3O8BA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords HCV NS3 protease/helicase
total genus 219
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8bA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8bA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA03
3KL6A 4P4UA 2R2WU 4F49A 3HPRA 1C5OH 2PZFA 4PSKA 1O2PA 4RY2A 1TQ7B 3TSZA 3RXKA 3RHFA 1KI7A 6LPRA 4EPTA 3RSOA 1H65A 1KGDA 3MUFA 3MI4A 5G41A 1CHOF 3THXB 3U44B 2XZOA 3BTEE 3Q3JB 5EP3A 4M9SA 2V1XA 1TPSA 5HXFA 4NCKA 4A4DA 1JRTA 1YLCA 1DARA 5FTKA 3UREA 5DH9A 4BLSA 1D3TB 2GCTB 5FL7A 1KNXA 1T5LA 1AHTH 4DLXA 2BD7A 3WBKA 2BZ6H 2WTUA 2ZYTX 1P2IA 3M1IA 1E9SA 4CDGA 4UE7H 2R62A 3TK5A 2J3EA 2A4RA 1AVGH 1JPNA 3VU9B 3GDVA 2WPDD 3DPUA 2ZGBH 2RGNA 4AKEA 2C96A 1W10U 1D3QB 3U61B 2W6JA 3KKQA 3VGCB 2AMPA 2J45A 2ZHDA 1XFAA 3G0HA 2A45B 3NBFA 1SKYB 5DYGA 1GI3A 1XM1A 2CE2X 5KSYA 4B3XA 2A4OA 2SGPE 4RFVA 2O0KA 3NKKA 4DSOA 3T35A 2BX3A 2O8CA 2ZRPA 4MYHA 3L8ZA 3THOA 2OC1A 4F38A 3U98H 1O37A 4XH9B 4CT4B 1KO7A 2XOKD 4OI4A 3RDZA 7GCHF 2DR3A 2FIRH 5B58C 1H4WA 4ZKEA 1P75A 3VR2A 3D8BA 1A7SA 2BJWA 1BMMH 4DC9A 4I8HA 2A4QA 2JLVA 1QG2A 3FKQA 4H1UA 3S1AB 4CBNA 1TIOA 4Q4AA 2WPKS 3MH6A 4Z1MA 2ESTE 1AK2A 2AERH 3VR1A 1UDXA 1DAGA 2QP3A 5SGAE 1V2RT 4Y7AA 4KVGA 5P21A 4FMCF 1ZMNA 2G88A 1TGBA 4LOYH 2ZHEH 1YZNA 1V2PT 621PA 2VYFA 4QKQA 5C2ZA 5B57C 1NPMA 4Q4JB 4NMMA 5DGJA 4A2WA 1L0ZA 2J0UA 3OIWA 4ZH8A 2PV9B 2UUFB 2HV8A 4BGDA 4C0KA 2DHRA 4BZPA 1RRGA 3BTHE 4B3FX 3TK1A 2CLDX 5JEDA 5GVRA 2G1KA 2O8FB 1OHHD 2BVRH 1MH0A 3ZZTA 3GY2A 2JGNA 1Q21A 1C1UH 4OHYA 1AIPA 1UBCA 4GZMA 4Z0KA 4SGBE 4B2PA 1GBLA 2DWPA 1ZUNB 4KTCA 5EQRA 1ZGIA 1AI8H 1O5GH 1GJDB 3W8RA 2OZEA 4NU0A 1FY1A 1YPMH 2HJGA 3I1FA 1GG6B 4AGJA 2BBSA 4D2IA 3GY7A 2W7SA 4JL8A 4C2UA 4LYFA 2O5VA 1GCTB 1W0YH 2JIZA 1C1WH 2P8OB 1FY8E 4BXWA 4V0MA 2WBLC 4ZUHA 3MH5A 2NO9A 3I8XA 2NO0A 4ZHMU 4LSGA 2ANYA 3EIEA 3RXAA 3GEHA 2BXUH 1Y5UT 2A5AA 4JVMA 4O3TA 4AYTA 2NU2E 1GJ7B 4AI6A 1P72A 3RDPA 1XUIA 3EIHA 4W5JA 3QTVH 3SI7A 4HFPB 1O5DH 3PYHA 1A2BA 2KAIA 1W14U 5AUPB 4DLVA 2GEUA 1G8GA 5HM9A 1DSUA 1E2QA 4QOSA 1DWDH 4ON9A 4TSFD 3BEUA 2L0XA 2AGIX 3ICEA 4Q47A 3BG4C 2Y8EA 1US8A 4M1SA 1V2WT 2XTNA 1FZZA 5AJVB 3QSYA 1U9IC 1AD8H 3SQEE 5JHGB 2LKCA 4PHFA 2ZE5A 5ETXA 3RC4A 1NN3A 2OCVB 1R0XA 5J40A 1OP0A 1E98A 2GF0A 4F4IA 4ZIRA 1NY22 3F9HA 1MTSA 4IN2A 3HU1A 4I81A 5PTPA 5FOUA 4UEHH 2Z43A 3LBIA 2BDGA 2QA5A 1G291 3DM5A 3GCHB 1KXAA 2GV7A 1IHTH 3OFND 3KQEA 4I31A 2G3YA 2Z83A 3QX5H 2Q3HA 2ZJBA 4Y7BA 3RXRA 1W5TA 5HE8A 1WBDA 2QG6A 3E90B 3H84A 2YC2C 3Q3YA 4FUIA 1XXHB 2ZF0H 1C4Y2 4YZUA 4HB2A 3K0AA 1Z7KA 2VP0A 3AW1A 4C7OA 1FNMA 4BASA 3AH8A 4Q1FA 4LY6A 2AEIH 2QGZA 3GCTG 5JRZA 5IDKA 3EE0B 3BTTE 4CEHB 2YJTD 2C9CA 4WBSA 4B2BA 1JR3D 4ABEA 2VEDA 3GJ7A 4Q9LA 4Z51A 3ENSB 2KI5A 1QZXA 4ABGA 4URYR 2H16A 1KSJA 1FPHH 1Q44A 5KNBA 2OP9A 1X8KA 3U6BA 3EWAA 3AVWA 4NG9H 5CIWA 1NU7B 5LDDC 2O8WA 3UR9A 1THSH 4FIDA 4ABIA 1GMCG 1LVMA 1KZ7B 2R0KA 4OBEA 4FCTA 2ZNKH 2B21A 4ZAEA 1IN8A 3M37A 2ZUBA 1ETTH 4BLRA 3A6PC 3NBZC 4QHSA 4ASHA 4ZHLU 5GJ4B 2BMDA 3B7GA 2XJ4A 4X1QU 5TXGA 1ZVQA 2H9EH 2GNOA 3TJZA 3UKDA 4B73A 4HZUA 3BC1A 5EG4A 1WUNH 4JZEH 4ISHH 2CXVA 1O2HA 2ZR0A 4KFRA 2P3UB 1GBFA 2BDIA 3KHVA 4A0HA 1HTWA 2QV1A 4AWXA 1AU8A 3VR6A 3M3SA 1G7RA 4L8GA 4BZQA 4FXGH 5ELXA 1DEKA 5C1BA 4ZHAA 1E0KA 4KP0A 3TE6A 2ZI2H 4O2LA 4QT8C 3ZVAA 1UTJA 3GY5A 3K0EA 1KOFA 3NDPA 3SFZA 2HYIC 3L8YA 2HGTH 1SKQA 1WOFA 3FZDA 5CB6A 1OH6A 2CXXA 3EYDA 1TMKA 5KSZA 1CRPA 4JT4A 1P9SA 5CM8B 5DP9A 4GT1A 3QKRB 1XUFA 2ZHWH 1NRPH 3CR7A 1DS6A 2BDYA 2X2EA 4MKFA 3VAAA 2IYYA 5IK2D 2ZE6A 4IOJA 2JETC 4FCWA 2HUPA 1WAYB 3VR4A 4S35A 2EI7A 5FR1A 2OBMA 4YOJA 3SNBA 3MG9A 1TGTA 1IAUA 1TUEA 3PV2A 2O8CB 4MDFA 4OS4A 4B3DA 2FYRA 1UJ2A 2ZGJA 2ZRJA 3HR7A 1E0AA 4QBIA 1CE5A 4K3JA 1EX7A 9ESTA 2ALVA 2F6RA 3P70B 1P06A 1ZSJA 3EDXB 3OE7D 4JZ1A 3EASA 1HURA 5K7RA 5AUOB 4BPBA 3T34A 4FW9A 1MQ6A 4GZLA 3RLFA 1VCOA 3D23A 3UQVA 3IEUA 1ZRHA 1Y5BT 5EZ6B 3AKYA 1XD8A 1DAMA 1EOLA 3CRMA 2ODPA 5I46H 4IFBA 1TX6A 4THNH 2ODEA 3T27A 4G0NA 2FFAA 3VHLB 1OXGA 4NIWA 2Y81A 2OM2A 5E2PA 4K46A 3KFVA 3KEEA 4G5OA 1A0LA 1E2HA 4WY3A 1Z6GA 1TPOA 1NRRH 3BIVH 1W7XH 1NY6A 2GA8A 3IGFA 1GKYA 2IXGA 3LDAA 1X1RA 1AVXA 2CHQA 3M4YA 2HCBA 4CREA 4Z6AH 3TAHA 4OJQA 1T3SA 1O2TA 4M9FA 3RXFA 1O2YA 3B13B 1EX6A 2A7JA 2XXLA 3MU8A 1SLUB 1ZPBA 1NN1A 2GVDC 1Z22A 2O8MA 3IKJA 1FJSA 3M5MA 3U69H 4LBVA 5CLQA 3C27B 2EW1A 1RTKA 4I32A 3ZS8A 4DKXA 1EP5A 1HY3A 2SGAA 1CP2A 3F9FA 1U81A 2BCJQ 2PJZA 3ONWA 4DVAU 2G52A 1U6QA 4IHQA 2VNTA 3P92A 2CL0X 5GJCA 4A2QA 1ANEA 1KLTA 3M61U 4GSYA 2Z7FE 2W6IA 2R3YA 1ZP6A 2XOKA 2XZLA 1ZHPA 3VTKA 3C7KA 3F1SB 1W1WA 1O2XA 2QN5T 2O8DA 2F9BH 3CIOA 2VB0A 5CDFA 4LV8B 4PSAA 2C99A 4XSGA 2EI8A 2F1IA 4PC1A 2V3HH 4OQMA 4LHVA 3D3QA 2AN9A 2OINA 4Q1CA 2ZIAA 4PXAA 4L15A 2YZ2A 3FB4A 4YMTA 5FAHA 2QROA 4A36A 2GMTC 4JLPA 1FZQA 5BQ5A 1YPEH 1EG7A 3B9PA 1EKBB 2HJVA 1Z6EA 2FX4A 1P62B 4FWIB 3PMBB 1VCMA 1LPZB 2STAE 2D2FA 2YOGA 3SE0A 1S85A 3KJHA 4R98A 1ZSKA 5C2JB 4BTTB 5H70A 1SGFA 5C1UA 2BBWA 5BPEA 1DXPA 5FBIA 3NHBA 3DOEA 5DO9A 2QU8A 1L1NA 