3O8RA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
molecule keywords HCV NS3 protease/helicase
total genus 212
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8rA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8rA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA03
2DY1A 1F0SA 1CLUA 4CR5A 1P2IA 4A9AA 3KXIA 3RHFA 5IK2D 1CT0E 1OT3A 1XD2B 3VU9B 1XXHB 1PUJA 5DE3A 2NWNA 2BDCA 4INHA 3ADCA 2ZPTX 5J40A 2ZE7A 3QKSB 1FTNA 3QPWA 1SGFG 1E0JA 1R8QA 4X8SH 3BWDD 3M5MA 2VGCB 1ZW6A 1GBDA 4RD0A 1AZ8A 1SHYA 4D8NA 1VCIA 1ZUHA 1FX0B 2O8CA 1ESNA 1Z08A 1DICA 2QGNA 1THPB 4DT7B 1O3IA 4PANA 3HK3B 2W3KA 3SGAE 1SVLA 1HB0B 4YDSA 2QA9E 2XTMA 1EG7A 1GILA 4ZXXH 1Q3HA 1CGIE 3K9LA 2A2ZA 3QF4A 1DUAA 2ZRDA 3RAPR 1A46H 3BFKA 3RXHA 2CN0H 3WNCA 4IMQA 1XTSA 1KNQA 2YHSA 3F8TA 2OSBA 3IILA 3RS0A 1Y8TA 1F0UA 2FJUA 3FMIA 3URCA 1SFQB 1IJEA 4LBVA 2FG5A 4BLPA 3AGQA 2GF9A 2P3SA 1FZQA 1IN7A 2YYZA 3NKVA 1BOFA 2FYQA 2HF8A 5FUXA 5L3QA 1CULC 1YR9A 5DN6D 1T4GA 3E0PB 5C2ZA 2NQ2C 4Q1BA 2CMKA 3VMFA 1HAVB 5JCZA 2XCFA 1W4AA 3ZZUA 1F5NA 5BYKA 1CA0B 4Q1CA 1EESA 1KTTB 5HXFA 1XUGA 5FBQB 2P93A 5JS7A 4I32A 2RG3A 3RM2H 3A4NA 1NLZA 1G3CA 1ABJH 3EIQA 1M9UA 1GI2A 2IYWA 3UFAA 2D26C 4YT6H 4TZ6A 1NLYA 4KITB 1C1QA 2ZSDA 1UVSH 1OKXA 2ODEA 1AI8H 4PAMA 4JKYA 4Q1DA 1WU1A 1DM4B 5FH9A 2YV5A 2Y81A 2G5NA 1V6DA 1Z2AA 1Z8JB 2DWPA 4ABEA 1V3XA 5KNBA 1TEXA 2VQSA 4UNRA 1G6OA 1FN6A 1UTKA 4JZ1A 4NIVA 2ZU6A 5FX5A 1BOQA 2DCUA 3LOXA 1TNDA 4XOIA 3OX7U 5B64A 1P62B 2ZTXA 3BB3A 4TT3D 1NI3A 1BH2A 4KJZA 4CH8B 1NRNH 2FI4E 3ATKA 3DDCA 4IDOA 3P70B 2QPOA 4A82A 1ELVA 1S84A 2PUXB 4HB2A 2AK2A 2V4ZA 3K9HA 3UUZA 4DVGA 4Q4JB 3LX8A 3MNXA 2PKAB 2KAIB 1U98A 3P26A 2QNRA 5CITA 5FOWA 4BAHB 2A7HA 3SNDA 5C4GB 1G64A 3VB5A 4NTZA 