3O8RA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
molecule keywords HCV NS3 protease/helicase
total genus 212
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8rA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8rA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA03
2YVUA 3TH3H 3BERA 1ELBA 4BFYA 3SU5A 1XCPA 1EXMA 3DKPA 3QF4B 4GCHG 4NCHA 4ASHA 3C7KA 1XEXA 2CVFA 2G81E 2VHUA 2FX6A 3M5MA 3IO5A 2D4HA 4D2IA 1OP2A 3VR5A 3NXSA 3LH3A 3KXIA 3E70C 1GI4A 2F9BH 2BBSA 4HATA 2QTVB 2A30A 1JPNA 1O2QA 3TW4A 1GHXH 1EPTB 4FUGA 1O5FH 1BO6A 1H9HE 1ZYUA 2OC1A 5JWOA 1E37B 4NCJA 1TOCB 1GOTA 1E1RA 3KCGH 2TGDA 1DAFA 2QU8A 1GBAA 2XC5A 4DT7B 1R10A 1TPOA 2TPIZ 4A8JB 4FU9A 1TMUH 3QXCA 1G2LA 4ISIH 3QE0A 3PYHA 1SGYE 5SZKB 1PUJA 5DLQC 3RXDA 3MWJA 3B8JA 4R98A 3GCNA 1C5SA 3LXRA 4TMTA 1C5LH 3SYKA 1TNGA 1SXJE 1C5YB 3P4YA 2ZYVX 2A5YB 1OJLA 1ESBA 2FOHA 4Z8XA 4KITB 3UMFA 3C1KA 3ZZ3A 3P26A 1WCV1 4URXR 4QBHA 1VG0B 3QKTA 1CGHA 3THYB 3N70A 4CVNA 1AHTH 2CL6X 2YKGA 1XRJA 1C1NA 1LCYA 1UFQA 1H4WA 1O3MA 2XXLA 3C41J 1VIYA 1DITH 3EC1A 2ZU1A 1UVOA 4WIAA 2QY9A 1N6OA 3SJ8A 4HUQB 2V1UA 2NGRA 3U1JB 1RPZA 3BTTE 1Z06A 3BB1A 1AWHB 1C5NH 1G3EA 3NEYA 1P2TA 1DG1G 1E79D 5KDDA 2IS4A 4ABEA 2A5GA 1KO7A 5E7MA 3RC3A 3WRYC 2J2UA 2Z3EA 4HZIA 1OSNA 3UMRA 2A4OA 3KJGA 1F48A 1ZBDA 1D9ZA 3PCRB 3GCTG 1ZSLA 4Y8YA 3ICEA 1KI1A 1XZPA 3SFVA 2X2FA 5EU8A 2ZRNA 2GTBA 5EXMA 2BC9A 2AGEX 3OU0A 4G5GA 5L8VA 4XBBA 5EUMA 4JS0A 2ZFTA 3LC3A 1E2HA 4AFZA 1Q22A 4Q4LA 1A2BA 1ZPBA 2NTYC 4PQRA 1W2HA 1P9UA 1IJFA 1KGDA 4TTRA 3JZAA 3EAQA 2GZDA 1XD2B 4FINA 4WZBE 4H1UA 3K70D 1IQEA 1ZHMA 2ERYA 1D9XA 3GFOA 2QL6A 1O2PA 1KO5A 4MDSA 1DAGA 4R2HA 1E2MA 4BECA 1T8LA 3KJHA 421PA 1PVOA 1MRNA 1NMZA 1DOJA 4Q4HA 2BD3A 2UUKB 2BJWA 3ZIAA 3RXRA 1Z6JH 3LAWA 1H8ED 5A5GA 3S9CA 5C2ZA 3HDTA 1BITA 2BKEA 3RU4D 5FBIA 2IX3A 1JECA 1A2KC 1K5DA 3GLHB 2GT7A 1TGBA 4THNH 1O36A 2Z43A 1D2EA 1OIXA 2OHFA 4LYAA 2DCUA 2F9OA 2HEIA 1VCQA 4GOJA 1V2JT 1DY8A 1CXZA 4RVCA 4IEIA 2R2AA 4BZQA 1P10A 1ELDE 5KDOA 1P72A 4QXAA 5FPHA 2RGNA 1OPHB 8GCHG 1DOAA 5LPNA 3AW1A 3LVQE 4P32A 1SGEE 1TLDA 3QSYA 3PEYA 3HR8A 4TL6A 1MBQA 2DFKB 2KSQA 5JWRA 2AFIE 3RMLH 1QRWA 1SLUB 1VHTA 4N1AA 2ZUCA 3HU2A 4P31A 2ZAMA 4TSFD 2EYUA 1I4TD 4GAWA 1R7RA 3K8YA 3TUZC 1Z6AA 1Z8GA 5A2MH 4IOMA 4B73A 4BRUA 4ABYA 1GI6A 2EU8A 1G5PA 2DR3A 1IHSH 5TCAA 4YMTA 1V2RT 1JEDA 2OXCA 2WSSA 2VNTA 4CEHA 3QPVA 2XC0A 3PIRA 3HKIB 1VG8A 1P3EA 3GLHA 1Z08A 3O8RA 1OXVA 4Q7LA 1FZQA 3U9AH 3NDPA 4O97A 3VB3A 4XTRA 2OG2A 4M1WA 4LHVA 3OIVA 1EX6A 4A1FA 1U0LA 2E87A 1KJYA 2NPFA 2NPIA 5L2YH 3REGA 4A8JA 1J15A 3VB4A 4MTBA 2J3EA 1Q20A 5JJKA 1ELGA 1YZLA 1CIPA 1E9EA 2ZRCA 3VX4A 2ZREA 2FV8A 2SNWA 2A2XH 4BFTA 4BASA 2HNTE 4G01B 1TQ4A 3EIQA 4Z1MA 4L15A 1B0UA 1B23P 1KI4A 2HDNB 2AMDA 5C46F 2F43A 5FAHA 2NZJA 5J4QA 4C3ZA 2EEKA 4ZCLA 1E96A 2BDYA 3OEHA 2FS8A 3FYHA 4ISHH 3GCGA 4X8TH 1P9RA 3TGIE 2G52A 1OYTH 1NFYA 2ATVA 3NK8A 1K1JA 4YESB 4IOLA 1OLOA 1G5RA 3GYLB 4PPFA 3VFDA 4BGDA 1P9WA 1XPUA 1O5DH 1P2KA 3UPEA 4FIDA 2HGTH 3S7KB 4LYFA 5IYTA 3RXTA 4ABHA 3U3RA 4K8YA 3D65E 1N5LA 3SJAA 4JLMA 3CUEF 1O38A 2QORA 4HB2A 5CJ2A 2QC2A 3LVRE 1IXZA 1KK0A 1GJAB 1SVMA 3ZZUA 2AKAB 3RMOH 3BTHE 5AUPB 4Z1MD 5E95A 1XKBC 4WBSA 4O3UA 1W36C 1S82A 4JJZA 3URDA 4WF8A 2O8EA 5LBIA 1GL7A 1ETTH 5DP4A 4AYWA 5M04A 1JQLB 3NC0C 3BK7A 2J95A 1NS3A 5T1VA 2FWWA 3RS7A 2WJHA 1V2NT 1NSTA 4A2QA 3MU5A 1G7SA 2X2EA 4CEIB 4K1SA 1C1MA 3RC4A 1N2CE 2ASEA 4Y0YE 1KK2A 1NJGA 1C5ZB 4OQFA 1A0HB 3AVWA 3FZZA 2RG3A 1OXSC 4LV5B 1LQEA 1C2MA 3N2IA 3LO5A 1TU3A 4I8KA 2D2FA 5C4GB 1O30A 2HNTF 5IRCD 3CF6R 2JETB 3OESA 2B9LA 3RXOA 4U2WA 1ZUNB 4NCYA 1HH4A 5BW8A 1C2LA 4GRAA 4PAQA 2Q0HA 5JI2E 4AC9A 2C98A 2YNBA 5CDFA 1C1PA 4BLPA 4EJSB 1A7SA 3R7WA 1NMXA 2OXSA 1G3IA 3BTWE 3FMPB 3V7TA 3ENSB 2GF9A 1BBRE 1AS3A 4TL9A 3L0PA 4ZKEA 6LPRA 3J81k 1LHFH 2QMEA 4DSUA 1KDQB 3B82A 3MCAA 1NY6A 4NFEA 1E9BA 5DH9A 3FHOA 4G5QA 5GIBA 4Q7KA 2ZFSA 2OLGA 5LH8A 4Q21A 3KUDA 3P92A 2ZPRA 3SYNA 1ZNYA 3QENA 2OINA 4PHFA 3PLKA 1CGJE 2AFQB 1J70A 3I77A 1OIWA 4WH8A 2VB0A 2JATA 5EODA 2CCJA 1AUJA 2WKPA 1O2TA 2BM1A 2FFBA 3A8TA 2ZVPX 3T35A 5DNYB 2O0JA 1T8UA 2PZFA 1P60A 4IW4E 4GPTA 1GBEA 4FWTA 3KDSE 1FUUA 1EAUA 4I8LA 2F9UA 3P27A 1O5GH 4M22A 1KJZA 1MAXA 5HE8A 4RKOB 1G8GA 3QO6A 3MNSA 1ELEE 4ITRC 4YO9A 4L8GA 4X2VA 4ACAA 3CZPA 4KFRA 1OKKD 3LV8A 1G3BA 4IBLH 3PENA 2AMPA 2Q6DA 3GLGA 5JCPA 4GZLA 4Q1DA 1ELTA 1GMDG 1NBME 5KNBA 1WYKA 3TVDA 2A0QB 3LC5A 4PPNA 3TJZA 6GCHG 1QJ6B 1XXDA 1ZUIA 2OCAA 1W0KD 3KHVA 2GHIA 3SO3A 4Q03A 1NFWA 4MGYR 1AB9C 5EXTA 4N0EA 4LJ5A 4OI0A 4QOSA 5F8XA 4JIMA 3HPTB 1KY9A 1QHHA 3WHLA 2X19A 1MABA 4UNSA 4I1UA 3LQRA 3W8RA 3LGYA 2Q9BA 1SGPE 1OHHA 3TRFA 3Q3YA 2OC0A 1HY3A 4ZDKA 1SLWB 3KKMA 1E2GA 1DLKB 1UDWA 2ZCKP 2ZKSA 2JA1A 4LWZA 1E4YA 4YLUA 2EFEB 2XC4A 4FVDA 3TSZA 1G30B 1EFTA 1TUEA 2ZETA 1EOLA 3K6YA 3H0KA 1O2LA 4IRUB 5DI3B 3A7XA 1VITF 1MMJN 2IYQA 1T5IA 1QY6A 2QEQA 4X6PA 2GJ9A 3RLFA 1DVAH 4XBDA 4YXWA 1MD7A 1Z22A 4W7SA 1MRSA 1P2SA 4YMSA 4URVR 4BRWA 4AG1A 2UVQA 3K09A 2ZIQH 1P61B 1XKAC 1O2MA 3GICB 3RABA 3MWYW 5F6MA 3M7TA 