3O8RA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
molecule keywords HCV NS3 protease/helicase
total genus 212
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8rA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8rA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA03
1WV7H 2JLQA 4YLUA 4JBXA 4I8HA 3ZYEA 1CGIE 4TY6A 2ZDKA 4ISOA 3AVZA 1VYTA 4M9QA 2H5DA 2R2MB 1J7KA 4GNKA 1XM1A 2ZRBA 2OK5A 1EFCA 3KXIA 1E0KA 3KIDU 1E38B 1AZSC 1H8EA 1YGCH 2CVFA 3J81k 3GCTG 2EYUA 2QMHA 5A0FA 3VKWA 1I2MA 1VPLA 1E35B 5DP6A 2VF8A 3K0FA 1GI4A 1OP8A 1JALA 3QWCH 1OIWA 3OEEA 3SS8A 1SFQB 4XWKA 2IL1A 4FW9A 4Q03A 3KFVA 4ASUA 1UADA 3P95A 5FH9A 1AS2A 3E5HA 1BJVA 2JA1A 1WBGB 1V5WA 3AVQA 2GCHF 1ANKA 1XDBA 3A85A 2ZHQH 4IC5A 3DOFA 4M1MA 2PKAB 2ZSBA 2OCYC 1RYFA 2Q0HA 4PFSA 2XC5A 4A2QA 2WJGA 2XZOA 1TNGA 1K5GA 1NMZA 2FOLA 4V02A 1SVIA 2ONJA 5KU1A 3V00A 1K1NA 3RS5A 1C9PA 1HXEH 4PHTA 2V3CC 2HXYA 2JAQA 5FXLA 1GJ9B 1GJ5H 4RCYA 3AAUA 4F92B 3QXSA 4HSEA 5JECA 1DBSA 1ZMLA 1HY3A 4YLQH 5ELXA 2VVVA 4PHGA 2IK8A 1ZTKA 4INHA 4KI0A 3K70B 4GRAA 2GCPA 3A80A 3BTDE 4FUBA 1KDQB 3I8SA 1MOZA 4ABEA 1R5OA 1S3GA 4L4UA 4PPGA 1O2VA 2QY0B 3FMFA 5H68A 1XUIA 4LRWA 4Y8XA 4PROA 2Z0MA 3IIJA 1C1UH 2QROA 1CT0E 1DUAA 3A8DA 1W36C 2WICA 1O38A 3TLOA 1PYTD 1JR6A 4NSVA 3G82C 1NS3A 1VDZA 3KJHA 1BZXE 4JBWA 3M5MA 4CREA 1Z29A 1MH1A 4X1QU 1EP5A 3TNFA 2BDBA 5LD2B 3QKSA 1C1PA 1XMNB 1TPZA 3ODFA 1U8YA 1ZM7A 3VB6A 1ZC4A 2VIDA 3U98H 2DPXA 1GRNA 1OXXK 2JLUA 3OAAA 1NKTA 1IN6A 2OC0A 3T1VA 4O3MA 4AC9A 5L6NH 3PUVA 3SJKA 4IOMA 2QZ4A 3X1ZA 1EAWA 1BIOA 2GAOA 2BEJA 2WIAA 2ZR0A 1UKYA 3Q3XA 2WOOA 4ERNA 1JXPA 1MTVA 5J4QA 4F4JA 3UUZA 1F6BA 2FOCA 2WBLC 3ODDA 3SW2B 1C2HA 2ZA5A 1XXHB 4XTRA 5FUYA 4B6FA 4P32A 3D62A 4P31A 4E22A 4J0QA 3OIYA 3U3RA 2IS4A 1FQ3A 4IOKA 4EAQA 4R8TB 2H2ZA 1KZ7B 2F3RA 3GISB 2B7BA 4C0KA 4DDWA 3OX7U 3MYWA 4UXHA 2W58A 1YZNA 3PIRA 5DSZA 1NU9A 3KHVA 5DGJA 4IGDA 2NO7A 4H4FA 2EEKA 1HRTH 3SGQE 3ICQB 5SZJA 1SVOA 1H8ED 2NU1E 2AR7A 2IWHA 3W6NA 1W5TA 2OBOA 4XFQA 3CLVA 3UNSA 2HOBA 3ZZAA 4DJTA 2FWWA 3CZQA 4RJLA 3RVBA 1KI4A 1XTIA 2BBSA 5G40A 3O8RA 4OK6A 3H0KA 5GCHG 1EFRA 2GKVE 3UR9A 3FZZA 2EFDB 1VTKA 4D4JA 1WXRA 1NRJB 1Z3IX 4FUFA 4K8OA 2VEDA 3FWYA 3MO3A 1K9OE 2IYSA 1N6OA 2D62A 3VTKA 1U6QA 3U4QA 3K09C 2N1BA 2XZPA 1GHBF 1AHTH 1M7BA 2Z9KA 3LAWA 3E70C 4PO9A 1TMTH 1TGCA 4CRGA 1L7VC 1XXHA 2XXLA 5EZ5A 1XEWX 4DLXA 3TH4H 2PSYA 3Q5DA 1GCDA 4ZIRA 4FIDA 2ZRMA 9LPRA 1IN5A 1ELVA 1LPKB 1IQHA 2QU8A 3BIFA 5AJXA 4AD8A 4X8LA 2F9VA 3PWCA 3B13B 5FTLA 3UMSA 4ZHLU 1AU8A 1XMSA 4KFRA 5LB2A 2PGQB 1NRPH 2ZFRH 1HAIH 4JK6A 1MO5A 3THWB 3D65E 3QE0A 5HXFA 5B30A 5K8TA 4UONA 1SGDE 3RMNH 2I1VB 4W7SA 1XB2A 3E1XB 2CGAA 3BB3A 1KNXA 2PLRA 3KF2A 3SOPA 1AZ8A 1ELDE 4KAXA 3H09A 1S9HA 4B76A 2W7UA 1E4YA 1THPB 2B21A 4FWIB 2A4QA 1D5CA 4IDOA 1E2KA 1G7CA 1O5GH 4A82A 1GCTC 1KXBA 3K0EA 4MYUA 4ZI3A 1KIMA 4UFFH 1D6WA 1PV4A 2UUJB 4MYTA 1P60A 2KBEA 4UFEH 2OFWA 5DN6D 2QE7A 4ZDJA 3RS0A 1TGNA 1H4WA 4XBDA 1Z2CA 2GCOA 1RVDA 4G5RA 1O87A 3OE7D 3U8RH 1O3YA 1EPTB 1UFQA 121PA 1R5BA 3BC1A 1J2JA 2VWOA 6LPRA 1DTSA 2QNRA 4RFSA 5IHPA 5G4BA 3RU4T 2O8EB 1Z0JA 3RXSA 4L5BA 2WIBA 5FI1B 2J34A 1C5ZB 1C5TA 1QHSA 3RC4A 1VIYA 4QGGA 1NG9A 1E94E 1ZPBA 4TMWA 3REFA 1T3SA 3FTQA 5DP5A 3MG9A 1O2YA 4ISIH 2IJD1 1GHXH 1H8DH 4F93B 4LBZA 3VB3A 5AWFC 4FXPA 2VSFA 2NTYC 1UVOA 2BOKA 1F2TB 1Q3TA 5EQRA 4NZLA 1W4CA 2YV5A 4LDJA 1G32B 2R6DA 1C1MA 1ZM3A 3A89A 1TNDA 2FFBA 2XBVA 2G77B 3PV5A 4GT1A 4M1WA 4TWYA 4ZCMA 1XEXA 2PX0A 4G5QA 4INLA 4FUEA 1WE2A 2VWNA 1YBWA 1CRPA 1GP2A 1ONBA 2W2XA 2GXQA 2IF2A 5L3SB 3FPAA 4KO8A 1GI1A 5JLJA 1RIWB 1CTQA 2XSZD 2PL3A 1AFEH 5A0BA 4QNMA 2PUQH 1V2RT 1RW4A 3G5UA 4MGZR 2IN2A 1ZGVA 3U3OA 3E16B 2BBTA 1ZBDA 4Y0VA 3WYGA 1B23P 4D4MA 2WPMS 3NEJA 3WP0A 3AP1A 2V9PA 5FUXA 2XNDD 2P3TB 2ZJYA 1EXMA 1YPGH 2VP5A 3BF6H 1YYY1 3RXFA 4X1RU 3OYPA 2AS9A 2DE8A 3AAVA 1GKUB 5FTNA 4TTRA 4JYTA 2C77A 3QPWA 1DSTA 2CMYA 3QKUA 3KQKA 2RGGA 1OYWA 5FUVA 4RD6A 2XAUA 5GVRA 4HB3A 2OO7A 4CHAB 4YDHB 2Z7FE 2X2FA 1BOQA 3QXXA 4OQLA 2FOEA 1Z07A 1F2UA 5ESTE 1P09A 4CEJA 4I8JA 1Q1BA 2AGIX 3RUOA 3SJ8A 3KTAB 3GEEA 4MYHA 5A5GA 4EPVA 2Z6BD 4DRZA 3LA6A 5C67A 1OH6A 2FF7A 2QV1A 2SGAA 2ZRNA 3U8TH 4K81B 1GI7B 4MKIA 4HGCA 1DWBH 5SGAE 2WWWA 3RXGA 2DFLA 3LVQE 3SUEA 2XTTB 1XD2B 4BUJA 2VIPA 4UKDA 1SFIA 2O0KA 2GVZC 5FPKA 7ESTE 3S1AA 3X1YA 1MRNA 2ZITA 5A2MH 1S2MA 4MUBA 3FMOB 2BDCA 1ZCAA 3A8TA 4FVBA 3SGAE 1O2LA 1XMJA 3NUMA 2GJAA 1O2QA 3MOCA 5DO9A 1NBMA 4LK2A 1Z71A 1O5AB 3EW9A 3KUDA 1F0RA 2FP7B 1C5WB 4NONA 4EIWA 1GBFA 1KDPA 4B32A 3Q8XB 1O2ZA 2PSXA 1G3QA 1IY1A 3LLUA 4BLOA 5B6OA 5JBAS 2ZTZA 2GV6A 1GBAA 1G8GA 1BITA 3AP2A 1QURH 4MG3A 5JBCS 2IS1A 4E03A 1VCNA 2N42A 4TMKA 3A88A 2IOTA 1E2DA 2QTHA 3VR6A 4PSVA 2BM2A 4LJAA 3U6KA 1ABIH 4AYTA 2WPHS 3V4FA 1ESBA 3RABA 2BQ7B 4WXPA 3A4NA 2QIQA 1XKAC 4YZUA 2D7DA 1Z47A 4CRWB 5EP3A 2ATVA 1BIFA 2A7HA 2ZG0H 1F5KU 1A5HA 2AXNA 2REOA 1GNRA 1EX6A 2ZEBA 1G3BA 4BTUB 1G3UA 4Q4JA 3BERA 1ELFA 2NO9A 4IDNA 1FN8A 2RGDA 5EUQB 5T6DA 1TMBH 4WZ6A 5LDDC 3PB1E 2M5TA 1ANDA 2EFHB 2ZJ2A 1EAUA 1F5NA 4GUXA 