2CVHA 1T3HA 3L2OB 5E7JA 1GPZA 4IXNA 2WWYA 1LHFH 4Y7BA 1B0UA 1Q22A 4FMBB 5KNCA 1ZYOA 4ZHLU 4M4SA 4KODA 1XZPA 4BFTA 4BWYA 2WKRA 3AW0A 1GDNA 1VGCC 4AN7A 1GITA 1P7CA 5HM2A 4DY7B 1FOEB 3N2IA 4FUHA 3ZQJA 2J38A 1JNYA 4LZ4B 1OS8A 2ERXA 5IDKA 1TBQH 1BBRE 1KDRA 1P10A 1H1BA 3LGVA 3AF1A 1QHHB 1ELFA 2FI5E 3QUMP 1XKBC 1YZNA 3EIEA 2C78A 1AB9B 2Q9AA 2Z3EA 4ASUA 2W2VA 1ZCBA 4BFXA 4N0DA 1ETRH 1T31A 1F60A 4BLRA 2D7CA 4XVRA 3IITA 2ZITA 2AH4X 4X1RU 3ZZAA 3W90A 3U44B 1RD3B 3ASYA 1KDPA 2AD5A 3B1YA 3LH3A 3ZZBA 2CLDX 4PC7A 1QIXB 2CE7A 3SOPA 2IX3A 2ZGBH 3Q7QA 3NBFA 1TNJA 1W0KA 1IQMA 1WMSA 4IKEA 3R8CA 4ISHH 2JLYA 4WA7A 2YKGA 3SU2A 2HYIC 3QKSA 4KTUA 2E1RA 2R6FA 3RXOA 1O2MA 2H5CA 2DYKA 1HJAC 3KQHA 3DFLA 4I8LA 1N6PA 1KJWA 3L6PA 4EKDA 4M9SA 1W13U 4BNRA 4F93B 1SPJA 6LPRA 4FWIB 2IOTA 4JSYA 4LOYH 2ZQ5A 2R62A 2PSYA 1UKZA 5JDUB 1JPJA 1SL3A 4Q7KA 3RLFA 3GLIE 4B35A 2IWHA 1G37A 4URUR 1DVAH 1MRNA 5GJ4B 2FTLE 2OCAA 2RGNA 1L7VC 1ZMJA 3KXLA 1JAIA 3QJYA 1O3KA 1EFRA 3VTKA 1NSTA 1MU8B 1ETTH 4ABDA 1UM8A 1Z8RA 3M3TA 1TONA 9LPRA 1KOFA 3ZZ7A 5CB8A 3I29A 1D3QB 2AD1A 3LKWA 4JLDA 2YNMA 1P12E 1HAYB 5ANRB 2ZHEH 5JSZA 2AIQA 5TMPA 3KNXA 2G8TA 4AYYB 1GBMA 3LD9A 2GESA 1FAKH 3IG6B 5G3ZA 1BMMH 4DCSA 5EPNA 1SOZA 1LF5A 2VH5R 4C2UA 3NUMA 2WWHA 4R0IA 2VHQA 3MH5A 1RIWB 1B0EA 1AN0A 2WJGA 1NT1A 1SGYE 2FP7B 1YRBA 2OD3B 3MWLA 2V0BA 4JIMA 4QXAA 1LKBA 5FUYA 4DZZA 2PEYA 1TQ6A 2BY6X 2UZ3A 2OCYC 4NA8A 4JLPA 5KNDA 2QY9A 1S4QA 4WMDA 1RJXB 1VYVA 2D2FA 2ZRMA 3PROA 3UMFA 3NCLA 3V7TA 3A4LA 4Q19A 3GLIA 5FOXA 1DWCH 4NCHA 3THXB 2FZ4A 5K8LA 1O2VA 4G0NA 4B44A 3AAUA 1EAUA 4WVPE 1ZRKA 2Q6TA 4A36A 4C9BA 3UNRA 2EFDB 5CM9C 1NN1A 1XEFA 1S1MA 2W6ID 4URXR 3AVUA 2XOKD 1W46A 4CBOA 1EZUC 6Q21A 4A8JC 1WTHD 1P57B 2J92A 1DELA 2QIQA 