4LJ4A 1FZZA 2IT1A 4NSVA 4URUR 4B3FX 2FGKA 2FM2A 1GHBG 4RD3A 2P94A 4DIIH 4KAXA 2NU2E 2BD5A 2KJQA 2XNDA 2ODYB 3BWDD 4BEBA 4BWYA 4NA9H 2NMVA 3SU2A 4BZXA 1KY3A 4AIIA 5IK2A 1GJ5H 2A3RA 2O8LA 3JVVA 4DSNA 3BSQA 1BYUA 4PXAA 1ZGVA 1SXJD 4UJ3A 3M35A 1GHVH 1TX4B 4NL4H 3B7GA 1RRCA 1E1RD 4NYMQ 2BQ6B 2GBLC 1TWXB 3CR7A 5C18A 3KN2A 3D23A 2WJYA 4BXSA 3K0EA 3TR0A 5C20A 2WICA 2H9HA 4KVAA 4C7OB 4Q48A 1MTNB 3OSYA 1ANEA 4QC2A 4KLNA 1G41A 3OZXA 1V2TT 3BFXA 2QGRA 3O8CA 3ZD6A 3A6PC 3U3OA 1U8YA 1GG6B 3ZVBA 3ZYDA 2FOFA 3KKOA 1TX7A 3U3JA 1TPAE 3BTEE 1QQ4A 1RW4A 3SE0A 2ZCLP 4UFGH 1BMAA 1E9AA 1NI3A 2F3RA 3EPHA 3FMIA 1X8JA 3EASA 4TYWA 1NJFA 3SGAE 1S0UA 1JQJC 1UKEA 3CR8A 1JJ7A 5EE1A 4X8OA 5DGJA 4HAYA 1H8DH 1MR3F 3TVJB 1AIXH 3PVSA 4R2IA 4DVAU 1W49A 2PEZA 3LOXA 1KI9A 4ISOA 2QGNA 2ZZUH 3MYWA 2YYZA 5DP7A 2OK5A 1DT2A 4XH9B 2ZO3H 4AKIA 3GEIA 3MRSA 2WMOB 1FV9A 3ZZ4A 2REXB 1W8BH 1YF4A 1UF9A 2VA8A 2M5TA 1FY5A 3EWSA 3S9AA 2F9LA 5SZJA 3QQ5A 4OS4A 1O3KA 3EZ6A 3SNAA 1HV8A 1HUTH 4RCYA 3TKLA 3LGVA 4B6FA 4G3XA 1U9IC 1D3PB 3AVPA 2BDGA 4E7NA 4MUAA 4DCTA 1V2ST 2C8WB 1AI8H 1IBRA 4DKXA 1U90A 3PMJA 1O37A 4JLNA 1KXCA 2EFGA 2PBRA 1G291 4B48A 1YKTA 2BY6X 3JZMA 3RDPA 3SQXA 2J46A 4B3DA 1P62B 3QVVA 2Q1JA 3NUMA 2J4IA 2BMDA 3KL6A 5F8TA 5BN4A 2VIPA 3C27B 1RGQA 3BTDE 1MTUA 1TIOA 5HZKA 2ZDVH 3C5HA 1GCTB 2V6NA 1FY1A 3CENA 1C1SA 1O3HA 1A82A 2V7QD 1K6MA 1TFXA 4GNKA 5FTLA 2FMXA 4JMPA 3TK5A 2ORVA 3LX5A 5FXLA 2CBZA 3PUWA 4FXPA 2QAAA 1NN1A 1HT1E 4DLVA 1F6BA 3ECCA 4HDQB 3TU7H 2QMUA 1O35A 4OK6A 1S4QA 1AWFH 1DO0A 4MKFA 3OTPA 3G82C 1QF9A 4XVRA 2WINI 4LBVA 3M5LA 5D3MB 1FNNA 2GJ8A 1A1RA 3H5CB 3LBHA 1YVDA 3D8BA 1Z7KA 5J5CA 3O8DA 2W2XA 1W46A 2D7DA 1P4SA 2ZYWX 2XBVA 2GETA 4CH8B 1E9CA 3IEUA 5EP4A 1E4VA 1OXUA 3UG7A 3I5YA 2YOGA 1VECA 4MNXA 3Q85A 1H9IE 5CITA 4P4UA 3SJKA 2VO1A 3CH5A 1XTJA 2OC7A 1SMFE 5CHAC 1S6FA 3Q3JB 1RXPA 5FR1A 1NPMA 4OM9A 3LH1A 4AZ2B 1T5LA 3SNEA 3SI7A 3PWCA 4MG3A 1NG9A 5AVDA 1FLEE 1OKXA 1Z0KA 3EW9A 4Q66C 2WBLC 5EPYA 2VRWA 4M9SA 4W9MC 1FP7A 4QNMA 2G5VA 1GFIA 1N0WA 1VCNA 4OHXA 1P2NA 4MGIR 3C8UA 4O2LA 1G8FA 4O3MA 2C78A 3NVAA 4FMDF 2LWIA 2ZR7A 1ZAKA 1YLDA 2D26C 3RM2H 1ZW6A 5DKMA 5FL7D 3RSLA 2CK3D 2VH6A 3GPLA 4NPHA 3TGJE 2VHCA 2BDIA 2QP4A 4X6NA 2J7KA 1IQIA 3W6PA 2OBQA 4HYYA 1V6DA 1TQ0B 4ZH8A 2CL7X 4NE2A 2VP9A 1ZRBA 1XDBA 4DUGD 2RCEA 3BH6A 2ZJAA 5C1XA 3GD7A 2HLCA 2ZYUX 1CBWB 1IQHA 2UUFB 2ODEA 2ZU4A 4WAUA 4WXPA 2J59A 2FTLE 2RGNC 4CREA 1P9SA 2W0MA 4HZUB 2CMKA 1LKAA 1S0RA 4M7GA 4FW9A 4KGAA 4Q1FA 2LKCA 3I72A 3QXJA 3GDVA 3QG5A 2CHAB 1EK0A 1IQMA 1BTHH 3HYRA 2Z6BD 4ZKNU 4RZUA 2XXAA 4C2TA 3K1JA 3AVOA 4ABFA 3AH8A 1P2QA 1YQTA 4BQSA 2XOKD 3VB5A 1RIFA 1YR6A 2IUTA 5JSZB 4NGAH 3ATLA 2BJVA 2ZSDA 3SUDA 1YPLH 4QM7A 3TVTA 3CKLA 2JCSA 1M7GA 4JZEH 2R0LA 2WPHS 3ZYCA 2GBLA 2VP0A 4EUNA 1WCZA 3LJJA 1NFXA 4DCVA 3RXMA 2ZRHA 4Y8ZA 4Q7MB 1UHBA 5A4JA 2PCLA 4E05H 1CRQA 2QTHA 1NRSH 1L7VC 2ZQ5A 1QBNA 4HFPB 1HIAA 1G37A 3I29A 4TSFA 2UKDA 1E1QA 4TWZA 4JSYA 1OYQA 4H6SB 2F9PA 1C2DA 1P2UA 4V0ME 1QA0A 1L4YA 1LPGB 2B7CA 2WPDD 3SQHE 3TSWA 3AF3A 1ESAA 3RC6A 1GVKB 4YOJA 3M3TA 2STAE 1GRRA 2ZJZA 3UR6A 1N5KA 2IUSA 3QNUA 1ARCA 1SFIA 2EI8A 4E5UA 3KTAA 1GJ9B 3UMSA 4PR0A 2VP6A 1VDZA 3AVVA 1THRH 6Q21A 2ZHWH 4WXIA 1LMWB 3KEEA 1HURA 3RLYH 9ESTA 4HB0A 2I6QA 1HAVB 3GY2A 3A8DA 3RHFA 1UJ1A 2ANYA 3A1TA 4U32A 5EE9A 3MU1A 3KFXA 2JIZA 1FX0B 1NNEA 4IC6A 3SBDA 3IWMA 1SGWA 2D2DA 4A1XA 1Z8IB 4DDUA 2VIOA 1EB2A 1GBBA 5L3SA 2IBMA 1F5LA 1XJCA 3HKJB 3PEUA 4XJXA 2P6RA 3HJNA 1YGCH 2AD5A 5HMAA 1VCMA 3NWJA 1FXYA 3ZZTA 3BIVH 5TY0A 1P2MA 1MKXK 1Z1JA 1D4PB 4MKIA 1OWEA 2R0KA 3T25A 2WPMS 1OP0A 1HUQA 5J40A 4TMZA 1O3CA 3BH7A 4Q4HB 3WMGA 4FU8A 3T12A 2BMGB 4IDQA 2WKQA 2AMQA 2Y5GA 4XFQA 3PO1C 1BMFA 3FTQA 3ADDA 1C4Y2 2PT7A 3T28A 1Z47A 3K53A 1XTRA 4IVPA 3RVBA 1AZ8A 4LSGA 4Y6DA 1EASA 2JLYA 1XEWX 5LB2A 3QKRB 4ZIRA 5GJBA 4WXRA 2FSFA 2AXPA 3SNDA 1ZU5A 5JCZA 2EWWA 1Z63A 4A82A 1W0JD 3TJOA 2SGPE 1V2OT 2THFB 4XWAA 1GBIA 1K8RA 3SBEA 1W7AA 1SHHB 1ORFA 1P05A 2ILNA 3KUCA 5AJZA 2HRVA 3GEEA 4F4OC 3T2NA 2XAUA 4LPSA 1O3AA 1R5BA 1PLLA 2L0XA 3QN7A 2K5UA 3P4XA 1U0HC 4MVNA 1KDQA 2PUXB 2WUBA 1XUHA 1N8OB 1X8KA 5KNDA 1QL7A 3LX8A 2RGEA 4AURA 2VU8E 2ZA5A 1AKSA 2OCBA 1WQVH 3TBKA 1W4AA 4AX9H 3OIUA 2NWNA 4RD6A 3TK1A 1WOFA 4E07A 3U60B 5T6FA 3BXZA 5KDLA 2AH4X 1JNYA 3FAOA 3DMNA 2G1JA 2WKRA 3LKWA 1UAAA 3T1OA 3CB4A 2R2WU 3SGBE 5DSZA 1F3OA 4JBWA 2FDAA 2IJOB 3MWLA 4YMWA 2BBTA 3QIAA 4NU0A 1K9OE 3M0EA 1C5MD 2FSHA 3DKVA 1E99A 1HPGA 3U2QA 4DZZA 2E1RA 2RA3A 3MH7A 2K1QA 1FNMA 2Z4SA 1AKSB 2VJ1A 1UADA 1YU9A 4ZDJA 3ADCA 4E09A 1A4RA 1UVSH 1E36B 4EDHA 5F98A 4Y71A 2CGAA 2WHXA 3WXMA 3TNTA 4ISNA 2B7BA 2WAXA 1S0QA 5EXXA 4BLQA 1RD3B 1BKDR 1GP2A 1RVDA 4MPWA 2WIBA 4GPGA 3ZJYA 2PX0A 4EFLA 3U44B 1E2KA 4BFVA 2OESA 1P2JA 2B8OH 1BTZA 1N1LA 4OHWA 1C1OA 3U3KA 3W6OA 4AYVB 1ANBA 3WRXC 2YWGA 4OBEA 1GHWH 1US8B 2VIQA 1PV4A 1GIAA 4OK3A 1ZSJA 1AFQC 2QYIA 3K0AB 4R8TB 2EI6A 2GKSA 4HLQB 4HGCA 2Z9LA 3A83A 3CWZA 4YQFA 1O5BB 3CS0A 1PQ7A 1QVAA 4TQUS 2P59A 3HPRA 4NZQA 3Q8XB 2WVJA 1EFHA 4CT4B 1YPMH 2PHBA 1KO1A 3A84A 3HR7A 