 1BA8B 2WJIA 1NFUA 1DO2A 1YKSA 3L2OB 3CENA 2VRWA 3UPEA 1P9NA 2D74A 4Y6DA 1LFDB 4LZ4B 1TUEA 1XUGA 4ZCMA 4RFVA 1OP2A 5FOSA 3BWDD 1EASA 2EWWA 3SJZA 3RC3A 1HV7A 1X8JA 4TL7A 2FN4A 3Q76A 2QQ0A 1GMHG 4OL0A 3UATA 1UAAA 2TGAA 5BN4A 2QPOA 4INHA 1P8VC 2AGGX 1DELA 1KZGB 2ZFQH 4TWYA 2IT1A 4YMSA 3FYHA 2GCHG 1C5QA 3QGNB 1EFRD 3B1ZA 2C93B 1Q44A 3UIRA 3CZQA 3FOZA 2ZAOA 5EXLA 1UTMA 3EAQA 1Z0JA 1ZRKA 1P2SA 1A7JA 1JIRA 2ZYUX 1K2I1 1YCPM 1W5SA 3VFDA 2FFHA 1F2SE 1D2EA 4XSHA 5KSPA 5GJWC 2PH1A 2ZF0H 1SVWA 1E2FA 1DUAA 2SGQE 2PKSC 2F1IA 4AYVB 3EA9A 4KFUA 4KKDA 2J59A 3U7HB 2BLWA 3SV7A 5TB5A 1OFTA 1HJ8A 2VP2A 3CBQA 3PO1C 1M8PA 4NONA 4D7FA 3TW8B 1ZM2A 4OI4A 4DLSA 1L4YA 5H68A 2ZRAA 3MO9A 5F6MA 3UOPA 3D23A 2BVNA 2R3YA 1C5RA 3EIQA 3ENSB 1GNPA 2WV4A 4UD9H 2GXSA 4H6SB 4X8LA 1SVMA 1LV7A 2C2HA 4QBHA 3M5LA 4OS5A 4DCDA 1KO7A 3GCGA 2J0UA 1R2QA 2V7QA 4CHAC 4DLZA 2IYSA 1KJWA 3OTJE 2ZS9A 2JH0D 1IQJA 1C5YB 3CF0A 3GEIA 3THWA 221PA 1QHYA 4PSAA 1UTLM 5M04A 4AORA 3EC2A 2FIRH 1YHNA 1ZD9A 3W90A 3MMGA 4ZKEA 2CHAC 1H65A 2PUQH 1Y3XA 4RD3A 1CRQA 3B9QA 4I8KA 1VJAU 3NKKA 5EW2H 2FA9A 3LGUA 1QHHB 3BTKE 3M3VA 4FU8A 3M5MA 4IN1A 3PENA 4D2IA 2H6MA 2EI7A 2HOBA 4A1XA 1NF3A 1UCYE 4DG4A 3TVDA 1VITG 4LC1A 5EQRA 2XAUA 2P3UB 3BB4A 4CT4B 1BTXA 2ZDVH 5KNDA 1G17A 3ND9A 5AHGH 5FTMA 1YPKH 1YM0A 2ZDLA 3H86A 2HF8A 1MAYA 5DN6A 1L4DA 3GLFB 1C2JA 2ZJ8A 1OYWA 3KUDA 1O2HA 4YXWD 3LV8A 4A6XA 4LYHA 4LRWA 3LO5A 4FIDA 1TYNA 4BFYA 2GJ9A 2ZREA 2Y82A 1XUFA 3TLXA 2IN2A 1L2TA 1G37A 4PO8A 1VMAA 3SU2A 2FYRA 3QUMP 1G41A 2BDCA 2XC5A 1S1CA 2CLDX 1ZM7A 4RD4A 2O8CB 2QM7A 4LK4A 1G5TA 1X86B 1Z8GA 3SORA 1P57B 2CVFA 1GJ6A 1GSIA 3JZAA 1T91A 4UNPA 4DEXA 1HT1E 1PPEE 1BIFA 2WWIA 2WWYA 2ZGBH 3KNXA 1NMXA 2FSHA 2HVXA 2C9OA 3W8RA 3U44A 5L3VA 2IUUA 4X8UH 2QRNA 1V2TT 3X1WA 1LTOA 2MMCA 4ITRC 1EX3A 1AZTA 2NU0E 4QHYA 3R3GB 4PTLA 5SGAE 4HZUB 1CSOE 5SZJA 3TW4A 5AJZA 2KJQA 4F4CA 3K0SA 3B60A 4DT1B 2GKSA 3BFKA 3BH6A 1CJMA 1C5NH 2WINI 2P3TB 1Y3WA 4BFSA 1SXJC 4ZCLA 1QJ1B 4HB0A 1ELFA 5DP5A 1US8B 2WIAA 2H5DA 1C2LA 4PC7A 4P32A 3DMDA 1FAKH 1Q1EA 5FBLB 2AGEX 4FUDA 4D9RA 3HYRA 1JRTA 3VFEA 1W5TA 5J4QA 1IM2A 1S0RA 4GMXA 4Q7MB 3ICEA 3LWNA 2XCFA 2BD5A 3BV9B 1FMGA 2CXVA 2CF9H 3V3MA 4U00A 5F2EA 2PTNA 1Z63A 5J4VA 2A2QH 4Y0AA 2HJGA 4A5TS 3QK1A 4NCYA 1AQ7A 4MGYR 5FI0B 2GK6A 5KPJA 2V3OH 1KMQA 2CXXA 1S8FA 3LDAA 4IEIA 1OFUX 1ZJ6A 3MFJA 4LJ7A 2REBA 2LNCA 5TCAA 3QF4A 4HSEA 1JBUH 3T62A 1FPHH 2Z6VA 3DPUA 2GZ7A 2VF7A 3HYTA 5FPTA 3UKDA 1NPMA 3FFAA 3KQBA 3BJIC 2ZGJA 3T15A 3GY4A 3HGPA 7KMEH 4AKHA 1GBDA 4J2YB 5CITA 1Z6JH 1CBUA 3SNDA 1ZD8A 1A4RA 2REOA 4TMTA 2P6RA 2OXSA 3GOVB 3OFND 1JALA 2WSSA 3PUVA 4IMQA 5DG6A 3DFLA 2PR3A 1AFQC 1V2KT 2QTFA 4IKEA 4DKXA 5FTJA 1JR3E 3S9BA 4RKEA 2BM2A 3CX8A 4S2EA 2ODBA 5J4LA 3VU9B 4JZDH 1GNRA 3K1JA 5LGOA 3CUEF 3BEUA 1ORFA 3AB3A 3TK1A 4LX0A 4PHTA 4OQXA 3VKGA 2CV3A 4B75A 2QG6A 3BRWD 3HR8A 1EPTB 2FMJA 3IG6B 4M9SA 3UWKA 3KEEA 1OLOA 4MITA 2AKYA 4NA8A 4M1TA 1Z71A 3V4RA 4ABJA 1LHGH 3VNUA 2ZSFA 4IDPA 4WMDA 1AGRA 1AVWA 3THYB 1TBRH 2ODEA 1EAXA 1T32A 2YINC 2ZRJA 5TVKA 2HWLB 3HK3B 1G3BA 3ZYEA 1YJ5A 1KO4A 4IVRA 3MI4A 2GXQA 1H8HD 1K8RA 1J17T 1TGSZ 3ZS8A 2Z9GA 1ZHPA 1E0AA 3P8NA 2BDTA 3AVOA 3B1XA 4X8OA 5GADl 1LS6A 1N0VC 2IPHA 3NVAA 2D2DA 1BQYA 1NLZA 2ZEJA 4M9ZA 3OHMA 4N1AA 1C9PA 8LPRA 4W5JA 4LOYH 3ATLA 4UNRA 2FTMA 