3O8BA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 219
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
219
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus
molecule tags Hydrolase
molecule keywords HCV NS3 protease/helicase
total genus 219
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8bA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8bA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8bA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8bA03
2OHFA 1XCGB 4L4UA 1LPGB 3NVAA 1GHBG 3KFXA 1ELGA 2BC9A 2PKSB 1KI9A 1COWD 4BLQA 5K8TA 2BDGA 2IX3A 1UVTH 1AIPA 1E1RD 1KMQA 3X1DA 2OBNA 2GMTC 1G8HA 4C4PA 2O8CB 5AUNB 4Q5IA 1XEWX 2AR7A 1GVLA 2OFWA 1GHVH 3SNAA 3F1SB 2ZIAA 4IC5A 1ZRHA 3GLGB 3TE6A 1KI8A 2J9NA 3SNCA 2ZUBA 2X2EA 3ZYEA 3PROA 2WHXA 1YCPH 4Z1MA 4ZCMA 1NT1A 1ZSLA 2ZSAA 3PIRA 1NM6A 4AIIA 1V2ST 2QSZA 2UUJB 4B34A 2JLVA 1P8VC 3H86A 2HJGA 1IN7A 1HAPH 1JR3E 1SZPA 2BZ6H 1KJZA 4TMZA 1Q44A 1WBBA 5C67A 1W2KH 1N5KA 5JS8A 3ZZ3A 1ZNZA 4SGAE 2G8TA 2JEOA 1HH4A 3O8RA 3SUDA 2VGCC 3KHVA 5C5NA 5BN3A 3MI4A 2Z9IA 2F9MA 4Q02A 5HXFA 1XZPA 3JZMA 1TTTA 5LDDC 4LV8B 1P9UA 4IDNA 3TJVA 4AGJA 3O8CA 1ZINA 1AFQC 5EQRA 2BLOA 4Q7JB 5E7IA 5FOTA 2QPTA 4OK3A 1O3CA 4MDSA 1YR9A 5AUQA 3KN2A 4XVQA 4MDEA 1MKWK 3AM1A 5GDSH 1PQ5A 1W49A 3RXBA 2R0LA 1PPBH 1MKWH 3RXFA 3RXJA 1UBEA 1ORFA 1JRTA 1QF9A 3I72A 4TY6A 2CDNA 5B64A 1AE5A 1W0YH 1IQGA 1K1PA 3RAPR 4GL2A 3V0XA 4D7GA 1YM0A 4LRWA 1XEWY 2GCTC 3PB1E 1H8EA 2ZDLA 5TB5A 3B9QA 3QF7A 4IVRA 2XC4A 5FOSA 3C41J 5EP3A 4KLZA 1U0HC 2VHUA 4AKEA 2FI4E 3RXQA 1W4BA 2GJKA 2JJ8A 2ZE7A 1FUUA 3E90B 4Q1EA 4JLPA 4QBFA 1T3LA 4KSCA 1O2RA 1A1RA 1US8A 2ZI4A 3MG9A 1S6HA 4RI0A 1AQUA 1ZHRA 1C4Y2 3M61U 4V0NA 3ZYDA 2V35A 3QEOA 2R6GA 3LH1A 5FUVA 4CR5A 4DW2U 2FFBA 4HB3A 2ANCA 3ODDA 1ZUNB 1DX5M 4ACBA 2O8WA 2BDAA 4IW3B 2FU5C 1GMHF 1K1JA 1LO6A 2FM2A 2VWOA 5FTNA 3BH0A 3VB7A 3KKQA 4NMMA 4XDEA 1E34B 2ZE6A 1G4AE 2A0QB 1CBWB 5E4FA 2V8OA 3EWAA 1I2DA 3FZDA 1GDDA 4ZXXH 1DO2A 4X1SU 4EFLA 3FAOA 1F2TB 1QNJA 4KGAA 5C3NA 1CJTC 3G82C 3C27B 1BMLA 2QC2A 4PAOA 2CHQA 1ZTJA 2H9HA 2HF9A 3KTAA 1K28D 2PW8H 4I8LA 3LQQA 2XTMA 3URDA 3UREA 5HR5A 3L0PA 1XDBA 3QTOH 3UTUH 1AZZA 2V0BA 5FXLA 5J4YA 1TMBH 2CLCX 4Y7AA 2BLVA 3RS2A 5HM9A 2DE8A 4FMCB 1SI5H 1KY3A 2F6RA 1SBWA 3E6PH 1Y3AA 4NCYA 3WYGA 3KQCA 3IIJA 2QGNA 4C0BA 5DP6A 2Q9BA 3Q9LA 3THYB 1ZVQA 4ZROA 1RKBA 4NCNA 4WZBE 1VR1H 4TQUS 2RGBA 1UO6A 2W6JD 3QTVH 5FUYA 5C4MA 1AFEH 4DLZA 5LBIA 3OSYA 1O30A 3RXIA 2XXLA 1XJCA 1FTSA 4LHZA 1BBRE 1COWA 1KXAA 4DDVA 1H8ED 4QG7A 2ZU6A 2CVHA 2AD5A 4PPQA 4ILEA 4JLOA 1HIAB 2OQUA 2OC1A 1L8QA 2BDCA 1BRUP 1ANDA 4X2YA 1VCNA 1C5WB 4LPSA 2IXEA 1W48A 1SL3A 4DEXA 4V0LA 5BN4A 3BTFE 4GOXA 5DN6D 1N6XA 4ON9A 3CS0A 3GY4A 3KX2A 5JZVA 3AF2A 4RCYA 1CU1A 4I8HA 1D6RA 4WMFA 1Q3TA 5FL7A 3QUSA 4EPYA 3C5HA 3D3QA 3U61B 1C1QA 5FBQB 1GI5A 3GLFE 2V3CC 3RWOA 5E3HA 4I81A 3I61A 3EZFA 3HU1A 2ZTZA 1GBLA 2XZOA 3VMFA 1BTWA 2YWGA 5DK1A 4XE4A 4V0KA 5G41A 3L33A 5LB4A 2D2DA 4FUJA 1HFDA 4PO1A 3K0AA 1N6PA 4PSAA 1YR7A 2A4QA 1AN1E 1E2KA 3WMFA 1G19A 2R44A 1IQJA 2ODBA 3FMFA 2P67A 1AUTC 4YLUA 4YMUA 3W5IA 1V2RT 4D0LB 3EE0B 2D3WA 3FMOB 1ABIH 1O2QA 1O5GH 3ZZ5A 3EC2A 4DSOA 1EAWA 4MQAA 1FZQA 4X1NU 2EFEB 2J7PD 2J94A 5F9FA 4G5GA 1YYY1 2F9NA 3KXIA 1ZM2A 1WU1A 4D2IA 2R2MB 2ZU5A 2VSOA 1QRWA 3EQ0H 3ZVDA 3E0NB 3THXB 1G3DA 2V55B 5C2ZA 4CEJB 1V2KT 2WPHS 4C9BA 1DBSA 1E2PA 1D3PB 4JK6A 1R0YA 2WM9B 4Y0YE 4I31A 3UG6A 2GJ9A 4MRVA 1GSIA 1KTTB 4D4MA 1QG4A 2EI6A 1TQDA 1M8PA 1HIAA 3RXOA 1P2OA 2IL1A 4XBDA 5IT5A 5BYJA 5BRRE 5BYKA 3DMNA 3KL6A 1O2WA 4MG3A 1SGYE 2WJHA 1P05A 3C15C 2YC2C 2Z4RA 2WUBA 2LNCA 1A0HB 2BOVA 3B82A 3ASZA 1OH5A 2ZDAH 7GCHF 2O8EB 1QGFA 2IA5A 4KVGA 1LPZB 1O0DH 1GBKA 1TGTA 2SGDE 3TAHA 1O3GA 4B71A 1AVXA 2Z94A 5ESBA 3SYNA 5C4GB 3N70A 3EPJA 4OKSA 4BQSA 7LPRA 2MSEB 3UOUA 3KQBA 1Y5BT 4P0TA 4UJ5A 5EE5B 4INKA 3B78A 1G3MA 4QBHA 2OCAA 5K8LA 2N42A 2H1LA 4M2LA 2CMKA 2OCYC 2AMQA 5T6DA 3UNQA 3ZVNA 4BTIB 2LWIA 1D2EA 4V0OA 1E69A 1A0JA 4X2WA 1YQTA 2XCFA 1XP8A 3NXSA 4A1FA 1DOJA 1GBDA 1T5LA 3PTBA 3LRPA 2HXSA 1MOZA 2IYZA 4TMVA 1UTOA 5EZ5A 4MPUA 2IUUA 2GX4A 1VGCB 4CH2B 1MTWA 2BQ6B 5EXPA 4URVR 2KB0A 1OP2A 4TWYA 4GSYA 1NVVQ 4JLKA 3SFZA 1WSSH 1NRRH 5EXMA 1Z0AA 1BTZA 2RGEA 4MQBA 1K8RA 2GEDA 3CKLA 1ZMXA 1SSXA 4DVGA 3EASA 3FHCB 1ZMJA 2G5VA 2BD8A 4DDTA 1IXRC 4CVNA 1W12U 1BZXE 4DGJA 4IKEA 2B21A 2FMJA 4MGZR 4TPYA 2MSDB 5DI9A 3RC5A 4AKGA 1P2UA 3QVVA 2I6QA 2V6JA 1BMMH 1A2CH 4CH8B 2E9SA 4II7A 3GPLA 3HK3B 1EOJA 5GCHF 4Q7KA 2ESTE 3ZVMA 5FCRA 1G8GA 1HE8B 3T06B 2ZDVH 2F9UA 3U1IB 3PMHB 1LS1A 4K1TA 5DI3B 3RRZA 1OWDA 1FOEB 3QG1A 4OHVA 2WKRA 3IEUA 1O3EA 2PLRA 1TOMH 1U0LA 3O47A 5JI3E 2IHYA 1W14U 3AVYA 3RC8A 4Y8YA 3LDAA 5FOWA 4PO8A 1TL7C 5JWOA 1DAFA 4XWKA 2HUPA 1C2DA 3T27A 3ODFA 4G01B 1FUJA 3MWYW 2OC8A 1HAVB 3LC3A 4B2BA 1O33A 3MNCA 1SHKA 2Y8EA 2ODNA 4JK5A 1XPOA 1RTFB 5L3QB 1H9HE 2R2WU 1RXPA 5DYGA 1UDXA 4HLUC 4X1RU 1GKUB 1EFHA 2HXYA 4M1MA 1DFPA 2V7QA 2BD2A 1JAIA 2A3RA 1S6FA 1O3NA 1NC6A 2WWFA 2D7CA 7GCHG 3X2SA 4FUIA 1LHGH 2ZTXA 3PO1B 2OZEA 3OEHA 3H7TA 3P70B 1QL8A 4HYYA 