1L0ZA 2WIAA 1HLTH 4ZCIA 2Z6VA 3T35A 4FUDA 4C4PA 1HJ9A 2Q3FA 4O25A 4XE4A 4LYFA 3NDBB 5FBLB 2B92A 4DWJA 4CGZA 1QQUA 3EWSA 4HI0E 3AF4A 5IT5A 5EU8A 1FNMA 1HGTH 3OFND 5DGJA 4FINA 1BT7A 2PZGA 2FSGA 1DVRA 5D3MA 3SO3A 4CRCA 2BBWA 3QF4B 4PC6A 2OFWA 3FB4A 2H6MA 3BXZA 4AYTA 3VNUA 1ZM7A 2SHKA 3Q3XA 3AASA 3SS8A 1ANEA 5K0HA 1NSFA 2F3CE 3RDZA 3AF0A 2WSSA 1KK3A 2P5TB 1GHZA 5JI3E 5G41A 1MO6A 4D0NA 3RWMB 1K1NA 4BZXA 1DANH 2NMVA 2YNBA 3TVJB 2GVZC 2KBFA 3OFNA 4KSCA 5TCCA 3CNLA 1JWTA 5AJWA 1CT4E 1SGEE 3EZ2A 2XBVA 4AIIA 4PHGA 2PV9B 4G3XA 5FOTA 5EE5B 2XEXA 1K1IA 1CJTC 4M2LA 1UADA 2G0NA 4NYMQ 4OJKA 1OB2A 5E4FA 4MYUA 1Z06A 2FOEA 3MD0A 3LT3A 5CJPA 1VCPA 3R9IA 4LV5B 1O2GH 3O47A 1XMIA 4HZHA 4I33A 3I5YA 4XFQA 1SGCA 3F0TA 2QBYB 4UONA 5G40A 2CNWA 5BWMA 3QI2A 2G1KA 1KY2A 4M9ZA 2IS4A 1D3TB 3QXJA 2QORA 4YMTA 2ZS8A 1UBFA 5CYOA 5E0HA 4HDQB 4Q4HB 3SFZA 2RGXA 1HAXB 1ZTJA 1P2TA 3M4YA 4R2IA 3T61A 4WW0A 3K70B 2GDEH 3VR4A 4AGKA 3EARA 2BEJA 3KQLA 3WNDA 3U60B 2ZDLA 2A5GA 4S35A 1Z0AA 4IXMA 2FOBA 3A1UA 2QCYA 1GJ9B 2SFAA 1D2MA 1Z47A 3SZRA 4XWKA 3KB2A 4DLVA 2OUAA 2JLWA 2P8OC 1Y3UA 2G77B 4P4UA 1IQEA 1UK3A 2JETC 1CXZA 2CK3D 2WSSD 2GZ8A 1YP9A 1AD8H 5EXSA 2JGNA 5AJYA 2BDTA 5FFMA 4KELA 5K8UA 4O2RA 1KDOA 1HDTH 2JEOA 5FI1B 2VWNA 2V3OH 4DKXA 1FV9A 3KTAA 2JAQA 3D23A 3RMNH 1VG1A 4F92B 3THWA 1ELCA 4TLEA 3GLIB 1O3AA 3GCTF 4B34A 2A7JA 1HQYE 1RVDA 2AMDA 1O2TA 2BLOA 1NVXQ 2WPHS 2FFAA 1L1GA 4AKGA 5EE9A 2ZDNA 1C5WB 4K1SA 3MJHA 3DUXH 2H8KA 1JOUB 1P01A 2H5EA 3ZVFA 3ZQ6A 4RKJB 4B3FX 1THSH 1A7SA 3P95A 5J5CA 1TNGA 5K8TA 2PL3A 2A5YB 3BB1A 1GI6A 4P31A 1GI4A 2A3RA 4PTLA 5BXQC 1SHKA 3HP1A 1ZGIA 2ZSBA 3EIHA 4M1OA 3BV9B 3T1QA 3B8JA 2CXXA 1II0A 2QQEA 3A84A 2GCTC 4WWYA 1VZQH 3SGQE 2WKPA 5EZ5A 3GLFA 1P6XA 