1ABIH 2F43A 4I81A 3ASZA 1A5IA 2BY8X 5EUQB 1GBTA 4WXIA 4LSGA 4LHYA 1UKZA 3QWCH 2D26C 3URCA 3K0CA 5EP2A 2W6ID 3K0FA 4G1UC 4BANB 2P94A 3A8AA 2EQBA 2OUKA 5H4IB 2GGVB 4MPWA 1YCPK 1Z3IX 1AY6H 1MKWH 3OU0A 1DAKA 2HF9A 3A85A 2C95A 1FONA 2R8RA 5IK2A 2BWJA 3I29A 2C8VA 2A5DA 2JJ2A 4KI0A 2ZTXA 2FEMA 1Y3UA 1P9WA 2CE7A 1H8IH 2JJ1D 2AGIX 1YRBA 5T1VA 2QGZA 4JT2A 3K0AA 1XP8A 1P73A 4BZXA 3BTHE 4EPXA 1H9HE 3IGFA 2VH6A 2FS9A 1LQDB 1S0UA 4IC5A 2XWAA 3O8CA 1VIAA 1O3BA 4K1TA 2A3RA 2GT7A 3K6YA 2FI3E 1Y3AA 3P8OA 2UWLA 1SOTA 3S7KB 4GHQA 1BTZA 1ZBDA 5F9HA 1GI4A 1QY6A 8OHMA 2F1RA 3LD9A 3A7YA 1S9DA 3FAOA 3OY6U 1JR3A 1SMFE 1RXPA 4OS1A 1CGJE 4K81B 1O3GA 2SGDE 4GPGA 3U8OH 1RGQA 4Q4JB 2BMEA 5IDKA 1M6NA 1P2TA 1GL9B 4Y71A 2G5VA 1G2MA 2ZR0A 4WBSA 3ZZ6A 1DAIA 2IXEA 2FPZA 2REXB 1TAGA 2J0UB 1C1UH 2J5XA 3Q3JB 3TJUA 3LW8A 1S5SA 2Z83A 2PFEA 4HZHA 1P09A 3PR1A 3SUFA 3B23B 5JWHA 1ZMXA 3TIUA 3P32A 4CR5A 1NBMD 3N5CA 1EB1H 2IW3A 2QXJA 3K65B 3HGNA 5EZ5A 2QNRA 1O2QA 2YHSA 1BIOA 3LC3A 2RB4A 4QOSA 4Q4AB 1H8DH 3M5NA 5A8ZA 1T31A 3PTNA 4HAVA 3S69A 2QXGA 4D80A 4F38A 4C0HA 2A5JA 1CBWB 2R2AA 5F9FA 5HM9A 2ANMH 4RZUA 2FX4A 1NVUQ 1O3EA 3FANA 3I78A 2RA0A 4V0MA 3RXGA 4EAQA 4GBMA 2CE2X 3NEYA 3X1ZA 2FYQA 1N5LA 1TMUH 2C4FH 1P04A 4EQ6B 4M1OA 1OWJA 4RZ3A 2GP9B 4BFTA 4TWZA 2O8EA 2EFCB 1O3CA 3DM9B 3SNHA 3SNBA 1U99A 2CCGA 8GCHG 2CMKA 3DMNA 4TY7A 3ATIA 3PUYA 9LPRA 1XCGB 1AFEH 1ESNA 2AMPA 4ISHH 5A2MH 2AWOA 2BBWA 5K8TA 5JCZA 2AK3A 4B3GA 3B6EA 3OIVA 4ERNA 2CJWB 1RVDA 3E1XB 3QKUA 3P70B 2BDIA 1HAVA 2OCBA 2UUFB 3NDPA 2JETB 1VKJA 2WKQA 5CDFE 1O33A 3HPTB 3MTYA 5FR1A 4OQMA 4NFEA 4CRAA 3HU3A 3QTVH 4ZIRA 1Y3YA 4IDOA 3STJA 5C1UA 1RIFA 5FI1B 1WUNH 3UTUH 1CU1A 1OXVA 4AX9H 1RE0A 2CHQA 2I4IA 3K09C 5EXSA 2W7SA 5DYGA 1O31A 3RABA 1VGCB 2IXGA 2WWWA 3BTTE 3G01A 1UVPA 1JEDA 4POAA 1J99A 3A1TA 1A82A 2NO0A 1V2OT 1FNIA 1O3FA 2Z5FA 3PROA 2ERXA 1IN6A 5E3HA 3JZ1B 3R20A 4DJTA 4GL2A 2F9UA 1SQ5A 3T5DA 3GY6A 4QGHA 3T26A 2AFIE 3A83A 4BXSA 2O5VA 4XD7D 3SGQE 1Q2WA 3UWJH 4ZI3A 1KSJA 5KHOC 1Q1QA 1TNDA 5FX5A 1P03A 2WYGA 4X2YA 2GDJA 1AHTH 2ZFPH 1NFYA 2HYIC 4IOMA 1E2GA 1GZSA 1Z1JA 1O35A 1UVUH 1GL1A 3LVQE 2GF0A 3EPLA 1ZU4A 1UF9A 2W26A 2ALPA 2CK3A 3CF6R 3NIBA 3A37A 2AEIH 2VL7A 5AUPB 2HCJB 4Q1AA 2FF7A 3GLGE 2G55A 3LBHA 3QF4B 3VB3A 1PQ8A 4ZHAA 3T1QA 2IL1A 3Q77A 5GXPA 2QU8A 3B85A 1EAUA 3I73A 1V2WT 4DSOA 2Y7XA 1QFKH 3CR7A 4TMWA 1EJMA 1YPJH 4LJ9A 4EFNA 2RDLA 4DIHH 1ARCA 4BAOB 3BN9A 1FQKA 1OH8A 2FWWA 5I46H 3RDZA 1QJ6B 4DW2U 3ZJYA 2GZDA 3HU1A 3CZPA 1P2IA 5HE8A 4ZKNU 4P3YA 3AVUA 2B92A 5SZHB 2AFHE 4MQBA 3IPYA 5LDDC 3QBTA 3E16B 3WP1B 1Q3HA 2G6BA 7ESTE 2A5FA 4MNWA 4P0TA 1FY1A 2JGNA 5F8ZA 1JNYA 3ZVEA 1XEFA 3TBKA 3IQWA 2VH0A 1SPJA 1O3OA 3SUEA 2FZZA 1I4TD 1IN5A 1SOZA 2QXIA 2V4ZA 3ZZ0A 4ZPXA 1O87A 3LH1A 5B58C 4Y10E 3NH9A 2BHGA 1BTYA 4YC7A 4D0NA 5L30H 1GI1A 1V2JT 3R9XA 3AF2A 2XRCA 4MGZR 1ZTKA 1JXMA 1G8PA 4LV6A 4DGJA 4IVQA 1HYQA 1G20E 1A4WH 2AERH 1S9HA 4K60A 3RMOH 1G291 3RNLA 1OHHA 1A0LA 2Y81A 3RXBA 4YT6H 4CRCA 2J41A 1SXJE 1IHSH 3BXZA 3U7EB 3CM0A 5FH9A 3VGCB 3WNBA 3RXOA 1ZGVA 1W2KH 3TJVA 5IT5A 1T5LA 5H70A 5CDFA 4CRFA 2BD2A 3M1IA 1LB1B 2L0XA 1DX5M 3H09A 1G64A 1R6BX 2GAOA 1VG0B 3P1JA 1HAYB 4Q4HA 3V7TA 2YOFA 2ZQ1A 1BMFA 2WOJA 4XOJA 4BLOA 5LD2C 2PEYA 3TKLA 6GCHF 3TH2H 3GDUA 4AK9A 2F43B 3I5XA 1ZIOA 2R6FA 4URUR 4U2WA 3KXLA 