3K0CC 9LPRA 3QDZB 3HDTA 3TLXA 1C2FA 1V2WT 4LYAA 5DN6A 2FN4A 4QRHA 1B7XB 4YONB 4BZPA 1GM5A 2DHRA 2OUAA 3ZJYA 2FLBH 3CRRA 2R2AA 1NY6A 2BBSA 2ZRMA 5GVSA 1HAXB 3S9CA 1QBOA 2FIRH 5KDOA 1Q22A 3AKYA 3MAAC 1O35A 4KFUA 4Z51A 2VU8E 3AUYA 1KXBA 1BHXF 4JL8A 3W90A 1JQLB 2A7HA 4TMKA 4I7YH 4HUQA 4MYCA 4MNWA 3D62A 4K60A 5L6NH 3ND8A 4O9VA 4LGMA 3ZZDA 4D8NA 3SEAA 4FU8A 4RZXA 4OHZA 4PQYA 5UKDA 2FS8A 1H65A 3CBQA 4GNKA 1YZLA 4IDQA 1AB9B 2BDTA 3VTKA 2P65A 1MZAA 1O2XA 3OF5A 4B2LA 1C1MA 5LD2C 1VHLA 4Q01A 1FAKH 1N0WA 4TL8A 2VP9A 1SGDE 4DLVA 1VYTA 2YV5A 1G4UR 5KNDA 3A8BA 2VF8A 4JSTA 1G3BA 3EIHA 3GMTA 1W44A 1AIXH 1MH1A 1KK0A 1MR3F 2QPAA 3PEYA 5FI0B 3OAAA 1PQAA 1JXMA 1DS6A 5E2OA 3SJ9A 2GF9A 3LBIA 2BD5A 1GHWH 1CR2A 2Z5FA 1LVYA 4K1EA 3T5DA 4AB9A 1GPZA 1QY6A 5JHHB 3OZXA 2ZQ5A 4F4IA 1P2TA 4TYQA 1AK2A 3NEYA 2QAGB 1OH6A 1UTMA 2O8CA 1KAGA 4IOJA 4ESHA 4MNXA 2WPMS 2ZS8A 5B58C 2C2HA 2RA0A 3K1JA 5FBLB 3EAQA 1T8TA 3C4JA 1DAMA 4WZAE 3R7WB 5FPTA 3TJZA 1BBRH 1TPAE 2IYRA 4Q18A 2JH5D 2EA3A 4B35A 2GEVA 1P2SA 4RFVA 3SHWA 5FCKA 3B13B 4DWJA 2C8XB 2B8OH 4GCHG 1FLEE 3TSZA 3GYMA 3AP2A 4K1SA 2FOCA 3CX8A 2O9QA 3CPEA 1TQ7B 3FB4A 4INHA 1SLUB 1N6KA 3KUDA 2EVWX 3IHWA 4A92A 2Q0HA 3SGAE 1XPRA 4D9RA 1EWRA 3GYLB 4AD8A 3B9FH 4D0NA 3A85A 3KDSE 4MH0R 3RLFA 2YWHA 1K1LA 3TGKE 3PYHA 1NBMA 4LHYA 3E2IA 3L8ZA 8GCHG 4QGFA 2PZEA 2QP3A 3P4YA 3I4LA 4HZUA 4YZUA 5F8XA 2XNSA 3SORA 4IRUB 3NC1C 1AMHA 5JBAS 1HCGA 4PC2A 3LV8A 1KTVA 2FX3A 4UNRA 4URYR 2SNWA 2RDLA 4AY2A 1CP2A 4M1KA 5FFMA 1W8BH 6LPRA 4UXJA 2ZJAA 1NMYA 1LV7A 1CR1A 1M74A 1EPTB 1D9XA 4HEJA 121PA 4TLEA 1Z6XA 1KLJH 4FVBA 3A88A 3SV7A 2H17A 4XJXA 3TNSA 2EW1A 1HGTH 2IEZA 1HXFH 4NL4H 1O2LA 2O8BB 4ZH8A 4TQ9A 1VITH 1UJ2A 4MRPA 1BS1A 1KO5A 4GCHF 2QXJA 3F0TA 5D3MA 3P95A 4B6EA 4OK5A 4MGKR 1AFQB 3NCLA 1UEIA 2GK6A 5KTYA 4XSKU 4D25A 5EE0A 2PUQH 2R9PA 3PUWA 3CX6A 3K9LA 3W8RA 5GJCA 4BZXA 4ISIH 4WZ6A 2EFDB 4HAVA 2B0FA 4BRUA 4CZ2A 3SN6A 2QY0B 4MTBA 3WHKA 3GJ4A 6GCHF 4DIIH 2OLJA 4RFSA 5L2YH 4JMYA 3UPUA 3LGYA 2OBMA 3OEEA 1HRTH 4ASUD 2ZYWX 3AVUA 5HZHA 1BMFA 3LGUA 5H8WA 3MO3A 4OI0A 1Z22A 4B2CA 2GF0A 1QCPA 3AVPA 2IF0A 2AS9A 1WQSA 4O03A 1A4RA 3BFKA 2ONKA 1RIWC 4S35A 5IK2A 3UOPA 1O3DA 2IEYA 2JKHA 4OQFA 2V6IA 1YRAA 1C4U2 1N25A 1KXDA 3ONWA 3EIEA 4A6PA 1NRSH 3M7UA 4B3GA 4C30A 2GDJA 4Q1AA 3MSXA 2QENA 1OT3A 2QMEA 3KB1A 3LPRA 2VHQA 1XMJA 1GFIA 1EOLA 3D23A 5BPEA 5FPKA 4EPWA 1AU8A 1E9AA 2SGPE 3E1SA 1YPEH 4W5JA 3SE0A 2JA1A 4OS7A 4G5SA 4TLAA 2H5DA 5GIBA 3M7QA 2GCPA 4R98A 4DT1B 1V2MT 5E0HA 4RD4A 2PLFA 2RGXA 3ATKA 2NO1A 2J9RA 4I1UA 4I8GA 5DP5A 2TGAA 4E7RG 2QRNA 3ZZAA 2NO0A 3ZZ8A 1MBMA 5AJZA 4DY7B 3HYTA 4DB4A 2NG1A 3TVJB 1VCIA 1GBHA 3PG5A 1TADA 4GMDA 2OINA 4LUCA 2AFQB 4MGIR 2ZFTA 2AFHE 3V7TA 5A2MH 3QZRA 1LHEH 1GI4A 3SS8A 1O87A 4O2LA 1P02A 4B75A 3R0FA 2FDCA 5JDUB 4YLQH 2UZIR 5JEEA 3UUZA 4C3ZA 2ZO3H 1FZZA 4MUBA 4IXMA 3HWSA 3REGA 4RD6A 3P20A 2PZFA 1XCPA 3WMGA 1RD3B 4BTTB 1ZTLA 3RS3A 5JI2E 2HV8A 3GJ8A 3NHBA 3CF2A 4X6PA 3MU8A 4UFEH 1J9CH 4BRWA 1O2YA 4ZO4A 1NMXA 2BEJA 5AUOB 3GLHA 3RXDA 4AG1A 4NFEA 4FN5A 1CEEA 1HUTH 1OFHA 3AQ4A 1P3JA 3QVUA 1TQ6A 1XKAC 4FU9A 4JT2A 4Q80A 3BJIC 2AN9A 4Y8XA 4IDHA 2NO6A 3PLBA 3Q3YA 3I32A 4LJ9A 4A6XA 2JJ2A 2IYLD 3AVZA 2AGGX 3IGFA 1KY2A 3RU4D 4GPTA 1KTSB 5EOKA 5L30H 4DCUA 1BTUA 4MGYR 4A8JC 1ZPBA 4YOIA 5H4IB 2OCBA 1GDNA 3JZ2B 2XZLA 1KI3A 1GRRA 3A1VA 1JBUH 4YOJA 3SQWA 4BNRA 2FFAA 2PX3A 4HI0E 2ZU1A 1G21E 5E2PA 4D9QA 1HLTH 3NWJA 3QEJA 1E1QA 1NVXQ 4RZ3A 1QHHB 3IITA 4C2TA 2ZRNA 2IYWA 1JEEA 4CEIA 3IG6B 4AYWA 4HDCA 1XTIA 2GXSA 2RAPA 3BB3A 1CQQA 4NONA 4FI3C 3RXGA 2VVCA 2DWOA 2XX3A 4AG2A 3W3ZB 1L0ZA 4RVCA 1BCUH 1CLUA 1DO0A 3N2IA 1DDJA 2FESH 1E37B 3A8CA 1V2VT 3FKSD 4FXGH 2KI5A 3DHKH 2IW3A 2J41A 5SZJA 2GHIA 1IQIA 2IC5A 2CE7A 3R9WA 5C18A 1QJ7B 1TOCB 3WBJA 4ZKRU 4A8JB 1WYKA 5A0FA 3M0EA 1QB9A 1W11U 4XD7A 1JPNA 3HATH 3MWLA 3OIUA 1FI8A 1GBCA 2IK8A 2O52A 5CDFA 1EX6A 1IAQA 3BTTE 3A1TA 3PENA 2ZHWH 1E9FA 3VU9B 1WRBA 3TUJC 3SHCH 2XTZA 1P0SH 2B7DH 3QX5H 1MRSA 3MH6A 4P4SA 1IHSH 1CJMA 4LBVA 3VNUA 1W36B 5H70A 1PLJA 3EA0A 4JYBA 1C1UH 5JSZB 1OH8A 5LPRA 4X8HA 2V54A 3OU0A 4L16A 4TLDA 2ZSDA 1V2LT 3CIOA 2SGQE 3A7VA 1YBWA 1HDTH 1OS8A 2OO7A 1PYTD 1SGQE 1BDAA 1VITG 3OAAD 2J5XA 1NG1A 4EFMA 1P04A 3FDIA 5HKKD 1BIFA 4CT5A 4A1TA 5IHPA 4FIDA 9ESTA 1UTJA 2P59A 4W5HA 5DP9A 1GJDB 3A7WA 1Z0DA 4MITA 1VCQA 3MOCA 5JRZA 3VHXA 3B6EA 1GCTB 4JVSB 5DE3A 1NNEA 3RXCA 1OP0A 3SC3A 3DT0H 2GCOA 1VZQH 3LH5A 1TGSZ 3LFUA 2ZGHA 3FHTA 1TNKA 3G5UA 2GTPA 4OQMA 1P11E 1U94A 5KPDA 2H57A 1A3EH 1BTYA 1V3XA 1QDEA 1PVOA 4D0GA 1UBGA 2Y81A 3T29A 3U7EB 1NTPA 4DHEA 3AASA 1ESNA 2Y5GA 4V02A 4RD2A 3M6AA 2UUFB 1X1SA 5AJXA 3KXLA 1CGHA 2QF3A 4KKDA 3MNBA 1C5RA 3LAWA 4ISLA 2AL7A 1THRH 2ZRFA 4UFDH 5LPEA 1E4VA 2FFHA 4NBSA 3D49H 1AM4D 5AFZH 2OBOA 4P3YA 1OH7A 4L15A 3FZZA 2OV2A 3HJNA 5AHGH 1ZAKA 2ZUDA 1C2IA 2PZGA 4JL5A 1S84A 2FV8A 1BBRK 1A7SA 4C0SA 1ACBE 2ZF0H 1A5GH 1MTSA 5CJPA 1YZUA 2FX4A 1E2EA 3KQUA 1E79D 1A82A 1ZC4A 5TARA 2OCVB 4IFBA 4JYCA 5FPYA 2WWGA 4EJSC 3KJEA 3F5FA 1MKXK 1G16A 4Q4LA 4I8KA 1ZNXA 2ZJYA 4JZEH 2ZA5A 4M21A 2F4LA 1HAHH 2J0QA 