5TARA 2FWRA 1TF2A 3AF1A 1AFQC 1SXJE 2IJD1 1T8TA 4NBSA 2V8OA 2O8LA 9LPRA 3GLIA 4ISOA 5AJWA 2IA5A 4Q4HA 1KMHA 1SVSA 1J17T 3RUOA 2YWGA 4YONB 1QY6A 1BBRE 1YPJH 4LZ4B 3O8RA 3MWYW 2IHBA 3TJOA 521PA 1VHTA 5SZKB 1X86B 2F9UA 1P9WA 3CNOA 1T4GA 4PAMA 4IMQA 4LK4A 1G8YA 1EJAA 3CS0A 1R10A 1UBFA 4RKOB 2BY7X 3AVOA 1MMJN 1O2MA 2VRWA 2ZRDA 3KQBA 5L3QA 2SFAA 1AN0A 3LLMA 2QM8A 4QXAA 1BOFA 2MMGA 4ASUA 1OH5A 1XMSA 5L30H 4CEJB 2QBYB 1R2QA 2ZREA 1EAWA 4OHXA 1II9A 3LBHA 4J0QA 3ZZ9A 1L7VC 1OS8A 4MNYA 5K8IA 1FN6A 1G3UA 1NL3A 3RLWH 3VX4A 4HEJA 2FI3E 1VDZA 2FSFA 3D62A 1SQ5A 1GI5A 2UWLA 1SHZA 2PMKA 1P2MA 1TGCA 4UFFH 1NFXA 2F3CE 4F7WA 1P3CA 1ARBA 3W6NA 1TQ4A 5LPEA 2G6BA 3TQCA 2BD8A 3PJRA 1GKUB 3ECCA 2PKSB 2BV3A 5JI2E 3A1WA 3BTWE 3SS8A 1GI0A 1ZPCA 3CZQA 4LYJA 5H68A 1ZM3A 2WIBA 3NXSA 2ZKSA 1C2DA 3EC2A 4P4TA 2P5TB 1P2VA 2VP6A 1QRAA 1U98A 4AYVB 5LPNA 3FMIA 2QGRA 3EC1A 1NBMD 1AFQB 2G51A 2WAXA 4Q5IA 2YOLA 3IITA 1GFIA 4M4SA 3KUDA 2G00A 1WYKA 4U02A 2NU3E 3A58B 1Q1BA 3C4JA 2PZGA 1ZM2A 1ZSLA 4A15A 3THWA 2SGEE 3GJ4A 3I32A 1US8B 3BIFA 3PROA 4QNMA 1S96A 4KGAA 3MGCA 2VHJA 3D7MA 1O3MA 3AP1A 4GPTA 4MKHA 1FX0B 1NM6A 2FOMB 3KF2A 2A5YB 1OXVA 2H5EA 4WJG2 4U7DA 3IHWA 2REBA 2QN6A 1EX3A 1JBUH 1KDQA 5KPDA 5CDFE 5JBBS 2GAOA 2EFEB 3RYTC 1S9DA 4LBWA 3K0AB 2G77B 4QJ3A 4JL5A 3OFNA 3QKTA 1HGTH 1BTHH 4L5BA 2WAYA 1U0JA 4B35A 1YLDA 2ZVQX 4VGCB 2QAGC 2WWGA 4IBLH 2UUJB 1T4VH 1TRYA 3PB1E 1TU4A 3MHWU 1QVAA 2XRCA 3VXFH 2ZXUA 2IS2A 3RWMB 2ZPSA 2YKGA 3ESTA 4HZIA 5EP4A 1HAVA 5DN6D 2AL7A 1PQ5A 3PIRA 1THRH 3QBTA 3LPRA 2QUZA 4LYHA 3KJGA 1SBWA 4RD6A 4TLBA 5FI1B 1VCNA 4CR5A 3K0FA 4HZUB 3OSYA 2CHVA 5A4JA 3SJ9A 221PA 3SU5A 3LGWA 5C4GB 1N5IA 5DP4A 2OFXA 3B60A 1QRZA 3TVJB 2R6AA 5BN3A 2GJSA 5BN4A 3ZYEA 3KQNA 2FOAA 2DY1A 4JT2A 3QTOH 2BHRA 4GCHG 2RMKA 3FE2A 2CNWD 1QCPA 2PFEA 3TNFA 1Q57A 4US0R 1FIWA 1VG9B 2DFNA 3BTQE 4IOLA 4JK6A 5DPAA 1IQGA 1F2TA 3H5CB 2WWHA 3ATLA 2H8KA 1ZCBA 1RXPA 4TY6A 1V2LT 2GEDA 1E3MA 1O35A 3A7WA 1G32B 4HGCA 4OS6A 3EGKH 3DKPA 1C4V2 1T9HA 3LW7A 2GJ8A 4A1VA 3NCLA 4B44A 4YDHB 2R6CA 5E0HA 3MAAC 3KKMA 2NIPA 4BRUA 3QQ5A 1A2CH 5EXLA 5F03A 1Q1QA 2YWHA 1CGHA 3VPKA 2JLQA 2KSQA 2FOBA 3X2SA 3OTJE 1E1QA 3GCGA 1EAXA 3MFJA 2C95A 2G83A 3W34A 2Y80A 1VCWA 3Q85A 4PFSA 4EFLA 2LPRA 1W13U 2Q21A 3CR8A 2AD1A 2VGCC 2HNTC 3RS5A 3QY0A 3W5JA 3RXJA 4P31A 3PEWA 4PPQA 1FY3A 2ZQ1A 4ABHA 2JJ8A 3FDIA 1NVWQ 4YO9A 4IVQA 3SHFA 3HPTB 4KV9A 3PEYA 1P2TA 4HLDA 1J99A 2R2AA 3TU7H 2J9NA 1Z0IA 1NBMA 4PQYA 2V54A 4A0FA 3SNCA 3T5FH 1Z29A 1GHAF 1Q3HA 3TJVA 1QL8A 1N6IA 3B2EA 1DSTA 1IXSB 3V0XA 1GJ4H 2JH5D 4R71A 2EFDB 3SJ8A 3RXMA 3TK6A 3TH4H 3MOCA 3TNSA 1O30A 1NLYA 4BFXA 1QVRA 2BD5A 2OBNA 1BCUH 1VITG 1QBOA 3AKDA 3HU2A 4DW2U 2Y5HA 1XX9A 2G5VA 2Y6TA 1ZLRA 2BD3A 5FUWA 1IQEA 4FI3C 5FFMA 4AOQA 4UDWH 3RXBA 3GY3A 3U44A 1TL7C 2G4TA 3ZQ6A 1EPTB 2ZU1A 2VINA 1KMHB 1TF5A 2FLBH 5LGOA 2ZVPX 1HAZB 1E2JA 2OO7A 1QRXA 4DUGA 4LI0A 1KXDA 1GCDA 2ZPRA 5FH9A 3VGCC 2D4HA 1C9PA 2AGGX 1EZSC 3VB4A 3TJNA 3SJCA 1CSOE 3ZD6A 3TGKE 1G3EA 1U90A 2KE5A 3Q3XA 2UKDA 5EXPA 2O8BA 4HI3A 2YC4C 1N1LA 3A37A 1FUUA 2W6JD 1LTOA 2FGJA 3F0TA 1HYQA 1Z5ZA 3A82A 5LPFA 1DG1G 3IO3A 5J4LA 2RGCA 1KK2A 1WQ1R 1LHGH 3SU1A 5A0AE 1G2LA 3FWYA 3QKRA 3T28A 2VA8A 1CHGA 2GDEH 3GLHA 1XJCA 4EJSA 1G7SA 4A7IB 4I8KA 2WHXA 1IN6A 1ZRKA 1OX1A 3JZAA 2JLUA 3RC6A 3RC5A 4MNXA 1GJ8B 1ETUA 3MSXA 4I99A 5AJXA 1PPEE 4YT7H 3HGPA 3TMKA 3ND8A 3GLGB 1HQYE 2O9QA 3OX7U 3CF6R 2CCKA 3SDZA 3G82C 1ACBE 2AWNA 4QM7A 2RGGA 1S0RA 2CE7A 1BTPA 2UUKB 5C3NA 2WM9B 1K5DA 4UXHA 1GBBA 4CH2B 2A5DA 1GWAA 3BFXA 1DWCH 1G37A 1MKYA 1JXPA 1HIAB 2EYQA 4IOKA 2A2QH 2G8TA 4OI1A 1OH8A 2FOFA 4YQFA 2SNVA 3W90A 2HEIA 3CH5A 3AVTA 4C0QC 3SBKA 3BTFE 2O8TA 5JB9S 4P32A 1O2WA 2TGTA 3MNXA 1XEXA 3SZRA 1KI6B 3LU9B 4JMPA 3SU2A 2BHGA 4GNKA 4XWOA 1XEFA 3F6UH 1RFLA 2G81E 2VLIA 3B85A 4MQBA 5FPSA 1TTTA 4MRSA 2FWWA 4H1VA 2PT7A 1E4YA 2XCFA 5J47A 1Q3TA 1TRNA 2QC2A 1II8B 3LGVA 1W47A 2ZGHA 4IOMA 5K8UA 4INHA 1OH7A 5TV2A 4MKIA 1ZHMA 1YZGA 3U3MA 3PTNA 1CJVC 3K0CA 4G5QA 2ZRAA 1WCZA 1O5AB 1Z1IA 4LJ6A 3FVFB 1G2MA 1Z47A 3UMRA 5J4HA 4ESTE 4NE2A 1JQJC 1A61H 1E9CA 1XTKA 4QGAA 5CE1A 4LHYA 1OV4A 5JS8A 3QKSB 3AF2A 2QTFA 5DHAA 5AF9H 2ZU2A 4GOKA 1GGDB 2ZYUX 5I25A 2OFWA 2NO6A 7LPRA 1AKYA 1MUEB 1HAGE 2ZJAA 3VR5A 3AW0A 2EYUA 1CJTC 2Q3MA 5F98A 1CJKC 4B2LA 4FU8A 2OE2A 3S9AA 2YVUA 1UBEA 3A89A 4A2PA 1AMHA 2DPXA 2W7UA 5EXTA 2J7KA 5J4QA 3WY9A 2KWIA 3KB1A 4B74A 3M7UA 3ODFA 5GXPA 1DADA 2BEJA 4DUGD 5IDVA 4G5SA 2WYGA 121PA 1VJ9U 4UJ3A 2GDJA 1H8DH 2BJVA 4D7FA 1E2IA 1CIPA 4HB0A 2EFGA 5FR2A 5FOTA 3TR0A 2P0EA 1AGPA 1WRBA 2PHBA 1OXTA 4CRCA 1DVRA 2QORA 5ANRB 1OSSA 2Q6GA 2HALA 3GFPA 5EZ5A 1WA5A 1K1PA 1FTNA 4AB8A 1ETRH 1KDOA 1P2JA 4CYMA 1ZC4A 4M21A 4TMZA 3A1SA 1O3BA 3PWBA 2ZFSA 1CT4E 2W2XA 3UNQA 2HXSA 4BFSA 1CXZA 3R9WA 2ZDAH 2QE7D 2JLYA 3CPEA 3KXIA 5TJXA 3TJUA 1KO8A 2J0SA 2YV5A 2AWOA 4JBYA 4OGYA 2C4FH 2I6SA 3MWKA 3KJEA 1P6XA 4Q9JA 1IAQA 5DJ7A 2H6MA 2F3RA 3HPQA 4V02A 4D0LB 3LNCA 1LW7A 3MCAA 3LBNA 2GDDA 3HK6B 1GDUA 3MJRA 3RM2H 1SHYA 4PO8A 4OK3A 3EA5A 3B9FH 4YMWA 4TYWA 1LHFH 2GZDA 