3QEJA 2FOHA 4X2VA 1IXSB 4A6PA 1PPZA 2QV1A 4Y79A 5FL7A 2KAIB 2ONKA 3BIFA 3ATMA 2DWQA 3SFZA 5CM9C 1W0ZU 5BN3A 1GJCB 2CNWA 1XUHA 2G1JA 3CPEA 1KSNA 3D6TB 1WP9A 3A7TA 4X1QU 3F8TA 1GI7B 2WPJS 3AKCA 5G41A 5FBWB 5CK5A 1E1QA 1NM6A 1WQVH 1CLUA 1CR1A 1LQEA 3A1VA 2IEZA 1C2DA 3GLGA 4ZHLU 3AF4A 1VCQA 1E99A 1D3TB 3RP2A 4DLWA 3K0AB 2W3KA 3PMBB 1TNJA 1KSHA 4P4TA 1ZR0A 1GILA 3X2SA 1C2IA 1PPFE 1EAWA 2GZ8A 4FUHA 2GTBA 5DJ7A 1H8ED 2IXFA 4BLSA 1CT2E 2QT1A 5LPNA 4Y0VA 2XOKA 2ZI4A 3OF5A 1BT7A 1O2RA 1IQGA 5AUQA 1BH2A 1W2GA 2WWXA 3FHOA 3VMFA 2CN0H 2I6SA 5L3SB 1XD2B 1KJZA 2WSSD 2G1KA 1GL6A 4MPVA 2FOFA 1ZHRA 3SQEE 1TMBH 1UTOA 1FY4A 2P65A 1BOFA 1P6XA 3FZZA 1E6CA 2BQ7B 5CB6A 2GF9A 4ZI2A 4U02A 3B1VA 4Q1CA 3RU4E 4FMBB 3P8GA 2FGKA 2IUSA 2DPXA 2SGAA 4A1VA 1FN8A 1WBGB 3A7VA 5FUWA 3HKIB 2W0SA 1LKAA 5E0GA 1Z0DA 3TQCA 1C2EA 3VR2A 5FPKA 3ZZAA 2A4RA 1GJ9B 2HEIA 3NBZC 1KO5A 2FXRA 2A9KA 4XBBA 5T6FA 1IN8A 1D3QB 3EG5A 1MV5A 4NGAH 2DFTA 5A8XA 4B3XA 4PAQA 1OWKA 1SXJA 1O3YA 1U2RA 4G3XA 1BUIA 2GZAA 1W12U 1VR1H 4I1UA 3SHAH 1HRTH 1KOFA 1A5GH 1RRFA 3ZQ6A 1HDTH 1QG2A 4AI6A 4GPTA 4LV5B 1TF5A 2ZROA 4A0HA 1P01A 3MOCA 5HPYB 3A88A 4ACAA 1O2XA 1M74A 1EXMA 3GEHA 1HY3A 1QVAA 1JAIA 2BBTA 2A7JA 2BZAA 1O3PB 1MZDA 2OCAA 1XMSA 1Q20A 1GRQA 2GDEH 3FMOB 3MU1A 5JECA 2TPIZ 1NN0A 1CR0A 5EG4A 2XNDD 2EI6A 2GJ8A 3A8BA 4BTTB 3GJ4A 3NBXX 1OS8A 1KKLA 3SI4H 1GVKB 2AXPA 2ZETA 4TTPA 3WNCA 4DEYA 4TQUS 3QZQA 3OIUA 1JECA 4QM7A 3CH5A 2UUJB 3NDBB 1T4GA 5FOTA 2NOAA 5B57C 3SJ8A 3A8DA 1XTSA 5JHGB 3U3OA 1C5UA 1HH4A 4C7OA 4GAWA 3FVFB 3E6PH 1XJQA 2OFXA 2G9NA 1QGFA 3E70C 2LCFA 4GLYA 1NRNH 3KUCA 2G4UA 4A9AA 4M4SA 1CT0E 1RTFB 3PUZA 3M7TA 1W7XH 3R7WA 4A0FA 4GHTA 3IILA 1RJXB 4AURA 4C9BA 3P26A 1KK3A 2F4LA 3FWYA 3S7HB 3WMEA 1NMYA 2PL3A 1T8UA 2QMHA 1JR3D 2O8FB 2XB2A 1W0JD 2Q3FA 5K8LA 2CEAA 2IYLD 4O2LA 3CP7A 4D4KA 2OC1A 3GICB 4IGDA 2ANKH 1E2DA 2IOTA 1K28D 1E2NA 2DY1A 1R0YA 1ZLRA 3FHCB 2JH5D 2AYWA 2XB4A 2BVRH 5HCNA 1LF0A 1Z8RA 3BH0A 1RC8A 1DAHA 1Q12A 3LGVA 1HUTH 1G16A 1A5HA 4PC6A 3SN8A 3AVXA 1ZW6A 1PPBH 5DISB 4E7RG 2RGAA 2EFEB 2WWGA 4AB8A 3RXDA 1THSH 3RM2H 1PV4A 1IAUA 1FI8A 2ZRHA 4AG2A 3GDVA 4DB2A 3NXSA 4PC3A 3AAVA 5JJLA 1MU8B 2CVHA 2X8AA 1LPGB 4LJAA 1XD9A 2GBLC 2ZHWH 1KDOA 2EFGA 3EA8A 1FUUA 1VCNA 3QXSA 2JAQA 2NU3E 3VR1A 2XBVA 1OKKA 3JVVA 2PKAA 5PTPA 2ZIQH 2ZIAA 3M3TA 2NGRA 2NZ8A 4XTRA 1N5IA 1UFQA 3QVVA 2IS2A 1W4CA 3QNUA 1GHAF 2PUXB 5EQSA 4KTCA 1AZSC 2ORVA 2IYRA 1MQ5A 4CEIA 2XEXA 2YOHA 1FDPA 1D5CA 1P75A 2J1LA 1HTWA 1TQ4A 5B64A 4DCNA 1F0SA 4I8HA 4D4LA 3EW9A 1Z6EA 3T2NA 6LPRA 2QYIA 2G5NA 4AYYB 3PXGA 3NH6A 1PQAA 2QMOA 2PX3A 4GP6A 3UXMA 4E7NA 4CYMA 2AIQA 1NL3A 3BTFE 4L15A 4RI0A 1QG4A 3W9YA 1VG9B 3QPUA 1EPTC 4UJ3A 2WMOB 3TGKE 4SGAE 4KFRA 2QXHA 1XMJA 3F9GA 1O2YA 2B8TA 4Q9HA 4BFVA 5JMTA 2GWHA 1NRJB 4BLQA 2FNAA 4BECA 1UKVY 5IRCD 3PO1B 1VCPA 3I92A 1ACBE 4HDCA 1C2MA 5EGMA 2F9MA 2NWNA 1GCDA 1O2PA 1XJCA 2OP9A 2OINA 1XVOA 3QUSA 5E7MA 2C8XB 4XIGS 3N2EA 1O3KA 1ZNXA 2XWBI 1QZXA 1FTNA 4AG6A 1N0UA 1XMNB 2PTCE 3U1IB 2VIPA 2EYUA 1KJYA 1ANBA 3C5CA 4MKFA 2JEOA 3LGWA 5DPAA 1ZIPA 5LBIA 4UJ5A 1IJEA 3DHKH 1EXFA 2A30A 3KL6A 3HWSA 2G4TA 5HM2A 3TH5A 1UTPA 1JQLB 1GBBA 2F1HA 4TN1A 3I72A 2C8ZB 4Q03A 3RRMA 4PHFA 2Q3MA 4ZKDA 1E96A 1UTQA 1IOEA 3WYGA 1ZM4A 5KU1A 1W3CA 1G32B 1N8OB 4XBCA 3A4LA 1WRBA 4XVRA 2IYYA 4ISOA 