1HXEH 2BVNA 2H57A 1E2PA 4US0R 4MGYR 1R0ZA 3FTQA 4WBSA 3O8BA 4DIHH 1ZLRA 1T4UH 4ZCMA 4YDHB 4OK6A 1YHNA 3C14C 4MPVA 1NFYA 5F6MA 3C1KA 3PB1E 1LHCH 3IEUA 2A45B 2AX4A 4L9SA 2ZIQH 1TGTA 1G3BA 3DZDA 1EJMA 3VKGA 1IQKA 1RZ3A 3RXUA 1XEWY 3FMFA 2NU3E 2EI6A 2NPFA 1OFIA 1E0FD 2XXAA 5LB2A 1DSTA 3ZZ0A 2WV4A 2JJ2D 1FJSA 4NCNA 1X8KA 3BG8A 2XTZA 2ERYA 1ZUIA 3THXA 3SZEA 4Z1MA 1FUUA 1K5GA 1UCYE 3QXCA 1GRNA 3LW7A 5EPYA 1ZVQA 2VINA 3QZRA 4JL8A 2BOKA 2OXRA 2V35A 1PPFE 5JJLA 1BHXB 4X2VA 3HKIB 3KF2A 2ZKSA 4DB2A 2ZVPX 4MDSA 5CM8B 1O5AB 2L0XA 1IY2A 1J70A 2RGNC 5FBWB 2KWIA 1KMHA 5A8ZA 4JMPA 4WZBE 1MTSA 1UK4A 1ETSH 2ZDKA 1E9AA 1NNEA 2XB2A 5JBAS 4TWWA 2EWVA 5F98A 3PEYA 2OINA 4LHVA 1H8EA 2IXFA 4LJ7A 4Q1EA 2ZSEA 2XNDA 1QCPA 2J0UA 1G7TA 1CS4C 1G4AE 1KNXA 2B0FA 4G01B 4C0AC 1JQLB 2BDIA 4FXGH 4M9XA 3V9PA 4PQFA 3B9PA 1S81A 3WHLA 3I1FA 2QBYA 5DP9A 3A6PC 3RVBA 4LV6A 1V2QT 2IEYA 2J0UB 1P2UA 3ENSB 4HLCA 4QBFA 3KQUA 6CHAC 3SYLA 4YOJA 4OI2A 1W48A 1OH8A 1GNPA 1OKKA 1CSOE 3MOCA 2ZUCA 5FBIA 4A2PA 2XBWA 1V2NT 2CHGA 3GQBA 3KFXA 1SLWB 5FPSA 4XSGA 1Y5UT 1V2ST 4EFMA 3IKJA 3FP7E 1LY1A 5TB5A 2N42A 2G51A 1Z0IA 3BN9A 1XUFA 2QM8A 4ACAA 4O03A 3F9EA 1AQ7A 6ESTA 1SVIA 2PH1A 3UIRA 2GXQA 2IW3A 3P8GA 5JMTA 1C1UH 4RD4A 5DI3A 3GJ4A 1XJ0A 1NJFA 3VNVA 1ZRHA 1W44A 1G291 1YCPH 1OOKB 4GMDA 2ZFSA 1P75A 3A1WA 4ESHA 2XXLA 3VKHA 4CRAA 1YZLA 2G81E 4WXVA 3L3TA 2A30A 4ZI2A 3OE7A 1GKIA 1RRCA 1PJPA 2LPRA 1RRPA 1IM2A 4NCKA 3IPYA 5AHGH 4MYTA 1TOMH 1SLUB 2OILA 2JATA 4TY7A 3GY2A 1ZIOA 5E0JA 4TLBA 2D74A 2G9NA 4YLGA 3TSOA 4D6PA 1YM0A 4UEHH 5FOVA 1GG6B 5H70A 2HOBA 4GHQA 2H16A 3U9AH 5HM9A 3A36A 3X1WA 3OY5U 4P4SB 4D82A 2VIIA 1PZNA 1SGNE 4MKFA 2QT1A 1D3PB 2IN2A 2BJWA 4JLMA 1F5KU 3S69A 4VGCC 5DP5A 2R6GA 4X1SU 3LGWA 1AKSA 