2W2TA 2OLGA 5DP7A 2V6JA 1KTSB 4GVUA 1Z8IB 4NIVA 1BRUP 3F68H 4AD8A 2AFHE 2ZHFH 2AS9A 1OYQA 4CGZA 1ZMLA 4NP6A 4JLBA 1SC8U 2V7QA 3UG7A 4D4LA 2ZRFA 1OHHA 6Q21A 4RKFA 2QGNA 4OQFA 2FXRA 1SVMA 4BANB 2DUCA 4HLCA 1JQLB 5EP2A 1TQ0B 2BIFA 1MZAA 1S83A 1GTVA 1TOCB 1IJFA 1XRJA 5IT5A 3R7WA 4IDNA 1AVWA 3TNTA 1XXHE 4A5TS 1H8ED 1RRPA 3U3RA 5GJBA 3QVVA 5AR1A 1EAIA 4D0GA 4TL9A 1SZPA 2GWHA 3ZV9A 1HE1C 5A0FA 1C1NA 1JI0A 1Y59T 1XCPA 3I4LA 1FW6A 2BTCE 3F3YA 3FOZA 5HMAA 3T62A 1NIJA 1W0KA 1YCPM 3X1ZA 4OGXA 2IXEA 2FF7A 1O2JA 3UOPA 3QXJA 4QC2A 3WRXC 1PQ8A 4FU7A 3R8CA 2ZC9H 4YMSA 5EQSA 1C5ZB 5T6DA 1NSTA 2X19A 3B8HA 4INKA 2CCJA 1OXUA 3VB3A 1TGNA 2OXRA 4DT7B 2ZDNA 1EXFA 1W0JA 2OBQA 3W6PA 1WBBA 3Q3KA 2B6HA 5JS7A 2MSEB 2LKDA 2WZQA 1N6LA 1NMXA 2Y82A 3RS0A 2PT5A 1UO6A 2UZIR 4CF7A 4M7GA 2BMFA 1KJWA 1ZM4A 1JXMA 3AM1A 4M9XA 2ZDLA 2I1QA 1ANCA 2JCSA 5J5CA 1YR7A 4JLVA 3ZZCA 1WBGB 1ZINA 5CYPA 3CX6A 4U2WA 3E3TA 1SSXA 1CEEA 4PO9A 3T61A 4CHAC 1Z2CA 5KOYA 1A5HA 1GILA 1OWKA 3SYLA 2BM2A 1P02A 1ELBA 1LNZA 2HYDA 4M2LA 2D06A 2A5KA 2ANKH 1CHOG 3BOSA 3GJ5A 1SOZA 1SI5H 4Q18A 3P4YA 3PV4A 8KME2 2WWYA 3D65E 2IS4A 1VYUA 1BMNH 4MYTA 1U94A 1NF3A 4PZYA 2P3SA 3UK6A 5EU8A 1EGAA 1S81A 1EZUC 3B1XA 4U32A 2VQSA 4D81A 5LBIA 1BDAA 1J2JA 5EE5B 4MG3A 3W3AA 4DDUA 1BKDR 2ZHQH 2BXTH 2QMEA 1EPTA 1AB9B 2NO7A 2C9YA 2VP4A 1TAWA 5JHHB 1QBVH 1OPHB 2H5DA 3SV6A 2ODWA 1DVAH 3B6EA 2PL3A 1MTVA 1ARCA 4E05H 3SHAH 3CF2A 1SXJD 3UTUH 4ZPXA 1ZD8A 4F4OC 3L0IB 5G3ZA 1KI4A 1E36B 4KBFA 2YWEA 1W7AA 1J90A 1QHGA 4B3GA 3VKHA 2F9MA 1D5CA 1U99A 3EQ0H 3GJ6A 4TTRA 2NPIA 1P01A 1NO9H 2RCNA 3ZVEA 1OKKA 1TFXA 2A32A 4LBZA 4WZAE 3OZXA 4NWLA 1N6YA 2C2HA 2RGNC 2FOEA 1P10A 4TQUS 3B78A 2OXCA 4CEHA 4JL6A 1I4TD 4AZ2B 1AQUA 4QJ4A 1A3BH 2WPDA 1YPHC 2OK5A 3TIFA 1G5TA 3THYA 3BXZA 1GJ9B 2ASEA 2QENA 3GEEA 1XTIA 1LTQA 4Y11E 1W2KH 2DFKB 4EPXA 1YE8A 1RJXB 4C0HA 4MKGA 1SGQE 2BLQA 1O31A 5L8VA 2QRZA 3HP1A 5KUTA 2ZE8A 2M5TA 3U1JB 3ZQJA 4Q1BA 2JLSA 1R4AA 3D49H 4TYYA 1WCV1 3AF3A 1O3DA 1DE0A 4DCTA 3SU3A 4DVGA 2QYIA 1QL9A 2CLSA 1G3MA 1ZW6A 2O8EB 3GJ0A 4C0SA 4NONA 6CHAB 1OOKB 4O9VA 1CR2A 1C2EA 4CHAB 5EPYA 3PEVA 3K65B 2BY8X 1A5IA 2JETB 2WOOA 4EFMA 1UKZA 1RVDA 3MWLA 5FX6A 4C2TA 4ISNA 1W2HA 2PMDA 1UCYE 1COWA 3KB2A 4ABYA 1EJNA 1UEIA 2QSYA 3X1DA 3BJIC 4UKDA 3S9CA 2BC9A 5E0JA 1FPMA 5KU1A 2A7QA 1OPXA 2AHOA 3B5JA 1C2GA 1T5IA 4C7OB 3AVVA 1G9XA 2WICA 1K6MA 4PHHA 1OSNA 5CYOA 3RP2A 1F5KU 2ZTSA 1XUKA 4RZ2A 1QHIA 1S9HA 4ZDKA 2P6NA 2XTMA 2D2DA 2GILA 2QRNA 1LVBA 1L1GA 3RXIA 4PR0A 2IK8A 4KBGA 5EE3A 4DY7B 4NA8A 1GHAG 3ZLJA 1MTNC 3MNCA 2Z3EA 5GJWC 2AIQA 3FANA 2ORIA 1G3BA 1SLVB 3AP3A 3SN8A 1D9IA 1AM4D 2F9OA 3SYNA 3QPWA 1N25A 2LCFA 4YLGA 2Z6BD 4TYDA 1P5ZB 1S0UA 1JALA 1BT7A 5HCNA 1GHXH 4RI0A 3T26A 3FMFA 4XE4A 1DAIA 1YC0A 2ZQ5A 1FV9A 2RG3A 3SUDA 7ESTE 1NS3A 1GJBB 4DIIH 2H17A 3UMFA 4MPVA 1UTQA 1YF4A 1EQ9A 1Y3AA 1Y3WA 3MNBA 3MMGA 3I78A 4ABJA 4JYUH 1ZTLA 2AFIE 4IN1A 3M3VA 4R2HA 4JCNA 4QG7A 1Z1JA 4K81B 1NMYA 1UK4A 4KCGA 2IN2A 1C4OA 2V0BA 3UMSA 4NSYA 4ZROA 3IUYA 2XBVA 1SL3A 1LHEH 3PUYA 2GK7A 2BD2A 2BLOA 4YLQH 1T3LA 3CRW1 1GVZA 1H9LB 1ESBA 2UWPA 2EWVA 1NROH 3ASZA 4EFNA 4GOXA 1Y3UA 1K1LA 3BB1A 3M7QA 3QXCA 5IRCD 1BBRK 2R9VA 2PLXA 2XB4A 1ANBA 3QZQA 4IEIA 1MO3A 2ZI5A 4Z8YA 3ATIA 3CH4B 1K22H 1GAJA 1T3HA 1SOTA 3IQWA 1SQOA 1KI6A 4DLYA 1NMZA 1EZQA 5FCKA 1ESTA 3QEJA 1PPHE 2WSMA 2J0VA 1BO6A 3CW2A 1E1RD 4KFSA 2VF8A 1XD2A 5FPHA 2JLRA 2CK3D 4E06H 5E3HA 3QK1A 3OAAA 2W6ID 4WVFA 1AKSB 4ISLA 3BH7A 4JLJA 4G3XA 2V1UA 4FMDF 2W0SA 4F91B 1X1SA 3H7OA 4KSCA 1B0UA 4XOJA 4UJ5A 3K53A 4IDQA 2BD9A 1RRCA 1KY9A 3SU4A 1E79D 4NCJA 8OHMA 1RYFA 1SGCA 3DD2H 1AS3A 1ZD9A 2RGEA 4M1TA 4X8HA 1IJEA 1GNRA 3VNVA 4OHWA 8ESTE 1IOZA 2AFQB 1K1OA 3F8TA 5L3SB 1VTKA 3R3GB 1D4PB 1FMJA 4DJZB 1IQNA 3LVRE 1O3HA 3TVTA 4MUBA 2BY5X 1FXYA 3K6YA 5HZKA 4FUDA 3MU0A 1GMDF 5L3QB 1Q2WA 4MPWA 3ATWA 1HB0B 4FUGA 2A4GA 1XPOA 3RU4T 1P05A 3L82B 2BD4A 1SVIA 1W0KD 4DLTA 4HTCH 3U7EB 3A84A 3E6PH 2XW9A 3DUXH 4V0LA 1YQTA 4Q4JA 5E7JA 1EWRA 3A80A 5EOKA 1TF7A 4ZKRU 2HT1A 5HTKA 2A78A 4PPFA 1LVYA 3LO5A 3PUWA 2IEYA 5EPNA 5IYTA 4UNRA 3SUGA 4BFVA 3AP2A 3PCRB 3I29A 3BWDD 3WNBA 3SNDA 1PYTD 5JCZA 1U8AA 1DLEA 2IYUA 1KTVA 2JDID 4A0GA 1YHNA 4EAQA 1TBQH 2RH5A 1MRNA 5FI0B 4NYIQ 1UHBA 3CPHA 1FY5A 3LFUA 3DFLA 1TOMH 2ZS7A 1YPHE 4EQ6A 1P04A 4DLRA 2FESH 2EWWA 3SOSA 1IQIA 3EX7C 1W8BH 5CLLA 5FPTA 2C78A 1IQFA 3QOFA 4UFGH 4LJAA 1P2KA 1BJUA 3WXMA 3ZYDA 2VH6A 1KDQB 1G8HA 1ZUHA 3EW9A 5DYIA 1HAOH 3CPJB 2QXGA 2QXIA 1Z6YA 1BHXF 1O3CA 2ONKA 4MLFB 1H8IH 2V35A 1HAVB 5JWRA 2YHSA 1KAGA 2ZAMA 1VMAA 2AXPA 1F5NA 3QPVA 2OLKA 3G01A 3JZ1B 3KQDA 3GJ3A 3WYAA 2WJHA 3BTDE 2RHDA 4NDZA 3ZZ4A 2FYQA 2SNWA 3W9YA 3ZVGA 2PW8H 1JAIA 5AUNB 4V03A 1IQMA 1KK0A 3B1YA 3TAUA 1BH2A 2IYRA 4H9GA 4A6PA 4HLUA 4D4KA 1V2KT 4LDJA 1N5JA 4JYBA 4K2YA 2NMVA 1OWDA 2Z9IA 4JK5A 5FUVA 2PEZA 1G1MA 2BMGB 3QGNB 1XZPA 4I1VA 2KBFA 1IQKA 3EZ9A 2JJ2A 4URZR 4D82A 2D1JA 1KSGA 4X2WA 5E8EH 4DSTA 1E99A 5JCPA 2IS1A 1HAPH 4BZXA 2Q6DA 3NWJA 1HJ9A 1A1VA 5FBLB 2CEAA 3FP8E 2WV4A 2JIZD 5BXQC 2UVQA 2RGBA 1AUTC 1C1OA 