3IBGA 1BB0B 1XMNB 1QRXA 1IY1A 1JIRA 4MUAA 4NA7A 4ACAA 2Z3EA 3U8TH 1F2UA 3BIVH 1N2CE 3SV9A 4ZHMU 2W2XA 3OE7A 3GFOA 4EAQA 1F0TA 1W4CA 4DURA 1CT0E 3TMKA 2FPMA 3H1TA 2BVXH 4G1UC 5SGAE 2PCLA 3FMIA 4J2YB 3VB3A 1KDPA 4URWR 2ZI2H 3RXAA 1RVDA 1RRFA 5A0CA 2LKDA 4OBEA 4YXWD 2YJTD 5KSPA 1EESA 3UNRA 4U02A 3TH5A 1LTQA 2FO9A 1Q21A 1TIOA 3SU4A 3E5HA 1C5PA 1QA0A 1MMJN 5EUQB 3K70B 3B85A 1GJ4H 6CHAC 4IHQA 4DSTA 2B92A 4G5QA 1O2ZA 2R9VA 1TABE 4X8UH 2G1JA 2GZHA 1KI4A 1BRAA 2BY7X 1F6BA 5AWFC 3AP3A 2IYXA 4JKYA 3P92A 3ND9A 2DFKB 4DOQA 4LYHA 1TX7A 3NEJA 1N8OB 3A4LA 3PITA 1SQ5A 2Z9LA 5J4VA 2UKDA 1GRNA 3QPWA 3TNFA 4ABYA 1P4SA 1SQTA 1EJAA 2YOLA 2CV3A 1A4WH 2IUSA 1NMZA 5C46F 3GICB 3AKEA 3QJYA 1H4WA 5IDVA 3BFVA 2Q9AA 2VIQA 3S9AA 1TNGA 1O5EH 1GMHG 1KJWA 4C0AC 4X2VA 1GHYH 1CGJE 5EQTA 1HV8A 5JBCS 2XXAA 3EA8A 4UFGH 1MQ5A 2H5EA 5JSZA 4ZHLU 1DUEA 2OD3B 1RTKA 3QOFA 1YU9A 2WMOB 4Q21A 3FVFB 4BAOB 5KDLA 4FUHA 1SKQA 4BPBA 3SQXA 2DWPA 1MTVA 5CITA 3I5XA 8ESTE 2AGEX 3SZNA 3F8TA 2BTCE 1U98A 3K0FA 2WPIS 1PLLA 2GILA 1UKEA 2F55A 1TRMA 3IBYA 2ZQ2A 3ZIAA 4Z0KA 3MJHA 3LX5A 5L8VA 1Z8GA 2ZAMA 3GJ0A 1IQMA 4Q2KA 1W3CA 1LF0A 1P6XA 5GJWC 6Q21A 3E70C 4LOYH 5FL7D 3F9GA 4PHHA 1OOKB 1GNQA 1ZGVA 3K70D 1MQ6A 4B3CA 2ORWA 4BFZA 4QGGA 4I33A 1XPUA 1CSOE 421PA 1NRPH 3BS4A 4UD9H 3LBNA 1J2JA 2P95A 1E9CA 3IWMA 3ELAH 4E06H 2C9YA 1B0UA 1DADA 2FWWA 1S5SA 2EI7A 3PWCA 3B8HA 4Q4AA 2GWHA 1K1IA 1ZYOA 5B30A 1NFWA 3IPXA 1SVSA 2JETB 1MTNB 1UVPA 1CA0C 1UKVY 1MH0A 5DPAA 1C1NA 1EB2A 2ZR7A 1F3OA 2Q3MA 1Q1QA 1MKYA 2KAIB 3RXKA 2H9TH 3NC0C 5TDHA 1E38B 2OXSA 3DKPA 3U3OA 4YTAA 3FHOA 2ZWLH 4WH6A 4TMTA 3K0AB 3TGJE 1C1OA 2Q6FA 3MHWU 3FVQA 1TWXB 4HLQB 3GP8A 4YC7A 3A86A 1NVWQ 2WJGA 3E3TA 3W94A 1J16A 2OUKA 3JZ1B 2PT5A 4R71A 4YMVA 2CCGA 3VQTA 3AF3A 3PUZA 1D2NA 1OKKD 3QI2A 2IBMA 2QGRA 3QZQA 1GDUA 2C8YB 4FUEA 2A4GA 4PFSA 2J87A 1ZUIA 1XBTA 1JQJC 5CYPA 1K5DA 2P6RA 4X2XA 3VFDA 1BIOA 2PJZA 1W7AA 1Z0IA 3FMPB 1P10A 4IVPA 4JJZA 2J1LA 2WWHA 4K46A 2GAOA 3A84A 2FOFA 1KY9A 1NRNH 3PVSA 4CEHB 2CJWA 2YNBA 1RYHA 2WWXA 4MKIA 3U8RH 1XD8A 4UE7H 5FTJA 1CR4A 1TU3A 1KIGH 4GOKA 1L1NA 2Y80A 3GCTF 4YMSA 1GIAA 3A4MA 1GJAB 1VPLA 1RTLA 1C5SA 3SOSA 3TIUA 1KNXA 1G18A 3P26A 4M7GA 1JXPA 1HAOH 3BORA 3UMSA 2R65A 1XZQA 1D4PB 4FU7A 1RFNA 1ZJKA 1XTQA 1T91A 1UVSH 2R8RA 5HCIA 4BECA 1FQJA 1SGCA 1GITA 1R8QA 2D8WA 1FTNA 4KV9A 3WRYC 3GY2A 3K9GA 2XNIA 2ZYUX 4KTCA 3QXCA 4AG6A 4AFUA 1F0UA 3GJXC 1AWFH 2IWRA 2CK3D 2H2ZA 1W7XH 4WOPA 1DLKB 4NIVA 2P6NA 1G3RA 2WV4A 2WICA 2QP9X 4NG9H 2RCEA 1JOUB 3QKSB 2AMPA 3ZZ9A 2UZ3A 1O2PA 2CBZA 2W83A 1BMNH 2F9PA 4CRGA 4BGDA 3DM5A 1CE5A 5CK5A 1T3SA 4NYIR 2QXHA 5HTKA 2KBFA 3B7GA 1GVNB 3EWSA 3TITA 4Q1CA 2ZECA 4ZI2A 4CT4B 2UVQA 1P2QA 2C9OA 3ZLJA 2OC7A 3EPLA 3LVRE 3LQRA 2F1JA 2P3TB 3RXRA 5KO2A 1CA8B 3B1XA 3H4MA 3QUMP 4BFXA 2GZ8A 1I4DD 3KUCA 3LWNA 3U9AH 2FEOA 1AA9A 1G9IE 3U7GA 4Z6AH 4JBYA 2GJSA 1KAOA 1WTGH 1HQCA 2NO9A 3UQOA 4W5WA 3SV2H 5EZ6B 1A1VA 3AVTA 1HJ9A 3UG7A 1Z6AA 3IO5A 2B7BA 4X8OA 2A31A 3ZIAD 3VR6A 2W26A 1HTWA 3KXKA 1MTUA 1LY1A 1ZNWA 5I25A 2HYDA 1NIJA 1L4ZA 4MKGA 1SGNE 1ESAA 1THPB 4W9MC 1BRBE 2OQ5A 3ETLA 3I8XA 3URCA 1SLVB 3SU0A 1C2JA 2VBCA 1AKYA 3TJOA 3A7TA 4WXVA 4B74A 4FMBB 4E22A 2QM7A 3TH2H 1ZUHA 2HGTH 4JYTA 4X8VH 1FP6A 2WIBA 2BMJA 1XEXB 2BVNA 2C03A 2GXAA 4M53A 1T4VH 3CP7A 1GHXH 3KQDA 4BFSA 1S0QA 1PPZA 4UONA 1US8B 2C77A 1UVOA 4K5ZA 1JNYA 1XTKA 3WNCA 3VB4A 3GEHA 1RRGA 4Y0AA 3BF6H 1KLIH 4JBWA 4I32A 1SKYE 1P12E 4QJ3A 1XMVA 1ZMLA 4EQ6B 1PUJA 4V0ME 2GK7A 1O2NA 3MU4A 1YLDA 2B8WA 1BOQA 4UEHH 1ZSJA 1QZXA 4FCVA 4RJLA 4PSKA 1KMHA 1NJGA 2IYSA 4JLMA 4ERNA 1FXYA 3FOZA 3QSYA 4XTRA 2FOEA 1TALA 2HT6A 3MFYA 2ORIA 4XWOA 3EIQA 2UUYA 3NBZC 6ESTA 5TMPA 3DPUA 4AC9A 1VCMA 2BLWA 3TLOA 1DY8A 2W6IA 1AVWA 1ELFA 1P2KA 2ERXA 4CRFA 2GGVB 2RA3A 2JASA 1E6CA 4QL3A 3OFNA 1ZGIA 4M9FA 2BBOA 2C4FH 2Y5HA 1XXHE 7ESTE 3GCTG 3TK9A 3WHLA 1KSJA 1MU6B 1GKYA 1SLWB 3PMAB 1TMKA 2AIPA 3H0KA 4TYNA 4EFNA 1ELTA 3LBHA 4JLNA 1ZC3A 3SU6A 2YINC 4QGHA 4F4JA 1M9UA 1EFRA 3SI7A 1Z8JB 2AXNA 1XUKA 3A8TA 5C1XA 1G20E 1N0VC 2ZJBA 2Q3HA 5DO9A 5KDDA 1ZD9A 4BLSA 4HUTA 1DAKA 4IN2A 2DR3A 3KQHA 1G7CA 1YR8A 1SC8U 1ZOMA 4XSHA 3OE7D 2RG3A 5FBWB 3Q3XA 2BLQA 3QKSA 4AB8A 3T28A 2BMEA 2P94A 5DG6A 1CKEA 1OYTH 4M1YA 4Z54A 1N6OA 1SVKA 1VG1A 3SU2A 2PSXA 2ZGXH 1MT0A 3LT3A 1TPSA 4J0QA 5CB8A 1KK3A 1SQOA 5CHAC 5EPYA 4V03A 3C5CA 1DICA 1KI1A 2PX0A 4KYIB 1XXHA 4DB2A 1OX1A 3SHAH 2A5GA 3EYDA 1K21H 5B6OA 2WINI 4JVLA 1NLFA 1IOZA 1E9DA 3ZVFA 2QE7A 4M0LA 1H1BA 2G51A 2QAAA 1C5NH 1SGPE 1KK2A 4ASHA 2ZP0H 2H18A 4M9XA 2RCNA 2ZKSA 2C04A 3EC1A 2BY5X 3KQLA 2ZFFH 2QNRA 3M5OA 4GHTA 4M1OA 3UR9A 1XD2B 4D6PA 4HTCH 2HLDD 1CVWH 2NQ2C 2W00A 1T7CA 2OK5A 3NHAA 2R3YA 2D4HA 1HYQA 3VKGA 4FUFA 2IT1A 1PPGE 3OIVA 1S4QA 2WVJA 4R2HA 4Q7XA 3RLWH 2BX4A 1QBKC 1NP6A 1F5RA 3ZGXA 5JBQA 2P3SA 3HKJB 1F5NA 2EEKA 1YHNA 1GBFA 1P9SA 3AKDA 4DCDA 5H68A 3TUIC 1M1YE 5BN5A 1DAIA 1V2QT 1WP9A 1LVGA 3WRXC 3MMPA 4KYUA 3L3TA 4OI2A 3AUXA 7KMEH 4MRNA 3QNUA 1WE2A 4AK9A 2CK3A 4Y76A 3EZ2A 1AHTH 1WA5A 2ZU3A 1A5IA 1CA0B 5B2ZA 3RRMA 4AYTA 3LX8A 1DY9A 1GI2A 2BVSH 1KSNA 4KCGA 