4OQXA 3QJYA 1PQ5A 1E32A 2RB4A 1AFEH 1C2EA 2P8OC 1Z6XA 4ZUHA 3SORA 3V4FA 1BYIA 1KXDA 1KXEA 3RRNA 1MT0A 2G3YA 4HAVA 4LX0A 4Q00A 3RYTC 3MH5A 1TB6H 3E91A 1ZD8A 3I5XA 3TSOA 2VPPA 2QMHA 2FEQH 3LQQA 1GDDA 2BY8X 2B0FA 3SBKA 4TWYA 1BDAA 1NU9A 5DISB 4DGJA 4EJSA 4ESVA 2DHRA 4I4LA 1A7JA 4B71A 3U8OH 5EZ5A 4K1EA 3ZV9A 1W11U 2FZZA 3RXIA 4LHWA 1T32A 4QJ5A 1ZNWA 1A1VA 1LS1A 1P02A 1B7XB 3MI4A 5E7IA 5AK0A 1D8TA 1FUKA 2QENA 4ZI3A 2BBWA 1HAYB 2PZGA 3TIUA 1JWTA 3QTOH 4ZV4A 4H6TA 1C5WB 3OEEA 2ORWA 4GVUA 2D1JA 3I32A 1J90A 3X2SA 3QPWA 3LWNA 1HE1C 3R9IA 1EP5A 2ZFPH 3RS5A 3F68H 5E2PA 3DA9B 2C8ZB 2Y7ZA 4JLVA 1INCA 3GFTA 3SU0A 2A7QA 5JBBS 1LKBA 4DVGA 1UTLM 2HUPA 3RMNH 3PR1A 3RDZA 2V55B 1CJTC 5ABWA 4GZMA 1OF1A 3WP0A 3NCLA 5B58C 1GNRA 3UOPA 1G9XA 2XRCA 1XTSA 2P95A 3UK6A 1NIPA 2XTZA 1RTLA 1CE5A 3PUVA 4V0KA 1QVRA 5A8ZA 3PQCA 3SZNA 2ERXA 3OFNA 2PSYA 2Y5HA 4JLKA 2PLRA 4P4SB 1X8LA 2H57A 4WMDA 3B78A 2PLXA 2PMDA 3W90A 3HU1A 3H84A 1I2DA 1XX9A 1DARA 1MO4A 1JALA 2C77A 4OQNA 5EE0A 1GWAA 4OYHA 1SBWA 4UEHH 5HCIA 1RJ9B 4LK4A 1V2MT 2D62A 4YMVA 1GGDC 4AG6A 1GI1A 1FQKA 2HLDA 2AN9A 5F9HA 3B6EA 1KKMA 4ZROA 2SGAA 3VQTA 1TX8A 1UTMA 1W48A 1S5SA 4Q01A 4EJSC 1GWNA 3VGCB 1R5OA 5FFMA 5KTYA 4HLCA 3F5FA 3DFLA 1R8QA 5DO9A 2VWOA 1O3FA 3DOEA 2FA9A 1C1WH 1HQCA 4XOIA 4WH6A 1Q21A 1QDEA 3VFEA 1SGDE 2RAPA 1ZP6A 3ZZ5A 1T6NA 1OE0A 1MKYA 3B23B 3K9HA 3IO3A 2FESH 1C1YA 2H5EA 3IEVA 1OB5A 4R0IA 2WSMA 5J4VA 1IN4A 2QG6A 2A32A 4LK2A 4QL3A 2GJSA 3A80A 3GYMA 3CP7A 2J1LA 4LPKA 2ZRDA 4U5XA 3PMHB 3ZVCA 2H18A 4TTPA 2IN2A 2CLSA 3SNHA 2F1RA 1UM8A 1RIWC 1S3GA 3KL4A 4I31A 4S35A 2CN0H 1GBLA 4N3NA 2ZEBA 3P17H 3T61A 4ON9A 2ZUBA 1SB1H 4GMDA 3LT3A 3GCHB 2A5FA 2A45B 4I1VA 3K0SA 1DDJA 1AUTC 1YZUA 2IEYA 4BFZA 2GCOB 2UWOA 3FKQA 4B2LA 4MNWA 4LYJA 1O3LA 4CBNA 2W2VA 2Z3CA 4RN6A 4K8BA 2V35A 1L4DA 4WW0A 2IYVA 1TU4A 3THOA 2RGAA 1KTVA 2BLQA 1C9PA 5BYKA 1OFIA 4FXGH 4TMKA 1O87A 5FH9A 4MYUA 4FUEA 3EPKA 3KX2A 5HZHA 2JJ1D 2CE2X 2HWLB 2XSZA 1W7XH 1C5RA 5BN5A 1ZTJA 3A89A 2DYKA 1XJ0A 1EUFA 4UNNA 5E3HA 1Y5AT 4NG9H 1JJVA 3TW8B 2ZSBA 3LY5A 2BHGA 4X0WU 4K2YA 3TGKE 3U61B 4DLYA 1A4WH 1BIFA 2ANMH 2QXGA 4XVUA 1WQSA 3CX8A 4PANA 1QHRB 4C9BA 4OGXA 1WU1A 2FSIA 4L4UA 1NN5A 3SU1A 4O9VA 3LH5A 2FSGA 1CBWC 4NZLA 1GITA 1G32B 5FL3A 3SN6A 3B9QA 4IXNA 1Q2WA 5K8IA 1IQKA 2Y8EA 1KXFA 2FFQA 4DSTA 1GVNB 3KQDA 3K0FB 5FCRA 1TA2A 1UBFA 3T27A 4RZ2A 4GT1A 4OHVA 5AUQA 2VGCC 2FYRA 4US2R 3BTQE 3AVYA 5LGOA 1VCWA 2QAGB 1T4VH 2A5IA 1C4U2 2DE8A 1XUFA 2VVVA 4L16A 4AG2A 1T8NA 1D6RA 3ASZA 1FIWA 2H16A 2QRNA 4B34A 1NY5A 4JYTA 4TMVA 1SPJA 3AVZA 3KGPA 2O8TA 2GXSA 1P57B 1PPFE 1YPEH 4A4DA 5K7RA 4P4TA 5BN3A 5FR2A 3S0NA 2ZU2A 1GILA 1C5UA 5H68A 4I7YH 4C0QC 4EQ6B 3PO1B 2HCBA 2ZPTX 1GHAG 4RSPA 1T3HA 2ZI3A 4X1NU 4AFUA 1VCPA 5FOTA 2ZJ5A 1UTQA 2XWBI 3R7WB 4DEXA 1E0KA 2Z9GA 5KSZA 2CEAA 2XTTB 2OUKA 2XTNA 4QGGA 1A0LA 2F9MA 4KSCA 2TGAA 2W6IA 5FUWA 1OWHA 2NOAA 4BXWA 1F7ZA 3S1AB 1W5TA 3W3ZB 2AL7A 5JZVA 1TGSZ 2J5XA 3QUMP 2Z3DA 3GJ3A 3AVTA 2ZHFH 5GADl 2Z7FE 4K46A 1DSUA 3SJ9A 1BB0B 5L3RA 3QKRA 1SULA 2ODNA 1II0A 1BZXE 1QL9A 1Z71A 1WA5A 4X1PU 2J0SA 3PV4A 3BOSA 1WF3A 5TB5A 2P3TB 1JBUH 2BM0A 2R6DA 1GUAA 1GBKA 2B8WA 1VMAA 2W26A 4Q4AA 5G41A 4AY2A 2YV5A 1GGDB 2QPAA 1IQPA 1XXHA 4CRDA 2BKUA 3ADBA 1VCOA 1EFRA 2RMKA 1SLXB 2EYQA 1BHXB 1ZYOA 1P8VC 4DW2U 4B3XA 2ZDKA 2O8DA 2IK8A 1Y3VA 3V13A 1V5WA 4ABAA 2XGJA 4GP6A 2W7SA 5EP1A 1YM0A 2FI5E 4LJ7A 2NU1E 1ZMLA 4FCTA 2ZAOA 4GSOA 1Y5UT 4MQBA 2ZU3A 4DSOA 1OX1A 5C1UA 5DP9A 4PSKA 2VTKA 4IVQA 4B2CA 1DAKA 4PHGA 2HYDA 2SGDE 2IWHA 1XPOA 3QKUA 3IQXA 4PROA 2R8RA 3D3QA 1SVKA 2F1HA 4TYQA 1CR4A 4LHZA 3DM5A 2PLFA 2QAGC 1DLEA 221PA 1SQAA 3W95A 3ZIAD 4B2PA 3VR3A 1DICA 1LVYA 1KMHA 3MSXA 1KXAA 4YTAA 3PUXA 2TGPZ 2R6FA 2C03A 3OEHD 3QXHA 4LBZA 3VKWA 3K0CC 1JR6A 1BIOA 1FDPA 2IXEA 5HXFA 4LV8B 3U4QB 1DSTA 1AFQB 1XXHE 5FBRB 4Q5IA 2V0BA 3NDBB 2WOOA 3ZVEA 1Z3IX 2V4ZA 2FWRA 1O34A 4JJKA 3U1IB 1Q1BA 3M7UA 2J7PA 3BFKA 2JLXA 5E2OA 4B35A 1GJ8B 1F2UB 1YPKH 4ZIRB 3UNSA 3L43A 3RS3A 5L30H 1BBRH 2O52A 1BA8B 3ZZBA 1WE2A 3PB1E 3UQOA 1KK3A 1ONBA 1M34E 1GDUA 4A1VA 2O8DB 1V2LT 1GI2A 1WUNH 4BAHB 4ARZA 1UCYK 4CZ2A 4JZIA 3AGPA 2ZGBH 2TMKA 3DZ8A 2Q21A 2BX3A 3NC1C 1M74A 1N6NA 4ZHLU 5BRRE 2DFTA 2QE7D 3F0TA 2GEVA 2R6CA 1FTNA 1DADA 1JMOH 3URCA 4RJLA 4ZKSU 1COWA 2E9SA 3E0PB 2V8OA 3RWMB 3SHFA 2XOKA 1HAXB 3RXBA 3CNLA 5KYKA 1HBTH 1GI7B 1O2HA 1Q44A 3RXQA 1TF7A 1A5HA 4IEEA 1Q0UA 1TE0A 2TIOA 2GMTC 1F2TA 1ZJDA 3GMTA 1FQJA 1WTHD 3NPSA 4UJ5A 2BMEA 2ZJBA 4G5RA 5FUVA 5T6GA 1A3BH 1XTIA 1IJEA 3LD9A 1DX5M 4UFDH 3FFBA 1Q1EA 4NHOA 3P8FA 3VAAA 3DZDA 4XWKA 2QT0A 3U8RH 1CTQA 1LF5A 2NO0A 4QJ3A 2OBOA 2HPQH 1XMIA 3ICQB 5FBVB 2OXRA 2BLVA 3LW7A 3BG4B 3PLPA 1AB9B 2A31A 3A8CA 4YLQH 3U7GA 3A7ZA 2WWWA 4OJKA 4FMCF 3K70B 1BH2A 3NIBA 1TMTH 4IN1A 2ZUDA 1B5GH 3T1QA 3UWKA 5A0FA 4ISLA 3W8NA 1A3EH 2I4IA 1HE8B 1K1LA 2Z94A 3AP1A 1H8EA 3NXPA 2CK3A 2VEDA 3RLWH 1R0ZA 2QTFA 5FX6A 2W2TA 1XF9A 1G6OA 1IQLA 1G16A 5CK5A 1O2UA 4PC2A 4F49A 4Q9JA 1W2GA 1D3TB 4YDSA 1G4UR 2MSEB 1Z0JA 2NO7A 1XTQA 4MYCA 1IY1A 2F3TA 4D8NA 4AD8A 4KFSA 1W1WA 