3GLGB 4LZZA 4O3UA 2CK3D 4R71A 1KI6A 3L0SA 2C04A 1F2UA 3SU4A 2VWLA 3LGTA 1NN6A 1N6XA 1GWAA 3KKNA 1SBWA 3LAWA 1GJ5H 2R2WU 4G0NA 3W5JA 1VZQH 1LMWB 4QRHA 5JFGA 3TGPA 4BFWA 2ZJYA 3RSLA 1A0JA 4UQOA 3PWBA 3QPVA 3GY2A 2KB0A 2AFQB 5KDDA 4PHGA 5JPMH 2CL7X 4Z8XA 3J81k 3R8FA 3DL0A 2ILNA 5AJVB 1W0KD 3RRNA 4I4LA 4HUQA 2AWNA 1O2KA 5ETXA 5HXFA 2QUZA 4IDHA 4E5UA 3QZRA 1PPGE 3OE7D 3KFXA 1KI3A 2AL7A 1G36A 2EVWX 1SI5H 4OHVA 1CTQA 1KI9A 4CVNA 4UE7H 5FHTA 4DDWA 1ZUNB 2FESH 1JIMA 2Z3EA 1KXFA 1OFHA 5EXNA 1F48A 3G0HA 2Y6TA 1IQKA 1Q21A 3CRMA 3LVRE 1RZ3A 1XNJA 5IDVA 1R8QA 3ZVBA 1WXQA 3KJHA 4CF7A 4ABYA 4NYMQ 1SKYE 4DIDA 3ZYDA 2H1UA 1AVGH 3LLUA 5FBQB 1OT3A 4C30A 1JB1A 1SVIA 1SQTA 2FOBA 2WWFA 3K09A 1OIXA 1DAEA 2OLKA 1FZQA 1XXFA 2BKEA 2TBSA 4AYXA 2P93A 2UWPA 4Q7YA 1BHXF 3ZD7A 1FTSA 3DDCA 2IYZA 1FOEB 4OS6A 1T8LA 1QDEA 4QHSA 1IQMA 4DUGA 1UK2A 4SGBE 1OHHD 1PUJA 4QJ4A 2D7DA 4CZ2A 2STBE 1ELGA 1A2BA 1S96A 2VNTA 5DP7A 3P4YA 4V02A 2R9PA 1E98A 2FZLA 1UK3A 1TPPA 1E9DA 5EP1A 1AO5A 1SGCA 3GJ7A 4H4FA 1QNJA 1E32A 4HDOB 4PSVA 1JJVA 1IHUA 1MTSA 4F4IA 1WSSH 1CJVC 1Y5BT 3MFYA 3DKVA 3T61A 1O3NA 1WAYB 3SGBE 3ADBA 1U8YA 4IS5A 5DP8A 3BOSA 1W48A 1QRZA 2W6JA 5K7RA 4B3CA 1BRCE 3M35A 3GISB 2KWIA 1OW3B 3TH3H 3CF2A 2P3FH 1EAIA 2GDDA 4Q7XA 4X1NU 2F1JA 4FN5A 1NG9A 3I5YA 1XVMA 2Z9IA 2ODWA 4JVSB 1MCVA 2VGCB 1Z0AA 1S84A 4R8TB 3D65E 2ECKA 3PIRA 1Z83A 2OILA 4BAMB 4UNQA 1KSGA 1TX4B 5EPYA 3FGNA 1ODFA 3BBPA 1WCZA 5GIBA 4DIEA 1LVGA 1UDXA 3Q3YA 1TQDA 4LBZA 4R0IA 3VNVA 1UK4A 2Q6GA 3BGWA 2J0QA 2A2XH 1QB9A 4BWYA 1SZPA 1U0LA 2BDGA 2FPKA 3WYFA 3FP8E 4OK6A 3BEIB 5I25A 4HYYA 2C77A 3I77A 4FWIB 1QR3E 3V4FA 1S6HA 3E1SA 2OLJA 3EAJA 2JETC 4TPIZ 3TQFA 4CRBA 2UWOA 2WPDA 2CLCX 1TX7A 4LI0A 4ILEA 2GK7A 3MH4A 1IQHA 3R8CA 1KKMA 3KQCA 2G81E 4LYAA 3VB7A 1VGCC 2X2EA 2ZE8A 2PWXA 1GHVH 2ZRGA 1V2MT 1KLTA 1YGCH 3IO5A 4R2HA 3E0PB 3I61A 1ZINA 1GL0E 2BQ6B 1PJPA 2EWVA 4BLTA 3ZLJA 2O8BB 1E37B 2WPHS 3SU5A 1E79A 1BCUH 2GVFA 1P06A 1KK0A 3VX4A 1C1SA 4X8SH 3PCRB 1GBJA 3QX5H 1E2LA 2ZC9H 2NO7A 1M2OB 5FOWA 1G3QA 3BAFA 1CHOF 4DLVA 3CIOA 3KHVA 2H9TH 1R5BA 1ZSJA 3BH7A 3GPLA 1HE1C 2BJWA 3D49H 4X2XA 5AFYH 5F03A 2RKOA 1QHGA 1XF9A 1WOFA 2ZCLP 4Q18A 2GZ9A 2JLXA 3DUXH 1NJGA 2J7PD 5DNYB 4L5BA 3F9FA 8KME2 5A5GA 1WQ1R 2ULLA 2ZECA 1G8HA 1ELVA 3BS4A 1SGTA 3SU6A 3NK8A 3SFVA 5JSZA 1S3GA 1DXWA 1SULA 3UMRA 4B48A 3FB4A 3RXTA 3UMFA 3ZV8A 3GLFE 2P5TB 1R5OA 4B33A 1KY9A 2ZDAH 3ZZBA 2V8OA 1UBCA 3OX7U 4PAMA 1Z08A 2ZXUA 2Z9KA 2ZE7A 1PVOA 3UMSA 5FX6A 3U1JB 5GJCA 4NL4H 3QN7A 4OHZA 4D76A 1I2DA 1MO6A 2Z9JA 3ODFA 1II9A 4PC2A 1B0FA 5ELXA 4TT3A 1JAHA 1C1TA 1A46H 4HAYA 3MU5A 2ZQ2A 1OXTA 1JPNA 3WRYC 1FPMA 4HUTA 2FOLA 2IBMA 2ZDKA 2ZDMA 4RSGA 6ESTA 4OQLA 4MRNA 1U9IC 1YPLH 1O5DH 5DI3A 4ZV4A 1SB1H 1VDZA 4FU9A 4DY7B 1BTHH 3B7GA 1XMVA 1TRNA 2PLRA 1SR5C 4OI1A 4D7GA 2Z3DA 1E2QA 1BKDR 4D4JA 1OYYA 3HATH 3T25A 4BQSA 2X77A 3U7FB 2B6HA 3RWOA 3KQNA 3LRPA 4HEJA 4FXGH 1AKSB 2A32A 5GJVC 5FPSA 2QRZA 2QF3A 3U9AH 4A36A 5D3MB 3BF6H 4HDQB 1W36B 3K9NA 3DT0H 2W2TA 3SOPA 2WJGA 3VGCC 4B76A 2XBXA 2KE5A 4XVQA 3PV5A 3W34A 1MQ6A 3P6ZB 1C2KA 2R0LA 1EOJA 3RS2A 3JVUA 2CDNA 3HKJB 2XITA 2HJVA 4EIWA 4NMMA 2ZCHP 3QKSA 3P4XA 5DSZA 3SO3A 4QGAA 3I3SR 4RSPA 2AMDA 1IBRA 1Z6YA 1XJ0A 4MDEA 3ASYA 3E90B 3QLPH 4MA4A 2OBQA 3LJJA 2VYFA 1GRRA 5TXGA 3E91A 2OBNA 2NQ2C 4TQ9A 