3LD9A 2A9KA 3PVSA 1XTQA 3DZ8A 3LW8A 2GEVA 5FTNA 5JRJA 1MV5A 1GHZA 5JI3E 1O5BB 1NSFA 3VR3A 3L33A 1N0VC 4GP7A 1K1NA 5IK2A 4AYYB 5F8ZA 1P73A 2ZE7A 3KX2A 4WAUA 3SO3A 5FOWA 3M7TA 4AN7A 2OXSA 4AK9A 1O3PB 1T7CA 1SHHB 2GCOA 3Q5EA 4TMVA 2F43B 721PA 3MFYA 1RPZA 2NU1E 5DISB 1CS4C 1SGTA 1DLKB 1SFIA 1ESMA 3KQHA 1MAYA 2FV8A 2QAAA 2H5CA 3K0FB 1ELDE 2ZCKP 2AKYA 3NH9A 3IPYA 1AO5A 2XNIA 2VTKA 5HKKA 1SMFE 3C5HA 3VB7A 2C8YB 1OKXA 2NZ8A 3HWSA 1W2GA 4RZUA 4KTUA 7KMEH 2VF7A 2P8OC 2QPAA 2PX3A 3CKLA 2WPLS 4FUEA 1FAKH 1G64A 3K2UA 4NKRA 4II7A 4JLDA 3Q00A 4YTAA 2O52A 1GWNA 1O3IA 1NU9A 1C1TA 5FOXA 1S5SA 2OUKA 2VIWA 1K9OE 2J94A 3PUVA 3THYB 5AFYH 4KTSA 1V2ST 1F7ZA 5DE3A 3FFGA 3GISB 2AK3A 1GI4A 5TCAA 2VH0A 2J1LA 3DFJA 3S69A 3A7VA 1OLOA 4EIWA 3ZZ7A 4R2IA 1CGIE 1CJMA 3LWNA 5KPJA 1T4UH 2Z9KA 1WQVH 4OHVA 4H6SB 2B7BA 5FOSA 4Q7ZA 4RJLA 4CZ2A 3DHWC 3CF0A 1HAIH 1EJMA 3A1TA 4K8OA 3KUCA 2QT1A 2REXB 1XWIA 2Z5FA 4NYJQ 4HB3A 5BN5A 2FX6A 1X3SA 2A7HA 2TPIZ 1R5OA 1C5NH 2ZPTX 1HV7A 4JLMA 4NA7A 2WUBA 4WMFA 4Y0AA 4JMYA 2PGBB 3ITIA 1TUIA 3ZH9B 5GWZA 4C9BA 4TTPA 1KY3A 3QG5A 1SGWA 1SVOA 1EFRD 2R6DA 1XPUA 5ESBA 3QUSA 2ASUB 4MGKR 1TQ2A 3OIUA 1K2I1 3E5HA 2O0HA 4X6MA 5FL7D 1FI8A 3WRYC 5LB4A 2GKSA 1EFHA 3GFTA 3NPSA 4CRWB 5TB5A 5EUMA 1JBKA 1SR5C 3KJIA 3RXCA 4CRGA 1G6OA 4IKEA 4IC5A 1YPKH 2GT8A 1F60A 4CRAA 5FXLA 1P9NA 4J1YA 1O2KA 1OFTA 3FHTA 2CCGA 1TU3A 5C20A 5K8LA 1MH1A 4NTZA 1B0FA 3U5ZB 2RKOA 3PEUA 1QFKH 1KI8A 1UFQA 3GYMA 3Q5DA 2GZ8A 2BWJA 1C1QA 1DX5M 1O34A 3QBVA 2CMYA 3ND9A 3SQWA 1WE2A 2XC0A 4RSGA 2OCBA 1QURH 2QMOA 2FE4A 2ZRCA 2PTCE 3E8LA 2QEQA 4DWJA 5B64A 5HR5A 1QTFA 2FFBA 3AV0B 2ZU0C 2W26A 4P0TA 4ASUD 1WB9A 1LY1A 1UTKA 2XEXA 3PWCA 3LA6A 1Z8GA 2IEZA 1SKYE 3IIMA 3GP8A 4X8MA 3LQQA 2IYWA 2GBLA 3T2NA 3RRZA 3PV5A 1MO4A 3W95A 3L6PA 5JEEA 3AUXA 4K8YA 1H9IE 4ABAA 1RZ3A 3RMMH 4KELA 4Y76A 3ZZ0A 4B34A 1IQHA 3W6OA 1P2UA 1GHVH 3QUMP 1T6NA 2ZI4A 2V6IA 1A4WH 1Z2AA 1AIXH 1OFIA 2K5UA 1XCGB 3LC3A 3TVDA 1E2LA 2F83A 2B7CA 2SGDE 2ZFRH 1O36A 1G8FA 3CLVA 1TX7A 1LV7A 4AY2A 5SZHB 1XMJA 2YINC 2SHKA 2R6GA 1ZJ6A 1QDEA 2XXAB 3KXLA 4BWYA 4Q7YA 5EXSA 4ESVA 1N8OB 4NYMQ 2PCLA 5GVSA 2VBCA 2ZUCA 4TSFA 3SYKA 1Y63A 3LIWA 2BDHA 4Y8ZA 2W83A 2GXSA 5JJIA 1LPGB 2GETA 1J8AA 2FX3A 1N6XA 1C5WB 2O8UA 5FX5A 3ATKA 1OYWA 1GZSA 2O0JA 3AUYA 1Q31A 4PQFA 1FN8A 2GCTC 2G4UA 1VHLA 2P93A 2P95A 1LKBA 4X6OA 1Z6TA 1S3GA 1C2HA 5HYOA 2E1RA 2Z3CA 2D62A 1X7AC 3ZVNA 1IN5A 1F48A 4RKEA 1T8MA 4US1R 1T91A 3VHXA 3TPIZ 1Z8RA 4P33A 1UF9A 1NESE 5TVKA 1MBQA 3MNSA 3UANA 4JLNA 1G3IA 2ZJ2A 2PX0A 2ZSBA 4ACBA 3UXMA 1YZUA 2N1BA 4X2YA 2IYTA 1NZQH 1TRMA 1J15A 2G55A 1AS0A 1AZ8A 2VHTA 4JVLA 1GBMA 1KSNA 1H1BA 1TX8A 3RXDA 4HATA 4DRZA 1ELFA 4AX9H 4ABFA 2GV6A 5C1YA 2DE8A 1HYLA 5DI3B 5JWHA 1V2UT 1O3KA 3DT0H 3AEZA 3RXSA 1JAHA 5DI9A 2Y7ZA 2F7SA 3EA7A 2ZFFH 1GMDG 4PTLA 1ELOA 4LX0A 1E9RA 1P09A 1NBME 3B1ZA 3GLFB 1ZCAA 3I61A 2BVNA 5HGGA 4AG6A 2P3FH 4QRHA 2ZFTA 2HPPH 1V2NT 2Q6TA 5L2ZH 2H1LA 1BMLA 2IT1A 4XSKU 2OEPA 3NEYA 1G30B 2ODBA 4QFMA 3PMHB 3GD7A 3PO1C 1SQTA 1Z8FA 5A8XA 1FP7A 1GBTA 5T1VA 8GCHG 4BNRA 1RW4A 1NTPA 4XVRA 1NRQH 3QE0A 4OQLA 1Z0AA 3BH6A 3P8OA 3TQFA 4RFSA 3S0NA 1KO1A 4KHZA 1JJVA 4LOAA 3SHCH 2W58A 3K70B 4IVPA 1KNQA 1WTGH 1ZNZA 1C1PA 5K8TA 4AURA 1BA8B 2P94A 5DP8A 2ZETA 1N6NA 1UADA 2WV9A 2V4ZA 2UWOA 1K8RA 1RC8A 1U0LA 4MRPA 1CF4A 4NHOA 2QBYA 2ZO3H 3I62A 2ZRLA 1WSSH 8GCHF 3RMNH 1TMBH 3RMOH 2XB2A 2ECKA 3GLGA 2XNDA 3KXKA 2VO1A 2FFQA 4JSTA 3SBDA 4JBWA 2OSBA 2XWBI 1GBCA 1LCYA 2BBOA 1CBWB 3TH3H 2CBZA 3RXPA 3U8TH 1LHDH 1R6BX 3NUMA 1O0DH 1JRSA 3SJAA 1KKLA 1VG0B 1BRCE 1HLTH 2PUXB 3TKLA 1CA0B 2ZRIA 4M1MA 2ZJ5A 1WXQA 1ZNYA 4MRVA 2QXJA 1BZXE 1XTRA 3SEAA 4Q19A 5EE0A 3OY6U 4Y0VA 2GTBA 1Z6AA 3U7FB 2ZEBA 4LC1A 4Q2KA 3RXHA 2P5SA 3EG5A 3UIRA 1N5LA 4A6LA 2IF2A 3A7ZA 2HNTE 2TMKA 5JBAS 5JFGA 3OY5U 4URUR 1AB9C 1UVTH 4U00A 2ERXA 3W8NA 2LWIA 2BKEA 3J81k 2QQ0A 3SUFA 1RIWB 1GIAA 4YC7A 1GNQA 1JR3E 1JPJA 1KMQA 3E2IA 3DZDA 2Z94A 4QGGA 4LHXA 2QMHA 3K6ZA 3CRQA 4NYJR 4TZ0A 2FEOA 2I4IA 1HXEH 5TY0A 1GM5A 2GCNA 4AG5A 1O3NA 1VCIA 1ZU5A 4G5RA 4WVPE 4DJTA 3SGQE 4NH0A 1VYVA 2D7DA 3BFVA 4NA9H 2FI4E 4M22A 5JSZB 1SXJC 3A8CA 4URVR 2ZJYA 1KXCA 1S6FA 4GBMA 3V9PA 1E2FA 3NIBA 1ZTKA 1SGNE 2A2XH 1XXFA 1O2IA 7GCHG 2OHFA 1PPFE 2ZG0H 2FSIA 2C03A 3QXHA 2QZ4A 3QN7A 3MMPA 5DNYB 4RD3A 4R0IA 5KNCA 2FU5C 4Y71A 3U8OH 2J7PA 5CJ2A 5FPKA 1OB5A 1Z8JB 2A5IA 2REOA 1AGJA 3FKSA 3SV8A 3WYGA 1SG8B 4X8SH 1BTWA 4IDOA 1JOUB 1EK0A 1DAHA 2WINI 2Q6FA 4OM9A 4FUJA 2ZZUH 2WPJS 4OK6A 4UNQA 4JJKA 3REGA 1KKMA 2DYKA 1FTSA 5LD2B 3ETLA 2B8OH 1UDWA 5A2MH 4MGYR 2W00A 3ZV8A 2FJUA 3CWZA 3FAOA 1P3JA 3PQCA 3M35A 1FY4A 4EDHA 2F43A 1C5UA 2ODQA 1R5BA 1PYTC 1G20E 4IVRA 3RWOA 1FUKA 1EXMA 3K0SA 2F1JA 2DWOA 2WWWA 1ZJKA 1JMOH 2BQ7B 3CS7A 1YZKA 3C8UA 2XSZD 1YR8A 2P67A 2ZR7A 3LGUA 1VKJA 1MCVA 1UKEA 2WWXA 4KJZA 1XBTA 3DEFA 2H92A 1QL7A 4NFEA 5A8YA 1E2DA 2PLFA 1Z0DA 1CR4A 3AKEA 2HLDA 1U0HC 1ONBA 2MMCA 4X2VA 2AIPA 3A86A 4FUHA 4LWZA 3SW2B 3FGNA 4K1EA 4Q7MB 1G4AE 1GKIA 1WDTA 3IBYA 3U7GA 1G7CA 1S82A 5J4YA 2WJYA 3IO5A 4B3BA 4LUCA 4WWYA 3RC8A 