5B57C 4QBIA 1S3SA 1F5KU 1NBMA 1AZTA 4CEIA 1O33A 4X6MA 2AGGX 4OS7A 1HQYE 1AK2A 1ZJ6A 4JLJA 821PA 1O2JA 3SI3H 4JYUH 2FI3E 3CLVA 2XJ4A 3TLOA 4MNYA 1BBRK 3AF2A 2QPTA 2PW8H 4URWR 1TQ7B 1ZIOA 1LVOA 2FO9A 2VYFA 1TEVA 2ZR9A 1YE8A 1P5ZB 1OXGA 1ID5H 1O2NA 2FPZA 3DPUA 2IA5A 3TH4H 2V6IA 2Q9AA 5J4YA 1X3SA 5FTNA 2I6SA 5F8ZA 1EAWA 4X6OA 2GDDA 1XXFA 1LHGH 2BX4A 1TF2A 5HKKA 1R0WA 1P11E 3FPAA 1FTSA 3EA0A 4OI4A 3B8HA 3ZQJA 3PM3A 2HOBA 3TK9A 2GTPA 4M1OA 5C1BA 5FPYA 2AX4A 4TY6A 1ETUA 4G5SA 2ZC9H 2ZU5A 4M9QA 5EZ6B 2OCVB 1VKJA 1S1MA 1R2QA 3SJZA 1QRAA 3DOFA 1O0DH 1CHGA 2FOAA 3LXXA 1SR5C 1EX7A 2ZCHP 2GMTB 1AE8H 1T31A 2ZQ2A 5CIWA 8LPRA 3WNBA 1LDTT 3M6AA 2JH0D 1KKLA 1GBJA 3ESTA 1ABJH 4HLUC 2WYJA 2NIPA 3GLIE 4GOXA 2ZGHA 1CQQA 2QM7A 3FP8E 5JHGB 1SGQE 2G1KA 1IN7A 4DLXA 5H8WA 2PTNA 4YT7H 1CJMA 5FUXA 1BHXF 2GESA 4B2IA 3A7VA 3T62A 4RCZA 1YZGA 2RH5A 1WXQA 5BYJA 2A5DA 2R62A 1L4UA 2ZDMA 3THWB 2ZFQH 4IDNA 2ZJ2A 4CRWB 1SOZA 3IBGA 1GZSA 3KJIA 4HUQA 5C5NA 4V0MA 5JWHA 4K81B 4DT1A 1G36A 1RRFA 1DFPA 3EA7A 2HCJB 1QHXA 3CWQA 4ERNA 1WP9A 1ZM2A 2QAJA 5H4IB 3BIFA 3ND8A 2GK6A 5FI0B 4K69A 4NDZA 4MA4A 5FPTA 5E7JA 2H5CA 1TPSA 1N6RA 5C1YA 2O8BA 2AHOA 5EQSA 2REBA 4MGZR 1AVXA 4FUHA 1KSGA 1A46H 4X2XA 1HAHH 1C2KA 2OAP1 4QG7A 5ETXA 1NT1A 4XVQA 2XBWA 3IIJA 1NRQH 3UG6A 4GOKA 2W6JD 4A15A 3RXUA 2AGIX 6CHAC 1YPHC 3PROA 4D81A 1CT2E 2G0TA 1NSFA 5HR5A 3NBXX 3EAJA 2ZU0C 2A5AA 4CEJA 2WPJS 1DXWA 3K65B 5CK4A 1E35B 5FX5A 3SU4A 2O8UA 3M1IA 4GDFA 2JH6D 4L5BA 1HAOH 1XM1A 5CB8A 1LTOA 5KSYA 4MYTA 2BVXH 1GBMA 1CA0C 2B6HA 3STIA 1UBGA 4AN7A 2QI9C 5AJYA 4JLOA 2ZPQA 4WJG2 3IHLA 1XBTA 2O0KA 1G5TA 4X8LA 1HRTH 2VWNA 4F91B 4LJ6A 3AP3A 4CRCA 3B13B 1KLJH 5GJCA 1NVVR 2XEXA 2PJRA 2FG5A 3VR4A 3FGNA 1ZOMA 5B2ZA 4ASUA 2HNTC 5F03A 3RXPA 3SHAH 5TDHA 3KQNA 1EPTC 2B8TA 2GEUA 1EAIA 1YZNA 2A4QA 4TYDA 2Q6GA 4Y79A 3NKKA 5FBEA 3M3VA 4D0GA 3FP6E 4A6XA 2OV2A 3HPQA 2OFXA 4G5OA 3HGNA 4EQ6A 2FOEA 1C9KA 2JGNA 2FJUA 3SV2H 1U98A 1PLJA 1VG9B 2JLRA 4ZXYH 1XNJA 3IG6B 3BFVA 2IYLD 1OS8A 4JK5A 4XD7D 3BTKE 4PZYA 3SUFA 2GZHA 1GMCF 1CJKC 3RP2A 2DWPA 3ZVFA 4AK9A 4YXWD 2OQ5A 1JOUB 2QBYA 1HFDA 2WOJA 1FPHH 2DY1A 1HEIA 4BE7B 3TR5A 1G8HA 4TLDA 1MV5A 1KI6A 4ZHMU 4MUBA 2ZI7A 4NIXA 1DXPA 1PQ8A 4NA8A 5GPIB 4DHEA 1ZM7A 3Q7QA 1JAHA 2Q6TA 2BQWB 3P32A 1EJMA 4BAMB 4TYYA 4JZFH 3GY3A 4M9ZA 1RTKA 1JXOA 4MPUA 4YOGA 5DHAA 1G4AE 2OILA 3WYAA 4DDWA 1OHHD 3X1XA 1S85A 5G3ZA 4E7RG 2QXIA 1OH8A 2J92A 3BC1A 4BLTA 5L3QA 2XNIA 1GG2A 3CBQA 3DVLA 3HU3A 4C4PA 2FN4A 4PSAA 3BS4A 1GKIA 2ZSEA 1V43A 2AIQA 4I33A 3NBYC 3G0HA 3VNUA 5UKDA 4I32A 1E2EA 5CYPA 1KI8A 2YZ2A 4JVNA 2O5VA 1DE7H 1DPOA 4OJQA 2FIRH 1CU1A 3RS4A 2IOTA 4AGKA 1EPTA 2EI7A 1XMNB 2RCNA 4RD0A 1TTTA 3SJIA 621PA 4QGAA 1IOEA 2BHRA 3UIEA 4Q02A 4HDCA 4PZLA 5E4FA 3H1TA 2QV1A 3QY0A 5K0HA 2WAYA 5JEEA 2CJIA 2G4TA 1GJDB 1ZTKA 1WB9A 1FY4A 1EX3A 2VSXA 1NTPA 5KPJA 5EW1H 3MO3A 2F1JA 3IDQA 1SGTA 5C3NA 2ZS9A 3HK6B 2ZRAA 2XCFA 4D25A 1DAIA 1KAOA 1UDXA 2GXQA 2QAGA 1ZD1A 4AKHA 1RZ3A 3X1WA 4NA7A 4BOHA 2YOFA 1CVWH 1DE0A 4ZKRU 5ANRB 2H2ZA 1THSH 1SKYB 4JZKA 2ECKA 2IS2A 4ESTE 2R3YA 2GRJA 3ZQ6A 1EKBB 2ZP0H 4UONA 1JIMA 4DT1B 1AM4D 2XB2A 2A7CA 1P04A 4DOQA 2WWGA 3CRVA 2F1IA 1UKYA 2BZ6H 4KCGA 1SGIB 1MTVA 4NMMA 5DP6A 3RXVA 2CF9H 2J45A 3DT0H 2BM2A 3EC2A 3UNQA 1ACBE 1OPXA 1BOQA 3MWKA 3KZ1E 4DBLC 4NZYA 5L6NH 2XBXA 3SUEA 4L9SA 1OH7A 1M6NA 2H17A 4RI0A 4HAWA 2JDIA 4D26A 4B75A 2ZRFA 2C8VA 4X1QU 4F38A 2ZDAH 1SQTA 3K9XB 3MLEA 2IYWA 1P0SH 2CF8H 4C0LA 2OC8A 3GY5A 4LC0A 3R9WA 3EGKH 2A5JA 4IXMA 1GVLA 1QZXA 1E9SA 2OP9A 2HVXA 3SQEE 3A1SA 3CRW1 2MSCB 1YR7A 1CHOG 3GCOA 5FOXA 3QKSB 2J38A 3M4YA 1CBUA 1P2VA 2BXUH 4UQOA 1TNIA 1XMVA 2YNAA 4FVBA 2EFDB 3PMAB 4NCKA 2AD1A 1LF0A 1UCYE 3VR2A 2F83A 3LLUA 8KME2 1FJSA 4MRPA 4BANB 4UFFH 1TPZA 2HXSA 1A0JA 1TA6A 1IM2A 4C0AC 2N46A 1HJ9A 3GJ0A 2PUQH 4CIDA 1AD8H 2XZPA 2JLVA 3L0IB 4D9QA 1KYIA 3MNXA 3A1UA 1E2FA 2CE7A 2OSBA 2BY9X 1HYQA 4DURA 4XE4A 3DHKH 5IDVA 3EA8A 5DO4H 2EA3A 4OL0A 2ZEJA 4Y10E 2V6JA 2CCKA 3NBZC 3ITIA 3C14C 1VGCB 1P3CA 1EATA 5KUTA 4BUJA 3C4JA 1N6PA 1RKBA 5JBTA 5ELXA 1T7CA 2VINA 1G2MA 1QG2A 1Q3TA 5DN6A 2OFOA 1ZM3A 1AQ7A 1YR8A 3CNNA 5E0JA 3BEIB 1E94E 3IGFA 2PKSB 4UXIA 3I8SA 3L2OB 1MKWH 1N8OC 4RFVA 2IL1A 4BTUB 1XP8A 4ARZB 5AFZH 3IPXA 4BFWA 1NU7B 1CJVC 4LV6A 1NLYA 2IWRA 3T5GA 2GCOA 1LTQA 2BIFA 3REFA 2Y80A 3L3TA 4UFEH 4MDEA 1QG4A 1BMNH 2H7VA 2ODPA 2ZXUA 2VP5A 1KDTA 2XJ9A 2YWHA 1CKEA 1MO5A 1LO6A 1EB1H 1Q57A 2ZR0A 4ZAEA 4KTUA 1P06A 1GCDA 2RGXA 4NIYA 2QF3A 2PZEA 5KSOA 2B21A 1VZQH 3GLIA 5CHAB 3AVQA 4MDFA 1EJAA 5DE3A 1YRBA 2BDBA 1GRQA 3ZD7A 3D7MA 2QZ4A 1V2UT 4H42U 2WJGA 1Y3UA 2GGVB 2N1BA 1QB6A 3ZZ7A 6ESTA 2WUCA 4JZDH 3AKEA 2H9TH 3Q7PA 1XTKA 1DWBH 3AVXA 3FE2A 4Y0AA 1KLIH 2RGDA 4UXHA 1C5QA 3TLXA 2J0VA 1YKSA 2YHSA 4KO8A 2I3BA 4Y11E 2O8FA 4CYMA 3OY6U 3K0FA 5BXQC 3FFGA 1ZTLA 4HB4A 1O2IA 2F7SA 3GLFA 1G7RA 1ZD9A 1NMYA 1OWIA 3IIMA 3LDXH 3MJRA 3U44A 1LFDB 2V3HH 3EXAA 4LCBA 1W44A 1OWJA 2P2LA 1M9UA 4RY2A 2FPMA 4DCNA 4Z54A 5DHFA 4PHHA 1HB0B 1SOTA 4LZ4B 4U7DA 4QRHA 1Z0IA 4G0NA 1BMFD 2N42A 5JRJA 3Q72A 3RSOA 3QG1A 