2ZR7A 1Z8JB 2XX3A 1T9HA 3CRVA 1ZNZA 3K0CC 1N6PA 5GNDA 4LBYA 1BMAA 1YP9A 5E7IA 3F1SB 4X6MA 7GCHF 1D2MA 4AKIA 2ZU3A 3BK7A 4UFGH 3RXCA 1V2LT 3A80A 2Y5HA 2OG2A 4ZH8A 1KO1A 3T27A 2GMTB 2V1UA 3F9HA 2ZYTX 4ISLA 1MO5A 4LHXA 1NTPA 1P2JA 2GCTB 1XUJA 3AGQA 4BRUA 3U98H 2J94A 1LCYA 2P67A 3FPAA 3M7UA 1ONBA 4HUQB 3GMTA 4DBLC 4BLRA 1MMJN 2RA3A 2WBLC 2R62A 3F68H 1EFTA 6GCHG 5E7JA 3ADKA 1W49A 4Y11E 3V0XA 4MNYA 3TGJE 4AB9A 1OJLA 3FTQA 3SV9A 3GLFA 4WZBE 2JLQA 4V0LA 3RXLA 3EE0B 4TMZA 1OKKD 4UFEH 5E4FA 1UBFA 2UVQA 1MABB 3KZ1E 1E38B 1NBME 1J90A 3BERA 4Q47A 1L7VC 2J2UA 4NCKA 4YO9A 2HT6A 2O8CA 4FVBA 1OXXK 4I31A 4BAKB 2IYWA 2H16A 4B73A 4LYJA 1ETRH 4B3BA 2AMQA 1M7HA 3U3KA 4NZQA 3X1YA 1KTTB 5B30A 2JDIA 4DIIH 1AU8A 1QHSA 1SVSA 4HLCA 3DD2H 2SGPE 1A1RA 3ZZUA 2ZE5A 4I1OA 1ZM3A 5A0BA 1ZSKA 1TU3A 1RIWB 5C67A 3D31A 4D6PA 2ZFFH 4PO1A 2QSZA 5E0HA 2RMKA 1TGNA 4HZUA 3Q7PA 1A7SA 5J5CA 1E1RA 3SS8A 3QDZB 4URWR 1UMAH 1Z8FA 4DT1A 1NFXA 4XOIA 5J4YA 3PB1E 1R8SA 2O0HA 2FSGA 3GJ8A 3DOEA 2IWHA 4C0LA 3GCOA 1GKIA 1UDWA 4OQFA 1DVRA 1C5PA 1W36D 4OHXA 1J70A 1XUIA 2W2VA 3RLFA 5GDSH 1O2UA 3CS7A 5DI9A 1GUAA 4NP6A 1N1LA 4MDFA 2G0NA 1BYIA 4P33A 2WV5A 3I32A 2VVUA 1COWD 1QA7A 1ZU5A 3EWSA 3NHBA 3TNFA 3AV0B 3WYAA 5EXPA 4AN7A 1IOZA 1DY8A 1X7AC 5BYJA 2GBLA 4I8GA 3AF3A 1BBRK 2OXCA 1S2MA 4KTSA 5HE9A 3MYWA 3EIEA 4WVPE 4JLNA 3TITA 5IHPA 1WQSA 1KMHA 3QJYA 2WKPA 3SQXA 1O30A 2WTUA 4TWWA 4AY2A 2QC2A 4JYBA 4ABDA 3SZRA 5J47A 4DSNA 2OCYC 4QM6A 4TYWA 2EA3A 1E94E 5FL3A 2FJUA 5EOKA 4RD2A 3VB5A 3TVJB 1Z07A 1Z5ZA 3PMJA 3ECCA 4C0BA 1MU6B 1DICA 2A45B 3EGKH 1XPRA 2HGTH 2FU5C 1UEIA 4TMVA 1WB9A 6CHAC 3SU1A 1HFDA 1Y3VA 5CLQA 1UADA 4LC0A 2BMDA 1V2VT 2GD4B 1T8OA 5GVRA 1IJFA 1G3RA 4IN2A 3H5CB 3BG4B 4K5ZA 1XZPA 3QENA 2TGTA 1XEWY 1MTWA 5J40A 1EPTA 1GTVA 3PFIA 3ZIAD 2B7CA 1T3SA 1NBMA 4EPYA 4Q2KA 4QHTA 1A0HB 3H1TA 3IWMA 4NCJA 1WBDA 1E34B 1OB2A 4JVLA 3LDXH 2ZI7A 5KOYA 3EPJA 2F9OA 1SKYB 2JLRA 2BY6X 4TYQA 4CEHB 3OAAD 4NE2A 3PVSA 1GG2A 3JZMA 4Q02A 1EJAA 4B2PA 4UONA 4QKQA 1THPB 4Q66C 4KFTA 1ANCA 3SJIA 1Q1ZA 2ANBA 3LBIA 4JS0A 5CJPA 1OFIA 4NWLA 4AG1A 9ESTA 3KJEA 4XDEA 4LY6A 1LVYA 2VP5A 1KXAA 3M6AA 1VITH 2HXSA 1MBMA 5JSZB 3ZVDA 2O8TA 4X8HA 3WMGA 2XSZA 5JJIA 3OEHA 4DUGD 3Q5DA 1Z6TA 2TGDA 5EP3A 5DIFA 1KIGH 1CGIE 2C98A 1IXRC 1XRJA 1FY5A 3TU7H 4DVGA 1LVOA 2BLVA 3TLOA 2OFWA 5DK1A 2D3WA 4MKGA 1ELAA 4UKDA 3PV4A 3MWKA 1TA2A 4MNXA 4H1UA 2G77B 3GY8A 3U7GA 4JLBA 2UZIR 3VTKA 1N6KA 1DVAH 4URXR 1PLLA 1KK2A 3CRW1 1B0EA 4YOJA 1D6WA 1VIYA 1I2MA 3ZZ8A 4LXBH 2DFKB 4Y0ZE 3SUGA 2W6JD 4RZXA 5CM8B 4DLXA 4NSYA 4YOGA 3TRFA 4RFSA 2QMEA 4GMDA 2XTTB 2EYQA 3LQRA 5FTLA 3WXMA 4FXPA 4HAWA 5DI3B 3TK9A 1D3PB 1ESMA 2BM0A 5C4GB 3LOXA 1W0YH 1EJNA 1TMKA 2V3HH 1GBKA 1II8B 5E95A 1FIWA 1VPLA 3UG7A 4M0LA 4FINA 2W7UA 4K1SA 1OF1A 3VEQB 2XC4A 2DHRA 3NTUA 2VHTA 3EX7C 4MPUA 4YDHB 3MU4A 1EWQA 4YM9A 4FMDB 5FCRA 2AD5A 2FPMA 3A8TA 1W7AA 1C1PA 3MSXA 1AGPA 5DGJA 2WAXA 1NI3A 3KFVA 4XD7A 2FP7B 4A7IB 2NO1A 5E8EH 1O3MA 5JBTA 2C78A 1C9TA 4GVUA 2A5IA 4X1PU 2A5YB 1TONA 3I8SA 4JSTA 3QKSB 2QM8A 3UR9A 5K8UA 3OTPA 4NIXA 3AF0A 3B1YA 1GJDB 1GHAG 2Q6TA 4LJ4A 4Q4JA 4DDUA 3QEOA 4X8MA 2ZGXH 1YZNA 3U60B 2WPDD 3IIJA 1MD7A 4U32A 4ABAA 1CRPA 3ZVGA 1N6YA 1IY1A 4GUXA 3LU9B 2PT7A 4K69A 4FMDF 4JMYA 1WTHD 3A87A 1G30B 2H57A 4LJ5A 3BFVA 5JRZA 4YESB 5F8TA 5FUYA 4LBWA 