2RKOA 1E79A 2GRJA 3SNEA 1TEVA 2ATVA 1AWHB 2WYGA 1HURA 1XFAA 4TL7A 2ZCHP 3N7OA 1DUAA 1OF1A 2BDIA 5TVKA 4PAMA 5GNDA 3MMGA 2BCGY 1IM2A 1IJEA 4GZMA 5FR1A 2QP4A 5J4HA 1DAHA 2B8TA 2GP9B 2JLXA 2ZETA 3KFVA 1LQEA 4URZR 4CGZA 1I4LD 1F5KU 3OIWA 1O2SA 1YZGA 4RY2A 1QRAA 1MO3A 4F38A 3E0PB 3EX7C 3GY3A 2IS4A 4BFUA 1CO7E 2QTHA 4CDGA 2F1RA 4RCZA 3CM0A 4B47A 4YDHB 1AKEA 1ANEA 2JLRA 2TPIZ 3MWIU 4JLJA 1E4YA 2F3TA 1HY3A 1UBCA 1MUEB 2BIFA 4BXSA 3KF2A 3W34A 4WH8A 1G5PA 2PCJA 2Y5FA 2H16A 5LPNA 4TTRA 1UM8A 3NWUA 1X8JA 1FW6A 5EXLA 4E05H 4WY3A 3AAUA 5G3ZA 4DXAA 1N6HA 4Q9JA 1AQ7A 1N5LA 2XYAA 1GWAA 3ASYA 2BY8X 1GGDC 1J14A 1G5RA 4FUGA 4EKDA 3UMFA 4NYMR 2H1UA 1BJVA 2HYIC 4FMDB 2HALA 4PR0A 4JLBA 2OEPA 2PMKA 1DEKA 2CMYA 4AORA 3X1ZA 4KXFB 2WBLC 1E2DA 1QVRA 4TL9A 4DSUA 1OXVA 3RXMA 4YT7H 1SXJD 2XNDA 2PJRA 1GVZA 3KKPA 3DMDA 1XWIA 1W1WA 4MKFA 1TGCA 4H1VA 2G0TA 5IYTA 4M9QA 2WPJS 2KBEA 1EP5A 2VP6A 4S2EA 3T1TA 2ZSBA 4WIAA 2A5DA 5J4KA 3ZVGA 2EWWA 3VGCB 2ZEJA 1SVIA 4IOKA 5CM9C 2UWPA 4NFFA 2XTNA 4WXIA 3SFVA 3V4FA 3HYRA 1UFQA 4O3UA 4UNQA 1LF5A 4ABGA 4BOHA 5ETXA 6CHAB 3B60A 1K1MA 4U2WA 1D9IA 4NKRA 4MVNA 4ISHH 1O39A 3VXEH 1NN3A 1JEDA 1R10A 4BFVA 4N3NA 4LXBH 1HYLA 1CBUA 3RMMH 1UK4A 3NDPA 3AGQA 2OILA 1GJ9B 5HM2A 2ZRLA 2HNTF 4HZIA 2V1XA 3Q3JB 4BEJA 4BE7B 4R8TB 1E2QA 4JZKA 1P9RA 5DSZA 4JMPA 3ZH9B 4R7ZA 1HT1E 4OQXA 1IQHA 2J95A 4AFQA 1Z6JH 1QHGA 2FSFA 3KL4A 2P16A 4D80A 1A61H 2CL0X 3EA7A 1W0KA 4HI3A 3FWYA 2QF0A 4V0MA 4PO9A 5AJWA 3TNTA 3KKOA 5L2ZH 4QKQA 1LHCH 3FP8E 2XW9A 1TF5A 2I3BA 2ZPRA 2P8OB 2EQBA 3GLIE 3GY6A 1EKBB 3H84A 1WBDA 1PPEE 2A30A 4O97A 4KHZA 4ZIRA 2VTKA 5GPIB 4LZZA 5A0AE 4MYTA 1RS0A 1PJPA 3B5JA 1HJAB 2QE7D 1ZBDA 3BG4C 1ZM3A 3CONA 1A3BH 2NO7A 2ASUB 1C1YA 3SJZA 3EZ9A 1EJMA 3GY7A 2C98A 1QHXA 2FP7B 2NOAA 3K6YA 2ZDNA 4YESB 1ELOA 4DIDA 3QKTA 1AD8H 1MBQA 4QGAA 3KNXA 4CEHA 3M5LA 4X0WU 1E9EA 5EE9A 4AYVB 1TUIA 2F9LA 2OBLA 1DVRA 2XSZA 3IIMA 4K8BA 1PZNA 3PLPA 1Z2AA 1VGCC 1TX4B 3QN7A 4OJQA 3F9FA 1UADA 3STJA 2WWWA 3GCOA 4F49A 3X1WA 4HDOB 3VAAA 4JZDH 1IN4A 3BSQA 3B1YA 3ATLA 3M36A 2Q9CA 2CE2X 2H8KA 3V00A 4OK6A 1DLEA 1R7RA 4TSFA 1V2UT 2ZC9H 1Y3WA 1J17T 4K8OA 5EE3A 2VSXA 2QU8A 4CEJA 4Q1BA 2FYQA 4MLFB 4D4LA 1QHSA 3C8UA 3LKWA 3BBPA 3KEEA 3E1XB 1TPPA 4P32A 1J99A 3RXEA 1HB0B 2QRZA 1KDQA 2CHGA 2F3RA 5K7RA 2Z9JA 3ZZ6A 2WSMA 1SXJE 1IXSB 4DDUA 4PZZA 4MDFA 3DA9B 5JMTA 3MLEA 3CRW1 4BLRA 1C9KA 3LO5A 1T32A 2OLGA 2I6SA 1JRSA 1QHNA 4MPVA 4Q9IA 1Q3XA 1B23P 1UCYK 4NCJA 4TMWA 4M1TA 1FL9A 4W7SA 1FX0B 5KNCA 3K6ZA 3PUYA 1QVAA 3RSOA 1TLDA 4IDOA 4DBLC 5A0BA 1UEJA 2SGFE 2BEKA 2GV6A 4MRRA 3K53A 1Q0UA 2O8DB 1GBEA 2BB4A 1DWEH 4LV5B 3SYLA 2WPLS 3A1UA 2BY9X 2FTMA 1Q12A 1U8ZA 2C3SA 4PAQA 4AURA 3RC3A 1P06A 1KO8A 3AVXA 4Z1MD 5K8IA 4Z8XA 3SJBA 3RLYH 3MO9A 1G17A 3QPVA 3PQCA 4FCWA 4HDQB 2A5KA 1ZYUA 3JVVA 3PV2A 1U0JA 3RP2A 1GDQA 1L7VC 1WXQA 1P7CA 3ATMA 1EZSC 1RRKA 3IO3A 4LWZA 4DLRA 1O5FH 2IUTA 3EXAA 1C1RA 1AI8H 1DS2E 1ID5H 3RU4E 2VF7A 2Q6DA 4DUGA 1EZUC 3P27A 4QM6A 4KODA 2ZFQH 3TSOA 3EAJA 4ABJA 4NDZA 4HATA 2GVDC 1FNMA 4LJ7A 1EAIA 3VEQB 5LH8A 1B0EA 3LJJA 1TU4A 3UWIA 1F48A 1CJUC 2AEIH 1M6NA 4RKEA 1N6LA 1ELCA 2IWHA 2JDIA 2Z43A 1NN5A 2IYUA 1RIWB 2ODEA 2XOKA 5FPSA 1HE1C 1YPJH 1M7BA 4OI1A 3RYTC 1QBVH 4QM7A 2JDID 2XBVA 4PC1A 3SBDA 1AGJA 1W2HA 2NGRA 5J5CA 1K9OE 2GDEH 2R3UA 4CEIB 1UTKA 2OCPA 3CH4B 2QV1A 3VKHA 4EPVA 2QBYA 1K2I1 4UQOA 1LVMA 3GDSA 4IDPA 1FQ3A 4N1AA 3FPAA 2QN5T 2RHDA 1UK2A 1D6JA 2FEMA 1OWIA 3ZZ0A 1W10U 4PX9A 1MKXH 2A78A 5TCCA 2JATA 2YNAA 2P2LA 4CRWB 2OC0A 2XNDD 1JR3A 1XXDA 2QAGC 2GV7A 4BWYA 1E2LA 1EFCA 1JAHA 4IXNA 4TWWA 3VR3A 2PEZA 4HAZA 1Q31A 2P5SA 4YLGA 4FMCF 4ZAEA 2NU0E 1G7TA 4QBIA 1UAAA 1Q20A 4SGBE 2VP2A 2QXGA 4OYHA 1II8B 2A7QA 1XUJA 2THFB 1JALA 1IQKA 1GJBB 3M7TA 1ODFA 2Y7ZA 3QO6A 2CHAB 5J4LA 5IRCD 4NZQA 1PQ8A 1R5OA 1YCPK 1Z63A 1G2MA 3ENSB 2BD3A 1C5UA 4B6FA 3VX4A 3K8YA 2H6MA 2Z3DA 5G4BA 3Q85A 5FX6A 5JJLA 1B5GH 1Y5UT 1C1TA 2XSZD 3MU1A 3SU8A 3BH7A 2C99A 4PSVA 1L2TA 2YVUA 4ABIA 2WUCA 1GAJA 3K65B 1NS3A 1KI2A 1VITF 3RS7A 2BMDA 1NJFA 1PFXC 3LNCA 3P8NA 4DVAU 3BTGE 3NIBA 1QA7A 2GKSA 4NYIQ 1BTPA 2GJ8A 3SU5A 3K70C 1E3MA 1H8HD 1HQYE 3Q3KA 4OHWA 5EJEA 4LC0A 2M5TA 4AKHA 2CL6X 4JT4A 2HEIA 3HGPA 3UK6A 4FMDF 5FH9A 4JVNA 4Y8ZA 1LB1B 3C7KA 1U8YA 3VXFH 4OGXA 1T4GA 2VA8A 1W36D 3U60B 5A09A 3CO5A 5CYOA 3A81A 1FUKA 2WJVA 2F43B 5JB8S 2AH4X 2I4IA 1O5BB 3KJHA 2ZHEH 1UTQA 1X8LA 3PFIA 1ZCBA 2XC5A 3FFBA 4BFWA 3ITIA 2ZGJA 4A9AA 1CXZA 1KO4A 2Z83A 3BH6A 4XVUA 3TJNA 1KIMA 2OXRA 1OHHD 4Y0ZE 2H92A 1M7GA 4Q4HA 2QZ4A 4TYWA 2G0NA 4RFSB 3DOFA 2QBYB 3PUXA 1DWDH 2AYWA 1VG0B 3GFTA 4ZDKA 2FOHA 3FP7E 1E2IA 3IEVA 5JJIA 1OIVA 2IS1A 1LQDB 1AQYA 3CPJB 1W46A 1C2KA 2YNMA 5CLLA 2D06A 1II0A 2JLYA 3GY8A 2ZU0C 2ZXUA 4R9UC 4FXPA 2W2TA 2XRCA 1C1VH 2JGNA 2O8BA 4F4OC 4FUDA 1Z8RA 2FSHA 3QXSA 1OB2A 1Z29A 2GT7A 2J38A 1R4AA 4C0KA 2XTTB 4KI0A 2A5AA 1C5YB 5KSOA 3VPKA 5KYKA 3BOSA 1PPHE 1HJ8A 3Q5DA 1C1SA 1CRPA 1CHOG 3NTUA 4D4KA 2DFLA 1SGWA 1IXZA 3F6UH 4NPHA 3BGWA 1KDOA 3LGIA 4H6TA 2D1JA 1QHIA 3D8BA 3LJOA 5L3SA 2VIOA 2BXUH 4KBGA 1WBGB 1DPFA 1XD2A 1E0AA 3DVLA 1ZNYA 1FX0A 