1Z1IA 4URZR 2KAIA 3SOSA 3ZVAA 1TRNA 5DN6D 2FP7B 5AF9H 4VGCC 1Y3AA 7LPRA 5GJVC 3PG5A 1GVZA 2CMYA 4B2AA 2Q6FA 4KODA 5DIFA 3T1TA 1NVXQ 2QN5T 3WMEA 3EA5A 2ZRBA 1U8AA 2BCGY 4KXFB 4B47A 1U94A 3FANA 4D7FA 1RFNA 2JH5D 3I61A 2P5SA 5GCHG 3A7WA 1MQ6A 1GJ7B 2SHKA 1GRNA 4GUXA 6CHAB 3HK3B 4U00A 1SHYA 1U9IA 5C2JB 3KQHA 1E2JA 3W5JA 1WBGB 4X1RU 3P8NA 1A5IA 2DWOA 2CLDX 4IOKA 3AKYA 3SNBA 5FOWA 3IITA 4HAXA 5SGAE 2PKSC 2FOCA 1OIVA 1BJUA 3AUXA 5LDDC 1AN1E 1LVMA 1CA0B 1OH5A 4X2WA 1CO7E 2XTMA 4DCSA 2ANKH 4FUCA 3W5IA 1CEEA 4KKDA 1GJ4H 2BVNA 1XWIA 2BOVA 1T4GA 4IC5A 2GCTC 1YCPH 1AU8A 3SZRA 4OI1A 3KB2A 3FHTA 2GNOA 1DPFA 5EUQB 4YC7A 3A58B 1E2PA 1AGPA 2ZYTX 2GT8A 3QWCH 4Y76A 1O2SA 2JASA 4O2RA 4D0NA 3BTGE 5J4SA 2GKVE 4IW3B 2JLSA 1GBFA 5FBLB 4IMZA 4K5ZA 3PWBA 4O0MA 1C1RA 4DXAA 4TLCA 1HJ8A 1YYY1 3HATH 3LIWA 2C04A 1S2MA 1XXHB 2PT5A 2BDAA 4B32A 4RZ3A 2BMJA 4CGZA 5JMTA 7GCHF 2BD9A 8OHMA 3BEUA 2XNDD 1FMLA 2ZJYA 4OQLA 3ONWA 1E2LA 1UBEA 3A86A 1Y59T 1EZUC 5AWFC 4XTCS 2FOGA 2H92A 2GJKA 1BTPA 4DIDA 4WVFA 3AUYA 3RRZA 4Z0KA 5BWMA 5L3SB 3TAHA 3CPHA 4LJ8A 1NN0A 1C4OA 3A87A 1C9TA 4ZHAA 2GV6A 2AK3A 3EWAA 3LA6A 2CDNA 1NROH 1Z28A 4Q80A 3B1ZA 3E3TA 2Z6VA 1CF4A 5K8LA 3W9YA 4CR9A 2V54A 4DUGA 4ABBA 4CT5A 1KIMA 3SW2B 3Q76A 4RKFA 3MO6A 1SXJC 2XNSA 1YPJH 2J9RA 1II9A 3LGWA 1AJEA 2ALPA 2BCJQ 2OLJA 1J17T 1VITG 1G3DA 3H86A 4SGBE 1IXSB 3P1JA 2XX3A 2IXGA 2ZGXH 4IDPA 2BDHA 4WZAE 3F9EA 4MRNA 2XW9A 1E0JA 1KZGB 3GEHA 2NQ2C 3RNLA 2JETC 1KZ7B 2O8WA 1N5IA 2A9KA 2XBYA 1BTYA 1I4DD 1SQOA 3F1SB 2BLWA 2YWEA 4PC3A 1O3BA 1OSSA 2ZPSA 3TNSA 4HLUA 2BVSH 2A2ZA 2H6MA 4TLEA 3ZH9B 2ZS8A 2WPKS 5FOSA 5EE5B 2ZS7A 4H4FA 2BDTA 3B85A 4XSKU 2O8CB 1GL9B 4BAOB 3TGPA 1WRBA 1ETSH 2P3UB 2VH5R 2OQUA 1P2OA 1ZVQA 3BIUH 2BOKA 2ESTE 2WIAA 1PYTC 4BTIB 3T5FH 4ABGA 5I46H 2UWLA 2BMFA 1M7BA 2D7CA 3T26A 2ODQA 1F5NA 1NESE 1SSXA 4Q1BA 1YPGH 1S6HA 2AR7A 2RA0A 3ZZAA 1E69A 2C99A 3GY6A 1GI5A 1CJUC 1HNEE 1F0SA 1MOZA 2JLWA 2ZNKH 1U0JA 1O31A 4A92A 1SQ5A 4IGDA 4Y0ZE 3X1YA 3MU0A 4W5JA 2LPRA 2XSZD 3MG9A 4JMYA 2OZEA 1NLFA 4JL6A 4OGYA 2G83A 3TUJC 4X2YA 1MH1A 1SGRE 2G55A 3JZ1B 1UTKA 2G0NA 3AVUA 1Z5ZA 3WYFA 4TT3A 2J87A 3T06B 4PTLA 4HAUA 1HAZB 2QP3A 1J14A 3QZRA 1Z0DA 3M36A 4TMXA 3ND9A 4PO1A 3PFIA 1AVWA 1NVVQ 2W6ID 1R4AA 4Q2KA 4JT4A 2D74A 3FDIA 4V0LA 2Z9JA 1CT4E 2IPHA 1SC8U 4URYR 4DLWA 1E0SA 1ZIPA 5JDUB 4DLUA 4JSTA 2ZFFH 3KQCA 3OY5U 2FODA 3AGQA 1C5TA 5DPAA 3P95A 2O8CA 1KTTB 1Z6YA 1KDRA 1ANKA 1XUGA 2GD4B 4EAQA 1TBZH 1GJBB 1JR3A 5DP3A 2W3IA 1FY3A 4QHTA 1ZLRA 4TYNA 4N0DA 4FUFA 4F7WA 1WTGH 1A5GH 1TMKA 3GJXC 4PO9A 2ZITA 5K8TA 3T15A 2FZLA 1J16A 5GCHF 5HE9A 4Q18A 2QIQA 3RXLA 1EZSC 3M5NA 1QRXA 3SI4H 2OTVA 1RYHA 4TPIZ 3FOZA 4HTCH 5JSZA 1ELFA 2HT1A 4D76A 4CRBA 1DUEA 1Y3WA 1WMSA 1W13U 3ZVDA 1C2GA 3SYJA 2AXNA 3QKSA 5DG6A 1SI5H 3RC8A 2R6AA 1C1VH 3QTVH 1G20E 5AUOB 3EZ7A 5FOVA 2ZHQH 1ZC4A 2AK2A 4P0TA 5TJXA 1MKWK 1TF5A 1EFCA 3N2EA 2AFHE 3TITA 2ZWLH 1QHHB 3NZIA 2OD3B 3OE7D 4TZ0A 2NO6A 5J4LA 2CV3A 4TPYA 1UO6A 2VHQA 3CRRA 1HV7A 5EXLA 4PPGA 3AV0B 2GXAA 2HJGA 2W6JA 1Y3YA 1UVPA 1R8SA 2AWOA 4TZ6A 5HGGA 2VIIA 2FZ4A 2UWPA 4ILEA 2A7HA 3EARA 1AZSC 4K60A 1VGCC 4RD1A 2F9VA 1OFUX 2A4RA 1E79A 4P33A 4OK5A 1TYNA 4WVPE 4LJAA 4AWXA 2G6BA 4C0BA 4D4MA 4WZ6A 1YP9A 2BD8A 1YZKA 1FUJA 2QRZA 1V3XA 1SKQA 3RRMA 1RS0A 4MRRA 1PPHE 1OWDA 3I1FA 4KJZA 3B1YA 2IXFA 1ESNA 4P4SA 1JEEA 3UATA 1ETRH 2GCNA 2EWVA 1K1NA 1NF3A 3RC5A 1RRGA 3VTKA 5HYOA 1HYLA 3LDAA 1GMHF 2HPPH 5AR1A 3OHMA 3DHWC 1TNHA 4JL8A 2FDCA 3UIRA 2ZI9A 3ZLJA 1K1OA 2GAOA 1THPB 4KVGA 4QNRA 3E16B 3RXSA 3FB4A 4GI7A 4DRZA 4C0JA 1KI7A 2BOHB 4F4JA 2A4GA 1MQ5A 1AMHA 3EE0B 2JAQA 1NY22 1IAUA 2F43B 1MTNC 4UDWH 1NRRH 1FNIA 2Q3FA 1R0YA 3QEOA 1KSFX 5JFGA 4L9WA 3RS0A 4A6LA 3A37A 2P0EA 2VP4A 2TGTA 1PJPA 3HWSA 1EQ9A 2GZ9A 3QBVA 3TUIC 1G21E 1S8FA 3KQBA 4E03A 1OFTA 4IFBA 4ZCMA 2CJWA 2FOBA 3B5JA 2C9OA 3GJ4A 2BY7X 3MOCA 1ZHPA 2CHQA 4U02A 2F9NA 4X8HA 4Q9HA 4PFSA 3ADKA 3WMFA 1DUAA 2V3CC 1DELA 4RKEA 1K21H 1XCGB 2SFAA 5DYGA 3W34A 2X8AA 1DVRA 2UZ3A 2Z0MA 1BTXA 4IKEA 1GHAF 1W2KH 1KO8A 5TARA 2V3OH 2QGZA 4XSHA 3A88A 5FOUA 2C9YA 3ELAH 2C95A 3VKHA 3KQEA 4M21A 4R7ZA 1AA9A 3T1VA 2XCNA 1N0VC 3AF0A 1O3EA 2BV3A 1UEIA 1XFAA 1YJ5A 3PEWA 3N7OA 1HAVA 4PO8A 2JLZA 5EP3A 1EJNA 3V00A 1W0KA 2F3CE 5CM9C 1IN6A 1KI3A 1J99A 1CR2A 3CO5A 1GDNA 4K8OA 3D49H 2WPLS 4Z6AH 5E0HA 1CT0E 2SGEE 5KO2A 1NC6A 2PSXA 3UR9A 4CRGA 1QA7A 5CLLA 3WBJA 2ZU6A 3THXA 2FPKA 4A36A 4INLA 3BB4A 1LB1B 4UD9H 4Y0VA 3ZS8A 3U8TH 3UPUA 3GISB 1PPCE 4PAMA 3E1XB 4HB3A 2RDLA 4U01A 3AKDA 4PQYA 1O3OA 4LBYA 5IT5A 3L82B 2WJJA 2RHDA 3E90B 1Z8FA 3CM0A 2O8EB 2XXAB 5TCCA 3GY4A 1GG6C 3I3SR 1XUJA 2CLCX 3E8LA 4M1YA 2NZ8A 2FX3A 2ZI4A 2WJIA 2DBYA 2A2QH 1WBBA 4EPTA 2ZE7A 4V0NA 4IOJA 3B60A 1UTNA 2WPIS 4DC9A 4Z51A 1KLTA 4M1MA 5AFYH 4C30A 4NH0A 1H9LB 2Z4RA 4ZKOU 2VP2A 1S1CA 2SNVA 2IYXA 1M7HA 2YINC 4PX9A 3MUFA 4EPXA 4B74A 1A2CH 3ZS9A 1P12E 2ZRMA 3A8AA 3I62A 3A7YA 1OXXK 4TLBA 4UE7H 4NTZA 3EPLA 2QP9X 1K1MA 4DG4A 5JBQA 1NVUQ 2W83A 1SHKA 1S9DA 1ZR0A 1F60A 1DBSA 2JEOA 3TE6A 5FBWB 1LVGA 1TAGA 4I8JA 4Q7YA 3H2YA 