1E2IA 1E6CA 1FIWA 2GF0A 3NXSA 1ZM4A 1GMCG 1O3LA 2F1IA 3AQ4A 2C93B 4MQBA 1KXAA 4IEIA 2R2WU 1AS0A 4MYCA 2Y7ZA 2ZI2H 4X8MA 4P3YA 1AKYA 1O3NA 3UR6A 2WPMS 3HR8A 1AMHA 2PJRA 1RJ9B 4IS5A 3PV0A 1XJQA 3X1ZA 5FUWA 1FMGA 3BTTE 1XFAA 2ZREA 4JS0A 2XWBI 2ZFFH 2O52A 1FI8A 4V02A 4CEHB 2NG1A 1W36B 3FHCB 1Q3TA 2ZQ1A 1H9LB 3VEQB 1TIOA 4E5UA 4FU9A 2YWEA 3KKOA 4OGYA 4QM7A 1E34B 2QN6A 3IHWA 2BXTH 4C7OA 1TPOA 3ODFA 5EE3A 4O2LA 5AWFC 3PXGA 1NY5A 3GFTA 2VJ1A 2ANBA 5KSZA 1O2PA 3LJJA 4AKIA 1XMSA 4WZ6A 1MABB 1N6KA 2OM2A 1EAXA 3HR7A 4C3ZA 4LV8B 2C3SA 3FP6E 3BTHE 1U8AA 1Z6TA 1XPRA 1E35B 2YC4C 1KY9A 2A32A 1EOJA 1CGJE 4SGAE 3ZGXA 1II8B 4HDCA 1TNIA 3QBVA 1EP5A 1P61B 3CM0A 4OHYA 3GY7A 1QDEA 3CPEA 1AGJA 2ZGHA 3T06B 1ZD1A 4BTTB 2JETB 4MNYA 5FCRA 1A2BA 4KVAA 1BIOA 2XTNA 1HUTH 1TPZA 4K1TA 4QJ3A 4ZXYH 1LTOA 3A82A 2ZGXH 5FTMA 3IBGA 1MCVA 1PVOA 2FWWA 2FIRH 2BBTA 2A7CA 4PPGA 3W6NA 1T5LA 4XSKU 1XXHA 3LXXA 3X2SA 1EXMA 1R0YA 1T8NA 1KJZA 1XTRA 1ZCAA 5B30A 5EP3A 3TJZA 1ZHRA 3NVAA 2P59A 3BIVH 4KYIB 4Q9JA 5EP1A 4B48A 2IYTA 3QEJA 5DISB 1D2EA 3ZZDA 4Z1MD 5JWOA 3Q3KA 3N5CA 2J45A 2KB0A 4FVDA 4R2HA 3LLMA 1XEXA 5L3SB 4QBGB 2W58A 4CH2B 4IRUB 4AG2A 4YMVA 2Y5FA 6GCHG 1O3CA 4GZMA 1WDTA 2YOGA 2F43B 1E9DA 4ISOA 5IYTA 3QIAA 2V7QD 2F9PA 2UUJB 2X2EA 4RJLA 5HPYB 1KSNA 5E2OA 3EZ9A 3THOA 3X1YA 5L3SA 1A1RA 1DXWA 2R2MB 3TK5A 2IEZA 3OU0A 4Y6DA 2HT1A 1FTSA 4DDUA 4QG7A 2FOCA 2WWGA 2CXVA 1OWHA 1GMDF 1B5GH 4QGAA 2WWWA 1E94E 5KYKA 1ZU5A 1KMHB 1PYTC 2ZE8A 3GDVA 5BQ5A 1DDJA 2C90B 5FXLA 3M61U 3RXAA 3CRRA 4KFSA 4W9MC 3MMPA 1KXBA 1CU1A 2CF9H 1T5IA 3M7TA 2HALA 4AG1A 2IYZA 1DPOA 1SLXB 3QF7A 4HYYA 3NH9A 4KFRA 1NRRH 1CKEA 2K1QA 2PJZA 3SJBA 4GVUA 1Z6AA 1GHAF 3EZ7A 1ZNYA 1UTQA 4ZHMU 4QHYA 4B76A 8ESTE 1YPJH 3SBEA 2OQUA 