1DTSA 4ZO4A 4AGKA 3GICB 3SUEA 1ZUIA 1GL6A 1WMSA 2HLCA 4W7SA 4OJKA 1A5TA 1X8JA 2G1JA 4MDEA 4B6EA 3KZ1E 4YMUA 1C4U2 1F0RA 1HAXB 2IWRA 2ANWA 2SGFE 4NCHA 2BQWB 1ZAKA 1HNEE 3N70A 1UMAH 4B75A 4MVNA 4PC3A 4KO8A 4A0RA 3VFEA 1GCTC 2QF3A 3QPUA 4Y10E 3C16C 3V00A 2VVVA 3HR8A 2IUUA 1CA0C 1QJ7B 1JEEA 1XEXB 1HUQA 5AJYA 1YZTA 4HDCA 1AA9A 2QTVB 2PSYA 2GCHF 4QGHA 5BYKA 3OEHD 4B76A 4F92B 3LOXA 2J87A 4X8TH 2BVXH 2ZS9A 5L2YH 3JZMA 2ERYA 3DOFA 2FI5E 1AUJA 3GPLA 2ATVA 4PAQA 3TITA 3RM0H 1TLDA 2CVHA 1XUGA 4TPYA 1H8HA 1QBKC 4YXWD 4OK5A 2FZ4A 2DB3A 4Q02A 1E9AA 4YLUA 1MD8A 1P60A 3CM0A 1W12U 3PLPA 3ZYCA 2GJAA 4QL3A 3BBPA 3RAPR 4BQSA 4Y6DA 4O03A 2BMEA 2QIQA 2WPMS 4I4LA 4Q4AB 3AVXA 1XNJA 2ATXA 3LGYA 1DBSA 4A8JC 4C0LA 3U2QA 4DSUA 3BH0A 2VWMA 3IDQA 4B47A 5KDDA 2B92A 3UFAA 5H4IB 4AB9A 3K09A 5F9HA 3MU5A 4FVDA 4OS1A 1C5XB 1COWD 1GBIA 3CUEF 3MD0A 1L4ZA 4LJ8A 3FMOB 4X6PA 4CW7A 4WH6A 3LONA 2VHQA 4AG1A 4B2CA 1YVDA 4U30A 2IJOB 4LCBA 5DN6A 2J34A 2A0QB 1K21H 4KFUA 4JKYA 3C1KA 4B6FA 1QGFA 3LJOA 4LYAA 4U5XA 2BY6X 1S84A 4WXIA 1UJ1A 3K9NA 4NYMR 2J46A 2OBLA 4TMXA 2YNBA 3K70C 4Y0YE 3EA9A 3DKVA 3ZZUA 1HJAC 3NTUA 1NFYA 4ABDA 2XC5A 5E2OA 1BS1A 2FH5B 1IQJA 2B5TB 1NN5A 4B33A 2ZCLP 4F93B 1EB1H 2GP9B 4G1UC 3VXEH 2ZRNA 4PSVA 1TPAE 4D76A 3GCOA 2AMQA 4OI0A 1D8TA 4Q80A 5DO4H 4RSPA 2YOFA 3T12A 3VKWA 2P2LA 2ZSAA 5C46F 3BEIB 2CJWA 1E9FA 1O3YA 1G5RA 2VHCA 1F92A 1D6RA 3VU9A 3ATMA 1OWJA 4BXSA 2C90B 4I33A 3LJJA 3QDZB 2BLVA 1BBRH 3BG4B 5B2ZA 3PITA 3U7HB 1RS0A 1KSFX 1Q1EA 1CLUA 3A8DA 1TEXA 1IM2A 3O8DA 4O97A 2GX4A 1UTOA 1ZYOA 3SGBE 1YU9A 4JYVH 1FP6A 2R44A 4AKGA 4JZDH 1BMAA 2XSZA 5BYJA 1WV7H 4FU9A 1G36A 2ULLA 1O87A 3UIEA 5C4MA 2OQ5A 2F55A 2QP4A 2QY9A 3F5FA 4BAQB 3PUZA 3MWIU 2ZJOA 5CK4A 2WJIA 5A5GA 3RC3A 2XBWA 3WP0A 3U4QB 1H8EA 1MT0A 4LHWA 3BSQA 3O8BA 4XDEA 1ORFA 1IN7A 4ZI2A 1WF3A 4CBOA 5HE9A 3Q77A 5BWMA 2D3WA 1OIVA 2PLRA 3NBYC 3A8AA 3PMAB 4WMDA 1QQUA 1N6KA 1KXEA 2BEKA 1VIYA 2RHMA 1KY2A 3WHLA 4IMZA 1XKBC 1O2LA 1TADA 5B6LA 3BGWA 1QNJA 1RFNA 1NKTA 4A92A 4MDSA 2FLRH 1DAFA 2BY9X 3NZIA 4VGCC 2QAGB 4MYCA 4M8NE 2YNMA 1Z6JH 1TB6H 3K0CC 2ZU4A 8LPRA 2XYAA 3GFOA 1JEDA 2OUAA 2R9PA 5EUQB 3U9AH 3BE4A 2H1UA 4C30A 1YCPH 2WYJA 1O2ZA 2VIOA 3A7YA 1TEVA 1VZQH 4EPYA 2NPFA 4YOIA 4ERNA 3GYLB 3LC5A 2FDAA 1RIWC 1T8LA 4F4CA 5J4KA 1ANDA 1XF9A 4XJXA 2IX3A 1SULA 4NCNA 3NC1C 5JSZA 3GLHB 1QHRB 2Z3DA 1QR3E 1KHTA 4D4JA 3Q72A 4ISIH 3WBJA 1YR9A 2WPHS 3GDSA 1CQQA 2ZITA 1UK3A 4TYPA 1V2JT 4AFSA 1TX4B 2XTZA 3TGPA 2BOVA 1AKSA 4GHTA 3L0PA 1ZYUA 3B8JA 3T29A 1ELTA 1O5EH 3T5DA 4Q7JB 4NCIA 1K1JA 3SNHA 2XWAA 2GMTB 3ADBA 4MYUA 1RTLA 2AK2A 3A85A 4GCHF 2F3TA 2X2FA 2OAQ1 1ELEE 3HKIB 1TABE 3SC3A 1GI9B 2O8DB 3I92A 4TTQA 1E9EA 1V6DA 1KK3A 4GAWA 4M9ZA 2IYQA 1X8LA 1G6HA 1X6VA 5FBRB 1TNHA 2FPKA 4GMDA 2VGCB 4CEIA 3R0FA 1C5QA 3JVVA 1B7XB 5KDOA 1BMFD 4W9MC 2FDCA 3FFAA 4BAKB 3H7TA 1LFDB 3LRPA 2IPHA 1KI2A 1O33A 2VJ1A 3X1YA 2CMKA 1GI1A 2QAGA 2XITA 4BLQA 3MH4A 4I7YH 3A81A 1AY6H 4HAYA 1MABA 4A1FA 1GDNA 1O3FA 1ZNXA 2J38A 1GMCF 1WTHD 1PLKA 2ZI9A 2AMDA 4QHTA 4X8VH 2J95A 2P65A 1C5MD 2D2EA 1FPCH 4XSHA 1YRBA 1O3EA 1PLJA 3W3ZB 1W4CA 1XVOA 2BM0A 2VHUA 1QHNA 2B9LA 1OE0A 1WP9A 4DCSA 3I3SR 2STBE 1V2QT 5FL3A 1J14A 3A1VA 3PV0A 4XTRA 2C8WB 3LDXH 4TZ6A 2F9NA 1C1MA 1OJLA 4LXBH 1DG3A 1UTLM 4Q1DA 1EFCA 1O3OA 4KVAA 3KKPA 4C4PA 1FLEE 1EFRA 1NVVR 1KXFA 2XGJA 5EE9A 3UWOA 1PUJA 1EFUA 3QENA 1TGSZ 4A82A 3A83A 4TL8A 3RS7A 2J2UA 2CLCX 2P6UA 3ICQB 1MR3F 2RA3A 4BUJA 3K9GA 1N6OA 3L0OA 4ZCLA 3SZEA 2IXFA 4XBBA 3VMFA 3ZZ5A 1TNLA 2F91A 4F4JA 2QMUA 3M6AA 3IPXA 1P2QA 2ZRBA 1UTMA 3SJKA 1EB2A 1ZZZA 1ZOMA 2ANMH 3MU4A 2N46A 4Q9HA 1G3DA 4X8UH 2OQUA 1CU1A 1FL9A 4DIDA 2J0UB 4WF8A 3NC0C 3QF4A 1TYNA 3NHAA 5T6FA 3EZFA 3UY9A 3SU0A 2ALPA 1MD7A 2V3OH 3F9GA 2JKHA 1N0UA 4RD4A 2QQEA 1E0FD 1KI9A 1F2TB 1ELVA 1B5GH 4GRAA 3SQXA 3V3MA 2FS9A 1IQLA 4Q7XA 1ZBDA 3A36A 4WZBE 3NK8A 4KSBA 4Q21A 2CGAA 1GJ6A 2BZAA 4E5UA 1DICA 3FMPB 1RRKA 1W3CA 3SI4H 1K5GA 1OXSC 3L43A 1WXRA 4E03A 4IEEA 2OT3B 4UQOA 3UPEA 1II8A 4NYIR 4GLYA 5LH8A 1ZM9A 4CH8B 5E95A 4BLPA 3GLGE 1Z6XA 3TW4A 1DXWA 2JH6D 5GCHF 2D7CA 1W44A 3BV9B 4TWYA 3ZIAA 2Q9CA 1ANKA 2ZYWX 4CRFA 1NVXQ 1CKEA 4IXMA 2HF9A 4AKHA 1W48A 1QHXA 1OF1A 3ZS9A 5FBVB 2Z4RA 1YKSA 3STIA 1NG9A 1FX0A 1PLLA 2VSFA 2G9NA 4O3MA 3TK9A 5DP3A 5GCHG 1GG2A 3OHMA 2BLWA 4B71A 4Q66C 2ZGCA 5LD2C 2F4LA 5ESTE 5E7IA 2J9RA 4BAHB 1GNPA 3UWIA 1ZHRA 4XIGS 1KIGH 2VH5R 3P32A 1EPTC 4P3YA 1O2OA 2HF8A 1IOEA 3TSOA 3EPHA 3RRNA 1PVOA 1G18A 1LVGA 5CM9C 2Z9LA 3KL4A 3OESA 3RRYA 1HXFH 1Z08A 1CBUA 1NLFA 1MU8B 2V9PA 2LNCA 2C3SA 1Z63A 3ZVCA 5FHTA 1G8PA 5A8ZA 1GRQA 2ZRKA 1O5CB 1F5RA 3V13A 4DURA 1VG1A 1RJ9A 1H8HD 2ZU6A 3TGIE 5DSZA 4AYWA 1QHSA 3ZZDA 3VFDA 5JDUB 1BYUA 2ZWLH 2E87A 2AD5A 3B1WA 2DBYA 4QGFA 1IY0A 4Q7KA 4AFUA 4NZYA 1FNIA 4ZXXH 1D9ZA 3MO3A 2KB0A 1M34E 5G3YA 2XXAA 1CULC 3S7HB 2VIIA 1FQKA 4X8LA 4HAZA 1CGJE 3GJ8A 5DGXA 3PLBA 1DM4B 5CK5A 2GAAA 2Q0HA 3QEOA 3LGIA 3LLUA 4PPNA 1GPZA 4BRWA 4OL0A 1P57B 4JKIA 1DOJA 3A88A 4US2R 2FFHA 4HZHA 4L9SA 1THPB 4LJYA 5B30A 3AQ4A 3CBQA 1N0WA 2DCUA 4ZKSU 1MAXA 