4CRAA 3B1VA 3GOVB 3SHWA 3SR0A 5HM9A 1PPGE 4LJ9A 4TQAA 4RKJB 3ZZ8A 5JB8S 4FUBA 2WWFA 1C1QA 5EXSA 1T3LA 5KU1A 2B5TB 3V3MA 1GI0A 1E98A 3HYTA 4FD2A 4M1SA 2G77B 4PZZA 1X7AC 1R6BX 1W10U 5AJVB 1JXMA 2FF7A 1IY0A 2LNCA 4QGFA 3IQWA 3KKPA 4B6EA 1U81A 3T5DA 3GP8A 1H8HD 5E8EH 4JVMA 2ZQ1A 4A0RA 3THXB 2IYZA 3AF1A 5A0CA 5JYIA 1TNDA 2ZRPA 4JK6A 1E34B 1QGFA 4OI2A 1S83A 2QY0B 4BFUA 4DLSA 2QT1A 3IPYA 5CIQA 8ESTE 1QNJA 1RFLA 2FXRA 3LGTA 1JI0A 1VG1A 5AJXA 5SZIA 2CXXA 2OT3B 4LYHA 1UK3A 1DG3A 4NONA 1DO2A 2FNAA 3UY9A 5HCNA 3A36A 1M8PA 4AB8A 3F9GA 2KBFA 2HXYA 2VHJA 1Q31A 2GVDC 5C5OA 1Z29A 4Q1AA 4LY6A 4KU4A 3U98H 3PV2A 1XB2A 2D06A 3VXFH 3LLMA 1YBWA 3OF5A 4JKYA 1C5VA 1MCVA 3SJOA 1K5GA 3SU8A 3PUZA 2CL0X 2CNWA 4I1OA 3RXEA 4ABJA 1AQYA 3G5UA 2V9PA 5JB9S 3A7TA 2YOHA 2CJWB 1E0AA 1GMCG 3TMKA 2O0HA 3EQ0H 5FCKA 2VIDA 2FS9A 4JBYA 4TTQA 3KJEA 3SFZA 2IYYA 3D62A 2IUUA 2ZM5A 5B64A 2FEMA 2C4FH 2GEDA 4XD7A 1T8OA 2NG1A 2D2EA 3I73A 1QHNA 1DM4B 1TMBH 3U5ZB 1QL8A 4ZCIA 3MH6A 1UVUH 2R3UA 1C5OH 5LD2B 2HF8A 521PA 5JHHB 3QUSA 1L0ZA 1ZMJA 1T8TA 1Z0FA 1TRMA 1L4ZA 2P65A 3V12A 3K9GA 4IDHA 4K3JA 1KK1A 2OO7A 1SL3A 3KQKA 4ZMAH 721PA 2FYQA 4M53A 4Q4JB 2GILA 2IS1A 3GJ5A 4OHYA 5FHTA 2FX4A 1TALA 2VWMA 2GV7A 1US8A 2WV9A 4AI6A 5LPEA 1IQJA 2VBCA 1ELOA 4AGJA 5GWZA 1AGRA 1ANDA 2B92A 1MKXH 4Q1CA 1W36D 3TPIZ 4F4CA 4FMBB 1D9IA 1ZINA 1DANH 5DYIA 1EESA 1WV7H 5JBAS 2ZDNA 1BCUH 2VLIA 2KI5A 4ZKDA 3PEVA 2QM8A 4NYMR 1T0JB 1H8IH 2JJ8A 1AY6H 1MTSA 1Q1ZA 1SVLA 3GLFB 3GDSA 2ZROA 1G1MA 1QBVH 1TQ2A 2BDCA 4Y8XA 3FMOB 4FI3C 4OKSA 4MRVA 1F2SE 3VNVA 1GHYH 4H1VA 3U6BA 4UNPA 2O9QA 4HI0E 3FKSD 3I78A 5DI3A 1C5PA 5C4MA 3SNCA 4QBFA 2HJVA 4ZPXA 1HAPH 1ZMNA 3SUGA 3S1AA 4MPXA 2WM9B 3AP2A 1F5RA 1DY9A 4IVRA 1MAYA 1MU8B 4AYTA 3LU9B 5G53C 3RUOA 3UQVA 1KSHA 4KFTA 2JIZD 2XYAA 4MNVA 4FCWA 4D0LB 1GAJA 3E2IA 3VMFA 1FY8E 3FWYA 1T8MA 5FL7A 3V9PA 4IDOA 1L1NA 3GJ6A 2STBE 3BAFA 2BD2A 1N6LA 1TNKA 5CDFE 1X86B 1F2TB 1Z2CA 1DS6A 4X1SU 1QCPA 3K9NA 3RXHA 1HCGA 1BTUA 3M61U 2ASUB 1SVIA 2XZLA 2HALA 2OCPA 5E0GA 2C93B 2HT6A 1CSOE 1RIWB 5I25A 4B2BA 4KLZA 4HUTA 1N6YA 3E1SA 1E38B 2F55A 3FKSA 1JIRA 4LHXA 1JRTA 1ZCBA 5JEDA 1P01A 3C5CA 4X8MA 3GCTF 1I2MA 3B9PA 4EPRA 1L2TA 2ZHDA 1U6QA 2ZGJA 1NG1A 2W0SA 2ZE8A 1NKSA 1HXFH 4WA7A 2I1QA 1KAGA 3RAPR 4B1TA 1SLVB 3CF2A 1EZQA 1NL3A 4JLPA 3UOUA 2J41A 2IYTA 2O8BB 1H8HA 2ZDLA 3A82A 3CRMA 2ANBA 1TRYA 1O5AB 2KB0A 4TWWA 1HGTH 1AO5A 3PTNA 2WV4A 2G88A 2VH0A 1J8YF 3NKVA 1II8A 1UTJA 3VGCC 2JJ1A 3SDZA 1IAQA 3BE4A 3HGPA 3VHLB 3ZZ6A 2A5KA 4OQMA 1Q1QA 1EG7A 3ODFA 1TABE 1GBDA 2W7UA 2G9NA 1YCPK 1ZJKA 1CS4C 3RXGA 1TNJA 3TQCA 2H5DA 4NYJQ 1MCTA 8GCHF 1VYVA 1QIXB 1C1UH 1Q12A 1O3NA 2O8FB 1IQNA 3SN8A 1S9HA 3RANA 3ZDQA 1GDQA 2IF0A 3MFYA 1AKYA 1TBRH 1P73A 2H1LA 4AG5A 1TQDA 2PTCE 1QFKH 3ZGXA 2FPLA 2BQ7B 3U3MA 1BRCE 1DAMA 2JLQA 2LKDA 5A09A 1GSIA 1LPKB 4D80A 2DE9A 1E2IA 1T3SA 1C4V2 4II7A 2A1DB 3P8OA 1P3JA 4KYIB 5PTPA 3CZQA 4B3BA 3KIDU 3FVQA 1PYTD 3ZVGA 1C2FA 3H09A 3GCHC 1W7GH 2FLBH 5JECA 1PLKA 1GCTC 4GFDA 2G51A 3IBYA 1FPCH 2IC5A 1FAKH 2RGGA 3GLFE 1E9FA 2KAIB 1F0RA 1W4CA 2KWIA 1RE0A 3ATWA 1Q3HA 5A0AE 2PFEA 5BPEA 3D31A 3TH2H 3H7TA 1LVBA 2GZ8A 2VIVA 2REOA 3WY9A 1NZQH 3DL0A 4TL7A 3AB3A 3MU8A 1P03A 3GJ8A 3CX6A 2XWAA 2R9VA 1XJQA 5EG4A 1UMAH 1PPZA 3E0NB 2BWJA 5EQTA 3Q00A 1GHBF 4NYJR 1FW6A 1Z6GA 1AKEA 1E6CA 3QPUA 1OYWA 2HF9A 3CH4B 1KSJA 1D6WA 1WAYB 1F0TA 1XD9A 3Q5EA 1Z07A 2HLDD 3RWOA 1JXPA 2FEOA 5L2ZH 1RRKA 2BZAA 2DFLA 3U7HB 2BEKA 1EOJA 1SG8B 4F93B 4H9GA 1ZRHA 1SKYE 4JLDA 1KOFA 4QHYA 1GKUB 4DLTA 2CCGA 3WYGA 3VU9A 3MHWU 3LBNA 1IXRC 1D3DB 4TY7A 3L33A 3STJA 1GJCB 1LHCH 1YC0A 3PITA 2F6RA 1XUIA 4RD4A 4R71A 4LBWA 1P9NA 3L0SA 3DM9B 4XSGA 3OFND 4PC6A 2XB4A 2BVRH 4ABIA 1TL7C 2Z83A 2PKAA 2FOMB 1HA3A 3L8YA 2GDJA 3B1WA 3K09C 4O25A 3A1VA 1BT7A 1N25A 2C8XB 4ESHA 3TNFA 5EGMA 4WMEA 1ZNXA 1G3CA 3LGIA 3KQLA 5JRZA 4B3CA 2V7QA 5JBCS 4EPYA 1N6KA 3UWOA 2QXHA 2BBOA 4LGMA 3CPEA 2EW1A 5CM8B 3L8ZA 1G9IE 1W4BA 3QF7A 4D4JA 3P6ZB 3GLGB 1AQUA 4NIVA 3PXGA 1K1IA 2PEYA 5G40A 2TRMA 4D7GA 1BRUP 5BQ5A 1O3GA 1D5CA 3UANA 4B33A 3SQWA 1OWKA 4S2EA 2G4UA 4DIEA 5EW2H 1VR1H 2ZRJA 3Q9LA 4C0HA 3BRWD 3R8CA 4YOIA 2H9EH 3Q77A 1WSSH 1UCYH 3BEFB 1IHTH 2YOLA 5B6OA 3VPKA 3F9FA 1OW3B 2ZRKA 1FI8A 5KOYA 1YCPM 1OV4A 4ABDA 2FMJA 2BD7A 3K6ZA 1O3PB 4Q19A 2R6GA 4OS5A 2ZE5A 2OCYC 4GHQA 1LW7A 3IKJA 1V2WT 2G5NA 4D9RA 5GXPA 2ZRGA 4GHTA 5A8XA 1II8B 4LOAA 5HKKD 3QBTA 2GAAA 2P5TB 1O2XA 1BQYA 1OOKB 3PMBB 1YZTA 2WYGA 1MU6B 2FGJA 2ODBA 1W12U 1ARBA 5DJ7A 2VL7A 2QF0A 4GSYA 4LZ1H 4ZO4A 3VKGA 1RRPA 2SGQE 1N5JA 5AJWA 1ZMXA 3UXMA 3NHAA 2JJ2D 2D8WA 2VVCA 3QOFA 3CRQA 1SVPA 3AW0A 1GBCA 1CRPA 1KI2A 2ZI6A 5JPMH 1G8YA 3QDZB 4AFQA 3EIHA 2RGBA 1GMDF 4ACBA 2GZAA 1BS1A 2H8KA 2ZSAA 3O47A 1XD8A 4UNRA 4WXVA 3OE7A 2W5EA 5H70A 4DJZB 4M1TA 4DB2A 1MUEB 1LQDB 2IYSA 3M37A 4CH2B 1AN0A 3KF2A 5JJIA 1K2I1 3U7EB 2FLRH 4Y7BA 4DIHH 3RXJA 2ZTZA 4FUDA 3TIFA 4YMUA 1SVWA 1TADA 1VHLA 1W3CA 1A5TA 1Z6TA 2BEJA 2PCJA 3CONA 3PLBA 3MNCA 1J2JA 1SXJA 3VB7A 4RD2A 4Q9LA 1KY2A 2ODWA 1J7KA 2ANWA 3AM1A 2JDID 4AB9A 1Y5BT 2DB3A 1ZRKA 