1LNZA 1P60A 1Z6EA 2HCJB 1Q1ZA 2J7KA 1GJCB 1ZW6A 2REXB 2FS9A 1GCDA 2IXFA 1W36C 5C5OA 1T8NA 1Q2WA 1TF7A 5T6FA 2QPOA 4F91B 1SGFA 3O8DA 4NIYA 2ZNKH 1E9RA 2O8EA 2ZRAA 3GLHE 4ARZB 1EX7A 3OY6U 3LY5A 1O32A 3NKVA 5J40A 2ZS7A 2X19A 1SOZA 1XXHB 1W5SA 3B9PA 2WYJA 1E2FA 2W0MA 1ZJDA 1W47A 4I4LA 1O2HA 2ZHQH 1DARA 3K0CA 4L9SA 4DLUA 5EP4A 1O3IA 3A1WA 2PUXB 5BXQC 2WV5A 4HSEA 3M5NA 1IY2A 4E07A 2XBXA 1K5GA 1K1OA 1KK1A 1TX8A 1S96A 1GHAG 5JEDA 5BQ5A 3V9PA 3STIA 3PV0A 2J34A 1TRNA 3ZVBA 2SFAA 1MO4A 1QJ1B 2QN6A 4Q66C 2I1VB 1GG6B 1CHOF 2W7SA 2ALVA 1C5ZB 4QFMA 4LYJA 2NPFA 1THSH 1SVLA 1BTXA 1GJ5H 5JJKA 1DE7H 1XX9A 2AWNA 1E36B 1GNRA 2VINA 1S1CA 3SW2B 3QE0A 5T1VA 2L0XA 1KO1A 2VWNA 4L9WA 4B48A 8OHMA 4AYXA 1UBFA 5EQSA 2C93B 3L6PA 3K0FB 1FNIA 1NN6A 1P9WA 4M4SA 3LVQE 2DYKA 1Z28A 2JLWA 5FOVA 1Z6YA 3E8LA 2V6NA 1IAUA 2ZROA 1NFXA 4QJ5A 2LCFA 1G7RA 1BHXB 1ZMNA 2ZQ1A 3TRFA 4TYYA 5IDKA 3GLIB 1CT4E 2GMTB 2WPDA 3QK1A 1C5VA 2BZAA 2OAP1 5J4SA 1BJUA 3GEIA 1PV4A 3I29A 1NLYA 1TA6A 2ZU2A 4LBYA 2ZPQA 1FONA 4OHXA 2IS6A 2UUKB 1O3KA 2OFOA 3RANA 1DXWA 4GFDA 3NBXX 1U8AA 4IVQA 3TGIE 2EFHB 4MNVA 3M5MA 1ZLRA 2XITA 3I73A 2ZE5A 4EUNA 1XNJA 2TBSA 3QKRB 4EJSA 2Z7FE 1UPTA 2VL7A 3RHFA 2D74A 4O3MA 1Z08A 3MU5A 2ZU4A 1EWQA 3P8FA 2EFGA 3AH8A 3RSLA 1X86B 1BYUA 4A4DA 4K81B 1FV9A 3NUMA 3RS4A 2MMGA 1HAGE 2XXAB 2R6DA 1U90A 3LONA 4KLNA 4GLYA 2F1HA 3ZV9A 2Z9GA 4NWKA 4E7NA 2OLKA 2A1DB 3SU1A 1BMAA 4B76A 2R6AA 1G3CA 3JZAA 3DZDA 4Q9HA 1O2GH 5DGJA 4UNPA 5FPHA 3U3JA 1ZM4A 5DH9A 3HU3A 1SQAA 1Z6TA 1LTOA 4HFPB 2QMHA 3ZZBA 1XVMA 4MPXA 5TCAA 2P3UB 4ZKNU 2XB4A 3OTPA 4LJ4A 5E95A 3KQEA 1YLCA 1BH2A 1C2LA 1MABB 4DCSA 2BOKA 5DNYB 4NZYA 1C4V2 4X8TH 4BZQA 1YPHC 4YXWA 4B2PA 1NKTA 3U98H 2XGJA 1OPHB 3T12A 2HPQH 4RKOB 2BM0A 2YYZA 4GI7A 3U7FB 5F9HA 3L0IB 1WCV1 4H1UA 4NE2A 4CRBA 2CNWD 3THOA 4WMEA 2RHMA 2J59A 5FI1B 1J15A 2ZSFA 4M8NE 4B2AA 1QTFA 3TH3H 4WA7A 1LDTT 1T8MA 3RRYA 1A46H 521PA 1D5CA 1YJ5A 4PROA 4LV6A 1DAEA 1IOEA 3RC4A 4AKIA 1D6WA 4P33A 1IQPA 1DG3A 1AGRA 4A0RA 5DIFA 1UKYA 2ZGBH 1E0SA 3T35A 4K2YA 2HDNB 3T62A 1SVOA 3VX3A 2EYQA 1J8MF 1O3AA 2W6ID 3CW2A 4US2R 1X6VA 4RSGA 4TT3D 5HCNA 2OE2A 1NKSA 2ANYA 1NSFA 5J47A 4F93B 3U7HB 4JYUH 1ETSH 5HYOA 1GWNA 2PWXA 2Z3CA 5KU1A 1IQFA 1G3UA 4U7DA 4JCNA 1AZSC 2I1QA 4JLVA 1G7SA 1CIPA 2CEAA 4TLBA 1GHAF 2VH0A 2X1VA 2NTYC 2WWYA 2EFCB 1FN8A 1FPMA 2F9OA 3TR5A 1PYTC 3TR0A 2JJ1A 4XFQA 4LPKA 1C5TA 3UATA 1G6HA 5JPMH 2PT7A 3BB4A 1C9PA 1F0SA 5H1YA 1X1RA 4QHTA 5A5GA 5C1UA 1OKKA 3PV5A 4IEEA 4G5OA 1RC8A 2QSYA 5A4JA 1N6RA 4XD7D 4JLAA 1UVUH 1O3MA 3AK5A 1F7ZA 3UY9A 2BQ7B 2XWBI 5AK0A 3E91A 2YWEA 1IJFA 1KJYA 1XUIA 4OL0A 3GCNA 2B7CA 1J7KA 4IFEA 3GLFB 1O3JA 1VYUA 3PJRA 4ZPXA 2IN2A 2AKYA 4PXAA 1TMUH 2SNVA 3FKSA 4TY7A 8KME2 2P6UA 2ZRPA 2F91A 1WAYB 1OSNA 2C95A 1E0FD 3T1OA 1ETUA 2EWVA 4B43A 3MU0A 2GCOB 2QA9E 2ZI3A 5DISB 4RN6A 3MWKA 2ZVQX 1C1WH 3KIDU 1VIAA 2GZDA 3ZZ7A 1GI3A 4O3TA 1O5CB 2BJWA 4FINA 1P09A 4IMZA 3AVQA 5E7JA 4IN1A 3BC1A 4UDWH 1T8OA 4B1TA 2P0EA 4ASUA 2YC4C 3FP6E 4IOMA 3LLUA 1E0KA 4PZYA 2ZJ8A 1P2NA 2MMCA 2ZRKA 3TQCA 4Y11E 4M1WA 1JIMA 2BQWB 4AYYB 1H8DH 2R0KA 1EZQA 2BD4A 5JBTA 2ZRIA 4TT3A 1ZHPA 4ZHAA 4Q00A 2ZRGA 3SJAA 3GCHC 3LGTA 1EG7A 3A89A 3MNXA 1SVPA 4H9GA 3M37A 3LW8A 1FFHA 1Z0JA 3I3SR 2QYIA 3LXRA 3GEEA 2RGNA 2W7UA 1FDPA 3AF1A 4FD2A 3R7WA 3BK7A 2REOA 1E1RA 2GXUA 3I1FA 3AVWA 1OFTA 1OLOA 5FUWA 4DJTA 4HB4A 4EPXA 2HWLB 5JCPA 2QUZA 2JLZA 1HT2E 3W6NA 4IW4E 2UWOA 1NSTA 5DGXA 1DWBH 1O2IA 2VHJA 3L82B 1LHFH 4NA8A 3AW0A 5HZKA 3OYPA 3NBFA 2JCSA 4ZDIA 2FI3E 4IC6A 5CIQA 1KSGA 2AERH 1S82A 4OS4A 3S1AA 2VP4A 1EUFA 5KNBA 4AI6A 1X7AC 2WPDD 1GI1A 3IUYA 3CZPA 1K1NA 1NY22 2BD7A 1GTVA 1CT2E 2EU8A 1O2MA 1GL7A 4NZLA 2REBA 2GCTB 1UHBB 2Z9KA 2H5CA 1O2OA 1A0LA 4I1SA 3MFJA 1VCOA 1AS3A 1N3BA 2HLDA 3CH5A 1K22H 2GNOA 2WAYA 4Q4AB 5EPNA 4NYJQ 3T5GA 2Y82A 1SHHB 4A8JA 2SGAA 4YOGA 3CLVA 3A83A 3DFJA 5EXXA 3EZ7A 2GCHF 1VMAA 4A0HA 3ADDA 1CF4A 4NYMQ 5TV2A 2G83A 2BJVA 1L4YA 2C8WB 1G41A 2G6BA 4TYPA 2PR3A 5FX5A 4XIGS 1YGCH 2G55A 4D82A 2ASEA 4BANB 2F7SA 3MTYA 3BIFA 3OX7U 2FGJA 4LDJA 2OP9A 1GI6A 2PSYA 4A2QA 4BLOA 2BHRA 5CB6A 1SB1H 2IJOB 3P6ZB 4B3BA 2FGKA 1G36A 4HUQB 2FDAA 2RGCA 3SOPA 3SBKA 5ELXA 1O38A 1P3CA 2OG2A 2VP5A 4BAMB 8LPRA 1YZNA 4PPNA 3QPUA 2STAE 5T6GA 1MCTA 1L4DA 3HGNA 3Q8XB 1M7HA 1FMGA 4WBSA 1TYNA 1ZIOA 4GBMA 5HE8A 1RFLA 3IQXA 4MPWA 4QBGB 2CXXA 4XBBA 4UXHA 3TU7H 2X2FA 1TGBA 3SJ8A 4H6SB 2ZRBA 1ESTA 3W6PA 3ADCA 4US0R 2P93A 2D2FA 3HPQA 4B3FX 3RXSA 4DG4A 2ZTYA 1PJRA 1T0HB 3M3VA 1CBWC 3AW1A 3Q76A 4ZXYH 2R6FA 5F2EA 3SGQE 2JLQA 1C5LH 1GL6A 1OIWA 1DWCH 1BKDR 2E1RA 4DIEA 5EXTA 4AFZA 3CRMA 2DUCA 4LJ8A 1C5OH 1KYIA 2OBQA 5SZHB 3QWCH 3B23B 4D81A 3R9XA 2WOOA 1MCVA 4Y10E 2WZQA 3U3MA 4GHQA 1XD9A 4Q7YA 6GCHG 5F03A 4A0GA 4QJ4A 1GCTC 2J4IA 2FOBA 3M3TA 5FBVB 4HLDA 1O5DH 3A82A 1U2RA 3K9HA 3ZD7A 4WW0A 4CRAA 4XBCA 1D9ZA 1UF9A 3QGJA 4A2PA 4E09A 4QOSA 2A5IA 4INLA 4ABDA 3KCGH 5GJBA 3BTME 1Z2CA 1FY5A 3OEHD 1GBMA 3RMOH 5KHOC 3T1QA 3D65E 2NU2E 2GKVE 2W5EA 2V1UA 1LFDB 2VB0A 3UIEA 1OYYA 3QQ5A 1HAVA 3U44A 1T6NA 1QJ6B 1WUNH 1PLKA 3SGBE 3WBKA 1JR3D 3ZYCA 4N0EA 