4B1TA 2Y5FA 3OAAD 4ABBA 4EJSB 4DZZA 3RNLA 3TH2H 1INCA 4KODA 2J92A 1VR1H 1OWHA 4QBFA 1JB1A 3URDA 3FPAA 4DBLC 4GOJA 1KAOA 1YM0A 3ELAH 2PEYA 4TLAA 5L3RA 4MUAA 2J59A 3KN2A 1HE8B 1PZNA 2FZLA 1DANH 3OEEA 5GNDA 3KKOA 3TRFA 2W3KA 1KIMA 1OYYA 1N6RA 2GESA 4MNWA 3MTYA 4AORA 3HJNA 1V2OT 1PFXC 1O38A 1TPPA 3QZRA 2OCYC 2H18A 1R5NA 4GHQA 1FMLA 3T15A 4V0KA 2OBOA 3GLHE 3OIYA 4R8TB 3FHCB 5JZVA 3WNCA 5EP1A 2ZEJA 2ZP0H 4TMWA 4E09A 3M36A 4JIMA 4BFUA 1DE7H 3A7XA 1A3EH 3SJBA 3I73A 4QJ5A 3R7WB 1W36B 3VNUA 3RXOA 4BAOB 1KJZA 2WMNB 5H1YA 1Z83A 3DO6A 4LPKA 4QBGB 1IY2A 1PUIA 1E2NA 3MH7A 4FD2A 3QG1A 3KGPA 3AGPA 4Q4LA 1MTNB 3IBGA 1LS6A 5EW2H 5GIBA 4PZLA 4DCDA 3P6ZB 1O3AA 1G5PA 1KZGB 1E0SA 1A7JA 3P95A 4MGIR 4RVCA 4JVNA 1V2MT 1L1JA 2BVSH 3NG1A 1E2EA 2H9TH 3P20A 2PKAB 2ZGXH 1XZQA 2BOKA 4NCYA 1F6BA 2GK6A 4HAVA 3JVUA 3IWMA 1DITH 3RXTA 3E91A 5D3MA 1N6PA 4KU4A 1TONA 1CBWC 4N0EA 4C0JA 3WMEA 2R65A 1XP8A 2XNSA 1HJAB 3GCHC 5CB8A 2ZPQA 4TL7A 1MOZA 1J7KA 4CR9A 1PPBH 3AVQA 1HQCA 2IYZA 3NWUA 4JZIA 2G0TA 3OU0A 1W36D 1BIOA 3ODDA 1IXRC 1OW3B 2WUCA 5L3SA 5C5NA 4C0BA 4KI0A 3TUIC 3SOPA 3PMJA 4BLTA 4XVUA 4YT6H 3DM9B 2W3IA 1A4RA 1PQAA 1V43A 1ZGVA 3GY8A 1C2MA 3OTPA 1GDQA 3SN6A 4GPGA 2JASA 3E70C 1M7HA 2I3BA 3QLPH 2OAP1 2X77A 2KJQA 1QBNA 1O2NA 1ID5H 2NU4E 4FUBA 5A0BA 1Y3XA 3MU1A 1VGCB 1YP9A 5E0GA 1P2OA 1OFUX 4ZI3A 2OC0A 1XMNB 1BTXA 1AS2A 1UBGA 3U8RH 3ZZAA 1II0A 3H2YA 1NLZA 3P8GA 2C98A 1UEJA 2GVFA 2Q9AA 1LMWB 3R20A 5KSOA 4PROA 1RTFB 3UOUA 3ZVLA 1N8OC 2BDBA 4YDSA 5J4SA 1E6CA 1OP8A 3H4MA 1J8MF 3ADCA 1Z0KA 1OKKD 1NRJB 1VGCC 1GL9B 5F8TA 4WZ6A 3HK3B 1Q0UA 3ZJYA 3RXLA 1W36C 3BB4A 1GJ5H 1E79A 2GF9A 4W5HA 3MYWA 2CN0H 1SVKA 4H42U 1M9UA 4OS2A 4Y79A 3QKSA 2XC4A 4B43A 2IUSA 1XD2B 3SJZA 1XTJA 1NKSA 4LZZA 4JVSB 2D74A 4IFEA 5EODA 1GJAB 4JSYA 1GJCB 2GGVB 4X0WU 3RLYH 5H8WA 1SLXB 4DOQA 4D6PA 3ZVBA 2PGQB 2QM7A 1FIZA 2VSXA 1U9IA 4TYNA 2F9LA 4JJZA 1F0SA 1AE8H 3RU4E 4HLQB 3AKCA 3E1SA 1S8FA 4IDPA 1UKYA 3SI3H 3TLXA 3EA8A 4HAWA 3SJOA 4M1OA 2YOHA 3U3JA 4OHZA 3U1IB 5FTMA 2PKSC 4FN5A 2VIDA 1XTSA 4IC6A 4LPSA 1GI8B 1S1MA 1CVWH 4GFDA 4BFZA 2BQ6B 2V7QD 2P59A 1KI1A 1GBDA 1D6WA 3CRRA 4E7RG 1F5LA 2ZCHP 4DHEA 1QJ6B 1QB6A 4POAA 2OLJA 5JPMH 1S1CA 4CIDA 1W0JD 4YMVA 1HPGA 3CZPA 3EPJA 3GJXC 3EARA 1XMVA 3H09A 2IYXA 5KO2A 1EAUA 5IHPA 4KITB 1NRNH 3ZZ8A 1P12E 1IHUA 3GLIB 4N3NA 4EJSC 3UNSA 1TWXB 2PR3A 1IONA 3LXRA 4JLAA 2Q3FA 4NPHA 4I8JA 3ZVFA 4D0NA 1ELGA 4TMTA 3N2EA 3QF4B 1E4VA 1GBAA 1J16A 3SV9A 3OIVA 4B32A 4HYYA 3P17H 3UWKA 1NVUQ 5FTLA 1DO2A 1VECA 4WXPA 5FUYA 2QTHA 1R7RA 5FOVA 2I1VB 5C18A 2THFB 3EWSA 4FUCA 2IF0A 1DDJA 2EC9H 1QB9A 2IHYA 1ABIH 2R2MB 2MSCB 3P8NA 1C2LA 4NFFA 2BX4A 3Q7PA 2ZAOA 3PTBA 1MU6B 1HDTH 2WOJA 1KK1A 1M6NA 5A09A 3FHOA 4IDHA 3T25A 1BRAA 2R0LA 1ZIPA 4HDOB 4TT3D 3LX8A 4OKSA 1MKWH 3BTKE 3STJA 1IY1A 1S3SA 2XBXA 5G53C 3D6TB 4L4UA 4BEBA 5HZHA 4MNVA 4XD7A 1SHKA 1W11U 2ZI7A 5JBQA 4DIEA 4RN6A 1SVWA 1GBEA 4XWKA 2FTMA 2KAIB 1TNDA 2WJVA 2P16A 1UPTA 4KLNA 1HT1E 1C5SA 1OWEA 3THXA 4I1UA 1OIXA 2A31A 2Y7XA 5EXXA 1W49A 1GMHG 2ZRHA 5CIQA 3RXVA 3ZVDA 2CHGA 2WVJA 2FS8A 1XXHA 2OTVA 3AAVA 4DSNA 4Y8XA 1N3BA 4UD9H 5F8XA 3BF6H 3BEFB 4TMKA 3THWB 3JZ2B 1LF0A 4WMEA 1GOTA 4JLOA 1IBRA 5JLJA 4YM9A 3IEVA 5JBCS 1P0SH 1C1RA 3ADKA 5F3WB 5AK0A 1BUIA 5DKMA 2ORWA 1GL7A 2W0MA 3WHKA 3PR1A 3IIKA 5FBQB 1F0TA 1SGDE 3A8TA 4JYCA 1OP2A 2FMJA 3FKSD 4NGAH 3U3OA 2GZ9A 1XUJA 1OT3A 2FA9A 1E38B 4DLWA 1Z06A 1CO7E 1TA6A 1C1YA 4WW0A 5M04A 4D7GA 1QHYA 1OWIA 2IC5A 1T32A 1CRQA 1YBWA 1UAAA 2ZA5A 3LH3A 2QCYA 4LGMA 2FPMA 1V2VT 2JH0D 2JJ1D 3NVAA 1TQ6A 2CJWB 4EQ6B 1O3LA 3K70D 4XTCS 2ZECA 4QHYA 1KXBA 5FBEA 1EWQA 1T0JB 4RKJB 1P11E 3K9HA 4RCYA 4BTUB 2C8XB 2Z9JA 4OS5A 2AYWA 3B9QA 5HCIA 2VU8E 1DY9A 1E32A 2CK3A 2GCHG 1G3RA 2ZJ8A 3LQRA 1RGQA 4Q48A 4BECA 3UNRA 5DP5A 3L3TA 4KFTA 1AQYA 3LKWA 2J0QA 3BD9A 2RA0A 2GZAA 3VEQB 4DCVA 4LK2A 4BAMB 1F2UB 1ZD1A 3T1VA 1J8YF 3HYTA 2JAQA 4GMXA 1HA3A 1NY5A 5T3HA 2NGRA 1OB2A 1HCGA 1DOAA 4BEJA 5TMPA 1Z07A 4DLZA 4EUNA 1VYTA 1HBTH 1NG1A 1GRNA 1KDTA 2GXUA 3U4QA 3GLFE 3KTAB 1QIXB 2DFLA 3ZDQA 4XWAA 1EUFA 1I4LD 4K1SA 1QHHB 2HWLB 2NQ2C 1O2GH 1FQ3A 1SGEE 4DGJA 1GBHA 3X1XA 1UM8A 5KSPA 3SNEA 2IW3A 2YYZA 4EPRA 2FP7B 5FBWB 4TN1A 1SVPA 1R0YA 2GT7A 1NI3A 4TLDA 1SGFG 2NG1A 4ZIRB 5CHAB 2CL6X 3O47A 1EOJA 1JXOA 1I4DD 3G5UA 3T1TA 4I1OA 3E0NB 4BFTA 1M8PA 3EXAA 4D4MA 1CR1A 1UVSH 1JWTA 2NOAA 4B3CA 3U6KA 1T31A 4WIAA 1KLJH 2PBRA 1G4UR 1GI7B 2QPOA 1SQAA 2J41A 4ZDIA 3BN9A 5HM2A 2FO9A 1GHYH 4Q4HB 3QWCH 3GQBA 4TWWA 3BTME 4I1SA 4IW3B 1A82A 4TPIZ 3SV2H 2ZSEA 3NH6A 2PWXA 4RZXA 2D8WA 2C93B 3B23B 1JIRA 3FYHA 1LQEA 1BOQA 5CMXH 1OIWA 2PKAA 2NWNA 3QNUA 3RVBA 4X2XA 1YR6A 4MRRA 1BB0B 3KCGH 1HH4A 2EU8A 1KTTB 1W4RA 3BTGE 2CVFA 5GADl 3GOVB 2ZU5A 1YYY1 4TLEA 4N0DA 1EESA 1AKEA 4UNSA 1K1MA 4D9RA 1TA2A 4MH0R 1ESAA 1TNGA 4O3UA 2AH4X 1DFPA 1E34B 2OCAA 3IILA 3DMNA 5DIFA 4G5GA 1MKXK 1DS2E 1P9RA 821PA 1ESNA 1I2MA 5EW1H 4K8BA 4WXVA 2GRJA 3RABA 1S4QA 3FP7E 1NIPA 4MPUA 1MO6A 4YESB 3SU6A 1VCPA 4DDVA 2QF0A 1NT1A 1EP6A 3GEIA 2XZPA 1KJYA 4G01B 1I2DA 3FFBA 4Q9IA 1EATA 2RGAA 