3SFVA 3EA9A 3CPEA 2A1DB 4ZCIA 2VVUA 2B6HA 3I1FA 2Z9JA 1P9UA 2NMVA 4KFSA 3GDUA 3UNRA 4I32A 1D3QB 2JDID 3U7EB 2F1HA 5FTJA 4LHWA 3MMPA 2DFKB 1GVLA 2ZI4A 5F9HA 5C2JB 1AKYA 3T1QA 1NROH 2SGPE 1VITG 1F0TA 3HR7A 1TX6A 4X8SH 4TL9A 1JBUH 4AIIA 3RXJA 5FCRA 2CHAB 4AFZA 2I1QA 1E2HA 1C5OH 5FOUA 5GWZA 4HUQB 2WWXA 2EA3A 4MYCA 3SFZA 1ZVQA 4IKEA 1CGHA 2ZU3A 3LC5A 2SFAA 1IHTH 1SGYE 1HFDA 1OFIA 2YINC 2ZJBA 3GCTF 3BTEE 1B7XB 4OGYA 3ZVAA 2QPOA 2J9RA 1CXZA 7LPRA 4B3BA 5CJ2A 3F68H 4BRWA 3C16C 3GJXC 1UTMA 3UWIA 4X8VH 2Z5FA 1M9UA 2A4GA 1IHUA 4ABBA 3B23B 3ZZ4A 2HALA 1L0ZA 1L4DA 1E1QD 1M8PA 2ZVQX 2O8BB 1C2JA 2VA8A 2IYUA 4C0AC 2JCSA 1LHGH 4JIMA 5FL3A 3QUMP 4B35A 2ERYA 1MKWH 3NBXX 3ESTA 2J95A 2BY5X 3ZZ6A 2H18A 4D7GA 3UQVA 2J87A 2O8MA 1GWNA 1P02A 3SNHA 4TSFA 2C4FH 221PA 2DE9A 5A0AE 2QY9A 4TQ9A 4ABHA 2CCJA 4MRNA 1WTHD 2O8EA 2I3BA 4Q9LA 4V0NA 3RXRA 3EDXB 4Q19A 3PLBA 2P95A 4QXAA 2HUPA 1A46H 1E3MA 2EC9H 1EFTA 1FQJA 3LQRA 3RRYA 1QL9A 1Q0UA 1VG0B 1ZRHA 4DLRA 1A0LA 1K1MA 1CHGA 1F5RA 1KTSB 5JEEA 4CEIB 5IYTA 2OTVA 3DZDA 4O2LA 4ZXYH 4V0KA 1NN5A 1Y5BT 2D06A 2GCTB 3OEHA 2VH6A 3WYAA 1W3CA 3ZQJA 1QGFA 1OHHA 1DVAH 3KZ1E 2ZRDA 4K60A 3K53A 1ZMNA 3GP8A 4C3ZA 3M6AA 3F9GA 4DLZA 2QXIA 1C5YB 3LX5A 3L0SA 2P16A 3URCA 1Q44A 2ZAOA 2UUYA 4UXIA 1YP9A 4I33A 3SUFA 4ABGA 4E7RG 2A5IA 4QJ5A 4M1YA 2BLOA 1XBTA 1WMSA 4JBYA 1DUEA 1XCPA 5L2ZH 2UUFB 3NBYC 1O34A 3KB2A 3M7QA 2YOLA 5A8XA 1VG8A 3SC3A 1C2FA 1I4TD 1VHLA 3NPSA 2QUZA 3HPQA 1W7XH 1O3CA 4CRFA 4GMDA 1FFHA 1YR7A 1OOKB 7KMEH 2IHBA 3PG5A 5ANRB 1U98A 3HGPA 2CK3D 1L1NA 1ZHMA 5E2PA 3C5CA 1QHGA 3GPLA 4OGXA 4L16A 1E0SA 5BW8A 1CBWC 1G7TA 4TZ6A 1Z1IA 1RRPA 4C0JA 3NVAA 2PUXB 5CK5A 2TBSA 2RH5A 3RC6A 3WNDA 3BTQE 2CLDX 2E9SA 1SVPA 3MH6A 2J59A 1JR3E 1XXDA 3H7TA 3MH5A 4RD4A 2O8DB 1FAKH 2HCJB 1M6NA 1JXMA 1ID5H 2YZ2A 5L3QB 2VIQA 4MDFA 2WWIA 2JIZA 3QEOA 4LJ5A 1ZLRA 1HJAC 5HM9A 5HKKA 1LF0A 1XUJA 1QBNA 2A5DA 2BKUA 5JYIA 3KQCA 4LBVA 1X8LA 2AGEX 4MH0R 1BA8B 5FOXA 2A5AA 1L4YA 4B2PA 2ZFQH 1LHFH 2Y5FA 2C9OA 3UMFA 1KI9A 1UTOA 1EG7A 1Z6XA 5FUWA 2VBCA 1NJGA 3LD9A 2VH0A 3A1UA 1RXPA 2Q21A 1N6LA 2ZYUX 2ANCA 2VIOA 2FMXA 4OYHA 3AVWA 3MFJA 4WXVA 3WMFA 1SHHB 1DAGA 1D2NA 2J38A 3MI4A 1K5DA 2C95A 4V0OA 1IY0A 4LPSA 4D81A 3PTBA 1NG1A 1YKTA 5K8IA 2VHUA 5CDFE 4N3NA 3IPYA 1KDQA 2R62A 3QF4A 5JBTA 2C3SA 2TPIZ 1UKEA 5JHHB 3RXMA 2UKDA 3SV2H 4WW0A 2GV7A 3VR2A 4EUNA 3HJNA 2R6AA 2JETB 2CLCX 4MPXA 1QB1A 2BBOA 4LXBH 2ASEA 5KTYA 4XD7A 4TMXA 3S7HB 1MAYA 4ZDIA 1L2EA 2O5VA 3W5IA 2I6SA 1VMAA 2B8WA 3SZEA 1DT2A 4RSGA 3MWKA 2ZCLP 1QG2A 1ZD8A 1E2EA 1P12E 1UF9A 1SQTA 1TEXA 1XUKA 2WPIS 1D3PB 3NC1C 5J4VA 1XXHE 1JI0A 4KHZA 1BQYA 1UTQA 1DY8A 3ZVDA 4U30A 1M34E 4A0HA 4MPUA 2PCLA 4YESB 4FWTA 3LT3A 2G6BA 1G3CA 4EDHA 1Q1EA 4PC6A 4M1SA 1QHYA 1AE8H 4JYUH 1YCPK 5EE1A 1HCGA 4BE7B 1UBFA 1L4UA 1C4Y2 3TH2H 3TBKA 4Q18A 4H1VA 2ODPA 1P06A 1T8LA 2J7PD 1EATA 4Q4HB 1EZQA 1OFTA 1DICA 3SHAH 1YZGA 5GJVC 4LHYA 3E0NB 4A1TA 1O2PA 3RXLA 4DWJA 1XTQA 2ZJAA 4Z0KA 2EI8A 5JCZA 2BDHA 5AHGH 1YR8A 5AUQA 3PTNA 4YM9A 4US1R 4H9GA 3UR6A 1ELOA 2BD9A 4Q7ZA 2JH0D 4JYCA 1U0LA 5GPIB 1ZC3A 1GKYA 4JKYA 3SUDA 4NWLA 2OC7A 1AO5A 4OK3A 1KXAA 3RLWH 1H8HD 1DANH 1TADA 3BTFE 3P32A 1UHBA 2Y5HA 5EXNA 1VECA 1S6FA 4NCJA 2CCGA 4NG9H 1FUUA 5LB4A 4NCYA 2ZO3H 4H6SB 4A0RA 2IXGA 3CW2A 3IILA 1K1PA 2C8ZB 4YMUA 3U60B 1OFHA 2GVFA 4OHXA 2A3RA 2VP9A 3BGWA 2HF8A 4OS5A 2HGTH 3ZZ0A 1LPZB 2QP9X 3H84A 2LWIA 4E05H 2ZI9A 4NIXA 1HT1E 5EUMA 3P26A 1P62B 1HA3A 1J70A 5FAHA 4LHVA 1J8MF 1U8AA 5H70A 3L6PA 3A8BA 3QF7A 2TGAA 1XXFA 3KQUA 4TL6A 3M35A 1DADA 1CR4A 3MLEA 1CGJE 4C30A 2FOAA 2Z4RA 1LQDB 4PZYA 4LYAA 1AUTC 2IWRA 2A5YB 2QF0A 2ZU6A 5G3YA 4M9SA 4M9ZA 2ZHEH 2E1RA 1FX0B 1UKZA 1KMHB 4JLKA 1CP2A 4QFMA 3RS7A 5BWMA 2BY7X 3VU9B 2N46A 4JL5A 1HB0B 3R9XA 1Z28A 3MU0A 4JVMA 3MRSA 3RDPA 1JEEA 1O37A 1DWDH 3CNOA 4NYIQ 1KKLA 1RFNA 2XBWA 3GMTA 3QIAA 3SR0A 2REBA 1BHXF 4XE4A 4RFVA 4FCVA 1F2TA 2XBXA 2WKQA 5J5CA 1ZP6A 1E2FA 2TGTA 1Z8RA 4Q9IA 3AM1A 1XRJA 1JWTA 3DZ8A 2CBZA 8KME2 2OC1A 3TJOA 2TRMA 1T4GA 1UTKA 3PR1A 4B34A 2AEIH 1LDTT 4ESTE 3EX7C 1CBWB 4IW4E 1KDOA 1UM8A 5AFYH 3RMMH 1OFUX 4QC2A 4I1VA 4UXJA 1YVDA 1SVWA 5AJZA 1IQNA 3FKQA 2H57A 3D49H 4PZLA 1ESAA 4OQNA 3K65B 4OBEA 2W3IA 5DP8A 1GVKB 4JSTA 4F91B 3RC5A 4RKOB 1BH2A 2ZS7A 2Z9LA 2GWHA 3FKSD 3PENA 2IUUA 5HCNA 1THSH 2JATA 2WSSA 5EE3A 4BTIB 3P70B 4ZROA 1A2CH 4LWZA 2C9YA 3IHLA 2GT8A 4CZ2A 3CB4A 3LGIA 1E32A 3ZH9B 3SU2A 3AW1A 1P2QA 1M7HA 1CT2E 3T1OA 3QPUA 2XSZA 1SB1H 4BANB 5LBIA 3FGNA 3PFIA 1EX7A 2ZJ8A 4LJ4A 5F03A 1WCV1 1BMAA 4JZ1A 2J46A 4BOHA 5LH8A 1U99A 1LKBA 4BFSA 1VITF 3TSZA 2QG6A 3PCRB 1V2VT 5KUTA 2AX4A 4DC9A 1K28D 1X7AC 1OWHA 1TNKA 2PFEA 3LWNA 2YOFA 3IEUA 2FDAA 3PROA 4XVUA 1L8QA 2BMGB 1G64A 2VP0A 3RS4A 1C5RA 2GBLC 5KHOC 5ABWA 1MZAA 4ZO4A 1GJCB 1Z8IB 4URUR 1TWXB 1HV7A 1MMJN 3EPLA 2GDEH 4KXFB 5EE0A 2ZQ1A 4P4UA 1UDXA 2ZFPH 1AZZA 3DM9B 3OHMA 3LY5A 2VQSA 1V6DA 1NL3A 3ADKA 2EFCB 3ZZTA 3DHWC 3GJ8A 4ZMAH 3V9PA 2PX3A 1MTNB 2GMTC 1MT0A 4GZMA 4EPXA 4WF8A 3SNEA 4O3TA 3ND8A 1SGCA 1S8FA 4JLNA 2J5XA 2AWNA 3OE7A 4RKEA 5SZHB 3THOA 4PPFA 