3SV6A 5AJVB 1GHWH 5SZIA 4OQXA 2BY5X 2AHOA 2GILA 4UKDA 3SBDA 1EXFA 1SI5H 1VJ9U 1E2LA 1Y5BT 1GRQA 3GLFE 1TGNA 3CNNA 2Q1JA 3K09C 5FL7A 1GGDC 1AUTC 4P4SA 3PUXA 1EKBB 1GSIA 1MKYA 1Y3XA 4Q21A 4GZLA 4UFDH 2STAE 3SNAA 4MLFB 5TCAA 2KE5A 4BQSA 1Z07A 1VIYA 5EJEA 4PSAA 1IN5A 3IGFA 1GJ4H 3M36A 2ZHDA 3K0CA 3KFVA 3BEIB 4ZROA 2Z0MA 4BFSA 3U8OH 5ABWA 3PQCA 3OE7D 1WB9A 1Z8FA 4UQOA 2PWXA 1ACBE 5FL7D 2ZF0H 2Z9GA 2XC5A 1M8PA 1YPMH 1UKYA 1TQ0B 1QF9A 3MWJA 2VIVA 3BJIC 1SOTA 3IIJA 2R6CA 2NU4E 4JYBA 2F9UA 1FLEE 1ODFA 2XRCA 4GUXA 1C5XB 4TLCA 5L8VA 1S0UA 2FTMA 8KME2 4URWR 1DY8A 4OBEA 1KSJA 4KV9A 4EPYA 4MYHA 2IYUA 3SU1A 1H8ED 4TZ0A 2ZTZA 3MWYW 4OI1A 2ZJZA 5TY0A 3SHWA 2IUUA 3KCGH 1W8BH 2GJ8A 2XNDD 4VGCB 2OXSA 2R44A 1HAIH 4RSGA 5H4IB 3PEWA 2HNTE 1H8HA 3P92A 3KHVA 4XD7A 3SU4A 5LBIA 3H2YA 4CEJA 521PA 3SHFA 4C0HA 4N3NA 2FODA 4BTUB 3K09A 1QNJA 3W3AA 4L8GA 2FPLA 5G53C 5A4JA 1DAFA 1EFTA 3ATIA 3TGKE 5CMXH 5TJXA 3QGJA 3OIUA 1LB1B 2OFXA 3AVTA 2FNAA 2BDBA 5C5OA 3Q00A 2RGGA 3SW2B 3K0CC 3TUZC 2EYQA 1BRAA 1MTWA 2GAAA 2GJAA 1QRZA 1A0LA 3MI4A 4Z6AH 3H84A 2GEDA 4MRVA 1Y3YA 1KO4A 1G3MA 3L33A 2GT7A 4XTRA 1AB9C 3SZNA 1XWIA 4H6TA 2CL0X 4QRHA 4HAXA 3V4FA 3GOVB 3ZD6A 1K5DA 3ZZ6A 5A8XA 2VRWA 5JWRA 2MMGA 3VR1A 2UUFB 3UTUH 1FX0A 4BECA 3T1OA 3DD2H 2PUQH 2BTCE 4Y0VA 5GPIB 2GCOA 1NMXA 1GJ7B 3GISB 3ND9A 1QA7A 4MUAA 1HT1E 2JH0D 3BTKE 2J46A 4MPWA 1OWIA 3LC3A 1IQIA 4BUJA 1TPPA 1NZQH 4NSYA 1ABIH 1KIGH 2A7QA 2HWLB 4PROA 2NIPA 3H86A 2QXIA 1TUIA 2GEVA 1ZMLA 4MNXA 2J59A 3TW4A 1G6HA 1IBRA 4F7WA 4A15A 2V8OA 3VPKA 3RABA 1COWD 3BE4A 1VCQA 4ISLA 3TIFA 2BVSH 2BQ6B 2GA8A 1FL9A 3KUCA 1IAUA 4X1QU 3V0XA 1G41A 1ZGVA 4Q9HA 1YPKH 3RXSA 4D25A 3BORA 4OKSA 3G5UA 3QG5A 5FPYA 1DOAA 2FWRA 3VR3A 4EUNA 1AVXA 1SKYB 4NE2A 