1P3EA 5EQTA 2OC7A 1AQ7A 2VWLA 5SZIA 2EI6A 5LPRA 1RD3B 3L0SA 2QNRA 4KAXA 1BMFA 3HDTA 4RZ3A 1O2UA 2WSSD 3IIJA 2JJ2D 4IJMA 3E16B 2HPQH 1J9CH 3L2OB 3GDUA 3GY4A 1AJEA 4WXRA 3M3TA 4TY7A 5JB8S 3P4XA 3FTQA 2WPIS 1CA8B 1MQ5A 2I6QA 3EA0A 1E94E 3MJHA 3UQOA 2A7CA 2WV5A 3ZVRA 1LPKB 2GCOB 1WU1A 3TLOA 3SV7A 2H2ZA 1PJPA 3TUJC 3V12A 2C5LA 1V5WA 2HDNB 1LS1A 1KYIA 1A46H 3RSLA 3SHWA 1GMHF 1NNEA 1YGCH 4V0OA 2NZJA 5AHGH 5AFZH 2IL1A 1LB1B 1XCMA 4LHZA 2RAPA 2HT6A 4QM6A 4FUFA 4K60A 4EPWA 2ZI6A 1GHBG 2C8ZB 4DT1A 4OQXA 4DB2A 2A5JA 1DPFA 2XX3A 4CRBA 1LO6A 2UUYA 1F0UA 1G16A 2BMJA 4Q9KA 3W5IA 5FTJA 4CT5A 2ZRMA 4DLSA 4ZXYH 2K1QA 3PG5A 3CENA 1XDBA 1W46A 1JJ7A 3A4LA 1SB1H 1TNJA 3C41J 1HIAA 2HCJB 5AUQA 5JYIA 1L4DA 1AN1E 2HNTF 3BRWD 2O8EA 3W94A 1ZJDA 3LV8A 1UTNA 3VQTA 2FODA 1GVLA 1C5PA 5B6OA 1CT0E 2IUTA 1UCYK 1FAXA 4BLOA 4O2RA 6GCHG 1HAHH 5F6MA 1RYHA 1QQ4A 4DEYA 4UNPA 3CWQA 4NIYA 1A2KC 1C9KA 2X8AA 1TMTH 3A4MA 1CTQA 5AJZA 1LHCH 1AZZA 1RRFA 1W7GH 1ELAA 3BIUH 5BRRE 1LVOA 3HU3A 1BIFA 3PFIA 2FOLA 3GY6A 1G9IE 1FQJA 1R0ZA 2G5NA 2WKPA 4B2IA 4EPVA 1HJ8A 4MGZR 4JZKA 1GSIA 3FVQA 1GI2A 4I8LA 4JZFH 4PANA 2WMOB 4HLUC 3PM3A 1LF5A 2CL7X 2XNDD 3ZZBA 2GBLC 1TMUH 2Z9GA 4NZLA 5T6GA 6ESTA 3S9BA 1C5YB 3QVUA 2IBMA 2WKRA 4O0MA 2HXYA 4MITA 3EAQA 4ZDWA 1HRTH 3SYJA 2GVZC 4MTBA 2EEKA 2GKVE 2QP9X 2GJ9A 4C3ZA 3KNXA 1GI6A 4OI2A 4BFWA 4CEJA 3TGJE 2D26C 4E22A 3M5NA 4PX9A 4FXPA 3UG6A 1HEIA 2CHAC 4AFZA 3LH5A 5GJVC 3CONA 3WP1B 5EJEA 3UR6A 2Z6VA 1GHBF 4J2YB 4PO1A 2ZDKA 1E9DA 1SGYE 4XOIA 4D9QA 4UNNA 2BM1A 3BG8A 4DDTA 3RXEA 4AG2A 2B8WA 3N5CA 4BE7B 3ASYA 4HI0E 1TPZA 2NO1A 4K5ZA 1DY8A 4UXJA 1S0QA 4H4FA 1UVOA 4M53A 4PC6A 2AXNA 2BKUA 4Y0ZE 1TQDA 2PZEA 4D8NA 3C14C 4LJ4A 2B7DH 2IS6A 1KSHA 4BFYA 2IYLD 3AAUA 3A8BA 3GLIE 4K1TA 4DB4A 2EA3A 2Z0MA 1E2PA 1SXJA 1YPGH 1XB2A 4TLCA 3UPUA 3NEJA 1VITH 2VVCA 1L8QA 4B2AA 3MWJA 3UATA 2ZTXA 1TNIA 3VKGA 2BDCA 4Q00A 4KXFB 4WA7A 2GCPA 5EQQA 1M1YE 1XVMA 1D9XA 1FONA 4ACAA 1RE0A 2XBYA 2P3TB 4MA4A 3HYRA 1C2KA 1BTYA 2VP2A 1DUAA 3MLEA 2QA9E 1V2TT 2ZANA 5JJKA 3SJIA 2F9PA 3S7KB 2VL7A 1EZXC 4D80A 2A5GA 3EPLA 3SQHE 4YXWA 4R7ZA 1Y3YA 3A1UA 2ZUDA 1GVNB 4ZCMA 2WSSA 2ODNA 5EXNA 3ZGXA 1NVVQ 2BYAX 1XD9A 5IF9A 6GCHF 1DWBH 1Q3XA 2Z4SA 3AVYA 1R8SA 3WYFA 2G0NA 2TIOA 3CO5A 1XMIA 4RD2A 2B8TA 1MTWA 2EFHB 1JR3A 1YRAA 2CHAB 3HATH 1NC6A 2UZ3A 1YKTA 1V3XA 3AVZA 5J4VA 1Z28A 5DG6A 1ZTJA 3KFXA 3CX8A 1O3JA 1P61B 4C0AC 1G3QA 1YZLA 2CDNA 1VJAU 1MRSA 1SXJB 4M0LA 2GTPA 3TBKA 1M2OB 4FMDB 3KQCA 3VB5A 1ZM7A 3BORA 1PV4A 5UKDA 3I8SA 1HFDA 4ZKNU 5DK1A 1L4YA 1K28D 1C1SA 4HB4A 2FGKA 1PPCE 2VIVA 1GDDA 2C77A 1B0EA 2F9VA 5D3QA 2FPZA 2ZR9A 4NZQA 2J5XA 1P03A 2ZRGA 2V55B 3R9IA 3WMGA 1A1RA 3C5CA 1QJ1B 1KO5A 5JJLA 3QKUA 2NU0E 1R8QA 2A3RA 2IYSA 3CB4A 1UHBB 1NRSH 1CT2E 4Q01A 3GLFA 1JR6A 4RCZA 1AFEH 2BDTA 1DUEA 1G3CA 3T06B 3NDBB 4HUQA 1E2GA 3H0KA 3A4NA 2ORVA 4HDQB 2FSGA 3NKVA 1DELA 4Z54A 4XBDA 2F1RA 2ZSFA 3BB3A 2ZM5A 2VP5A 1L4UA 1YCPK 4PC7A 4V0NA 1VITF 3K8YA 2ILNA 1C5RA 4HSEA 3AF4A 3CX7A 4MQAA 4GL2A 2AX4A 4PC2A 3EAJA 1GBJA 4ZDJA 3RS2A 3D31A 1Z0JA 2ZS8A 1SGPE 1DWEH 3ZD7A 2AGEX 1G41A 2GXAA 4BOHA 2N42A 4X1PU 4M1KA 3UUZA 1G21E 3B82A 3AASA 3IHLA 1VIAA 1B23P 1XUHA 3DMDA 2R8RA 4XFQA 3RANA 4W5WA 1QA7A 1QG4A 3AF0A 4GUXA 1NP6A 2FEQH 4S2EA 5KNDA 2MSDB 5KHOC 4R9UC 3GCTF 5JBTA 3EZ6A 1RJ9B 4TYQA 1BQYA 2CNWA 2JLXA 1NN0A 2PH1A 3RXGA 3REFA 4FWTA 1XEWX 4Q03A 4P4SA 2WWFA 1O2SA 3KQLA 4I8GA 4XBCA 4A6XA 2C8VA 3A87A 5ABWA 2BCGY 3LH1A 3EZ2A 1UKVY 2DFTA 1P4SA 1J70A 5BW8A 3VB6A 4FCVA 4CEIB 1F3OA 1HUTH 1Y3VA 3ZZ6A 1Z3IX 4LBYA 1P2NA 3SFVA 5GDSH 5KDLA 5DI3A 1FFHA 1SVLA 2XJ9A 1TBRH 1TAGA 3BK7A 2FMXA 4JYTA 1DAEA 1QB1A 3TUZC 5LB2A 1AWHB 1ZRBA 3U3KA 3U60B 1OYTH 4M1YA 4PQRA 1MKXH 2XAUA 1ABJH 2FM2A 2OESA 3Q7QA 1YZQA 3BERA 3I5YA 1D3PB 1MBMA 3V7TA 5C5OA 4AIIA 1UK2A 1E2MA 4HAXA 1T8NA 3N2IA 2PTNA 3LY5A 3QI2A 5JMTA 2ZQ2A 1ZU4A 1R0WA 1D6JA 1Z0FA 2FPLA 3MO9A 3AK5A 3SBEA 2BDAA 3PLKA 4TL6A 3MO6A 4DCNA 3K09C 4GSOA 4D25A 4K69A 4LRWA 3MRSA 1QA0A 2EVWX 1E69A 2V6NA 1GITA 1UTPA 2ANCA 3ADDA 4A8JA 1SPJA 2ZDMA 2TBSA 1IXZA 4PPGA 1UVUH 2SGQE 1MTUA 1IQPA 1GP2A 4QNRA 3HKJB 4V0ME 4ILEA 1O2RA 1ZC3A 4PHGA 1BHXB 5L3VA 1S6HA 1U8YA 2DE9A 4ITRC 1AGRA 2XTTB 2VWNA 1P9UA 3PO1B 5C67A 1FUJA 3GCNA 3RMLH 2QT0A 2GZHA 4FMBB 3TR5A 3FZZA 4ARZB 1O32A 1FDPA 1H9HE 2B0FA 4RD0A 3CNNA 4IRUB 5K0HA 2GXQA 5JWOA 3RXQA 4Q7LA 2ZYVX 1Q22A 2JDIA 4IXNA 2H9HA 1DAKA 2GHIA 4Q1AA 5FPYA 2OG2A 4X6NA 1IHSH 2A30A 2QXHA 5C1XA 3H86A 2WIAA 3N7OA 2ZSDA 1VCQA 4SGAE 1GUAA 2XCNA 2QI9C 3KQUA 2CV3A 1P8VC 3RS3A 4HAUA 1N5KA 2ZU3A 2W5EA 4Z1MD 1MABB 1U8ZA 3KIDU 3M0EA 1XU4A 2ODYB 1KDPA 3OEED 1Q12A 3A7TA 5EXMA 2ZFPH 1N6HA 4OS7A 3B1VA 1C2IA 2FNAA 4HUTA 4BTIB 1GVKB 2RGDA 1M7GA 3V4RA 3LAWA 1RIFA 4GP6A 3CP7A 1Q1ZA 4EKDA 3RU4D 3SGAE 3QO6A 5F2EA 5JECA 2CF8H 4LZ1H 4WOPA 1MZDA 4TWZA 4INLA 5HPYB 1D3DB 1YJ5A 4Y8YA 1W4AA 2OFOA 1K1IA 4OQNA 3HGNA 1ETSH 5TCCA 1FOEB 3BAFA 3S1AA 4LJ9A 2BOHB 1PJRA 3SR0A 3DHKH 1Y8TA 2HVXA 2ZFQH 2ZIQH 2YWFA 2RGXA 3K9LA 4M9QA 4MPXA 4CRDA 4XD7D 3OYPA 3VX3A 1C5TA 1O3GA 2HRVA 1M7BA 3E0PB 1AZSC 