1QNJA 4QG7A 1O2NA 1KYIA 5EG4A 2XOKA 3SJAA 1PLJA 4FUDA 2EWVA 1P61B 3UPEA 1TF7A 1NN3A 3KJGA 4PPNA 4FUCA 5FPTA 1ZRKA 4FCTA 4GAWA 1NESE 2YJTD 1WF3A 5C1YA 4WJG2 2X19A 2XX3A 2J92A 1EAXA 5JI3E 3SU8A 4A15A 1TNJA 2YOHA 2R0KA 3B82A 3I32A 1FW6A 4UFGH 1C4V2 2O52A 4C0SA 3IO3A 2PZFA 1JXOA 3GCNA 4MPVA 3EASA 3LGWA 1ZSJA 3MFYA 2CJIA 1E2MA 2ZHFH 1C5MD 4URVR 3P1JA 3BBPA 4HAWA 3SE0A 4LBYA 2IHYA 3WY9A 1Y3AA 1OYQA 4PQRA 1UPTA 1W0JA 4D0GA 4D26A 3RRMA 1KO5A 3U3JA 1NIPA 1W13U 3BTGE 1CHOF 1O2IA 3M5OA 5JJIA 1L4ZA 3WY8A 4M2LA 2J4IA 2ZTYA 1KK1A 1MCTA 3N2EA 8OHMA 2SNVA 3BB4A 1LHDH 4NCHA 1XWIA 1HAZB 1H65A 1E0FD 3VR1A 1Q3XA 1KTVA 2VIWA 4A8JA 2IBMA 4AURA 1E9AA 4UNQA 2QAGA 4X6MA 2ZI3A 1BBRH 1NRSH 3PXGA 4DHEA 1HXFH 1GBJA 1G8FA 2BM1A 4EPWA 2G4TA 4IN2A 5TV2A 3E0PB 2LKDA 1UK2A 2ZHWH 1KI3A 1MTUA 4MNWA 1IY2A 5AF9H 3ATWA 1Q2WA 3FHTA 3GLFA 2O8CB 2YWFA 3NXPA 2V8OA 2AKYA 2R6CA 2ZU2A 1KHTA 1QHNA 3S9AA 1DE7H 2IYZA 2R65A 3NH9A 4WY3A 1E1RD 2GX4A 4MKFA 3B2EA 3TAUA 3I4LA 3IHWA 5IF9A 1GHBG 2ZDVH 4BLPA 4B2AA 3EC2A 3B7GA 5K8UA 1ZU5A 1KY3A 1ZD9A 2H5CA 2VHQA 3B9FH 1GG2A 1UEJA 3HKJB 1TNHA 2THFB 4K1TA 4NYIR 3CRRA 2AFQB 4BLQA 4KITB 2W5EA 1E9RA 1FTSA 3WMGA 5JB8S 1IOZA 3CRQA 1JJ7A 4OJKA 1DWEH 1O3BA 4FCWA 2ZJOA 3A84A 1TFXA 4F4CA 3P8GA 4Q21A 1SZPA 1WP9A 2G0NA 3WHKA 5FL7D 2GZ7A 2GBLA 2ZJZA 3JVVA 3PMJA 2QPAA 2R9VA 5EPYA 2VL7A 2A2QH 1QRZA 4IDQA 3T28A 4FN5A 4LV5B 2QXHA 3AVVA 2WUBA 2AH4X 1NP6A 4VGCB 5JBQA 1ELGA 1CU1A 4GHQA 3FFGA 1C1YA 1IAQA 2O8CA 2ZP0H 2ZSFA 1FY8E 3UANA 1TB6H 4TMTA 3SN6A 1TBZH 1MO4A 1G18A 1N6KA 3HYTA 2G3YA 4FVDA 2QENA 1YCPH 2GJ8A 5EXMA 2H9TH 4TYDA 2NZ8A 2XYAA 1BCUH 5CYPA 1NN6A 1EWRA 4AZ2B 3GLHB 1OWDA 2AGGX 1ZHRA 3X1DA 1G9XA 1Z6EA 4HDCA 3FFBA 3PUYA 1TRYA 3KKQA 3MGCA 1SQAA 3A1SA 2WMNB 2K1QA 2F4LA 5C20A 2HXSA 3C41J 2NO6A 2ZCKP 4ESVA 4ZH8A 3OF5A 4OI2A 3NBFA 2AERH 2GZ9A 2PMDA 2RA0A 3EGKH 1BMLA 1GHVH 3RC8A 4JK5A 2OT3B 3UMRA 4X2WA 1KOFA 3LQQA 1X1RA 3LKWA 1N5IA 3R7WB 4TT3A 1O35A 2IYLD 2GGVB 3QG5A 1R0YA 1II8A 4KTUA 1TOMH 3RHFA 1QF9A 5FOWA 4RD1A 2FGKA 3SQXA 2ZI7A 1BTUA 2HVXA 1P2VA 2YWHA 2VB0A 3FDIA 1UMAH 2BHRA 3QEJA 2PCJA 1FNIA 4BFVA 3THYB 3WMEA 1RPZA 1OF1A 1TL7C 2G00A 1QVAA 1OHHD 2F83A 3T12A 3BH0A 3MTYA 1AN0A 3KQEA 2UWOA 3AUYA 4KELA 2ZR7A 5GXPA 2IX3A 2IEYA 4XOIA 3ICEA 4FD2A 3B1ZA 3ZVBA 5T3HA 3I62A 4GHTA 3T5GA 3AF2A 3UTUH 3WRXC 1P9NA 4MNXA 1KI6A 3RP2A 1IQPA 2FZLA 1TQ6A 4GSOA 2JLRA 2OG2A 1FMLA 4HLDA 1VITH 4TTPA 1NVUQ 4KODA 3GJ5A 4NTZA 1DLKB 4X6OA 1JNYA 3SV9A 1SULA 1FV9A 3TNTA 1G21E 2ZI6A 1N6XA 1YPHC 2VWLA 2J2UA 2WJYA 1VIAA 4GZLA 1T8NA 3HYRA 3I61A 5AJYA 3SNAA 4EQ6B 4JYVH 3NG1A 1RRFA 2ODBA 1Z63A 3BFXA 4DSNA 4A8JB 2OILA 3QGJA 3M0EA 3FVQA 3CRW1 1GNQA 1COWA 3PV4A 2ZGBH 2F1JA 1GCTB 3HU3A 1P7CA 1Y3UA 2LPRA 2ORVA 1O3AA 4BRUA 5HE8A 5TJXA 1XJQA 3IGFA 1GUAA 3LBHA 4NKRA 3EPKA 2OLGA 1C4OA 5CK4A 4OHVA 4D8NA 1CR1A 1O2MA 4DLVA 4AG6A 4XVQA 2A7QA 2ZGXH 4G01B 3EIEA 2D2FA 1YPMH 2AFHE 2G5NA 1KDTA 2B7CA 2ZI5A 1GMDG 2PEYA 3U7FB 1SR5C 3CNLA 3SZNA 2ANBA 2IJOB 3SI3H 4J1YA 3VXEH 2HNTC 3TSWA 1C2DA 1NMXA 2CN0H 2ZANA 3Q72A 3TIUA 5FBQB 2DR3A 1E79A 1ZUIA 2VINA 3P8NA 1AMHA 2GZHA 1V2PT 5E3HA 4LV6A 3WNCA 1Z6GA 3RXBA 3TH5A 4KJZA 3DUXH 4IW3B 5K0HA 1N0WA 1C5QA 2GEVA 1JMOH 1TQ7B 1EZXC 4YMVA 1MTSA 1TYNA 2KE5A 2Q9CA 1RRCA 4M8NE 1WQVH 2VPPA 4JVNA 1GI9B 2D7CA 2VP6A 2H8KA 1O2JA 2Q6DA 1C1VH 2ASUB 5DHFA 2GP9B 3VFEA 4Q4HA 1O3HA 4TTQA 4WWYA 4YMTA 1A0HB 2V7QA 1ZTLA 3SYNA 1P01A 1ZUHA 4Q7XA 3TW4A 4D0LB 3A8CA 3CF6R 4MRVA 3A6PC 1CSOE 1F3OA 4FU7A 1LPGB 2A30A 4NIYA 3DOEA 2D26C 1YF4A 3QXJA 4X1PU 2FS9A 2FTLE 4LOYH 2RGBA 4HZIA 1S96A 4B6EA 2GESA 2BTCE 5EOKA 1R4AA 5P21A 1TGSZ 3THXA 6CHAB 2NIPA 1QRWA 3AF4A 2FZ4A 3RXEA 5KNDA 3OTJE 4YMWA 5JSZB 1F2UB 2C99A 5AJVB 1SVKA 5EXLA 2SHKA 2IYWA 4R9UC 3E3TA 2F9PA 1D4PB 1MV5A 3GLHA 2VNTA 1HNEE 4H6TA 1IN8A 2MSCB 5HTKA 3GY4A 1WOFA 1Z83A 1JBKA 3AASA 1G291 4G5SA 2FOHA 2UZIR 4DLUA 2IUSA 4GP7A 3PEUA 2CXVA 1S3SA 2ZE5A 1OWEA 3CX8A 1GVZA 1A5GH 1W11U 4LC0A 1GMHG 2F43A 3EARA 4DLWA 1HAYB 1UTNA 4PHHA 5J40A 3CRVA 1HAVA 4U01A 5GNDA 1G19A 5LGOA 1UCYE 1VJ9U 5DG6A 3A86A 2UUKB 4HB4A 1U90A 4BZXA 3VGCB 1JR3A 2FODA 4Q1EA 1P03A 3PUWA 1EPTA 1O3NA 2I6QA 1Z8JB 1YHNA 4CEHB 3C14C 2GAAA 5DP3A 2HCBA 5DP9A 2FA9A 1MD7A 1QB6A 4A8JC 4PTLA 1UKVY 2FFAA 4R2IA 3FVFB 2Q9AA 2F3TA 1A3BH 1TNLA 5LD2C 5CMXH 1MRSA 2OCPA 1FXYA 2HJGA 5DI3B 3SYLA 1AB9C 1P04A 3T5DA 4Z8YA 4XWOA 5DNYB 2FLRH 1MABA 1HIAB 1EFHA 1S0UA 1C1TA 1CVWH 8GCHG 3D7MA 3K0AA 4JMPA 4GCHG 4YQFA 1N8OC 2MSEB 3LDXH 1GZSA 2GDJA 1ANBA 1WDTA 1YPHE 2PTNA 4V03A 1C1OA 3LX8A 1T5IA 1XTKA 4Q4AB 2GEUA 3ATIA 3TK9A 3JZAA 3GDSA 4INKA 3RC3A 1OP0A 2DCUA 1SL3A 4UJ5A 2G81E 2QCYA 1JRSA 3LGVA 2XNDA 1R6BX 2OP9A 4HLUC 1V43A 1G2MA 1D9ZA 4ON9A 3FP6E 2C78A 3IPXA 5BXQC 4AG1A 4PXAA 2CE7A 1J16A 3KQDA 3LH3A 1E0JA 4NL4H 5DIFA 1W0KD 3B1WA 1GBCA 4TPIZ 2VU8E 1SC8U 1DFPA 5JB9S 4MGKR 1EP6A 2HNTF 2JASA 4I8KA 2XTMA 5K8LA 3F0TA 2WJHA 4AG2A 2FMJA 2V3OH 1C2GA 4O25A 1JR3D 1AWHB 2GK7A 1SOZA 3D3QA 1NC6A 1XX9A 3AVXA 1CO7E 1AA9A 1CJUC 1OXUA 1X3SA 1EB2A 4NYMQ 2DFTA 1HAHH 2H6MA 2FI5E 1AJEA 2OV2A 3NC0C 4O2RA 