3QGNB 4QC2A 2GZ7A 2P3FH 5KPDA 5HE8A 1LHGH 2CBZA 2QMEA 1LVOA 4UFEH 1ELTA 4MDEA 5A2MH 2ZRLA 2WPJS 3A88A 3IPXA 4RD1A 3LX5A 4YC7A 5TDHA 3WNBA 3OHMA 2XZLA 2SNVA 1GJ8B 4K8YA 4F4IA 1LHDH 4Q9IA 3PJRA 1ONBA 3M3SA 4NBSA 2Z6BD 2W83A 1HAGE 1HJ8A 1QBKC 3I77A 3A1VA 2F6RA 2Z4SA 3EAJA 2JIZD 1GDUA 1O5FH 5DH9A 1DUEA 1TRNA 3LQRA 2BD8A 4LDJA 4B3GA 2BY9X 4JLOA 4C2TA 2Y82A 4XH9B 3P4YA 1N1LA 2ZP0H 2VVUA 3VB4A 2O9QA 3M6AA 1O87A 1IY1A 4FXPA 2PX3A 1TQ4A 1Q57A 2ODPA 3C4JA 1A5TA 4MH0R 7ESTE 2W7UA 4NONA 1XMVA 4HAZA 4AORA 2GCHF 4HUQA 3TPIZ 1XX6A 1LS6A 4LJ5A 2F83A 5CE1A 1P05A 1CQQA 3TH4H 2V7QA 3CX6A 4AYXA 5H8WA 4NP6A 4LY6A 2NO6A 1UTOA 4JZIA 1QZXA 1XMNB 5E8EH 1COWA 4LYHA 4LC1A 3C27B 4LJ6A 5E95A 1O30A 3W34A 1DG1G 1YPEH 1XMJA 4M21A 2FF7A 3B9QA 1GNQA 5JSZB 3WY8A 2ZQ2A 5KDDA 2C4FH 4FUGA 1W11U 5GCHG 2OEPA 1O2HA 3SBKA 4MVNA 1N6RA 3RRNA 4G5OA 2VWMA 4BRUA 1Z0JA 1LPZB 1GGDB 5C18A 3LDXH 3VKWA 2I6QA 2R65A 3T1VA 2C04A 4V03A 1KO8A 4DLYA 1BTHH 1NG9A 4ZKDA 3DOFA 1P9SA 4TYYA 3I62A 3CLVA 1QG4A 2CHQA 3RXJA 4HLQB 1ZMNA 1ZHPA 2QGRA 1C5PA 1L2TA 5IHPA 1VG0B 4F91B 3SI3H 2WAYA 4FIDA 1YPGH 3ZV9A 3NWUA 3VXEH 4C30A 3SQEE 1JEEA 4JLKA 1YR8A 4I1SA 4HSEA 4NZQA 4XOJA 3GEHA 3RXQA 4M1KA 2BD5A 3R3GB 2ANMH 3MLEA 1IHTH 2ZM5A 3TAHA 5CDFE 1ZR0A 3NHBA 4U30A 3V00A 1D8TA 1IOZA 1G36A 3QOFA 2R0LA 1VITG 1MMJN 1KDQA 4PHFA 5F03A 3A58B 1EQ9A 2WWIA 4DBLC 4CRDA 2EFHB 2WJJA 3S1AA 1Q2WA 3K8YA 2QAGC 3I61A 3RU4E 3A8CA 4V0KA 1G19A 1E2EA 1BTZA 4FUEA 5B57C 2F4LA 2WPDA 1T8MA 4HLUA 1S0QA 1ZJDA 2ODWA 5FCKA 2F9BH 4I8JA 4IHQA 1G8FA 2BOVA 1L1NA 4GSYA 4GLYA 4B47A 2BY7X 1XTJA 4ISIH 2JH5D 2H92A 4EFNA 3OEEA 3E5HA 3KL4A 1F5RA 2ZHFH 2J1LA 4OHVA 2VPPA 5JBTA 5EW2H 2V6IA 1MR3F 4YLUA 3QN7A 4OQNA 2P5SA 1A5HA 1E9CA 2DPXA 3CB4A 3BIUH 1XD2A 