1KTSB 3FP7E 2CHVA 3FZDA 1EXFA 2ORIA 1SGNE 2Y6TA 1QB9A 4Q47A 3QGJA 1O5EH 2VSFA 2NU0E 4WWYA 2ZF0H 1JR3D 1G64A 4JVLA 1Z83A 4FMCB 2ZIAA 4NBSA 4NWLA 1XX6A 4AKGA 1JR3E 1PZNA 3IIKA 1W36B 4HI3A 4ZXXH 3SYLA 3SS8A 1SVOA 1G18A 1J8MF 5A8YA 4O03A 4BAQB 1FAXA 4I81A 3VB6A 1GI3A 3L0OA 2GF0A 2ONKA 2QPOA 1FL9A 2A78A 1MD8A 1TONA 1ZSKA 2WWHA 2RHMA 1G19A 4JYBA 5B30A 3B9FH 4D6PA 4BLRA 4P3YA 3FHCB 3ODDA 3FMFA 1XPRA 1TBQH 1ESTA 1NRJB 3MU4A 1C2HA 4VGCB 1BTWA 3MH4A 4RZXA 4I1SA 2QROA 1ZUHA 5F2EA 4CF7A 5LPFA 4OS6A 3AEZA 1UVTH 5EXPA 1Z6EA 4B43A 1O2OA 2WTUA 4Q4JA 4B76A 2F91A 2ZI5A 4FWIB 3SU3A 3M5OA 2ZRLA 1DWEH 3M3SA 2ANCA 4M9XA 4MLFB 2DWQA 2VHTA 2PKAB 4HLDA 4D4KA 1C2JA 3AK5A 1X1RA 2P67A 1XEXB 1CULC 4FMDB 5CE1A 4IS5A 3Q5DA 4I8GA 3D6TB 4US1R 3QLPH 5A0BA 4Q7JB 1SGFA 4FCVA 2XITA 2ZFRH 2GCTB 3A4LA 4US0R 3ZVMA 2ZANA 3K2UA 3KXKA 1G8PA 4BLOA 1OP8A 1GKYA 3GY8A 3KKQA 3U6KA 3JVUA 1IOZA 4JLBA 1XD2A 4YONB 1GL0E 3S69A 1Z8JB 2IYRA 5GJWC 2XZOA 5TVKA 2IYUA 4V0OA 5LD2C 2FOLA 2X77A 1E0FD 1ZHRA 4MPVA 3CPJB 2Q9CA 1T91A 4QGHA 1KMQA 1XEFA 4A0FA 1GTVA 2QBYB 5LB4A 1HAIH 2OBNA 1EWRA 4GCHF 3KXLA 3WNDA 4K1TA 3QF4A 2ZG0H 3H7OA 2IW3A 2EFHB 1O2GH 1CR1A 2GA8A 3CF0A 5FTJA 1E9DA 3H4MA 2ZHEH 2GJAA 3MAAC 2QA5A 3OIYA 1JPJA 1G3RA 4BZPA 2YNMA 2QSYA 4A0HA 4IFEA 1JB1A 2KBEA 4HEJA 1QJ7B 3SJCA 2ZGCA 4PC1A 1S96A 1RJXB 1ZU4A 1BRAA 2ZECA 4D4LA 3RXCA 3DD2H 1XCMA 3EZFA 2C3SA 2AIPA 2Y81A 1WXRA 1ZZZA 4OS1A 3LBIA 3DEFA 2R65A 1NVWQ 2AS9A 5GVSA 3GLHE 4U30A 1UJ2A 4GMXA 2PR3A 1QBOA 2IJD1 1O3DA 3Q3KA 1EFRD 3QX5H 3U4QA 3LNCA 1QHSA 2NO9A 2MMCA 3UKDA 1B0FA 3KKNA 4SGAE 3BB3A 1PPEE 1SGCA 3ATKA 2BTCE 4V02A 4E06H 3R3GB 4MKHA 1OXTA 5KPDA 1KO4A 1P09A 4A1TA 4JL5A 2DPXA 2Z9IA 2H1UA 4NIWA 2KE5A 1SFQB 3P70B 4ASUD 4M4SA 3VHXA 2WSSD 1H65A 3CIOA 2BB4A 4M9FA 1KHTA 4GBMA 3LPRA 3NG1A 5DGXA 4F92B 2BD4A 3CNOA 3IHWA 1TGTA 3U7FB 1T0HB 1MBMA 3GY7A 3MWIU 1Z2AA 5CMXH 1PUIA 4NKRA 2OUAA 1F92A 3ZYEA 1MZAA 1O3JA 3VX3A 3Q3XA 4XIGS 3QK1A 2B7DH 3MMPA 4OHZA 3RXAA 4DY7B 3IUYA 1XUKA 4YM9A 1YHNA 4LOYH 3SU6A 2VWLA 3GFPA 4PPQA 1O3IA 2A7JA 1ELCA 4O3TA 2EQBA 1U2RA 3GDUA 2OFWA 4MKGA 3LFUA 3I8XA 4JZ1A 1I4LD 5J4KA 2JLUA 3SGQE 3SV8A 5EQQA 2EVWX 1QURH 1O32A 2P3FH 1W4RA 3F6UH 4JCNA 1DTSA 4MQAA 4X8SH 1G6HA 4BFSA 1OFHA 4A5TS 1TNLA 4LJYA 3QZQA 4QBGB 2BXTH 2GP9B 4CRFA 1ZPZA 1QHIA 5FPKA 3AF4A 1EGAA 1NBMD 3QEJA 1XVOA 3DUXH 5G4BA 1DAHA 5C67A 2WJVA 2PL3A 1U99A 2ZTSA 3VR1A 3TAUA 2GK7A 3EIEA 1AGJA 3BG8A 1RYFA 1KDPA 2UZIR 2IHYA 1FN6A 2CNWD 3PV5A 5JJLA 4PC7A 3FVFB 6GCHF 1W47A 7ESTE 3V4RA 5IDKA 4RSGA 1O5CB 3EA9A 1P2IA 2PWXA 5ESBA 1O2KA 4DDVA 2ZJ8A 4PHTA 1ZPCA 4C7OA 1YRAA 3LGUA 4HAZA 4DEYA 3QI2A 4MH0R 1O39A 1IHUA 4DCUA 3BV9B 4ZI2A 5GNDA 1NRPH 4IN2A 5F3WB 3RM0H 1D3QB 1V2PT 4KTSA 2W00A 5T3HA 2GZ7A 3N5CA 3A81A 1XEWY 1HAGE 1UK2A 1C5XB 3JZ2B 1M1YE 3ZVRA 5KHOC 5CLQA 1MABB 3SV6A 1IN5A 3KTAB 5FTMA 2WPDA 2AEIH 3CX7A 1QB1A 1NN3A 4JYCA 4W5WA 5GJ4B 4IJMA 1DEKA 2GX4A 3OEED 1EP6A 3NTUA 4LXBH 3R8FA 3ZZDA 1E1QD 1KNQA 4QKQA 4LC1A 1G17A 5JS7A 2QA9E 7KMEH 1ODFA 2ATXA 1IONA 2RKOA 5AHGH 3DDCA 3MGCA 3M7QA 2YC4C 2WWIA 3R0FA 4KV9A 5DI9A 3GQBA 2ZTYA 1WQ1R 4J2YB 4IMQA 4KBGA 3UREA 4JYVH 1HT2E 4MYHA 2CVHA 3UFAA 3OX7U 2OAQ1 2J94A 2V1XA 2FI4E 1HJAC 2IF2A 3BJIC 3ATIA 3KB1A 3VU9B 1N0UA 4PAOA 2PGBB 1D2MA 3B1XA 5F9FA 1KDOA 1COWD 3B2EA 2IS6A 2C8YB 3THWA 4AORA 1Z0AA 4PQFA 3QXSA 3K9LA 1PJRA 3E5HA 4G1UC 4LI0A 1NM6A 1OH6A 4EFMA 2CHGA 1IQGA 1RC8A 1H1BA 2FH5B 3SOPA 3I92A 3L6PA 3MJHA 1PFXC 4A0GA 4WY3A 1L1JA 2J0UB 1B0EA 2X1VA 5J4HA 1N3BA 4EPWA 1F0UA 1GBHA 1D2NA 2PX3A 1AIPA 4GLYA 3S7HB 4AYYB 3PJRA 1UEJA 2MSDB 9LPRA 4OS2A 2GDEH 2J7PD 5IHPA 2VSOA 4A6PA 5DP8A 4KTCA 3UNRA 1RJ9A 2QSZA 2ONJA 1C2IA 5EOKA 4RFSB 5EP2A 3U69H 1D6JA 2P6NA 1K1PA 1V2QT 1EFUA 1T4UH 1KIGH 1R5NA 1IQFA 4UNQA 1NO9H 1MH0A 2EC9H 5FUYA 4A2PA 4JT2A 4Q9IA 5GDSH 2Z5FA 4CW7A 4Q7ZA 2JKHA 2P3SA 1KI6B 2W58A 1JRSA 4EKDA 1UBCA 4YZUA 3SV9A 3K0CA 4MRSA 1VIAA 4CEJB 4UXJA 2DUCA 4J1YA 2WMNB 1J9CH 2P8OB 4NCIA 4TLAA 3AAUA 1TX6A 5D3QA 1KXBA 3BG4C 4NFFA 3ZZ9A 3EPJA 1S81A 3SZEA 3BH0A 1BRBE 2NO1A 3MTYA 3LW8A 1EWQA 4TQ9A 4A8JC 1UKZA 4TMWA 4INKA 1J8AA 4NWKA 3NEJA 2GCHG 4CHAC 2QNRA 3SC3A 3WY8A 2ZJOA 4EPVA 2WZQA 3BGWA 3NH6A 3GLGE 3VXEH 5CB6A 1V2VT 3NHBA 3RXKA 1E2DA 3IILA 3TH5A 2GWHA 1SHZA 2JJ2A 1FMJA 4YLGA 3CS7A 4XWOA 1W14U 3KQUA 2GVFA 2QN6A 1O2YA 3EYDA 3VEQB 2O8MA 2QUZA 1NN6A 1YR9A 1ABIH 3THYA 1G3UA 1TGNA 5CJPA 2VGCB 5AUNB 4KP0A 4HZHA 2MMGA 5HM2A 3VR6A 1UTOA 5H1YA 4X8VH 3MNBA 1GI8B 1TUIA 1ESMA 4J0QA 4DLRA 1O2ZA 4Q7XA 1L1GA 3PV0A 1PPBH 2QE7A 1FMGA 4LDJA 4HSEA 1GI9B 2BYAX 1MTWA 2I1VB 5SZHB 2OBLA 5FI1B 3QGNB 4Q4AB 1M2OB 1X6VA 2RGCA 2IHBA 1V2KT 1LV7A 3G01A 2WV5A 1GNPA 1JBKA 1O2RA 2BLOA 5HPYB 3OIWA 4MGKR 5FBQB 1E2NA 3OAAD 121PA 4TYPA 5HTKA 3CW2A 5KNCA 1VCIA 1ZC3A 1K28D 1GM5A 2OLKA 4XBCA 2ZVQX 4GL2A 1KMHB 2WWXA 3EG5A 2ALVA 5FTKA 4AFSA 4CEHB 3X1ZA 1QQUA 3SJBA 2Z9KA 3DFJA 3I4LA 3BN9A 2WWYA 1W5SA 1ELVA 1PQAA 1HLTH 3NBFA 1GMHG 1TAWA 3WBKA 1Y63A 1EZXC 1Q3XA 4FUIA 2R44A 2ZSFA 1TPPA 3QXXA 1VITH 5J47A 1Z8RA 3OTJE 1ZM9A 4UKDA 1VJAU 4CBOA 1UHBB 2QXJA 1GHZA 