4WXRA 1ZRBA 3RABA 3MRSA 2RMKA 1J90A 1BYIA 1R2QA 4BTUB 3VGCC 5CIWA 2PTNA 1ZJ6A 3VR1A 4YT6H 3SO3A 3CR7A 2A4OA 5GXPA 3CZQA 4YDSA 721PA 2K5UA 1R8SA 2VVVA 1ZPCA 3RS5A 2PV9B 5L3VA 5GWZA 1RJ9A 3G0HA 2VIDA 4JKIA 3TJUA 4UKDA 3QBTA 5JRJA 2TRMA 1RIFA 1X3SA 3LXXA 1LPKB 2XB2A 1EXFA 1R5BA 1ANCA 3M1IA 3TK6A 4PC3A 5DHAA 1Z1IA 4CBNA 3RM0H 1BRCE 4WXPA 1QHYA 5EQQA 3R8FA 2VSFA 4FW9A 4P4TA 1XUHA 4OS5A 2ZPSA 2QG6A 2D26C 3EPKA 4J1YA 1P01A 1AZTA 4IEIA 3EA5A 4QXAA 3BTKE 4PZLA 2KJQA 1ZD1A 3CNOA 1QHRB 4WWYA 3U2QA 4O0MA 3V13A 5HPYB 3CNLA 1YZKA 3PCRB 1QG2A 4KFTA 2B5TB 3OESA 1ESMA 1O31A 2VWLA 1SMFE 4EJSB 3F3YA 1SHYA 1IQNA 2C5LA 2JLSA 2JLUA 1RRPA 3U6BA 5FAHA 2OT3B 3BFXA 2FSIA 4C0LA 1KNQA 4FUBA 1IHTH 3HP1A 4M1SA 3FANA 5FHTA 4QHSA 5JLJA 2KWIA 1O5AB 3GLIA 2FXRA 1OYQA 2XWAA 3BTEE 2VQSA 2GA8A 4NP6A 5AUPB 2J92A 1ZCAA 1MABA 1NROH 4P4UA 4X8SH 4NHOA 2MSCB 3PUVA 4DIHH 3SYJA 1ZM9A 2DFNA 1T31A 1TFXA 4BAQB 3K09A 3BTWE 3UKDA 1Z8IB 1W0JD 1NZQH 4OS2A 1OXUA 1ELVA 4KITB 1HV7A 2J0UB 1ELBA 1BO6A 3GY5A 4Q4JA 1C2MA 2ZG0H 4HLUA 1VYVA 3ADBA 3FGNA 1VECA 1GBBA 1Z7KA 2G4UA 4ESTE 1B0FA 3UQVA 1Y8TA 2QT0A 4DLXA 3GLGA 3HU2A 1KZGB 5HKKA 3B1VA 4Q7LA 2JH0D 3SU3A 1N5JA 4DRZA 3ZVAA 4OI4A 1OHHA 4N0DA 4LK2A 1FJSA 5E8EH 2PKAB 2EYUA 4NYJR 4QNMA 1X8KA 1UKZA 1JWTA 2H7VA 2W3KA 1R6BX 1FAXA 2PH1A 1TEXA 2O0HA 1ONBA 2SHKA 1UHBA 1GG2A 5D3QA 3T5FH 1TGNA 1GRQA 2QM8A 3QGNB 1SFIA 3LH3A 1JMOH 3WYFA 4CF7A 1OWJA 3RDZA 1INCA 3P32A 1WQVH 2WTUA 4BLTA 1QL9A 4B73A 2RGGA 1DSUA 3LLMA 3TVDA 3B2EA 3UANA 2GZ9A 3REFA 3HPTB 3Q00A 4YO9A 2O8DA 1L1GA 1KKLA 4B32A 2DCUA 1SGIB 3KKNA 3C14C 3QXJA 1V2OT 3A80A 1SGEE 4WVPE 2VNTA 2CCKA 1CULC 1JXOA 3EGKH 2J0SA 2QAGA 3PR1A 4DCVA 1KDQB 3SV8A 3R9IA 4UNSA 2X8AA 2AIQA 4ZCIA 1V2JT 4PTLA 3W6OA 5JFGA 4TZ0A 1YC0A 4AN7A 4PPFA 1J8YF 2QAJA 1KGDA 2YWFA 2A2QH 1W13U 2V4ZA 2ZYTX 3VKWA 4OHYA 2O8TA 5BW8A 2JIZD 3MH7A 2V9PA 2XOKD 1A7JA 4TZ6A 2GBLA 3QY0A 2WSSD 4NA9H 4OS6A 3PTNA 3H5CB 3EDXB 4U5XA 4IJMA 2PLXA 1QIXB 2CXVA 3GFPA 1AN0A 5EXSA 5GCHG 3BTQE 2CN0H 2AXPA 1GBTA 1H8HA 5GADl 4OQLA 4A0FA 1GMCF 1JB1A 3TW8B 1A5TA 3WY9A 2BBTA 2C8VA 1GI7B 3RUOA 4UXIA 1EQ9A 1NIPA 1DT2A 1EFUA 2QQEA 1GJ8B 4KO8A 3TW4A 3GDVA 3L2OB 3ESTA 3K9XB 5F98A 1WOFA 1L1JA 3GLHB 1HUQA 3ZZ4A 1NN0A 3K0EA 3RXUA 4X6MA 2G52A 1EFTA 2C8ZB 2BV3A 1KMHB 5A8XA 1E9BA 2HF8A 3L0SA 2G00A 4LJAA 821PA 1KI7A 2HNTC 3AVVA 3MNSA 1GJ7B 3THYA 3TPIZ 2GAAA 5CDFE 1WQ1R 1LKBA 2OTVA 4DLTA 3PLKA 3Q5EA 4Q19A 2HT1A 4ZKEA 1GNPA 4MYUA 5EP1A 4G3XA 1T0JB 2QGZA 3CS7A 2F3CE 4EQ6A 1P3EA 1S2MA 2FOLA 1NVUQ 4R0IA 3DOEA 2ZRHA 1VJ9U 3DD2H 1TRYA 3CNNA 4GP7A 1AE8H 3R3GB 2G4TA 1P62B 4BEBA 3IDQA 4QNRA 4ABAA 2D62A 3J81k 5DKMA 4HLCA 5FOUA 5TY0A 3P8GA 4OS1A 3PV4A 1VTKA 5ABWA 1FMLA 3IILA 1HEIA 4B3XA 2O5VA 3EPHA 4QT8C 1YPMH 3G01A 1EFRD 4AG5A 1L2EA 5FTMA 3ZVRA 3I92A 2QIQA 5JCZA 4Q9KA 3AF0A 1Y63A 5CHAB 4RKFA 1T8LA 3DFLA 1UJ1A 3IPYA 4RD1A 2GCHG 4RD3A 5T3HA 2JJ1D 1E2MA 3LD9A 1S83A 4X8MA 1AS2A 3MH4A 1LVBA 1DTSA 4DJZB 2FWRA 4MRSA 3SI3H 4POAA 3GJ5A 1KI6A 2R62A 1DE0A 1T9HA 2ONJA 1UMAH 2ZEBA 2QEQA 2ZANA 2AFIE 5DJ7A 4RKJB 2F9BH 2VJ1A 1AB9C 3KTAB 3T26A 5G3YA 2WSSA 1F2TA 3NDBB 1OPXA 4KVAA 2LPRA 1QB1A 3UXMA 2ZHFH 1TA2A 2VWMA 2N46A 2PL3A 3VR4A 1CJKC 1E96A 4GP6A 3LC5A 2WJJA 1O2TA 1Q3HA 2IYYA 2CCJA 1Y59T 2FZLA 3U3RA 5DI3A 2BBWA 1MAYA 1PUIA 1M34E 1O37A 1ZHMA 1T3HA 4DUGD 2J3EA 3THWB 1E35B 1GI8B 4U30A 3A8AA 1OXXK 1IBRA 4LHWA 1QQ4A 1RE0A 5DP8A 4AGKA 1AUJA 4PQFA 2RGDA 1TNHA 4GUXA 3S69A 2PKSC 1F2UB 3N2EA 3P17H 4ESVA 3MGCA 5DO4H 3TUZC 1CS4C 4TQAA 2CHVA 2QL6A 3NZIA 3DHWC 3UWJH 4DDWA 4WAUA 1TQ4A 1GI0A 4KU4A 3BB1A 1KHTA 2W0SA 1KYNA 1I2MA 2IF2A 4MNYA 5K8UA 2IPHA 3F9EA 1GG6C 4THNH 1V5WA 5KSZA 2GDDA 5C1YA 3W3AA 5E7MA 3HR8A 3CPHA 3WXMA 2Q6TA 3NH6A 2G5NA 4TMXA 1GP2A 2Z6BD 2VGCB 3LW7A 1D2MA 4HZUB 1ZU5A 3H2YA 1BITA 2ZS9A 1VCWA 3U4QB 2FMXA 4MA4A 3BEUA 2GTBA 1XCMA 4KBFA 4CYMA 2Q1JA 2VH6A 1P03A 5B57C 3KKMA 4A82A 5TJXA 3SN8A 1MTNC 3B8JA 1F92A 1SULA 2A32A 4D76A 8GCHF 3SBEA 1OFUX 1GL0E 1XKBC 2VPPA 2A2XH 4TPIZ 1TMTH 3EA9A 2AD1A 3FE2A 2G81E 2ZPTX 2H9EH 3BV9B 2FSGA 3OTJE 221PA 4NCHA 4TL6A 3I78A 3RXTA 1YE8A 1YPKH 2AHOA 1TBQH 3IHLA 1JECA 3M35A 1NBMD 2HJVA 2NZJA 5HE9A 1IN8A 2XEXA 3VR5A 1P72A 3F9HA 2O0KA 4LZ1H 1O3LA 3UNSA 4DSNA 2GT8A 4KP0A 3TGPA 3NBYC 2ZCLP 4DCTA 3LGVA 2RGAA 1NN1A 3UMRA 1G2LA 2OXCA 2FYRA 4QC2A 2XBYA 4D7FA 2F9VA 2OFXA 4LHXA 4C0QC 3FYHA 3K0SA 3HK6B 5JB9S 1EZXC 1NRQH 1W4RA 4JBXA 4LY6A 1CR0A 5L3SB 2ZVPX 2D7DA 1GUAA 2AWOA 2CLSA 1E94E 4CIDA 1YRBA 2QORA 4D26A 4FVDA 4FCTA 4XWAA 3SQEE 2EC9H 4EPRA 1C1PA 2FOAA 2DE9A 5EW1H 1R0WA 3SNDA 5DYIA 1Y5AT 3OY5U 2GXQA 3S7HB 4D4JA 4CRDA 1UK3A 3C16C 3KJGA 2XJ9A 5JYIA 1ZZZA 3OFND 2WOJA 1YCPM 2VLIA 2GETA 1BUIA 2ZJ5A 1J8AA 1ELEE 3RVBA 4Q4JB 2PTCE 4F7WA 4AFSA 1G3QA 2WWIA 1WTHD 1YZQA 2EI8A 4KFRA 2Q6GA 1R0XA 5CK4A 3SNHA 4KTSA 2A2ZA 4NSVA 1W5TA 3T61A 1NRJB 1XJQA 1U9IA 4GAWA 3TVTA 4DC9A 2Z0MA 3OHMA 4A36A 1NVVR 3SHFA 4GZLA 2FTLE 4FWIB 2JETC 1QL7A 4A2WA 4U01A 4B3DA 3PXGA 3ICQB 2FFQA 3A58B 2JIZA 4GRAA 2VIPA 4VGCC 3T1VA 1Q57A 1BA8B 3SV6A 3WY8A 1U81A 2VO1A 3BAFA 4BXWA 2YOHA 3BE4A 4LZ4B 4BASA 1SG8B 