4XOJA 3H4MA 2FSIA 3HGNA 3ZZBA 4D9RA 3MWIU 4WMFA 4NZYA 4VGCC 4KYIB 4Q1CA 1IN4A 4LOAA 4DT1B 3OU0A 4ABAA 3ZVCA 4A6XA 2DB3A 1BTWA 4UEHH 4PPQA 3TR0A 2GZDA 2ZPQA 1OT3A 3KB1A 4ISNA 4THNH 3ZLJA 2B92A 3S9CA 1NN1A 3AK5A 2QTVB 4E06H 3MUFA 3ZVNA 4DSOA 2AL7A 3M4YA 1XD2A 4QM7A 4QHYA 1E36B 2ZEJA 5H8WA 5FBWB 1CR0A 4L9SA 1NVVQ 1OIVA 1KLIH 1O3OA 3TU7H 2FM2A 1LHCH 3HATH 4CT5A 3PYHA 5DO4H 3K09A 1UCYH 4OS1A 3K8YA 2YWGA 4C0BA 2WHXA 2OC8A 1RJ9A 2IYTA 2FX6A 1ZSKA 3K2UA 2DWPA 1ZNWA 4KTCA 2VHCA 1ARBA 4D0NA 3B9PA 4TT3D 1NZQH 1DG3A 1Q20A 1T9HA 3RS2A 1EESA 3EIHA 1Z06A 5JZVA 2AKAB 4WMDA 2G4UA 2H7VA 2Y5GA 2JLZA 1NVVR 3EG5A 4TLCA 4B44A 1K8RA 2R2WU 3BTWE 3PV2A 2BCGY 2ZRHA 4PX9A 3W95A 2FFHA 4JLBA 4B47A 3SGBE 2FEOA 3CS7A 1KK2A 5EJEA 4IMZA 1GM5A 3A58B 2OESA 1ZNZA 3C7KA 5E7IA 2YC2C 4C4PA 2FOMB 3MO6A 3MAAC 5JSZA 1AQ7A 1QR3E 3B1VA 3T61A 3TSOA 3KXLA 4NA8A 3SORA 2ZU4A 421PA 5KDLA 4X1SU 3TUIC 3GY6A 4JKIA 4K69A 4OKSA 1U2RA 1CJKC 1LY1A 1VJAU 5TDHA 2ZRKA 2CHGA 1H9HE 4BECA 4RN6A 3VKHA 1GI6A 1S85A 2XITA 4JYBA 2BIFA 1IAUA 1GHZA 5EXTA 1OKXA 4B1TA 2JLXA 4QBGB 4NA9H 4AFQA 2ANMH 4RY2A 2VSXA 3U7GA 1GL1A 2VHJA 1ETSH 3ADBA 1GMCG 2IS6A 4KBGA 4MNVA 5GADl 3GFPA 5FPYA 2XC0A 1T4VH 2QP4A 2HF9A 2DWQA 2ZFFH 1AIPA 2NG1A 4UD9H 1Z2AA 1V2QT 1FIWA 2F9LA 4B3CA 2NU3E 1JOUB 4BFYA 3F3YA 1OKKD 1RTKA 3W6OA 3M7UA 1ESMA 4WBSA 1WXQA 3ZVRA 3C27B 2FWRA 4KVAA 1YU9A 4ABYA 2KSQA 2ZSEA 5CJPA 3AVOA 1E0AA 2WUCA 2GF9A 1YR6A 2P59A 4PAMA 5AK0A 2IS2A 3QX5H 1G37A 3PEYA 2OQ5A 3OIUA 2GXUA 1BJUA 1DX5M 4CF7A 2O8TA 2STBE 5BN4A 1XEFA 1AFQC 3BIVH 1MABB 3SJIA 1Q3HA 1MCVA 2XNIA 4Q02A 3GJ6A 5HR5A 4OS2A 2DHRA 2WPKS 2Q3FA 1S83A 3AKYA 3LXXA 1JQJC 3HPTB 1N25A 3A7YA 1GBIA 2RGNC 1ABJH 2A45B 1KK3A 1QL8A 1C5XB 1QTFA 1ZM2A 4PC7A 5C5NA 3AKDA 1WTGH 4NFEA 1E99A 2B5TB 2XXAA 1P2OA 2D8WA 1CKEA 2Z43A 2XCNA 2ZS9A 1NN0A 1ODFA 3ZS9A 3ZV8A 1IQIA 2Q6TA 3G0HA 2ORIA 1TQDA 1FY3A 3SU1A 1TPAE 4Q9JA 3MNBA 1YPKH 1OXGA 1F0SA 3U3MA 1J8AA 1ZYOA 1N0VC 1GG6C 3CZPA 3GY8A 4ZUHA 3IWMA 1S1CA 4DKXA 2F3CE 5E2OA 4JL8A 1Z6JH 4RFSB 1A7SA 5L2YH 1QCPA 3UOUA 3BG4C 1W1WA 1SGFA 1GMCF 4M1TA 1C5SA 2G83A 3QBTA 3BTHE 4K1EA 2ZE8A 1RJXB 2GXSA 5KDDA 1YZLA 1NFUA 1DPFA 4XIGS 1FPCH 1GJAB 2C90B 3LV8A 2AD1A 1C1NA 1MKXK 2F9OA 3W90A 3EIQA 1G6OA 2JETC 1BMFA 3BH6A 2FGJA 3WRYC 1UDWA 4DVAU 2W83A 1LTQA 4RD2A 2JH5D 1W36D 5FHTA 4Q7YA 5T6FA 6Q21A 1QZXA 2GT7A 4QBHA 1J9CH 2JLWA 1N0UA 4PHFA 1GBHA 4MRSA 1EGAA 3SU5A 4M4SA 1ZOMA 1Q57A 4YXWD 1TIOA 1AKEA 3U69H 3K6ZA 3P8FA 4AKGA 2ORWA 4EJSB 3ZGXA 4AK9A 4WH8A 4EJSC 3GJ7A 3VXFH 3GLFE 1DO2A 2X8AA 3MU8A 2D4HA 2OBQA 3SO3A 4NWKA 2OFOA 4C0QC 1GGDC 1GILA 5EE5B 1QDEA 1V2LT 1LV7A 3PEWA 3G01A 3A7VA 2RAPA 1GAJA 1G8YA 1GRQA 3F1SB 5GCHF 4IVRA 2RG3A 2HJVA 821PA 4MA4A 1RD3B 1KYNA 4ZKNU 3ZVMA 2GETA 1X8JA 1JIRA 2OEPA 3NXSA 1AN1E 2ZYTX 3WP1B 1HGTH 3SHWA 2G0TA 1R8QA 4MGIR 2P8OB 4BXWA 3ATKA 2EVWX 1DOAA 1US8B 4JLMA 3EPJA 3FP7E 1O36A 3AKCA 4WZBE 4BAKB 4DGJA 3GLGA 5E0GA 1UJ2A 4QJ3A 2BLQA 1E2PA 4ZHMU 4DVGA 3RM0H 1AVGH 3DT0H 1E9SA 3N7OA 3M3VA 4DB2A 4KBFA 2XWAA 3UK6A 4Q2KA 5L3QA 4IBLH 4JJZA 1YRAA 4Q7MB 1E1RA 2FPZA 5C2ZA 1G4AE 1VHTA 1X6VA 2QI9C 3KNXA 2J0SA 1GBTA 1SLWB 1HAPH 4I1OA 5F3WB 4ACAA 1Y3YA 1GI8B 1E2NA 4ITRC 2ODQA 2V4ZA 1UO6A 2BYAX 3B1XA 4TLAA 4LZ1H 2ZETA 2ZS8A 1CIPA 5KNBA 4FI3C 3TJZA 4I4LA 3RSLA 1SXJE 2BKEA 3K9LA 1P75A 4K2YA 3CPJB 1T3LA 1U9IC 4KCGA 3M3SA 1V2OT 3BJIC 5JCPA 2NO0A 2A0QB 4LYFA 2EFGA 4NIVA 1VCMA 3O8BA 4LI0A 5JWOA 1QQUA 4OK5A 4QT8C 1YLDA 2REXB 2JLSA 5JS7A 4V0MA 2QQEA 1TGBA 4IN1A 3HKIB 3QVVA 1Y3WA 2NOAA 1QA7A 3RMLH 3RS3A 5KSZA 4DIEA 4M21A 1QHIA 2RA3A 3A7ZA 2QMUA 4PZZA 1COWD 1MKWK 1UTPA 4JLDA 1C5PA 1W4BA 4LJYA 4HLCA 4M7GA 4AX9H 1HURA 3QKRB 1TONA 1QBKC 3KN2A 2J1LA 4KU4A 2UVQA 3C15C 4TYQA 4RI0A 3LJJA 1G8PA 1RYHA 3UNQA 2AYWA 3VGCC 1NM6A 2BD2A 3ZZ7A 4I99A 1R2QA 5DJ7A 2R6FA 5FOTA 1GDQA 2VO1A 1QBOA 2G51A 3EC1A 5FPSA 4Z6AH 2B8OH 1UVSH 3B8HA 2QN6A 2A78A 1G30B 3AUXA 1Y8TA 5LPFA 2FDCA 3DKVA 2F9BH 2QQ0A 5HE9A 4DXAA 2PT7A 1EQ9A 2ZR9A 1XZPA 1NJFA 3HU2A 2SNWA 3E2IA 1MKYA 3HK6B 3EQ0H 1PUJA 3QSYA 2QGZA 2C04A 4J2YB 2ZPSA 2W6JA 1KAGA 4KP0A 1KXCA 2L0XA 3ND9A 4JZIA 3X1WA 3N70A 1CQQA 3QOFA 4NHOA 1O2GH 2DUCA 4KFTA 1GMHF 1KXFA 1SKYE 1Q1ZA 3TK6A 2H9HA 1KLJH 4Y79A 3VU9A 1N6PA 4FINA 3LJOA 2KJQA 1GI2A 1UVUH 2PGBB 4XJXA 3RXKA 4JZDH 1MU8B 1P72A 5T6GA 3NKVA 5JRJA 5FFMA 3KEEA 3QJYA 1KI8A 4DCNA 4U00A 1ACBE 1G16A 4I1SA 2O8DA 4AI6A 2TMKA 2OCBA 1W10U 1LB1B 1EK0A 4KVGA 3TAHA 1FONA 1N6IA 1V2JT 4PC1A 2LNCA 1H1BA 2QE7D 1UJ1A 2CE2X 2TGDA 1V2WT 1GJ7B 2W6JD 5EXXA 1SGTA 3F9FA 1N1LA 2AXPA 1AM4D 4ZDWA 1GNPA 4F4OC 5FOSA 3U9AH 2QRNA 1CHOG 2RGXA 4ASUD 1G20E 1GBMA 4BLSA 1ETTH 4QKQA 3TQCA 5F6MA 3I29A 1T91A 3CS0A 2J0UB 3D23A 1O31A 1MQ5A 5H4IB 3AGPA 1S0RA 1C9TA 3M5LA 1Y3XA 3H7OA 1E6CA 3MWLA 4SGBE 3K0CC 2XXAB 1WQ1R 2BY6X 1TX8A 3U4QB 3STJA 1P6XA 1KDRA 4BEJA 3C5HA 2Z6VA 1ZZZA 1J90A 5AFZH 2ZDAH 1K22H 2PZGA 1OYYA 1P2JA 4PO8A 2QL6A 1PJPA 4ASHA 1OXVA 1JIMA 2A2ZA 5IK2D 1ZD1A 4KFUA 1WRBA 3KKMA 5FBRB 1O5EH 1SGQE 4Q4LA 1RC8A 2QAGB 1AIXH 1QB9A 2J7PA 4MLFB 1ZR0A 2WAYA 2R8RA 1ORFA 2JJ2D 1Z0FA 