2FFBA 2XNSA 2ZFSA 4NH0A 1VCIA 3MWIU 1G3EA 3KQKA 1QURH 2OUAA 2EC9H 2V35A 1C4OA 5DO4H 1G7RA 2FX6A 4U01A 1SSXA 4QGGA 4DCTA 1EKBB 2FLRH 1E79D 2NIPA 1T3HA 1BDAA 1G9IE 2FFQA 5FTKA 1UTNA 5A8YA 1HE8B 1P60A 4ZMAH 3FMIA 3TK6A 3SYNA 5E0JA 4ARZB 4Q4AA 4Q9LA 1UCYK 2VHQA 3MH7A 1N8OC 4WOPA 4PPFA 1PJRA 3PG5A 3W8NA 4LV8B 4ABIA 1ZD1A 2GCOB 3CONA 1T4UH 4MNVA 3GEEA 2Q9AA 3FKSA 1TBQH 2WJHA 5BN5A 2UUKB 1R0ZA 4G01B 1EESA 4IDQA 1RS0A 2ESTE 1KZ7B 4F7WA 4PQYA 1SGQE 4DDVA 3CWQA 2AX4A 2W0MA 4KV9A 4EQ6A 2IS4A 3AASA 3HR7A 1OWHA 1AQUA 2ZRPA 5CIQA 1B23P 2WPKS 1CO7E 1XFAA 1E2KA 4INKA 5JWOA 4C2TA 1ETTH 1FP6A 1CR2A 1VJ9U 5L8VA 2QPTA 1JI0A 4JZ1A 2Y5FA 2Q3HA 1OPHB 1EP6A 521PA 1GHBF 3D8BA 1GBLA 2O8DA 3ETLA 2XXAA 2VB0A 3HJNA 4S35A 1QRXA 5T6DA 3ND8A 5KDLA 2CJWA 4TT3D 1HA3A 1GBMA 4PROA 2AD1A 2P5SA 1NP6A 3PJRA 2D06A 1NNEA 2ALVA 3ODDA 2IWRA 5C1BA 4R7ZA 4E03A 4ESTE 1ZOMA 3W95A 4JL6A 1Z29A 3SUDA 4J1YA 3GJ3A 2Z0MA 4DSUA 4UXJA 1II0A 5A4JA 3ZZTA 5AUOB 5JB8S 1O5GH 2VTKA 2WJVA 1LVMA 1P5ZB 2XC0A 1WXRA 1DADA 4BPBA 3KQDA 1GI9B 1P7CA 3L33A 4AFQA 3OESA 2MSDB 3AM1A 5D3QA 4CDGA 2HALA 3MWJA 1G9XA 2ZYVX 2AHOA 5AK0A 4HAUA 3RXKA 2YWHA 5BXQC 3UANA 4HLDA 1IQNA 2W83A 2BBSA 2VLIA 4Q9JA 1Z0FA 3RC6A 2OXRA 2VIWA 4V0OA 2VEDA 3WY9A 1AMHA 2J38A 4IBLH 1O3LA 3LIWA 3A4MA 3SHCH 2IJOB 4DWJA 1BMMH 3SBDA 4KFSA 2F6RA 1P3CA 4FU7A 1ZPCA 4BXWA 1YYY1 1ARBA 4FUFA 4BFXA 2GEUA 1ZRHA 4M1WA 2QN6A 1ZNWA 3EDXB 3NHAA 3K9GA 4D9QA 1H8EA 3K9LA 4Z0KA 1KMHB 4TMKA 3RLYH 2VGCC 3V9PA 2OK5A 3M4YA 1Y5AT 4BZQA 5EODA 1HV8A 1ETUA 1OXGA 2G00A 4QGFA 1XX6A 2O8MA 5DKMA 3MRSA 1DFPA 2BMFA 1QIXB 1HUQA 1YLCA 3F0TA 1C5LH 1EB2A 3SZEA 4B3DA 1GBHA 1Z28A 2R0KA 3EPHA 1IAQA 4G5SA 1O36A 1G5PA 5AFZH 1KO8A 3OIWA 1E2MA 2FMXA 3SZNA 721PA 5HKKA 2X2FA 2WHXA 1T7CA 1UHBA 1N6NA 2Z3CA 2JH6D 2KBFA 3ZDQA 3P27A 3X1DA 1ABJH 1U9IA 2Q9BA 2FPLA 4WJG2 4AGKA 3NBFA 4QNRA 3GP8A 3CS0A 2DFNA 4MYTA 4OS4A 2GKVE 1EX7A 3ADDA 1QRWA 1Z0KA 1IQLA 1EP5A 2D2FA 1ZYUA 5FXLA 1ZP6A 1C2FA 4ZCIA 5C4MA 4F93B 1GHZA 1U0JA 1SL3A 1FQ3A 1T6NA 1E0FD 3ZVNA 1KK1A 4H42U 4Z1MA 4X6OA 1D9ZA 1BO6A 2I3BA 1TNIA 1SLWB 3MLEA 2B21A 1ELEE 3QF7A 2JDID 2O9QA 3FFBA 4A15A 1TPAE 1O32A 4TTQA 2F9PA 5EE3A 3LONA 3PEWA 2VSFA 2PJZA 4E06H 2R2MB 1SGFA 4RD0A 1E1RD 2FFAA 2ZPRA 1E35B 2OD3B 1S4QA 1QBVH 1XTRA 2XNDA 5BPEA 2BVXH 2V1XA 1XXHE 1VYTA 1XTIA 2KAIA 4NIVA 5HYOA 1C1VH 4B2LA 5EPNA 2ZWLH 1KSFX 1XU4A 3SJBA 3IEUA 2ZCKP 4IW3B 2WJYA 3I62A 3GYMA 4CGZA 4HI3A 1TBZH 1SVPA 4FMCB 3H84A 3TAHA 1LHDH 1C9KA 3A8CA 1TRMA 2G8TA 1E4VA 5CJ2A 1DLEA 1P2OA 4TLEA 3B9FH 3HK6B 4RFSB 3GLHE 1CS4C 1K1PA 1W4BA 1EFHA 4UNSA 1XPUA 1FV9A 1C1NA 4MKIA 2ZGHA 4ACBA 1CHOG 2BZ6H 3O8RA 1F0TA 2G52A 1YF4A 3SOSA 1N6LA 1CVWH 3E0NB 4K8YA 1LPKB 3M3SA 1HAHH 1KTSB 1GPZA 1YQTA 2QPAA 1ZTLA 4IJMA 3IITA 2ZS8A 1NVVQ 3RXMA 1DUEA 4NZYA 1IY2A 4XE4A 1ANKA 2G3YA 2TMKA 5LPEA 2X1VA 4A8JB 3TR5A 2RCNA 5EW1H 1ETSH 3CX7A 4Q7ZA 1PQ5A 4FMCF 3EWAA 2W5EA 2F9BH 1ZC4A 5G3YA 4U7DA 1KXEA 4US2R 1TALA 4IOKA 4A4DA 3LT3A 3RMMH 3K9HA 2HCBA 2I6QA 1FN6A 4TY6A 1I4LD 1FP7A 5L3SA 4MLFB 1XD2A 3SDZA 4BUJA 2XXLA 3P8FA 2QMUA 2GCNA 4RVCA 1W0JA 4TSFD 4UXIA 4Z8YA 2NU2E 2ODYB 2GJKA 4M22A 1XEWX 2FOCA 3KL4A 1LW7A 4PHHA 1O2SA 3EZ7A 1W36C 4BRWA 2ZAMA 1O5BB 1KAOA 3LW7A 4MYCA 4B3FX 3SYKA 4QJ3A 1NSTA 4ESVA 2FOAA 2J45A 3LH5A 4OYHA 3RXQA 3SNEA 1TX6A 3FFGA 2JKHA 4OS2A 