3PUYA 5ESTE 4DDTA 1E9RA 3GJ7A 3RMMH 5EJEA 4LUCA 2Y82A 4NYIR 1XMSA 1BMLA 1XU4A 3F8TA 4V03A 1VPLA 4M8NE 1NKTA 2GCPA 3A85A 2GVZC 5TV2A 2FFHA 1YLCA 4KSBA 3F9HA 4B44A 3R9XA 4M0LA 4NP6A 2C9CA 2D3WA 3TQFA 2TBSA 4QFMA 4NSYA 2FFAA 5LPRA 1Y3XA 3TJUA 1FONA 3AASA 2PJZA 3W3AA 3SHCH 2R9PA 1L8QA 2J9NA 3X1DA 3LJOA 3UTUH 1EAXA 4QJ4A 1IN8A 2EFCB 4QM6A 4C2UA 5P21A 4EFNA 1TQ6A 1SXJB 1YZQA 3MD0A 1ELAA 4M2LA 4BAKB 1ZNZA 1VTKA 5DP5A 1LHDH 1BUIA 3KNXA 1QJ1B 4YT6H 4QT8C 1X1SA 1GPZA 2YJTD 1UPTA 1CR0A 4BLSA 4QHSA 4PSVA 1N6HA 1E3MA 1FX0A 1YPHE 1KSNA 3F3YA 2J0QA 1QBKC 1DWCH 4C0SA 1OB2A 1CP2A 2OEPA 5L3VA 1O3YA 4Q1EA 5IK2D 3AQ4A 3P8GA 1SVSA 2C5LA 5JS8A 2C90B 2VIWA 3BORA 5CYOA 3KFVA 1G3MA 1IY2A 4AOQA 1GNQA 4DWJA 2NU4E 4ZDIA 1QHYA 1BMMH 4X8UH 4JLAA 1DS2E 4B3GA 3EZ9A 3PTBA 4INHA 1XMJA 2OBMA 1LHEH 4Y7AA 1C1TA 1TEXA 2OM2A 4LHYA 3UUZA 2VQSA 4JKIA 1NRNH 2AWNA 1QRZA 2QQ0A 3DMDA 4Q9KA 4EIWA 1UTPA 1AZZA 4XOJA 1P75A 4DJTA 5IF9A 4F4IA 3LONA 1NIJA 4KI0A 2VVUA 3T34A 4C0KA 3A4NA 2PH1A 4XDEA 4TT3D 1HTWA 2LCFA 2Y7XA 3C15C 2NU3E 1GL1A 2VF7A 2W3KA 4POAA 4LRWA 2OE2A 1G7TA 3UWJH 2F4LA 2ZE6A 1W0JA 2SGFE 2CXVA 3ETLA 1CA8B 4JBXA 1AS0A 1FFHA 4CR5A 1CHOF 2GCHF 1OT3A 3A8BA 1QTFA 1MO3A 5K8UA 2UUJB 4ZDWA 3MMGA 1KYNA 3V0XA 1DWDH 4CHAB 4BNRA 2FE4A 1BOFA 2C2HA 4HDOB 2QCYA 2R2MB 2YC2C 4AKEA 1FPMA 1Y8TA 4NCNA 5JLJA 3AKCA 1W0YH 1SGFG 5EQRA 4YDHB 4FUJA 2AYWA 3TK6A 5TMPA 4LZZA 4WOPA 3W6NA 3NWUA 3SV7A 4BFXA 1WBDA 2VF8A 1JAIA 5B6LA 1AE5A 3O8BA 5D3MA 4KBFA 1AVGH 2Q3HA 1ANCA 2HV8A 3LRPA 1QR3E 3T29A 1OKKA 5G3YA 1XZQA 1N6IA 4DLZA 1CGIE 3C16C 1P7CA 1NLZA 1KJWA 1CLUA 2YWFA 1ZGIA 7GCHG 2G00A 1W0ZU 1A61H 1VJ9U 1NFUA 1FP6A 4A9AA 5EE3A 3K70C 3NH9A 4JVSB 1LPZB 3S9BA 1NP6A 3RU4E 3BF6H 1UKVY 2J0UA 3BD9A 1R0XA 1O2WA 4BEJA 1LNZA 4TL8A 3RRYA 2DFNA 3BBPA 1KNXA 2ZTXA 1BJVA 1GBTA 3P20A 1RTFB 1MZDA 1TOMH 4FN5A 1FOEB 3ASYA 3TJVA 3K0AA 1G7CA 4TN1A 1U8ZA 3ZVLA 3W94A 2P93A 4AYXA 5FPSA 1LS6A 2AKYA 2ZRIA 5T6DA 3RS2A 1FQ3A 1N6XA 5JI3E 2PV9B 2P6UA 5EXNA 3ATMA 1S84A 1VYTA 4M1KA 3TJNA 1OYYA 3AAVA 5DK1A 3EDXB 4GP7A 3BTME 1L2EA 4I99A 2HYIC 2UUYA 2QMOA 2FTMA 2PGQB 2Y5FA 2IEZA 4HZUA 3OAAA 4KHZA 4DB4A 4NYIQ 3ZZ0A 4DCDA 4Z8YA 2QQEA 4I8HA 1TGCA 3R20A 3RU4T 3QVUA 3MFJA 3WHKA 4WMFA 1HJAB 1VYUA 4FU7A 5KSPA 2PMKA 4W5HA 4KYUA 1HDTH 1QHGA 3WP1B 2AERH 3UWIA 4D82A 1F2UA 1DAEA 1GL6A 3MO9A 2FU5C 4MITA 1E2QA 1LY1A 1XVMA 1FIZA 2J34A 2BY5X 1T9HA 4KELA 1ZCAA 1UK4A 4IHQA 4CDGA 1ZM4A 2G8TA 2CHAC 3GLIB 5L3QB 1HIAB 4KFUA 1O2VA 4R9UC 3HP1A 1MO6A 1WDTA 4BPBA 2ZI2H 3OYPA 3A1WA 3EX7C 4A2WA 5EPNA 3ZV8A 2Q3MA 1GJ6A 3A4MA 1SZPA 4A7IB 3ZZCA 2P16A 1P6XA 2C96A 3BTFE 1HXEH 3WNCA 4E22A 3ZVNA 4BTTB 1G3QA 3RXFA 3E6PH 2GXUA 3FFAA 4RFSA 2ULLA 1FN8A 5GVRA 3DO6A 5TXGA 3SEAA 1K22H 3EZ2A 1AS2A
chains in the Genus database with same CATH superfamily
2YVUA 1ZSNA 3TH3H 1B1AA 1NVAA 1WQ3A 5ALEA 5FJJA 3BERA 1ELBA 4BFYA 3TLGA 1V8PA 1ZFNA 2WD8A 2YZMA 3SU5A 3FVTA 3G8CA 3HA3A 5NLLA 4TN5A 5HXAA 3MPUA 1R16A 1XCPA 4HQNA 2GLTA 4MMZB 3W5UA 1EXMA 2OECA 5KS2A 3DKPA 3IH5A 3P2JA 3QF4B 3O8QA 4GCHG 2EZTA 1R6AA 3DFMA 4NCHA 4ASHA 3C7KA 1XEXA 3ROFA 5CA1A 2PMCA 2CVFA 2G81E 1GA1A 2GK3A 2JIRA 2QUBA 2VHUA 3H1FA 4UBKA 4YT5A 1J1IA 2FX6A 3M5MA 3IO5A 3U7RA 3OP1A 1W581 3GLKA 2D4HA 3AL2A 4D2IA 1M2FA 1PFWA 4I55B 1OP2A 3VR5A 3WAJA 3NXSA 1J8FA 2Q28A 3LH3A 2AJDA 3KXIA 1MXFA 1RAFA 3JCZA 5C3MA 3ECAA 2A7XA 3E70C 5D5HA 3KUKA 2O2SA 3AFHA 4QUBA 1MG0A 1GI4A 2F9BH 1BXRA 2BBSA 2QTVB 3I83A 4FKMA 4HATA 1D1QA 2A30A 1JPNA 1O2QA 1LBQA 2PBFA 1GHXH 4H4EA 3RS9A 3TW4A 1ZRNA 1EPTB 4FUGA 1O5FH 1RFGE 2V7VA 1BO6A 2P5UA 1H9HE 2HMSA 4RX1A 2ZTHA 5A3RA 1ZYUA 2GBCA 3K8OE 2FCRA 4ENVA 1AUVA 3UHFA 3IEIA 1HORA 3D7RA 3FYSA 2FZEA 2OC1A 2P2SA 5JWOA 5I6DA 1UBMS 4HNAA 1Z2OX 2FEAA 1E37B 4NCJA 4ZOCA 1X3LA 1TOCB 2WSBA 3UAVA 4HEA6 1J5PA 2FZWA 1GOTA 1E1RA 3QWFA 4PN7A 3MCVA 4WEQA 5LA6F 2FB9A 3N2ZB 3KCGH 1QKKA 2TGDA 4TKVB 4CLDA 2D0DA 5CX1B 5K3FA 1DAFA 3UHOA 1A4XA 3HWX1 2QU8A 1GBAA 3CLSC 3GARA 2XC5A 4DT7B 1CNMA 3G6KA 3GWZA 4R2MA 1ETHA 2XT0A 5HZGA 1SC4A 1R10A 1EP2B 3CLHA 2ZUTA 3WJ2A 1PHRA 2CFTA 2ZGVA 5U1PA 1TPOA 2TPIZ 3GS9A 4YJFB 3AL0C 1XMQB 1E18A 5EQJB 4A8JB 2XUJA 1T3GA 1KYVA 3M83A 4FU9A 3UJPA 3IDZA 2JGAA 1ACMA 2GARA 2R5WA 3B51X 2D2XA 2CMDA 3OMXA 1XI2A 2Q50A 1TMUH 1OILA 3QXCA 1G2LA 4ISIH 5C94A 3QE0A 5A5FA 2P1DA 3IUJA 3PYHA 2AQHA 1ZL0A 3BUSA 2PUCA 5TX7A 1NF9A 3PRYA 3DOIA 1AHPA 1KFKB 2I4NA 1SGYE 3VJMA 5SZKB 3G17A 4RFLA 3REOA 3DLHA 1PUJA 5DLQC 4UEQA 1M1UA 1U0SY 4OIFA 5LP6B 3RXDA 3MWJA 4YRTA 5EJMA 5BRAA 2DKNA 5EJAA 1GFZA 1GQSA 2V6GA 3F90A 3B8JA 4R98A 3R6TA 1XELA 1D1PA 2BR5A 3H8WA 1ZW1A 2NNWB 4WT7A 1UR5A 3GCNA 1UP7A 1W93A 3L1UA 1C5SA 1MB4A 3LXRA 4UTOA 3OQHA 5CCBA 1P1CA 2V7TA 2A9JA 4TMTA 1NPTO 1FNCA 2FZKA 2WTMA 1C5LH 2JZNA 3LXUX 3PIIA 3SYKA 1Z5PA 1K27A 3AERB 3AETA 5DOZA 1I2BA 3UV7A 1TNGA 1EM8B 1C5YB 1SXJE 1XMXA 1L5MA 2Z2ZA 2ZYVX 3P4YA 3NANA 3Q2OA 2Z04A 3FYUA 4KUGA 4H7HA 2A5YB 4P54A 1TIPA 3FDXA 1NVDA 4KKXB 1M72A 4X20A 1MQ8B 2Y9MB 4EB6B 1Q74A 2QTZA 3BF7A 3U4MA 3W7BA 3FX2A 2IPQX 1IM8A 1OJLA 4QA9A 1WVGA 3IBSA 1Z4KA 1ESBA 2FOHA