2CL0X 1AK2A 2CJWA 2QP3A 4ARZB 1EWQA 4URXR 3UWOA 1EZSC 4DDTA 1TOCB 1TALA 2RGCA 3BEUA 3I3SR 4B3GA 1XZQA 1ETRH 1KXDA 3K0FB 1QHRB 1BTXA 9ESTA 1C5VA 2BDAA 3IIMA 4TPYA 2ZECA 4EPYA 5LPEA 3DA9B 1WB9A 5G53C 1E4VA 4QGHA 2VVCA 2XBYA 1SHKA 4ZV4A 3QTOH 3CM0A 1W2KH 1XTRA 5CHAC 5TMPA 3QN7A 2BVRH 2WZQA 1NBME 4IVPA 1SOTA 3T5FH 2JJ8A 1CLUA 4D6PA 3L33A 1DVRA 1MBQA 4CIDA 1NY6A 4IHQA 1SXJC 1JB1A 4ZDKA 2WAXA 1CE5A 3ZQ6A 3FFAA 2NU0E 2BD7A 2BX3A 2QTFA 3TUZC 1VKJA 4HLUA 4B2CA 1UVTH 3ZDQA 2CCKA 2O8BA 1N6NA 1KO1A 1D3DB 1ZNYA 3EA0A 3RRNA 4Y76A 3MWJA 3GLGE 4OI1A 2H1UA 1E96A 2KB0A 2QC2A 2F1IA 1EJAA 1KY9A 1IOEA 2AK3A 3GYMA 3X2SA 3IUYA 2J3EA 3F8TA 2HT1A 2AMQA 3Q76A 1OH7A 1EPTC 4DLTA 4YT6H 3DDCA 5JRZA 4TMZA 1C5NH 1SKYB 1GJDB 2XRCA 3KQNA 5FX6A 4B2LA 1MTNC 3SBKA 3RMOH 3NK8A 1NFWA 1DAEA 3H5CB 4H1UA 4GOJA 5BPEA 5JJKA 1D9IA 3SNDA 1SVMA 2ANWA 4P4TA 4IOJA 4ZPXA 4WVFA 4C0LA 3THWA 4JT2A 2W6ID 5TARA 1TBQH 5FOVA 3P8OA 5FX5A 2Q6GA 1NTPA 1SXJD 4GCHF 5A4JA 2WSSD 3FHOA 2C8VA 1P3EA 2QMEA 1V2KT 3W9YA 4X0WU 3CO5A 1G3DA 1ZIOA 2UWPA 1ZM4A 4LZ4B 3BAFA 1NRNH 1Z0IA 5TXGA 3W34A 4Z1MA 4PO1A 1BDAA 3QNUA 4UNRA 3NDBB 4TY7A 2P3UB 4DCVA 4R71A 4DEYA 1ZCBA 1QJ7B 4N1AA 3MHWU 4NSYA 1SGIB 4N0DA 2F91A 3U7HB 2BD8A 2QF3A 4NYJQ 3RAPR 4JZEH 2ZUDA 4LJ8A 1MTWA 3TE6A 4NIWA 3GLIB 2FJUA 4DEXA 1LCYA 1RIWC 4RKFA 1GRRA 1E2JA 3UWKA 1H8IH 2CL7X 2GNOA 5EW1H 1IN7A 4K8BA 1W49A 4UNSA 3ZVEA 1D3TB 4HTCH 5J4SA 2PJRA 5DE3A 1TU4A 3SZRA 5HPYB 4D82A 1AB9B 2P3FH 3RXAA 1VCQA 1YR9A 1P9RA 3C1KA 1ZAKA 3LONA 4Q7JB 1AS3A 4URWR 1OPXA 4HUQA 1O30A 5AUNB 3KGPA 3S69A 3UREA 1TRMA 1A1VA 3WNBA 3C8UA 2Z3EA 1QY6A 3GCHC 1ARCA 4K46A 1VCIA 3THXB 3GFOA 2ANYA 2BZ6H 2GILA 1NO9H 5B64A 3SBDA 2OCAA 2BJWA 3VPKA 2JH6D 5EW2H 1CULC 2A4OA 2GD4B 4UNNA 4URZR 2FE4A 3VAAA 2K5UA 1C5LH 1HYLA 2RHDA 1AI8H 5D3MA 4FMBB 3FAOA 1Z0AA 3E8LA 4PR0A 2GEDA 1TU3A 2D74A 8ESTE 1INCA 5TCAA 3SI7A 1W2HA 1IQMA 3RM2H 4AFSA 3QENA 2GCOB 5K7RA 1DAIA 4Q80A 1YZTA 1Z6YA 2JGNA 1C1WH 1SHZA 4BGDA 2CNWD 3SV8A 4HB0A 2DFNA 3M5NA 4UNPA 1TTTA 5JS8A 3L82B 4P0TA 2O8FA 3AQ4A 2RHMA 1A5IA 5ESBA 3ZVGA 1ZIPA 1J15A 3R8FA 1ZSLA 1XF9A 3RU4D 1KSJA 4IOLA 1NLZA 4CDGA 2RDLA 3NTUA 1PPZA 2WKPA 2FX4A 3B6EA 4FXGH 3MMGA 3IITA 2A5FA 1ZJDA 4LUCA 3A7WA 1LHEH 1ZU4A 4GFDA 4RZXA 3NWJA 2BVSH 2JJ1A 4YONB 2WPDD 2V35A 1VG1A 3KX2A 3KQHA 1T8MA 1AVXA 3BIUH 1BTPA 2CDNA 5HZHA 3RXQA 4A4DA 3R3GB 4DURA 3OTPA 3U5ZB 5HGGA 1XMVA 3RXDA 3SU0A 2FLBH 4DUGD 3K9XB 1K1OA 1C2LA 1T8OA 2C5LA 2R2AA 2ULLA 3ETLA 3GLHE 1TLDA 3ENSB 2KWIA 2QEQA 2VHTA 4OQXA 5HKKD 3AVPA 3FKSA 1U94A 1T8UA 1C2KA 3HU1A 1D6RA 1WA5A 4AYVB 1R0ZA 3BH7A 1P2TA 1NIJA 3A87A 4K5ZA 4US0R 1W46A 2FFQA 4TLEA 1E34B 4UFDH 1B0FA 3ONWA 4BAHB 3F9HA 4DDUA 4JJKA 4DG4A 3DL0A 3VB4A 4DY7B 3K0CA 4P3YA 1XX6A 2CL6X 1LKAA 5DYGA 4IDPA 1BTHH 4Y6DA 4X1NU 1XTJA 1P10A 4MGYR 2FOBA 2PH1A 2BX4A 3M7TA 5JJLA 3L8ZA 3VNVA 2GCNA 1UEIA 4MUAA 4HAXA 4EPRA 5UKDA 4ZCLA 1NI3A 2YYZA 4DDVA 2ODNA 1GDUA 1CJMA 1DG1G 3T27A 5AR1A 4X8OA 4IXNA 2WWHA 4XVRA 1DAHA 1TE0A 4EFMA 4EPTA 2NPFA 3LGTA 2PW8H 4M1KA 3AF1A 4ZAEA 1O3PB 3WBKA 3RLFA 1WBBA 1ANEA 1TMKA 2KAIA 1ANCA 2STAE 2GHIA 3QUSA 4P4SA 4X2XA 3BFKA 3UKDA 1IQFA 1EUFA 3DPUA 2J7KA 4CRAA 5EP4A 2IUTA 1KXEA 2WSMA 1P57B 4UQOA 4D80A 3KKPA 1SGWA 2FESH 1VZQH 5AUOB 3LXRA 4Q1FA 3PV0A 3M1IA 1DO0A 2ZREA 3QQ5A 2WWFA 2SGDE 4ISHH 2BOHB 4G0NA 5J4HA 3WBJA 2A31A 1N5LA 5EQSA 3TJVA 1CR2A 3OFNA 1GITA 4PAOA 4HAZA 4ESHA 3PLPA 1ELTA 4DSTA 4CEHA 3MU1A 4A6PA 4RZ2A 1GI0A 5C3NA 5CLQA 1PVOA 4BQSA 1Z0KA 4AWXA 3A81A 2GMTB 4TMVA 2VLIA 3S9BA 4RSPA 4V0ME 3SNCA 3EAQA 4A36A 3P4XA 3A7XA 1NKSA 2HT6A 5CHAB 2WV4A 1BMMH 4MQAA 2A2XH 1UAAA 1FN6A 3RXHA 3A82A 1BUIA 4B48A 3FMPB 3T62A 2ZVPX 1O3GA 3TMKA 3AKEA 1YZUA 2A4RA 2Z9IA 1MO6A 5CLLA 3QTVH 1W0KA 3RXIA 1PLKA 1BMFD 1ZJKA 2GJSA 1E37B 2J94A 5E0JA 2PTCE 3MD0A 1D2MA 1IONA 1DLEA 1FJSA 5KPJA 5GJWC 3AGQA 4Y0YE 3QKSB 3LNCA 4CW7A 4ABIA 5JDUB 1KZGB 5L3RA 2Z3CA 2C93B 1KLTA 3A8AA 1PPEE 1FPMA 3M36A 3BE4A 3TLXA 1FY1A 1IXZA 4JZKA 5KSPA 1AGRA 1W48A 1K2I1 3TGKE 1KI6B 2BD4A 3KCGH 2IYRA 2BMFA 1QHHB 1NU7B 5GJBA 1QFKH 4GPGA 1FOEB 4TYWA 2AD5A 2SGQE 3S1AB 5G41A 4GBMA 3A1VA 1SGRE 1NFYA 4M9XA 1O2KA 2ZRLA 2FO9A 3TJUA 1VCPA 2QA9E 3A37A 4HEJA 1AD8H 1HH4A 1X8KA 2PJZA 4IVQA 4DIDA 4XBCA 4Q5IA 3W6PA 4RCZA 1RZ3A 1W7AA 2ZXUA 1HTWA 5CB6A 1P9SA 3M3TA 4AYWA 4QOSA 1GBDA 1TF5A 4ABDA 1OWKA 1PZNA 1J99A 2ODEA 3GD7A 4Z8XA 3Q7PA 1HUQA 2ZM5A 5DI3A 1BBRE 2ZYWX 2R9PA 4E09A 5E4FA 3CBQA 4WZAE 4C7OA 1Q22A 3OY6U 2PMKA 5J4KA 1GL0E 4NMMA 4LC1A 1AE5A 1HE8B 3NHAA 3T15A 1OSNA 5JEDA 3EWAA 1AUJA 4DW2U 1V2NT 1BS1A 2NWNA 4YOIA 1TAGA 3OIVA 3BV9B 4DLYA 2VTKA 2IXFA 2FTMA 2P65A 3K0AB 5L3SA 4EKDA 1ZYUA 1SI5H 1LFDB 1XUGA 1SSXA 1OKKA 5TB5A 2V1XA 2CV3A 5GIBA 4FU8A 1MAXA 1FIZA 2TIOA 1MO3A 1BYIA 1QA0A 1A2BA 2FX3A 1GIAA 4BZPA 4MRRA 3M37A 2G5VA 3DFLA 1WYKA 4Y0ZE 4Y7AA 4BFTA 1ELBA 5C5OA 1F60A 4RZUA 4A1VA 1B0EA 5EZ6B 2R6GA 3CH5A 2GTBA 4WXIA 2XTZA 1SGPE 1TRNA 4PSKA 3PEVA 3E1SA 5AUPB 3JZ2B 1JEDA 4K8YA 3PQCA 4DIIH 2OD3B 4AGKA 2QYIA 2G55A 4GOXA 2IYQA 1P0SH 3W5JA 4F49A 4NCNA 3CONA 2O8FB 3ZZDA 4LCBA 3P92A 