1XCPA 2KI5A 1S83A 4M9FA 3AW1A 1TOMH 2OQ5A 4O2RA 4EFMA 2OC8A 2X19A 1J8MF 4DZZA 2HLCA 4JJKA 2RGBA 5GVSA 1TX8A 1QA0A 5GCHF 1RJ9B 4QBGB 1RYHA 3THOA 1FL9A 3QXXA 3VXEH 3E8LA 3BG8A 4FCWA 3F5FA 2LPRA 1F5KU 2J87A 2ANYA 2YYZA 4KGAA 2ZR9A 3EQ0H 4BGDA 1NRRH 1RKBA 2B7DH 2QORA 4RN6A 1F60A 1MR3F 3KCGH 4NA9H 4MYUA 2ZSEA 3GJ0A 4HLUC 4KBFA 2D2EA 4Q9IA 4K1EA 2GJAA 5FBVB 4JZKA 2GMTC 4EPTA 3BEFB 3A36A 1MKYA 2XSZD 3OEHD 2OFOA 2GCTC 1TF7A 2PGBB 3W6NA 1D2NA 3VR3A 1OSSA 1DWCH 3IEVA 1EUFA 3NCLA 2VIDA 1NFWA 1THRH 1NN5A 3ZVMA 1CP2A 1WU1A 4GP7A 4HFPB 4RD6A 2HLDA 2YWGA 1XXHA 2WUCA 3FVQA 2QF0A 3IBYA 4PZLA 4KVAA 4W5HA 2SGFE 3WRXC 3GY3A 4CRWB 3GYLB 4NIWA 4C0JA 4X6NA 2ZJZA 2GV6A 2ZM5A 1FW6A 4B44A 4IW4E 1OH5A 5JB9S 2FSFA 3DM5A 4Y7AA 4B74A 3SJ9A 3QVUA 3TSZA 4MGKR 3VAAA 1UPTA 3K70B 5JBCS 2O8DB 2Y5GA 4NWKA 2XXAB 1AE8H 1F2TB 3FDIA 1DG1G 1AQYA 7GCHG 5FTNA 5JEDA 3GLHA 4C0QC 2GHIA 1LKBA 4IRUB 4GT1A 1E69A 1NN3A 3LXXA 5G53C 4DXAA 3S0NA 4MRVA 1GG6B 3SU0A 2DBYA 1NG1A 1PFXC 3KF2A 3RANA 3ATWA 1YZTA 3MH6A 1DG3A 3PLKA 5DP4A 1TNHA 1YPHC 2HPPH 4RJLA 1KIMA 2XBWA 2H9HA 1GL7A 4KYUA 4C4PA 1C5ZB 2VO1A 1OWEA 2ZRLA 3NWUA 3L82B 4OBEA 3AVZA 3EC1A 4I1SA 1C1RA 1PLKA 3TJOA 3C27B 4R2IA 1TMTH 2EU8A 5DHFA 4CRDA 1RIWC 4NTZA 1SLXB 2CHGA 2AN9A 3RXUA 1GP2A 3AKYA 3A6PC 4V03A 3SQWA 2UKDA 4INLA 4ZDWA 3QIAA 5IF9A 4I33A 2WICA 3B2EA 1CKEA 1XZQA 2ZRDA 2JCSA 1DBSA 2O8FA 3D3QA 1SLUB 1VHTA 5JHHB 1AJEA 3CPHA 4FUEA 2F9NA 2AS9A 3MU0A 2XZPA 2Z9LA 1GMCF 4WAUA 4US0R 4BE7B 3TH4H 2YNMA 1HAOH 4Q7LA 3MO6A 5EXTA 5J4HA 4YMTA 5KNCA 3URDA 1V43A 4AYTA 1OYQA 2VWNA 3DZDA 4V0KA 3QO6A 1INCA 1DLKB 1P3EA 4ZDKA 4II7A 3RUOA 4J0QA 5K8IA 2ZHDA 2Q6DA 1BB0B 2GCPA 1W0KA 1KI7A 2W58A 2H5EA 4XSKU 4KU4A 2OM2A 2OV2A 4NBSA 4LJ6A 1IQEA 4WMFA 3MG9A 4GSYA 2F7SA 3OE7A 4HB2A 3LPRA 3A7XA 2VP9A 1H9IE 1OIWA 4DJZB 2VIOA 4RZ2A 4XH9B 1LHEH 6Q21A 2SGEE 4I7YH 3TK5A 4P31A 1PZNA 4BTUB 1OE0A 4XWAA 2XTMA 3A82A 3TMKA 1DEKA 3FKSD 3QKRB 2GESA 4QC2A 4F4JA 1RW4A 1UHBB 5L3RA 1P9RA 2VIIA 5FUXA 3RAPR 2QENA 1LS1A 4O3TA 2XW9A 4M2LA 3MNXA 3ADCA 1CR4A 2A5GA 4TZ6A 2FEOA 2J46A 1TNKA 1V5WA 1YPEH 3BE4A 3AGPA 1XB2A 1D3DB 3DA9B 1O2NA 2BDBA 2IX3A 1J15A 2XJ4A 2V6JA 1GRNA 3BG4C 1OPXA 1GJ8B 1ELDE 1AN0A 4YLQH 3BTWE 3FKQA 3IHLA 1S81A 2HT1A 2BB4A 4AOQA 3EIHA 4EKDA 2FG5A 4MUBA 3K70D 2FM2A 2WAYA 3LNCA 3X1XA 1GI5A 3ZVAA 1WTGH 1G7CA 2IYTA 1YZGA 3KGPA 3NC1C 5CIWA 4TLBA 1NROH 4BNRA 4ZKRU 1VG8A 1P11E 2J92A 4Y76A 1PYTD 1BRUP 1ZTJA 4MRSA 1KDTA 2J0VA 2ZU4A 3RS3A 1F6BA 4EDHA 1DOAA 3SGAE 4U30A 4B34A 1EX6A 2Q1JA 2DB3A 5DO9A 4FVDA 1V2ST 3UWIA 1BTPA 1UVSH 1F3OA 4EFLA 2F83A 4DRZA 1LY1A 5CK4A 2YZ2A 2CGAA 1TEVA 1O2IA 4KTUA 4FW9A 3CKLA 3A4NA 3SJCA 1NY22 4Q19A 1DSUA 2H18A 3CX6A 1K21H 1KLIH 5F8XA 2BOHB 4EUNA 3AP3A 4IXNA 2GV7A 2ZSDA 1K1OA 1K1NA 1LO6A 2FI5E 2Z94A 1M34E 3C4JA 3ZH9B 3UY9A 2A7HA 5EP4A 4AFZA 1BS1A 2JLWA 2FDCA 1DWDH 1O2GH 1VYUA 1OWDA 4ASUD 1N3BA 1HGTH 2WYJA 1GWNA 4RCZA 2QL6A 1O38A 1YPMH 2BY9X 2OZEA 2WKRA 4CH8B 3C7KA 2A31A 5JS7A 1YR8A 1P2KA 3EA7A 3WY8A 2FX3A 4P4UA 3CPJB 1WA5A 1KXBA 4ON9A 2ORIA 3T06B 4ASHA 1YU9A 2JLYA 4EJSB 4MH0R 1AIXH 3SV8A 1ELCA 1X3SA 3A7WA 3RMNH 4KSBA 1BITA 3GD7A 4YMUA 4U5XA 1P12E 5EQTA 5CHAB 2VSXA 1GCTC 4JYUH 5ANRB 4B32A 1DE7H 3LFUA 2BTCE 1YPGH 1W44A 3SBEA 1YZUA 4ZXXH 4Q7KA 3RS0A 2IF0A 1HXEH 3C8UA 1N6IA 2HUPA 4QXAA 1G19A 2EFDB 3Q3KA 