4YQFA 1Z1JA 1V43A 4BFYA 2WKQA 1N8OC 2A7JA 3SI4H 1GHZA 2ODPA 2QI9C 3RC6A 1P57B 3K9NA 2HLCA 1ZM7A 3HR7A 4US1R 3ICEA 4LJ5A 1VDZA 5E0JA 3BEIB 1AY6H 4JZFH 3QENA 3BG8A 2C90B 2IHBA 2ZJ2A 2J2UA 4KTUA 1XXFA 1MAXA 4E5UA 4A1XA 5L3RA 1G3IA 1S0UA 2CF9H 3I5YA 1RJ9B 1O2VA 3M4YA 1Z71A 1D3TB 2ZJZA 1ESBA 4DT1A 1WV7H 2XAUA 2OM2A 3QG5A 3ATIA 4KELA 3A6PC 3X1XA 4BUJA 2CLDX 4O25A 4RZ2A 2FNAA 4B44A 1UTLM 2ZFSA 1NLZA 4HGCA 5BWMA 1SR5C 3SZRA 1TBZH 1TAGA 2Q21A 1ETTH 3UR6A 1AO5A 4OQNA 2ZFPH 1LS6A 4Q03A 1OV4A 1O34A 4Y71A 3DEFA 4YM9A 3TK5A 3LDXH 4RSPA 3I77A 3L0OA 1O3FA 1EP6A 3ZZUA 1RW4A 2XZPA 1II8A 1XRJA 4UNNA 4LK4A 3RU4T 3CX7A 2KE5A 2ANBA 3ZVEA 4Q48A 3CWZA 3ZQ6A 1TQ0B 5SZIA 4CW7A 1AJEA 1E2HA 1C2HA 2A7CA 4NTZA 2ZSEA 1N6NA 2ULLA 3ADKA 2CNWA 4DKXA 1SOTA 4GSOA 1EXMA 2C96A 5CMXH 2CVFA 4CRCA 1CHGA 1Z3IX 1S1MA 2ZYVX 3W95A 3KGPA 3RXPA 1WB9A 1R0ZA 2P3FH 1V2PT 4U32A 3KB2A 4AX9H 4JZIA 3ZVCA 4MKHA 1AZ8A 3CUEF 1RJXB 1PPFE 5A8YA 1IN5A 4B33A 4HB2A 1HNEE 1L4UA 3RS0A 1F0RA 1SGRE 2ZRJA 3D7MA 3TSWA 3A7YA 2NZ8A 2A45B 4ZKSU 5D3MB 3KQNA 1Z0KA 2ZREA 4Q47A 1GBAA 3BN9A 4ITRC 3MH5A 5AFYH 2VH5R 1IQLA 3H09A 3D31A 5I46H 3QIAA 1NI3A 2OAQ1 2ZI6A 3V3MA 3BTDE 1TUEA 1IONA 3V4RA 1NO9H 4AZ2B 2G3YA 1XF9A 2HNTE 1LCYA 1Z06A 2VIVA 5IF9A 4I1VA 2Z4SA 5AJYA 3T25A 1ZTKA 1A2BA 2W58A 5EGMA 1LVOA 3KQKA 2RGNC 2ALPA 3E16B 4KAXA 1XX6A 2P5TB 4ZCLA 3PO1C 1EPTC 1IHUA 3PEVA 1FY4A 1VHTA 4CR9A 1RZ3A 2LKCA 3CRQA 3EW9A 2ZM5A 1MD8A 3RXVA 2BCJQ 2XC0A 1E0JA 1G64A 2FE4A 1SHZA 3QKUA 1EK0A 1RRCA 1XTRA 1SPJA 1ZSKA 2GVZC 1QBNA 1GI9B 1MRNA 2AGIX 1SXJA 2DY1A 1FPHH 1IY0A 3WYAA 1G3EA 1UCYE 1DAGA 2GESA 2CHAC 2Y7XA 4CHAC 2A9KA 1ARBA 2IYQA 2ZRCA 5EP2A 2TGTA 1U99A 1SFQB 4C2UA 1NY5A 1KDRA 1UTNA 2BMGB 2ZIQH 1RPZA 1C2EA 1BQYA 2ZZUH 2VEDA 5FOXA 2KAIA 3Q77A 2WJYA 2ZGCA 4LBZA 3WNBA 4JVMA 3A36A 1NFUA 1ABJH 4TTPA 4M22A 1QRZA 1SLXB 1OWEA 1KOFA 4CBOA 3GCHB 1LKAA 2NU4E 2ZI9A 1TE0A 3W8NA 2FODA 1VCPA 5AJVB 4XSGA 1GMDF 1CRQA 1XTSA 2ZDMA 3K2UA 1C5MD 1HJAC 1S9DA 2CL7X 1XJ0A 4G5RA 5JWRA 5FBRB 3S9BA 1AS0A 3SQHE 2DFTA 1E1QD 1D3DB 4ABEA 4Q7MB 1KDTA 3RRNA 1OP8A 3EG5A 1YVDA 3VNVA 2P8OC 1O2KA 3U1JB 1HA3A 2D2EA 2OESA 4HAWA 1AKSA 2VIWA 3ZD6A 3FFGA 4X6NA 2FA9A 2QCYA 2DPXA 4JJKA 1O3PB 5EU8A 3O8BA 3S7KB 1TQ2A 3DO6A 4P31A 1S85A 3T15A 2ZE8A 1E9SA 3MO6A 4LJ6A 1QHHA 3BTHE 1DITH 4ARZA 3AEZA 3QF4A 2ZCKP 2ZRDA 1T4UH 4PC6A 3DDCA 5E0GA 4GT1A 1DSTA 4YMTA 5GVRA 4Y6DA 1TNLA 1F2SE 1EB1H 1FIWA 2HOBA 2TGDA 1V6DA 2BYAX 1Y3UA 4LOAA 3X1YA 2NWNA 2A5YB 3MWJA 1DELA 4K69A 3VFEA 3BRWD 1YPHE 2O8FB 2ODWA 3ATWA 2YOGA 621PA 3PWBA 5GJ4B 3C1KA 3DKVA 5F8ZA 1U6QA 1FY3A 2ECKA 2NU3E 3NH9A 2BXTH 1C5XB 4DT7B 1R5NA 3W5JA 2ERYA 1O2JA 3MCAA 2GCNA 4XVRA 2VYFA 1NU7B 4IBLH 2QMUA 1H9IE 4ZUHA 3AP1A 1Z07A 4LCBA 2CF8H 1FQKA 2PKAA 1OXSC 3R20A 3HKIB 2O8MA 1MV5A 4X8LA 3QXXA 3CB4A 2NU1E 4WMDA 1JJVA 2SGEE 2IOTA 4LHVA 3IIKA 2GBLC 1Y3XA 4EPTA 3H7OA 2ZR9A 2F43A 2BMFA 4LX0A 3BWDD 4TYDA 1NL3A 2FX6A 1PPCE 1WDTA 1OSSA 3FFAA 1P2VA 1S81A 2ANWA 4A7IB 4JL6A 4C0JA 1G291 1VG9B 2F1IA 1KXEA 2FOGA 2FZZA 4X6OA 5KUTA 3U4QA 1KO7A 3NXPA 2OSBA 3NK8A 4YMWA 2Y6TA 4K3JA 3AVOA 1UDWA 3BERA 1GBIA 4TLCA 1O2UA 2Q3FA 4GVUA 1NF3A 1DXPA 2ZDKA 2DBYA 1W7GH 3ZZCA 1Y3VA 3EARA 1G8PA 1SKYB 2GEUA 4BFTA 1O3OA 2JH6D 2GVFA 4Y0VA 2B9LA 5FUXA 1KZ7B 1RYFA 2BKUA 2FG5A 5G53C 2AK2A 4KJZA 4A5TS 1TNJA 4LYFA 3UPEA 3D6TB 3FKQA 3BD9A 4H42U 2VHTA 2HVXA 4RD0A 2F83A 1ANKA 3CWQA 4PANA 3SUFA 3VB6A 4JYVH 1JR6A 5LB2A 1YPLH 2GJAA 4Q9LA 3KJIA 4TN1A 2O0JA 1XM1A 2E87A 3SYKA 4JSYA 5HGGA 4DLYA 3TIFA 2WKPA 1G8YA 2QMOA 1YP9A 1G6OA 4Y7BA 2YKGA 5LGOA 2QA5A 4L8GA 3GD7A 4ISNA 4ZDJA 4Q1FA 4GDFA 2WMNB 1GL9B 4ISOA 1D8TA 3S0NA 1OWKA 5AR1A 3UFAA 5DLQC 1QR3E 2DB3A 5DP4A 1AGPA 5JS7A 1GBJA 1Z8FA 4ZMAH 1SVWA 4HAXA 1P5ZB 2J45A 2G77B 1S9HA 1OXTA 2FH5B 1NESE 4BLPA 3PEUA 5F6MA 5FBIA 5K0HA 1C9TA 1TB6H 4ZKOU 3DUXH 3RM2H 4Q7ZA 4NWLA 1YF4A 4FUCA 1SXJC 2BVRH 3UWKA 4TWZA 3HPRA 3Q7PA 1N1LA 3ZQJA 4URUR 3A37A 3A8DA 2PGBB 4DLWA 1F5LA 1KI6B 5CLQA 2BDHA 5FBEA 1W2GA 1LW7A 4CREA 1BMFD 2CGAA 3A1SA 2JJ2D 1XTJA 1YPGH 3KZ1E 1OB5A 2BDBA 2PGQB 3TQFA 5AF9H 1Z0FA 1FN6A 1JI0A 2RH5A 3AV0B 5CJ2A 2PBRA 2QTFA 3UWOA 2IYVA 4ABHA 1DPOA 1Q1BA 5EUMA 3ZV8A 2V7QD 3SJIA 2QXIA 4C7OA 1QQUA 2ZJOA 1GZSA 2IS2A 3SJKA 2G88A 2ZFRH 1KKMA 2PMDA 1V2NT 1TPOA 1N0UA 3CF0A 5LD2B 2ZUCA 5HMAA 1V2TT 4Q1DA 3NPSA 2BY6X 3CF6R 3Q7QA 1OFIA 1T5IA 1CGIE 5LPFA 1Z5ZA 1Z6GA 5F8TA 4NGAH 1C4OA 3B1WA 1QB6A 1ARCA 2ZHDA 2JAQA 1GL1A 1HAYB 1EATA 1P2JA 2TMKA 3IQWA 2QY9A 3PM3A 1OIXA 1W4AA 3RNLA 2A4RA 4MYHA 2C78A 2ANMH 1DVAH 5JWHA 3RDPA 4NH0A 3QXHA 3GLGE 1VJAU 3F68H 3S1AB 5JECA 2N1BA 2YOFA 4G0NA 1ZD8A 2G9NA 1E2GA 2FLRH 2ILNA 2FPKA 2NIPA 1E2JA 1O36A 4GOJA 1M2OB 2A5JA 4WF8A 2QQ0A 3MYWA 3GJ6A 3VU9A 1DM4B 1N5IA 1G8FA 4RZUA 3BIUH 3WNDA 4Z8YA 2GD4B 4AWXA 4F4CA 1G37A 4JLDA 1QURH 2O8LA 2O8FA 1EJNA 3LGWA 1E2NA 4BAHB 4DCNA 3SJOA 2ANKH 1XMSA 3WMEA 1TX6A 3U3KA 1XMIA 1GVKB 3Q72A 1NPMA 2IXGA 1FY8E 1SGFG 1PQ7A 2YHSA 5IK2D 1QFKH 3I62A 5TXGA 2CJWB 1K6MA 1NBME 2VVUA 1P61B 3RXHA 4EDHA 2AX4A 2XJ4A 5P21A 2BWJA 2XBWA 3GJ7A 1AKSB 3N5CA 1FIZA 1G5TA 4ZIRB 1N6YA 1UTPA 3OEED 