8LPRA 1G8HA 1OW3B 1ESNA 3GJ4A 2P3SA 3MWYW 1L1JA 4M0LA 1K1JA 2BDTA 3QZQA 3GY3A 1LF5A 2RGAA 3DMNA 1E2LA 5A8YA 2CHVA 1AFQB 1OP2A 4OJQA 1F92A 4OHWA 1L2TA 1SMFE 3OZXA 3KQLA 2CK3A 2F9MA 1QHXA 2PKSB 4LX0A 2FV8A 1GPZA 3LGYA 1GL7A 3KKNA 2IYXA 2E87A 2VF7A 1JRTA 3Q3KA 5C1BA 2Y6TA 4QBFA 4MKHA 2A5KA 2ATXA 1XD8A 2BB4A 2QN5T 4LJ9A 4PAQA 4G5GA 3D31A 2F6RA 2J41A 1DXWA 3AV0B 1J8YF 1T32A 4GDFA 1O3LA 1ZJ6A 3B78A 1RKBA 4I1UA 1TBRH 1GKIA 1ZRBA 3SHFA 3OESA 3RU4E 3RXTA 1G7SA 4JL6A 3I8XA 1P2MA 1QG4A 1SQ5A 1QRXA 2HYIC 2ODYB 2ZRCA 2ZDNA 4FU9A 1FP7A 3GEHA 2P0EA 7GCHG 2OM2A 3ECCA 3BWDD 2DY1A 2ZFSA 1RTLA 1G3MA 1RTFB 2ZRIA 3ADCA 2IW3A 4A2WA 1XPRA 2H9EH 5FTMA 1MD8A 5IDKA 2ESTE 1PQAA 4YMSA 2A7JA 1JJVA 4ZKOU 3ASZA 2J45A 4IEEA 5DHAA 2ZU5A 3MNCA 2QSYA 5JWHA 4ZIRB 1M1YE 3IBYA 4TYPA 3IG6B 2FEMA 5BN3A 4NFFA 3QF4B 4L9WA 1N3BA 1VGCB 3SQHE 1CBUA 1ELCA 4MITA 5JBBS 4LJ7A 4KSBA 4TQUS 5C4GB 2WPDA 3B8JA 1G36A 2V6NA 2P2LA 3WYFA 1S0QA 3UFAA 4LV8B 5EODA 3GY7A 4LHXA 1EJNA 3H2YA 1TPOA 4TLBA 5TY0A 2Y80A 2HWLB 1HIAA 4DT1A 1LNZA 4V0LA 4U2WA 1C1SA 2QA5A 2IA5A 3RANA 1O2TA 2MMCA 1THRH 5BYKA 1NY22 3OIWA 4LZZA 1DAMA 4A0GA 1J14A 3NWUA 4B33A 1F2SE 1Q12A 4HATA 3LIWA 2RCEA 4CYMA 1UBGA 2VRWA 3UIRA 3T26A 1DEKA 2PLXA 3CENA 2FOGA 3I5XA 1NF3A 2OQUA 1E69A 2RKOA 4LSGA 4NCIA 4Q66C 4OS4A 3I73A 1O32A 3QDZB 1IHSH 1SLUB 1FY4A 2BC9A 3CR8A 2OBNA 3SV7A 4AFUA 3FMIA 3GQBA 1TABE 4DBLC 2XWBI 1BYUA 1O5DH 1CT4E 2P8OC 3QLPH 4E5UA 4AOQA 4JZFH 1E79D 3NBZC 2IF0A 3BTME 1EOLA 3PJRA 1II0A 4NYJR 4Q01A 1N5JA 3LLMA 1GJ6A 5CM9C 2C8YB 1UCYK 1EX3A 3ITIA 1T8TA 1FUKA 3B5JA 4HAVA 5H1YA 1IQLA 1NSTA 3OAAD 1EJMA 2ZRJA 1FP6A 2X2EA 4M1OA 2GDDA 1DS6A 3ZV9A 1N6YA 3S7KB 3BXZA 3K70C 1QIXB 4YTAA 4I81A 2VGCB 1O3JA 1N6HA 2W3KA 2IT1A 4CGZA 1SLVB 1S9DA 3CRMA 1G2LA 4GOKA 2PZEA 5CDFA 1PPFE 6ESTA 1PPCE 1TA2A 3QKTA 1OJLA 2PHBA 4DZZA 4XSGA 3B9QA 1PUIA 2V55B 5JWRA 3TW8B 4IXMA 1XMIA 2XGJA 2HLDA 2O8WA 1HLTH 2YNMA 3QG1A 1XJ0A 4Q9KA 2Q3HA 1OH5A 1KSHA 1IBRA 1U0JA 4XTCS 1LS1A 3LDAA 3ZD7A 2BY8X 1ELEE 4DCUA 4WIAA 1SHYA 1ZW6A 3FE2A 5FBVB 4TWZA 5DK1A 1LVBA 4D7FA 4DJZB 3BRWD 2XB4A 3EYDA 3PUXA 4ACBA 2WPJS 3AP3A 1US8A 4US2R 3R7WA 4CBOA 3AF3A 4L15A 2QT0A 1G41A 1DM4B 3MJRA 1I4DD 1UTLM 1DWCH 1A1RA 3RXUA 1P05A 3EWSA 5DH9A 2ZU0C 3UOPA 2EW1A 2ZFTA 3EA7A 3AH8A 5DGXA 3EE0B 2SGFE 2FXRA 1GDDA 4Y10E 2WWGA 1K1LA 4FUGA 1I4LD 1SGEE 1P2NA 4HLQB 1G5RA 5KO2A 1HJ8A 4BASA 2A9KA 4O3UA 4TWWA 2FIRH 3ATMA 2LKCA 1DELA 2JKHA 5KPDA 1UHBB 5TCCA 3SNBA 3SEAA 4C7OB 2OLJA 2ECKA 1W47A 4M9FA 1E9CA 3LOXA 2BDYA 3LVRE 3GLFB 3KL6A 2WJIA 3CF2A 3IO5A 2ZPTX 2B9LA 5DN6A 4C2UA 4B73A 1YZKA 1OS8A 1SKQA 3MU4A 1X86B 1EFUA 1U0HC 4CH2B 3T1TA 2ALVA 1BB0B 3U44B 2ZQ2A 4S35A 1UK4A 1XVMA 1D6JA 2ZJ5A 1XFAA 1JQLB 1LS6A 3PWBA 3Q3JB 3ATLA 2DYKA 2ZROA 1GOTA 2VWMA 2CHAC 1ZMJA 1D8TA 4I8LA 1B5GH 1TAWA 2D2DA 3A4LA 5KSOA 3NIBA 1SPJA 4NDZA 3MNSA 3MCAA 2ANKH 2ZU1A 1S5SA 1G17A 4I7YH 2WKRA 2YVUA 2Z83A 3P17H 4FUJA 3SQWA 3TKLA 2ZGCA 2ZQ5A 5EQTA 5EP1A 3K9NA 1Z8GA 1OSSA 1G9IE 4CRBA 2KI5A 2Q6FA 3K9GA 1K21H 1DSUA 5GDSH 4YT7H 3RRZA 3LU9B 3CWQA 2P5TB 5I25A 2ZAMA 3K9HA 1TF2A 5FTKA 4U7DA 2V54A 1HJ9A 1FLEE 4DUGA 3ZYDA 3Q3YA 4CBNA 4MNYA 2W6IA 1MKXH 1T3HA 2ZHDA 1O2OA 1XD9A 1W44A 3LRPA 2C03A 5IK2A 5EP2A 2NZJA 3GLIE 4Y8YA 4O03A 5F8ZA 3TQFA 2R3UA 1KSFX 1XCGB 1ELAA 1HDTH 2C98A 2RCNA 1XEXB 1KMQA 3F9EA 1HAVB 1NSFA 2O9QA 3R0FA 3P6ZB 1GJ8B 1EOJA 1IQEA 3AVUA 4JT4A 3BD9A 2ZDMA 1WBDA 3KKOA 2BQWB 1HV8A 1N5KA 2Z94A 4IMQA 3JZMA 4E07A 4C0HA 1YJ5A 1NT1A 4JMYA 4D4KA 4B2IA 5EE9A 5F8XA 1ZM9A 4YOGA 2YNAA 4W9MC 2QAAA 2FPLA 2YNBA 4W5HA 5HCIA 4F4IA 2BMJA 1OE0A 3GY5A 4M53A 1EASA 2XZLA 3PMHB 2AMPA 1NLFA 1G3EA 4B71A 1YPLH 3FOZA 3EXAA 2A32A 3T06B 5E95A 1AZTA 3Q5EA 4HZUA 4OS6A 4A9AA 4HAYA 1XU4A 1E9FA 5FR1A 2VP4A 4LHZA 1NLYA 2A7CA 1MBMA 4P33A 2GXAA 4YDSA 1M74A 4Q1DA 4X2YA 1BRAA 1W12U 3KL4A 2PBRA 4TLDA 4B3XA 4JS0A 3GICB 1LMWB 1EZUC 5BQ5A 4NE2A 1SG8B 4QRHA 3BSQA 3UY9A 4BNRA 3EAJA 3BS4A 1RE0A 3V7TA 3SJCA 4OM9A 1HT2E 1PYTC 3MJHA 3BG8A 1R7RA 4BPBA 1KSNA 1CRQA 4Q9HA 1YCPM 4W5WA 2JLYA 2JJ2A 3SJBA 3AW0A 2YWEA 4FMCB 2SGEE 1E9BA 1QRAA 1HBTH 1Q21A 1EKBB 2OZEA 2EU8A 3A1TA 5B57C 2X77A 4Y8ZA 3I72A 4XH9B 3VEQB 4AYYB 1GHYH 2Q9BA 2W2TA 2OXSA 2R3YA 3MO9A 1XPUA 2QPTA 2OFXA 4MPWA 3TITA 1Z6TA 1DAFA 3L0PA 5GVSA 4DCTA 5C1XA 3CX6A 2OHFA 1JAIA 1FAXA 3RXCA 3U8OH 1V2UT 3TJNA 4EQ6A 2P6NA 1W36B 1YQTA 4HZHA 3DFJA 3ZD6A 4NCKA 4HZUB 1N8OB 4CRCA 2V6JA 1HAOH 1U81A 4GMXA 1OWIA 2ZGJA 1O2SA 5CYOA 1KKMA 3RSOA 4D9QA 3SDZA 5DP7A 2RGEA 1T7CA 2AWOA 4Y71A 3EZ7A 2KAIB 4CEIA 4P4SB 1BBRK 2WYGA 5HYOA 1XUFA 2Z3DA 2XOKD 1SVSA 2ZC9H 4R7ZA 1KJZA 1Z8FA 1HE1C 4TZ0A 5GJCA 5IDVA 1LW7A 2IYYA 2BY9X 3R9WA 3BEIB 4X8TH 3MSXA 4OL0A 5SZIA 2UZ3A 4DOQA 1O3EA 2D3WA 3ZVFA 1P9WA 2G1KA 2J0UA 5E7JA 1II9A 5FL7A 1FTNA 4Y0AA 1GG6B 4R2HA 1YZQA 4LBWA 3WXMA 3PO1C 1EFRD 2BZAA 1N2CE 2ZWLH 2W0SA 5FR2A 4FMCF 3EZFA 4NH0A 1KJYA 1TX7A 2GJ9A 1W4AA 3HK3B 1YKSA 5J4LA 2BXTH 1UBEA 3MH4A 5CB8A 4FMDF 5E0HA 1W8BH 1P2UA 1JECA 4NP6A 1ZMXA 3PMAB 4JSYA 2Q3MA 2HPQH 2GK6A 3RNLA 2YOGA 3R9IA 3JZ1B 1SGNE 3FANA 2ZUBA 2JLVA 4XDEA 