5KTYA 4M1WA 1PQ7A 3DL0A 1XEWY 2JLZA 1FNNA 1C5VA 2A5FA 3PXGA 4UFDH 4NWKA 4ARZA 4A1TA 2A2ZA 1DPOA 2PJRA 5G40A 1ODFA 2ANBA 1GGDC 1W4BA 1AZTA 3R9XA 2OILA 3QXXA 1RKBA 4U01A 3FP6E 3NBXX 1QRWA 2Q9BA 1YPLH 1E1RA 4NIXA 3CNLA 1GRRA 4ZV4A 2ONJA 1GBKA 4LV6A 4X1SU 1E2KA 3O8CA 1GG6C 5KYKA 2PUQH 1NFUA 1LKAA 4UONA 2IOTA 1SGIB 2ZI3A 4LJ7A 3R8FA 2P6RA 2AR7A 3ZIAD 3TW8B 2QAJA 5TDHA 3PUXA 2H57A 5AVDA 2NTYC 1O5FH 4URWR 1QF9A 3I72A 2FN4A 1UVPA 4PAOA 2O8FA 1ELCA 5DHFA 2R3UA 4RD1A 1HT2E 2ZTYA 4IS5A 3C15C 2OD3B 4TT3A 2VIQA 3WNDA 4KKDA 2OV2A 5FCRA 2QE7A 3CRVA 2JA1A 1MKWK 2O8BB 3PENA 3P8FA 1LDTT 3Q8XB 2V3CC 4A1XA 4ZMAH 4X1RU 4L9WA 3RRMA 1OFHA 3OE7A 2VP9A 2BBTA 2WJJA 2WWIA 3KKNA 3QGJA 421PA 4AFQA 3BFKA 1PPZA 1GL1A 3LXXA 5L6NH 3SZNA 2GD4B 2FTLE 1Z71A 3K9XB 2QSZA 1XPRA 1FMGA 2TRMA 4LV5B 2TGAA 1LQDB 1ZNWA 3AB3A 1XX6A 2FZZA 3QXSA 4X8OA 2ZROA 2ZDVH 2J7PD 3KQKA 2OCPA 5FUXA 2VVUA 4KYIB 3M5LA 1QHHA 2RB4A 4DCUA 2KBEA 2VSOA 3KDSE 1Y5AT 2FOCA 4Z8XA 2JEOA 3QJYA 4PZZA 1IN4A 5HKKD 3E1XB 2J4IA 3TSWA 2EQBA 2VIPA 1JECA 1E96A 1M74A 1UCYH 1VG8A 1XJ0A 2F1HA 1A0JA 1EASA 3X1WA 2FEMA 1D2MA 5SZJA 1TALA 1PPGE 1O2QA 1E35B 2W2VA 2FOHA 1Q20A 4LC0A 1MCTA 2DWQA 1XXDA 3ZVMA 2VWOA 1BRBE 3RS4A 1P7CA 3URCA 3V4FA 1ZMJA 5G4BA 2WKQA 4JS0A 5CHAC 3Q76A 5GPIB 1BYIA 2GZ7A 1C9TA 1D2NA 1GHWH 4TQ9A 4N1AA 1NJFA 2IYVA 2HLDD 4JLKA 2C04A 1ZR0A 2R6FA 3SU8A 2CJIA 1HAYB 1G17A 2RDLA 4AYXA 4KLZA 3DA9B 4E07A 1C2FA 3T5GA 1NFWA 1E37B 4DLUA 2E9SA 2JLWA 1G7TA 4X1NU 1GL0E 4A9AA 2QY0B 4DIHH 1AWFH 4O25A 1JIMA 3H1TA 1T0HB 3OF5A 6CHAC 1CJUC 3IQXA 1DT2A 2EFCB 1W0ZU 1NJGA 4FVBA 4QBHA 1KI3A 1ZPZA 1O39A 1OXXK 2YNAA 3BS4A 2PSXA 1HV8A 4NSVA 1KO4A 3DVLA 3EIQA 1BITA 1EFTA 5CJPA 1ZIOA 3TH5A 4WH8A 5A0CA 4CVNA 4FINA 4YOGA 2VPPA 3I5XA 1BJVA 3AGQA 4AC9A 2RCEA 2IWHA 1BTZA 1SFQB 1G19A 3F9EA 4URXR 5EE1A 4B48A 4XVQA 3EPKA 3T1QA 4ESHA 1XJQA 1C1VH 4FMCB 3IG6B 3K1JA 3P1JA 1P2SA 3QF7A 4DG4A 3SORA 1ZMXA 2ZTZA 1T8UA 4OYHA 1SGRE 1L2TA 3RXUA 3AVPA 1JNYA 1O2VA 5CITA 2H7VA 2FG5A 2TGPZ 2Q1JA 3Q9LA 2PCJA 1TBZH 3OEHA 2Y5GA 4DEXA 4H6TA 1MO5A 4LJ5A 1XKAC 1SLWB 4ZKOU 4KYUA 4GI7A 4HUQB 3I77A 1NN6A 3P27A 2X1VA 2QL6A 2JATA 1C5LH 3P26A 5AWFC 3ZZ3A 3KTAA 2JJ1A 1E0JA 3NXPA 2CF9H 1L2EA 2GJKA 4UFEH 3T1OA 1KYNA 2ZJZA 1DO0A 3QIAA 2FSHA 4ZCIA 2FOGA 4PHTA 2QPTA 4D26A 3EZ7A 1E9BA 4GDFA 5E7MA 1F2SE 3LT3A 3SNAA 4UXIA 3WY8A 4RFSB 1TNKA 1T8OA 4Q1EA 5DLQC 4AKIA 3UWJH 3M5OA 1E1QD 1F2UA 1VPLA 2A1DB 4TQAA 2AKAB 1C2JA 4MRNA 1A5GH 4E7NA 1CR0A 2HOBA 1W5SA 1D2EA 4IGDA 5E4FA 1N2CE 4DT1B 2TGDA 5DP6A 4L16A 2OC8A 2C9OA 4JBXA 4A8JB 3LVQE 4NL4H 1WQSA 1KLIH 1U2RA 4DXAA 4DDWA 4ZKDA 3GMTA 1S2MA 3LX5A 5F9FA 2WJGA 1TE0A 3WMFA 3LGTA 3DDCA 5EGMA 1A0HB 3TIUA 1BTUA 2BB4A 4IW4E 5D3MB 3AVUA 4P4SB 1AE5A 1KDRA
chains in the Genus database with same CATH superfamily
2RFKC 3GROA 3CVUA 1USUA 4EB8A 3KL6A 3FRJA 2E0IA 3G2NA 2ZJ1A 2C7VA 3K35A 4JUDX 4P4UA 1T9DA 2R2WU 2Q3CA 2WHYA 3GDWA 4F49A 1S3IA 1SXIA 3RFCA 3K5IA 2O6LA 3HPRA 1C5OH 3RTBA 1GA6A 2NADA 1UXOA 2PZFA 4GI3A 4KH1A 3V7WA 3ZWAA 2TMYA 3BJRA 3JD0A 4MLCA 4PSKA 5LQAA 1O2PA 5LDHA 4YRAA 1HDGO 3N1UA 3EFEA 4RY2A 4FQ5A 1ZZGA 3JYLA 4MPRA 4UEOA 5EXDA 3ROKA 1TQ7B 1BVRA 2PAAA 3TSZA 4Q3OA 4BNMA 3RXKA 3RHFA 1C50A 6LPRA 1KI7A 3RSOA 4EPTA 1C4XA 1L4KA 1H65A 1KGDA 4PN3A 1C8LA 1MB9A 2RI6A 1L5LA 3MUFA 5EL0A 4GEGA 3SXJA 5KX5A 3MI4A 2CZQA 5G41A 1E3IA 2V4MA 2MT9A 2OQ2A 5DKFA 2NP6A 3V6LA 3HSSA 1CHOF 2XTJA 3THXB 3TNYA 1E89A 1DMRA 3NYRA 1BA3A 3GX1A 4YRSA 3U44B 1JVBA 1CY1A 1ONOA 4TTIA 2XZOA 4RELA 1NGSA 3BTEE 3Q3JB 2P6OA 1D2AA 2JFYA 5EP3A 5SY9A 4M9SA 3S2FA 4UE3S 2V1XA 1TPSA 1NJ8A 3TZKA 2NAFA 2Q07A 4RYLA 2VTBB 5HXFA 4NCKA 1YJQA 4A4DA 2IHJA 1NW6A 1JRTA 1YLCA 1DARA 1LPMA 2AUTA 2P90A 3UREA 2WW8A 4MXDA 1PEAA 4V0QA 5FTKA 3NV7A 3KZMA 4GXRA 4D8TA 5H4GA 1RKUA 3HDYA 3IERA 4WFIA 3FYUC 5DH9A 4QXPA 4YT8A 1SA0A 2C84A 4BLSA 1WR8A 4IO0A 5KJFA 1O9HA 1WZEA 4N6NA 1MFZA 4QD3A 1UDCA 1D3TB 2GCTB 2R60A 1DKNA 3ZNOA 2AMVA 5FL7A 2QKYA 2QVXX 2CNDA 1KNXA 3E27A 3H0CA 3SQNA 1T5LA 4WN3A 3J7AC 5H1YA 1AHTH 1B6RA 5KMGB 4DLXA 1NBIA 2GCIA 3R0QA 3D8HA 4CLEA 2BD7A 2GM9A 1DKOA 1M76A 2BZ6H 4I0WB 3D59A 2AUMA 2ZBPA 3WBKA 2WTUA 2P9HA 2EGGA 4CMBA 2KFWA 1JDVA 1ZY2A 4WTOA 2ZYTX 3B7WA 4MP6A 2PA0A 3CZ9A 1P2IA 3D8NA 1ADCA 1JIVA 3JAWB 5EYPA 4BMYA 6REQB 2BFDB 3EVEA 2XI4A 1VP9A 1E9SA 3GHYA 3M1IA 4AJKA 1F0KA 3MTGA 4CDGA 4DMCA 2EP7A 3O94A 4UE7H 2RAFA 2R62A 4EF6A 3TK5A 1GUFA 1TVCA 2A4RA 2J3EA 4GGOA 2O3JA 4MR7B 1AVGH 1JPNA 3V8VA 2M98A 3VU9B 4B4UA 3GDVA 1VLMA 1Y8QB 2WPDD 4OXIA 2FEPA 4GX2A 5FO0A 3DPUA 2ZGBH 2RGNA 2RJOA 4AKEA 2GZ3A 1EK6A 2C96A 1W10U 2GNAA 1D3QB 4S1WA 2W6JA 2PRSA 2ZTVA 3EGWA 3KKQA 4RTNA 3U61B 3VGCB 1L4GA 3EUEA 3IULA 2COUA 3GCZA 4IFIA 2AMPA 2V7GA 2I65A 4R40A 1DRVA 4YCDA 2J45A 3GGJA 1GQQA 1L7PA 2ZHDA 1T5OA 1XFAA 2XB6A 2A45B 1N2CA 4KX5A 4A0QA 5JATA 2C1EA 3G0HA 3NBFA 4HS9A 4AZ0B 4CG0A 1THTA 1SKYB 5DYGA 1Y6FA 1GI3A 2JNWA 1XM1A 2CE2X 3G7NA 2WTEA 3HXKA 3K6JA 4GVPA 2VZ0A 3ZR4B 2DH6A 2A4OA 4B3XA 5KSYA 2Z9DA 3KR0A 2SGPE 4RFVA 2O0KA 5GTDA 1SUEA 3NKKA 5IVIA 4IFTA 1UXHA 5FJJA 5LDGA 2Y67A