1TBRH 2WAXA 5EE1A 1XUFA 1GOTA 1XVOA 1TAWA 1OKXA 4PHGA 1DG1G 1WCZA 2VIIA 3MD0A 4JIMA 1S8FA 3L8YA 3CENA 1EAUA 4Q4HB 1FP7A 1W0KD 5ESTE 4ZKDA 2TIOA 2QT1A 3AGPA 3LOXA 1S0RA 4L5BA 2KSQA 2IJD1 1O3HA 2HPPH 1BTHH 4IMQA 5A8ZA 4C0HA 2AK3A 2STBE 1JJ7A 2GZ7A 3TK1A 1ETRH 1S3SA 2A5FA 1OXGA 3CR8A 4IGDA 3P4XA 1E99A 2GZAA 3GQBA 3GLFA 4EIWA 4OJKA 4P4SB 1NG9A 5C20A 1SGTA 4R2IA 1EX3A 2HCBA 5M04A 1S3GA 1ZU4A 4ABBA 1DOAA 2BKEA 4JS0A 4I99A 5EXNA 3FTQA 1P2MA 1TPZA 3T34A 2K1QA 4NIWA 1TNDA 2ATXA 3SNBA 1NU9A 2TGPZ 1CJVC 1U9IC 3RMLH 2FEQH 4H4FA 1Z83A 2J0UA 3SDZA 1KSFX 4NIXA 3PMBB 1SXJB 5EW2H 2RB4A 2V3OH 1TNIA 2ZR0A 4I1OA 1P75A 1ELAA 3K09C 4HZHA 5EODA 1OJLA 1G30B 4XH9B 2BDYA 2DWQA 1MZDA 4NCKA 5KOYA 1UCYH 1TF2A 2WJIA 4NSYA 1XU4A 4U00A 3AKCA 3AB3A 3SUGA 1KLTA 4Y79A 1GMCG 4BAKB 1KXFA 4VGCB 4KSBA 3AF4A 3JVUA 3ZDQA 1ELDE 3WP0A 4C7OB 4ZI3A 3WP1B 3VR2A 2J7PA 5EG4A 3U44B 3SUEA 4A6LA 1ZPZA 2W6JA 3TH4H 3GCGA 1SVMA 2CJIA 4LSGA 3LU9B 1KSHA 2G1KA 1C5QA 1VIYA 2ZTSA 3T2NA 4LI0A 5JHGB 4HAUA 1NFYA 1XEXA 1N6IA 1LHDH 3PEWA 4IOLA 4ABFA 5J4QA 1MD7A 2FPZA 3GJ3A 4TTQA 2Z6VA 5L3QA 3MJRA 4PPGA 3R8CA 3THWA 1W0JA 1MU8B 3U69H 4ZV4A 3RXLA 1A2KC 4NCIA 3ECCA 4LC1A 3SR0A 4FWTA 1T8UA 1O3YA 1D3QB 5AVDA 1XB2A 1YKSA 1EAXA 1ANBA 1Y3YA 1H9LB 1E98A 2WV9A 2ORVA 1FPCH 5B6LA 2HRVA 3U8OH 3QLPH 3MUFA 4UJ3A 4KFSA 1AVGH 5SZKB 1HAZB 1BT7A 3U5ZB 3L43A 4K8YA 1FNNA 3P1JA 1G32B 1EASA 1JBKA 1WXRA 2ZAOA 1FY1A 3BEFB 1VKJA 4HB0A 3TAUA 1EGAA 3LA6A 4JZ1A 3OIYA 4O2RA 4E03A 1P9NA 3GOVB 3V12A 1BOFA 1F60A 1TONA 2BD9A 2VRWA 4A15A 2BX3A 3GDUA 1GMDG 4F92B 3LIWA 1HAIH 2BM1A 5JBBS 5FTKA 2ZI5A 2FI5E 2YZ2A 1MO6A 3A7ZA 4X1PU 2FPLA 1XUGA 2BM2A 1GJ6A 4B2IA 5F3WB 2VHCA 3QKRA 3NG1A 4GPGA 2VP0A 4PQRA 5KSYA 1G1MA 4DEYA 2J46A 1GILA 3BXZA 1IN6A 4X1QU 1CTQA 2ODQA 1IQEA 1ZRKA 3ZS9A 4WJG2 4ZDWA 2AMDA 3ZZTA 4PHFA 3SZEA 5FTLA 4XOIA 2QTVB 3A4NA 1WMSA 1P2IA 1FMJA 3CRVA 5DP3A 1DANH 2BHGA 1II9A 3W9YA 3EZ6A 4UFFH 2UWLA 2V3HH 4TSFD 2W3IA 4AOQA 4A1VA 2B6HA 5CM8B 3IKJA 1GKIA 1ZR0A 4GMXA 4DLSA 2NMVA 5PTPA 1OW3B 5C1BA 4I8JA 3GISB 2XCNA 3RWMB 4PC7A 2J0VA 1ZIPA 3A7XA 3DZ8A 4URXR 3U6KA 1HPGA 1RGQA 2ODYB 5C2JB 4LBWA 1EPTA 1I4TD 3ZS8A 2WPKS 2X77A 2NPIA 2O8UA 4NU0A 3I8SA 2PHBA 5DHFA 1YZTA 1HBTH 4M9ZA 1HXEH 4HAYA 2IYTA 4M9SA 1JPJA 5GJVC 1GHBF 4XTCS 2BOHB 2R6CA 2C9CA 3UIRA 3RMNH 1MO5A 1KXCA 1J70A 3BG4B 1Q1EA 1YKTA 5FR2A 2FOMB 3PMJA 3VHLB 3ZVLA 1G9XA 3TKLA 5KPJA 3DM9B 1Z47A 2PFEA 3A87A 2ZITA 4LJYA 2AKAB 5CE1A 4DZZA 1ZP6A 3THXA 1OYWA 1C2GA 3AAVA 1P73A 1XEFA 4IS5A 4CHAB 1WF3A 5FL3A 4OGYA 2QROA 1H8IH 5G40A 4WVFA 3VB5A 1OWHA 2W2VA 4OM9A 1YR6A 3M3SA 5DP7A 3DL0A 3QBVA 3SJCA 3QF4B 2FF7A 1W0ZU 3P8OA 2FZ4A 4XOJA 4QHYA 1LMWB 3NKKA 1VG8A 1OE0A 2FJUA 2PEYA 2WIAA 1A5HA 1E32A 2ZI7A 4PHTA 1O3BA 3B1ZA 3TBKA 1GGDB 5ANRB
chains in the Genus database with same CATH superfamily
1ZHOA 2OHFA 1HFEL 3HEAA 4PNHA 1XCGB 4L4UA 1LPGB 5AVVA 2PVCA 2PWAA 3NVAA 2RHBA 1GHBG 2ZBQA 4G09A 3PPWA 1C9JA 2OQIA 4K9RA 5DPMA 4CLOA 3QWIA 1RHUA 3HB0A 3KFXA 3ZN2A 1ELGA 2BC9A 3CVVA 2PKSB 4GGMX 3UJ9A 4RT1A 3VISA 3M6VA 3ZKWA 1KI9A 2D00A 5LNK6 1COWD 2NM0A 4BLQA 3TFQA 3AU9A 3V42A 2Q6VA 7YASA 5K8TA 2BDGA 2IX3A 3TK1A 1UVTH 1D3AA 3BJMA 5LWHA 1GPUA 5DSXA 1AIPA 4C6TB 3ZH2A 1E1RD 1KMQA 2A0YA 3DLHA 3X1DA 1P8JA 1XVUA 2OBNA 2GMTC 5B37A 4DJ5X 3RTEA 4DF3A 4BQEA 1F3LA 3OLXA 1G8HA 1GUFA 5E4JA 4C4PA 2O8CB 2H5LA 4B4UA 3K1AB 3Q10A 4UBIA 4DC1A 1GUBA 4KX5A 2WA1A 3IMEA 5AUNB 3EQ8A 4WSOA 5DYYA 2HADA 4Q5IA 1XEWX 3G79A 3HBLA 2AR7A 2BFEA 1BS9A 1GVLA 4MCIA 4PY2A 4TT8A 5TX7A 1FUIA 5DLYA 5FHRA 3L7JA 2HTEA 2OFWA 1RLMA 4XVCA 1GHVH 3M3DA 1H4VB 1KP9A 3SNAA 3F1SB 2JAUA 2ZIAA 4IC5A 1U80A 1ZRHA 2EZ8A 1L9KA 1K86A 2DR2A 1RWXA 3ZNPA 4C3OB 1ZHFA 2GD0A 5COAA 5DJ5A 3GLGB 3VVCA 3TE6A 1KI8A 2C84A 2J9NA 3SNCA 3BCHA 2ZUBA 2CFOA 2X2EA 4O02B 4CETA 5JG7A 3ZYEA 3PROA 2WHXA 1CQJB 1G60A 1GTMA 1YCPH 4PFQA 2FAXA 1DOZA 4Z1MA 2XTAA 1H85A 1K8XB 4ZCMA 1NT1A 2H1VA 4F72A 1ZSLA 3LOUA 2ZSAA 3Q8WA 3BWVA 1NM6A 3PIRA 5EIOA 5KJ1A 3O4IA 3UAWA 5TGDA 4ND8A 1V2ST 2QSZA 4UBNA 4AIIA 3OPVA 1U3UA 1RPZA 2Z3VA 3BD6A 2UUJB 1TM1E 3G0CA 1PT9A 1YDMA 3WFJA 2QN7A 4KPEC 1X1DA 3PDJA 2R8XA 3I3OA 4B34A 3IAS1 2JLVA 1P8VC 3AM3A 1UBSB 4G6ZA 4WN3A 1OGYA 4K0KB 3H86A 2J4DA 6LDHA 4YJGA 1DFGA 2HJGA 3EDRA 4FFPA 4B3TB 5JALA 1IN7A 5LYJA 1HAPH 1JR3E 4YJ2F 5LQKA 1Z4KA 3E8MA 1SZPA 1U5AA 3T3PB 2BZ6H 4Q12A 1KJZA 2X14A 1NBEA 4TMZA 1Q44A 1WBBA 3ZJTA 5C67A 1W2KH 1EVIA 5CDSA 1N5KA 5JS8A 4BEVA 3ZZ3A 5KWJA 1ZNZA 2HM7A 3IP7A 5JY1A 4SGAE 1DX6A 2G8TA 4LMPA 5G0UA 3T1HB 1AH2A 3HB7A 2JEOA 2WYIA 1O58A 4IJQA 1RT9A 2G25A 3B2NA 5L40A 3FOFC 3HG7A 2QF4A 1HH4A 5EVCA 3O8RA 1HMPA 3UGJA 4KQ6A 5CPFA 3SUDA 4YRAA 6REQB 1VKOA 2VGCC 3KHVA 5C5NA 1Z4IA 2OGZA 3STVA 4MGEA 5BN3A 5U9CA 3ROZA 3FXAA 3FOAA 3UMGA 1GR1A 3G8BA 3MI4A 2Z9IA 2APJA 2F9MA 4G1FA 1U3GA 3UWDA 4Q02A 5HXFA 1P1RA 4QJBA 4KGVA 1O5TA 2C7VA 4IIYA 1UM9A 1UXOA 1XZPA 3JZMA 5A6SA 1UUFA 4K2AA 3UCEA 3VNRA 3KKLA 2CKMA 3GMSA 5ALNA 1TTTA 5LDDC 4LV8B 2HQ1A 5ADVA 5KEIA 1P9UA 2HHCA 3N3AC 4JEHA 2IEGA 3NX4A 4XE5A 1HEUA 4U2CA 4F4DA 3HWWA 4ENPA 2OV8A 3B48A 4IDNA 1K75A 4LRYA 3UG6A