3L6PA 1J8YF 1XKAC 3T1OA 5LPFA 2H92A 4Q1FA 1GKYA 4RKFA 1P9SA 3GCHC 4MYHA 5HKKD 1TPSA 3E5HA 1C4U2 3UFAA 1R4AA 4JSYA 5JJKA 2ZANA 2ZFRH 2IYUA 3K9XB 3MJHA 2XZLA 1NLFA 1FUJA 2WOOA 4JLPA 3W3ZB 3RXAA 1R5NA 1OSNA 2BX3A 1HYLA 3CO5A 2J7PA 4JLVA 3AW0A 3IKJA 3NXPA 2RGDA 4MRRA 4L9SA 3LBNA 4JLOA 2K1QA 1XX9A 1YKTA 4ISIH 1KDPA 5L3QA 2ZPQA 4JYVH 2JASA 3B82A 4NCNA 3RU4T 3WP0A 8ESTE 1UO6A 1KDRA 2HNTE 5KNBA 5TY0A 1BRBE 4ISNA 1V2RT 4Z1MD 2C9YA 3KXKA 4IOJA 1M7GA 4WWYA 3M36A 3U8RH 2BY7X 1H4WA 2ZP0H 5EE5B 4PXAA 1AM4D 3M5OA 3SE0A 1SFIA 2BXTH 1AI8H 2ZSAA 1Q22A 1OXSC 1U0HC 2GXAA 4B2AA 1UVTH 2YNBA 1R7RA 5ABWA 4NHOA 1GJ4H 1K5GA 1VCOA 2FGJA 2PMDA 2NU4E 2ZHFH 1XXHB 4ZAEA 2FLBH 1MD8A 1F5LA 1V3XA 3CRQA 3RHFA 4NSVA 3ZGXA 3G82C 1OP0A 2P3SA 5GJBA 2PZFA 3VQTA 1AK2A 3C41J 1AIPA 5ESBA 1J14A 2ZRNA 2YOGA 3AF1A 5FPHA 1ESAA 3GLHB 2FOMB 4GCHF 2PHBA 2JLUA 1N6RA 2VU8E 1YR7A 1SFQB 4X0WU 4M1SA 4B35A 3MCAA 1O3JA 3RC4A 1GI8B 1MKXK 3TUIC 6CHAB 2J3EA 1Y8TA 2ZRFA 3TSWA 1O3IA 4BAHB 1SQAA 2GZHA
chains in the Genus database with same CATH superfamily
4DRXB 4TVSA 4CBVA 1W46A 2C5EA 1KOGA 4IUCS 2RGNC 3G2JA 1SVNA 1T8MA 5L2ZH 2H2ZA 3SC2A 5CR9A 4FFMA 5FAHA 3DFUA 5KDOA 3PQEA 1GPYA 1F4LA 2QLTA 2AZ4A 4UOEA 4NA7A 4ZOEA 3UK6A 5DWDA 1RAGA 3HFRA 4OTZA 1ZSVA 1DDJA 4WZAE 1QFSA 1FY3A 1QRTA 1G2OA 4C01A 1DWQA 2DF8A 4OP1A 5C5OA 4KITB 1CQJB 1W8IA 4ISCA 1LWNA 3FYSA 3K94A 1QL9A 5L4NA 1M0EA 5JI3E 2EOAA 4PCLA 3O31A 1MZVA 1ZNQO 2J7KA 5JYBA 4WH6A 4HQNA 4TKMA 5DP3A 4UEWA 4Z9YA 3KKZA 4Y8XA 3O8DA 2E1RA 4UVGA 4GOOD 5HF9A 4ETWA 4JP2A 1ETHA 2IH4A 3EDRA 3ZK7A 4U1RA 1IQRA 3DMGA 4A6LA 2ATXA 3AVTA 5CBKA 4A0GA 2W00A 4JD5A 3EXEA 4EA9A 1OWPA 1F9EA 3B5EA 3UCFA 4X2WA 1Z7KA 3VB4A 1RI3A 2CZGA 1I3LA 3QBVA 4AF7A 4ZTBA 3I76A 1JA1A 1XXLA 3I9JA 1XEXA 2A88A 4QA9A 4F55A 4DCOA 3FOFC 2Z6UA 4DR3B 4PNHA 2AZTA 3REGA 3OZEA 5AHRA 2IYQA 5FPYA 3GAZA 3G49A 3GFOA 2J5UA 1W13U 3FP7E 2PGQB 1INLA 5IVDA 2H31A 3V34A 2F90A 3KE9A 5J23A 2P69A 1BS2A 3L77A 3H05A 4GOKA 1FMCA 1BWPA 3UOGA 1Y3HA 5JBQA 4RMHA 4L9WA 5EGSA 4EHLA 3K35A 4AFUA 3M9LA 1ICIA 1U7PA 2NU8B 1YPHE 1E9EA 2RI0A 4HQKA 2NTYC 5T6BA 3SEAA 3C1KA 1ZY2A 4ER5A 3K05A 2HCFA 1IHTH 1AVXA 5C3NA 1DANH 4KODA 3CNNA 4OGXA 4O9VA 2C5LA 2YS6A 3N3BC 1ZG3A 4XQCA 1OBCA 3FSGA 4ESHA 1Z8IB 4KMRA 2Q49A 1IN7A 3G9XA 1ICEA 1E2EA 4X1RU 3JD3A 3ZZ5A 5KTMA 2B3TA 1EYZA 1S2IA 2BLNA 1C5MD 2ZZKA 1TVCA 2UAGA 1R4ZA 2QP4A 3NYQA 2ZI2H 1CCWA 3Q5EA 1EDDA 4MWZA 3V8NA 3V42A 4QAQA 5P21A 5AM5A 1T3GA 1RWBA 3SBXA 3WYCA 5A4DA 4H0CA 1HNEE 4RLHA 4KPYA 2G04A 1QAQA 4AUEA 5GPIB 1WUTA 1W5EA 3KXIA 4Q3BA 1CQIB 2GARA 1W11U 5C1YA 3RT9A 2XIQA 5H82A 4DLYA 3F73A 3MM4A 1H42A 3LKWA 4WZAA 4OLFA 1QX3A 2CNBA 2JHPA 3M7QA 5AKZA 1EB8A 1OTXA 4BO6A 1Z6PA 3N2YA 2IIPA 3M3HA 3FMGA 4RABA 3R9WA 3EEYA 3PTZA 3HB5X 1NVBA 1T8SA 1JMOH 1CY0A 4RE5A 1KXCA 3GROA 3MT9A 5EJ1A 4LOAA 4B7AA 4OHPA 2PBRA 3ZVFA 2IC5A 1T6ZA 2E9SA 5I45A 1AO0A 1ZLXA 3F46A 3JYQA 3OE4A 4UHFA 2KBEA 2RSLA 1O3DA 4Q3DA 4ZCSA 2GPTA 4PZUA 3DD1A 1JZSA 1KFCB 2JNWA 2OBBA 1PUIA 5EEHA 1ULBA 4JC0A 4RIGA 5AR1A 1V7QA 3HUTA 3THWB 1SUWA 1M6HA 1GBCA 1P4RA 1JDJA 2ZJ4A 4FSHA 1JAXA 1ZAKA 4HDAA 4CT5A 3VC3A 1X7HA 4E5MA 4IF4A 1O2JA 3O84A 3NMUF 4KR3A 4PZAA 4OBWA 4MKRA 1E6WA 1NE2A 1Y9JA 4CF5A 3KKPA 1MABA 3R76A 4HYTA 4DWWA 4QD3A 1YA4A 1PL6A 2OG1A 3OZXA 2ZU5A 4D81A 1P72A 2ZO3H 3PGA1 5AYVA