1I2DA 3ZIAD 3A83A 1KI2A 2Y82A 1WU1A 3F5FA 2QBYB 3ADDA 3W94A 1S1MA 3ZIAA 5EXPA 1GMDF 2FI4E 4Q47A 5JI2E 1P8VC 1KI1A 3I5YA 3VNUA 1SBWA 1A4RA 1P11E 5A8ZA 4DCDA 4PC2A 1AGPA 1FNMA 1T6NA 2ZTXA 2RB4A 4IEIA 3GY2A 2PKAA 4II7A 4BFZA 5FBLB 3RYTC 1GI3A 2H5EA 3VHLB 3L0OA 3M61U 4XWAA 3LC3A 3T34A 4MTBA 1PLLA 4KKDA 1KY2A 2P94A 2OCVB 1W7GH 2GCHG 3VR5A 3DHKH 1DPOA 2I4IA 5DI9A 4ZXXH 2BOVA 3B60A 1CA8B 2ZRAA 1GL6A 3RXOA 3LH1A 2QAGC 3O8DA 1R8SA 3EZ6A 1O3DA 3QPVA 4MVNA 1QL7A 2HYDA 1OPHB 5F2EA 1N6RA 3ASYA 2RGNA 3GFTA 4FUHA 2NU4E 5GJ4B 2XEXA 2JIZD 3SU3A 2XC4A 3DEFA 5J4YA 4JLJA 5I46H 1DS2E 1VGCC 1XPOA 3LW7A 2ERXA 2FPMA 4Y11E 5F8TA 1A4WH 1YM0A 1UTJA 3B1YA 1H8HA 2CHQA 1YPJH 1IJEA 2FN4A 3BK7A 2GA8A 1GJ4H 1PFXC 1A5TA 721PA 4K3JA 4DT7B 4YXWA 1FZZA 2W00A 3IEVA 2ZIQH 3TNSA 1ZPZA 2EFEB 2HLDD 3X1XA 1O2UA 4AGJA 2CJWB 4ARZA 2V1UA 2BV3A 4G1UC 1CJVC 1X1SA 2ZZUH 5CIWA 1P5ZB 1OXSC 4TYNA 3E6PH 1J17T 3L8YA 1O3IA 2BCJQ 1Y59T 4AY2A 2QXGA 2ALPA 1OH8A 1SVLA 1KI7A 2OUKA 2FOFA 3GJ3A 1BMNH 4NPHA 2P6RA 2QM8A 1NFXA 3SYJA 4GP6A 1BRUP 3T35A 1E9DA 3ZZ9A 1EXFA 4CEJB 3FYHA 4IFEA 5J47A 5LPNA 3K70D 2X1VA 4ILEA 3Q85A 4AORA 1DARA 3PITA 3U1IB 2AK2A 4BFXA 2W2VA 1O3FA 4GI7A 3BN9A 3A1WA 3GYLB 2UWLA 3ZS8A 1BHXB 4PQFA 4ZHAA 1G6HA 2P67A 3CH4B 3LPRA 1TPSA 3TH3H 4A1FA 1W14U 1T0HB 3HPRA 1FDPA 2HEIA 1TUIA 1E2QA 2FS8A 1K6MA 1T5LA 2HRVA 3TUJC 5KDOA 4X6NA 3D8BA 3TIFA 1DOJA 4BXSA 2ILNA 3LO5A 2P5SA 4GSYA 3C4JA 1T4UH 4G3XA 3GJ0A 1Q1QA 4AN7A 2BBWA 4NGAH 3TK1A 4W5JA 4RZ3A 3BORA 1C1QA 2G1JA 2OUAA 3NZIA 1TQ4A 4O9VA 3D6TB 3V4RA 1Q31A 3AB3A 1O3KA 1GFIA 5HM2A 1G5TA 2GZ8A 1FMGA 3KDSE 3V0XA 2J0QA 3IDQA 3U1JB 4O97A 2PWXA 2NQ2C 1ETUA 3KFXA 4UJ3A 3OEED 4BAMB 5KOYA 1U9IA 2ONKA 3BTTE 1GBEA 3FB4A 5DKMA 2GZAA 2BD5A 4HFPB 3SYKA 1Z0DA 4WVPE 2VYFA 4TSFD 3Q9LA 2YC4C 1DITH 1H9IE 1E9EA 2WPLS 3UG6A 3BEFB 4ZKSU 3VFDA 3URDA 1C2MA 4HB2A 1AWFH 1SGFG 2VJ1A 4BTTB 3MNXA 2PKSC 2BVNA 2H1LA 1YRBA 4Y7BA 1E2GA 3W8NA 3DD2H 3AVTA 1XUHA 3VR4A 1NVXQ 1GL9B 3ZVLA 4EFLA 3V12A 5D3MB 4AYXA 1Z22A 1QVRA 2AN9A 3L2OB 1R0WA 2EQBA 1S6HA 2GVDC 5F98A 1ZHPA 4A92A 1PJRA 1HQYE 2FH5B 2FYQA 1GWAA 2CEAA 2OXCA 1NNEA 5C1UA 2HDNB 2OLKA 3UATA 2H16A 2FZZA 1HAXB 2NO1A 621PA 2GKSA 1VYVA 2XNSA 1LO6A 3NHBA 4QGFA 1C9KA 3E91A 1QBVH 3GOVB 3KXKA 2ZI2H 5ETXA 3P4YA 4YOJA 2TGPZ 1CJTC 3EA8A 3CPHA 3KJIA 3VR3A 3CX7A 1MH0A 3TVDA 1MZDA 1HJAB 4TN1A 4HUTA 3QBVA 3TPIZ 1T31A 2RMKA 5AJWA 2ZKSA 4CT4B 4K1SA 1XCMA 2IPHA 3THYA 2WJVA 2CVHA 2QORA 2JDIA 1FZQA 3U61B 2Z9GA 1R0XA 1NRRH 3RWOA 2ZF0H 3NCLA 3LBNA 2BLWA 1H9LB 1C5UA 5C46F 1ZTJA 5CITA 1IQKA 4JLVA 3RDZA 1FUJA 3EA5A 2GCTC 2OAQ1 5IT5A 2D2EA 1P3CA 1G1MA 1JPJA 2V0BA 1OB5A 4OI4A 6GCHF 3SI4H 3KUCA 1O2XA 3NKKA 5FPHA 1G4UR 5HMAA 5A0CA 1RRGA 2FG5A 1QJ1B 2H92A 1NY5A 3PMBB 2WM9B 1AGJA 2IYVA 1M2OB 4IC6A 3AVYA 2OBMA 1GGDB 4HI3A 1FI8A 3OEHD 4QJ4A 4LPKA 1F5LA 3OSYA 4URYR 2ZSAA 3K1JA 2IXEA 4JVSB 3GLIA 3LW8A 1OB2A 5EGMA 1O5FH 2F7SA 2HV8A 3LFUA 5E8EH 3BTKE 3E90B 5EQQA 1RIFA 1V3XA 2ZIAA 1Y5UT 3IQWA 3LBIA 1LVGA 1PQ8A 1P4SA 2B7DH 3CWZA 4HAUA 3RLYH 2Z4SA 5C18A 1IJFA 3V13A 3QK1A 3DVLA 2BJVA 3SJZA 1FMJA 2H17A 1TUEA 1F0UA 3ZYCA 3SJOA 1XP8A 3PO1B 3H86A 2CF8H 4OQMA 2G88A 1KGDA 1K1IA 4FUIA 4A7IB 3ZZ3A 2BM0A 4YLGA 5BYJA 2EI6A 2OAP1 1OWJA 2XW9A 4JVLA 3SU6A 3UG7A 4B3DA 2O0JA 3NDPA 4O0MA 1IM2A 3SJ9A 2BVXH 2QXJA 1GDNA 5KYKA 1KO8A 4KLZA 3GEIA 2O8UA 4Q48A 3LGUA 5SZKB 1QHHA 4AKHA 4RKJB 4BEBA 1P73A 3U44A 3K6YA 4NZQA 3RXPA 3R20A 2A5GA 3QXHA 4OS7A 4LYJA 3ZJYA 1O2HA 3SV6A 3RXVA 1RJ9B 1TMUH 4GVUA 1CA0B 2D1JA 4WXRA 4WAUA 3RWMB 4G5OA 4NA7A 4R0IA 1RRKA 4X8MA 3CKLA 3PVSA 4JLOA 1E98A 2C2HA 1BTYA 2NU2E 1KNQA 3VKGA 5LPRA 1FPHH 2VIVA 2F9NA 2QSZA 1A7JA 4MQBA 6CHAC 1LQEA 2VH5R 3SU4A 1B0UA 1HAGE 2QAJA 3CUEF 4UE7H 2Q1JA 3MU5A 1PPGE 1HPGA 3CIOA 1IQJA 2DWOA 2YHSA 3U3KA 4S2EA 3QVUA 4U5XA 4B3FX 1G3RA 2BD3A 3N2IA 4YO9A 2CMKA 3WHLA 4XD7D 2HLCA 1GJBB 1ZINA 2OXRA 1KJWA 4RVCA 4XSHA 2VIIA 1AS0A 3QKRA 3BOSA 1P3JA 4OQFA 1BRBE 3BFVA 1V2MT 3DKPA 1TQ2A 4X8UH 4X8HA 4QGAA 1GVNB 3DM5A 1QJ6B 3Q00A 2OE2A 4DLSA 2AIQA 1OV4A 1TEVA 2CXXA 4TQAA 5KNCA 3ELAH 3Q7QA 5B6LA 1O2RA 1FL9A 3AF0A 4TL8A 2QGRA 4D4LA 1TPPA 3SHCH 4ZKEA 2ZRPA 1OYTH 4POAA 2C8WB 4WMEA 1A2KC 4L8GA 4FMDB 1Z7KA 1WCZA 1E2IA 2F43B 1TX4B 2CNWA 2WOJA 1Z1JA 2WMOB 1C2EA 1VG9B 1E1QA 1HQCA 1GHAF 4GLYA 4DIHH 1SQOA 1KAOA 5CM8B 2F55A 3VX3A 2GTPA 3P20A 3OFND 5F9FA 2ODWA 5KSYA 4GL2A 2OINA 2BEKA 2OBLA 4F38A 1T0JB 2PLFA 1CA0C 4E7NA 1MUEB 2VSOA 4QHSA 1O2WA 3L0IB 2ZGHA 2G8TA 4HI0E 4ABJA 3HWSA 2P6UA 2FSGA 1GSIA 4HDQB 3REGA 3NEYA 4R98A 3EZ9A 2ZE7A 4A1XA 4UDWH 1HUTH 3VMFA 5D3QA 3Q77A 2OSBA 1G3IA 4OHZA 4PC3A 4BWYA 1P2SA 4Q7KA 1A61H 1CF4A 1DE0A 3TK5A 2WINI 4NU0A 1BOFA 5IRCD 1NBMD 2R0LA 3CP7A 521PA 5L3VA 3UQOA 4CR5A 3L3TA 3TGPA 4QBIA 2HPPH 4Z51A 1BO6A 1AQUA 1MQ6A 4Z54A 1LVYA 4KGAA 1LVOA 4RD3A 4U32A 2V7QD 5DLQC 3KQBA 4BFWA 2ZUCA 2V6IA 1NMYA 1W2GA 3GCOA 4B2BA 1RFLA 3I92A 3U2QA 3ZZUA 4HYYA 2ZPRA 4BFUA 4NYMR 4XSKU 2AMDA 2BDGA 2FPKA 3A36A 2QRZA 4YC7A 1BRCE 1JPNA 1C4U2 5E7MA 1M7GA 2C8XB 1MR3F 1Z08A 3PUZA 1FX0A 3IKJA 4KV9A 3GCHB 2J0VA 3GCGA 3UWJH 4KLNA 4Q00A 4ABFA 1TGTA 5CIQA 3UIEA 2ZYVX 3QO6A 2J9NA 1ZGIA 4HDOB 3B85A 1C1RA 3HR8A 4IDHA 2WWYA 4JCNA 1TNIA 1AQYA 3H1TA 4A6LA 4MDSA 3TGIE 1GTVA 1VYUA 2CLSA 4ZKRU 1HYQA 4LGMA 4LK4A 2XJ4A 2C96A 1WUNH 4JLPA 3A7TA 1U8ZA 2BLVA 2BDIA 1W5SA 3FP8E 3OY5U 4B43A 4X6PA 4CR9A 2IC5A 1PPHE 1OIXA 3S0NA 1IXRC 4N0EA 1O5CB 1NVWQ 4KTSA 3UXMA 2EYQA 1O5BB 1A0JA 5EXSA 3TVJB 1S81A 1RS0A 2BQ6B 1TA6A 2EWWA 3STIA 4SGAE 4NBSA 1F48A 8GCHF 3TR5A 3UPUA 3FZDA 2XTNA 2BMDA 2LCFA 1GBBA 2FYRA 1O39A 1O0DH 2ZE6A 3CF0A 3IBGA 3PLKA 3VB7A 1S84A 1ZUNB 2WVJA 4KYUA 5JPMH 4A2PA 4GPTA 4OHYA 1KO7A 5BN5A 5DP4A 4AB8A 2FEQH 5AVDA 2QMOA 1YPEH 4I8GA 2JEOA 4QNRA 2W7SA 3QZRA 2QBYA 3VX4A 2ZRGA 2BMEA 1DXPA 1AKSB 3A4MA 4TYYA 2BWJA 3HP1A 3CNNA 2BHGA 4IFBA 1A3EH 3ZZ8A 1II8B 1S4QA 2Y81A 2ZNKH 2ZRFA 3GLGB 4IJMA 1XJCA 3QXCA 5PTPA 4PANA 4PQYA 3L43A 5FI0B 2Y8EA 5CE1A 1GHAG 3FHCB 1XKBC 3QI2A 4WA7A 5B58C 4QHTA 4QL3A 4H42U 3SQEE 2FSFA 4Q1AA 4KSCA 5FCKA 4X2VA 3V3MA 5DYIA 1R5NA 4Q1BA 1R10A 1VCOA 2IEZA 3I77A 1D9XA 1NPMA 1XTSA 4U02A 4Q4JB 2FSHA 3KTAA 5L8VA 4Q4AA 1SXJB 1WSSH 1S82A 1FNNA 1KTTB 2WJJA 1ZNXA 4I31A 5DPAA 4BZQA 5DISB 4IS5A 3U6BA 4A0FA 2ZSDA 5C4MA 2GF0A 3VQTA 2O8LA 5A09A 4M22A 1Y3VA 4B75A 4EJSA 5M04A 4OI0A 4IRUB 2HNTE 3IIKA 2PEZA 2QT1A 2VP2A 1C2IA 1Z6AA 1GBKA 2A5JA 1W0YH 2KBFA 7GCHF 2P93A 2DBYA 4TL7A 3VB5A 2C9CA 3ZZ5A 2CF9H 2GRJA 1DY9A 4AKEA 4LY6A 3HDTA 4DB4A 1AKSA 4WH6A 1XEWY 4MRPA 1ESTA 2EI7A 3F6UH 3SUGA 3T29A 1XNJA 3W8RA 1A82A 2GJKA 1GHWH 1YC0A 1UK3A 1P2KA 1IXSB 3AEZA 3P27A 1CEEA 1QQ4A 4WOPA 4XBBA 1OLOA 2YKGA 2MMGA 1V2TT 4A5TS 3ZZCA 3TRFA 4AB9A 4D76A 3MH7A 2G52A 1GI5A 2V3HH 2QM7A 1KK0A 2F9UA 3BG4B 3I78A 3CR7A 1BTZA 3DMDA 1Y63A 4CRDA 1G7RA 4DSUA 2G9NA 5T1VA 5JFGA 4DCSA 4ISLA 3PM3A 2F1RA 1SXJA 4C2TA 4JLAA 1FQKA 2PR3A 3BB1A 4LJ6A 4EFNA 1HEIA 3TVTA 4CVNA 3JVUA 3LH5A 4ZKDA 1F7ZA 3N5CA 3QGNB 1BKDR 2FU5C 4B74A 3O47A 2XB2A 3O8CA 4Q7LA 2MSDB 4MDEA 2Y7ZA 2ZCHP 2AFIE 2PV9B 5FBEA 6GCHG 2FI3E 1G5PA 4MKGA 1DAKA 2QGNA 1XVOA 5EPNA 2WV9A 1KSGA 1O3MA 3EZ2A 1W0ZU 5JHGB 4QM6A 1SLXB 4BLTA 1RGQA 1KIGH 5B2ZA 3K0SA 1EB1H 4PSAA 3W3ZB 2XCFA 2NPIA 1IQGA 3W3AA 1VCWA 5HZKA 2O0HA 1BT7A 1VR1H 1UVPA 5G3ZA 3TGJE 4AKIA 2AHOA 1OX1A 3GDVA 2ZTSA 1DDJA 3T25A 1WQSA 4D25A 2Y7XA 5FBIA 3NH6A 1AVWA 1ZPCA 4AG5A 3SBEA 1KMHA 1Y5AT 2R44A 2B8TA 1UBCA 1LTOA 2B0FA 3KJEA 1P2IA 2XJ9A 2WTUA 1JAHA 3T2NA 1OXTA 4C9BA 5EU8A 3DO6A 2BXUH 3R8CA 4RD0A 1LVMA 2ZDLA 4D2IA 2WV5A 2W26A 1PQ5A 2NGRA 4CHAC 4Z1MD 1PQ7A 5BRRE 2PT5A 4CH8B 1O33A 3VHXA 4BAOB 1AY6H 3IQXA 1L1GA 1EAIA 4LYHA 4BLRA 2FNAA 1Z5ZA 1WAYB 1NRQH 5JMTA 1MU6B 1PPBH 1GBLA 2AIPA 5L30H 1D2EA 4ZI2A 1CS4C 1YE8A 2WYJA 1W0JD 1V2ST 3SOSA 3EPHA 3QY0A 4F7WA 1YLCA 1W4RA 3SN8A 2W0MA 4BAQB 2VGCC 5TVKA 1KO4A 1FY5A 2JJ1D 1TQ0B
chains in the Genus database with same CATH superfamily
5D5HA 4EF6A 3NIDB 1WV7H 2JLQA 1WKVA 4YLUA 4JBXA 4I8HA 3UB2A 4P34A 1E3WA 2A0YA 3ZYEA 1ODKA 4WK2B 4MVJP 3HO8A 4HWSA 4HNGA 3PA6A 3JRWA 3RUAA 2GZSA 2YWCA 5IVKA 2BGGA 1CGIE 3UGQA 3V33A 2PD4A 1MA3A 4TY6A 2ZDKA 4HN9A 4ISOA 4MQEB 5J58A 3AVZA 1VYTA 4YP0A 1BCRB 3FPHA 3ZJVA 3G5LA 2R1UA 2O07A 4D45A 4CTNA 4M9QA 1PQPA 2H5DA 2R2MB 1T9DA 3HA2A 1J7KA 3Q3GE 3QOWA 1L4MA 1LVUA 4TWRA 4GNKA 1XM1A 2QD2A 1MO2A 5HJ2A 2ZRBA 2OK5A 1DCMA 3P0JA 4JLUA 5JMOA 1EFCA 2JKZA 4IIDA 3I1JA 5TEWA 1F8XA 1RLOA 3IVMA 2JGJA 3HCEA 1E0KA 3KIDU 1M5TA 3KXIA 4G24A 1E38B 4O8ZA 4Y9RA 5G0VA 1AZSC 1H8EA 4O1HA 4ZVMA 4HQNA 1YGCH 5G2OA 2CVFA 4EJ6A 3GCTG 2EYUA 3ELYA 3J81k 4AJEA 2QMHA 3MCZA 4HQ0A 4GX1A 5A0FA 1I2MA 3GVPA 3VKWA 1UXIA 1FW8A 3T8YA 4RTRA 3K6JA 1VPLA 3ISJA 3WLFA 1E35B 5DP6A 2VF8A 2PH7A 3FAZA 5KVQA 3T5TA 3K0FA 5KQPA 3JAKB 3CLKA 4MVJD 4W9NC 2DBQA 3OHPA 2CV1A 4UE2A 1GI4A 3V5NA 4R0NA 1OP8A 1XZLA 1JALA 3SLGA 1RQXA 1PJ2A 3PYXA 4RTLA 3H1AA 4UE3S 1IEWA 3QWCH 3DE6X 1OIWA 1VRWA 4F8EA 4UQLA 3OEEA 3SS8A 3M4JA 4PN3A 1SFQB 1SBHA 4TZTA 4XWKA 2GN1A 2IL1A 1J2TA 4FW9A 3K35A 4Q03A 4PNPA 4AZ0B 3KFVA 3M33A 4G4SP 4EWLA 4IDGA 2QNBA 4ASUA 1UADA 4BMZA 5ITWA 1D2AA 3P95A 2R1TA 4QYIA 5FH9A 1AS2A 3E5HA 1BJVA 1Y7LA 3VSDA 2JA1A 2WD8A 2ZTHA 4ZCRA 2R5WA 1X1EA 1RWMA 2G25A 4LOJA 4MI3A 5IPFA 2GASA 3FZYA 1YQWA 3ZY5A 4JV5B 1WBGB 1LSJA 5C7IO 1EP2B 1V5WA 1XAJA 2Q4EA 1VSUA 3AVQA 2GCHF 1ANKA 1BEZA 3N6VA 3N8KA 1XDBA 5FP0A 1C50A 5HF5A 3A85A 2QNIA 4OP3A 2ZHQH 4IC5A 3DOFA 3KXPA 4PCAA 2PKAB 4M1MA 3TSAA 2ZSBA 3SJ7A 4DYDA 3LI2A 2OCYC 3H97A 2F64A 4CG1A 1IWBB 1H5NA 1QKJA 1RYFA 2REQB 4JOCA 4BGVA 3OPYI 1C0LA 2Q0HA 1ZN9A 4PFSA 2WAAA 1XRMA 4HWOA 5A5EA 3UGTA 4B6JA 1MGPA 2C82A 4YAWA 2XC5A 2CWDA 4QXRA 5BUCA 4A2QA 4YPOA 5LLSA 3NDBB 2WJGA 1R4NB 1U28C 5D7BA 2D8MA 2XZOA 1AXRA 4D3FA 4OLAA 2YS7A 3WB0A 1A8SA 1Z5OA 1TNGA 3X1JA 1K5GA 2WFLB 4ZP1A 1JFFA 1NMZA 2B9EA 1TMOA 2FOLA 3F6EX 3LLSA 3OZEA 4V02A 1SVIA 3W1WA 4GE3A 1QIJA 2JA2A 3D6JA 3GFRA 3K8ZA 4RDHA 2FRXA 2ONJA 5KU1A 1RBYA 3BMXA 3PQ2A 4OGKA 2XGGA 1NI5A 3NASA 4P7GA 1K1NA 5SYMA 1QOPB 2BCEA 5F12A 1C9PA 1HXEH 3RS5A 3W2GA 5KVAA 4JJ6A 2CHUA 3GG9A 4DLPA 1D03A 1L8OA 3OUUA 4PHTA 4N03A 5AOVA 4A5OA 3WB1A 4AUEA 2V3CC 3GG2A 3ESBA 3OECA 3G0OA 1NVEA 2HXYA 3UN1A 2P40A