1E79A 3RSOA 1ZSJA 2JA1A 4Y10E 1H65A 1C1WH 2AEIH 4D9QA 2D06A 4FUFA 3VAAA 2A4RA 3CBQA 3MNCA 2OC7A 1H8HD 1MTUA 1KZGB 1SXJE 1H8DH 4V0OA 1GWNA 4BLQA 2OUKA 1G3QA 5DP4A 3R8FA 4DDWA 4LHYA 1CJMA 3ZVAA 3QKRB 3ELAH 2G4TA 3VR2A 4CBNA 1E2KA 4MRSA 1V2KT 3SU5A 3MUFA 1W1WA 1N6HA 3B1WA 4BEBA 4UXIA 3QG1A 1DAGA 4XD7D 4Z51A 2M5TA 3IQWA 4HLUC 3I78A 4TY6A 4U00A 3D6TB 1JR6A 1Q21A 1H9HE 2ZS7A 1CRQA 1FQ3A 1TA6A 4XJXA 3REGA 3RNLA 1ZOMA 5DPAA 2QSYA 1W12U 2O8EB 2IK8A 2FM2A 3LQQA 1G16A 3W8RA 1S0RA 3M5NA 3LLUA 3PUWA 3DVLA 1NU9A 1A7JA 2J7KA 3BG4C 1S3GA 1E2HA 1G18A 2ZI5A 3KJIA 5JHHB 1KSFX 4POAA 5GCHF 3S9CA 1Q3XA 1C1PA 2FX6A 5DK1A 4DW2U 1NMZA 2XW9A 1OWEA 1IQNA 2ZRPA 3ND8A 1GHBG 2ODNA 3SYNA 3K0AA 4FD2A 1JJVA 1GDDA 2PT5A 3MU0A 1AJEA 3LU9B 3VXFH 1TAGA 4BLSA 5CHAC 1E79D 3KJHA 5LH8A 3QNUA 1M34E 1YVDA 4CYMA 4X1NU 3UOPA 1GJDB 2AMQA 2GMTC 3SOSA 4MTBA 1GMDG 4NKRA 1LV7A 1O5BB 1D3DB 3GCGA 1GBIA 2XZPA 3N2EA 1DBSA 1BBRK 1AIPA 1D5CA 4DIDA 2ZG0H 1C9KA 1N5IA 2EEKA 1DO2A 4LJYA 1C5VA 2C8YB 3FKSA 2ZGJA 2QUZA 1JXPA 1PPZA 2ZAOA 3T1TA 1E2FA 2GETA 1E9RA 1C2KA 1B0FA 1AM4D 2IYXA 2LKDA 2JLVA 3PUZA 1YZKA 5DHAA 1KI2A 5AUOB 2EWWA 5J4QA 2ZO3H 3K2UA 1EX6A 4EPXA 1E0AA 1S83A 4GHTA 3A7YA 3RUOA 2X8AA 2PT7A 3EA0A 1NRJB 3PR1A 1GCTC 1P72A 2ZAMA 4TQUS 1TA2A 3VGCC 2GKVE 3U1JB 1TADA 1PUIA 3MH7A 3QENA 1QHRB 3UWIA 2AKYA 2BD2A 5FOUA 1INCA 3SJ9A 4FW9A 4H4FA 3OEHA 1ZTKA 4X8VH 1VHLA 3RXIA 1Z0FA 1YPHE 4QOSA 4MQAA 1R5BA 2ZFPH 2QROA 4C7OB 3ZZ9A 1ZMXA 3JVUA 1SR5C 3RS7A 4HUQB 5CIWA 4Q03A 3C8UA 3PG5A 1LQEA 1G3RA 3K0EA 3E1SA 2QY0B 2R9VA 3MAAC 4M1MA 3A80A 1JXMA 2QAAA 4THNH 2QRZA 2J2UA 4WMEA 3IQXA 3TIUA 4LSGA 1XNJA 1O38A 2FPMA 3WBJA 1KY3A 3CR7A 1GCDA 2PKAA 2P0EA 4AFUA 2WJHA 3HU1A 2JKHA 4DLZA 2F9VA 2CDNA 3CRW1 2YZ2A 3AKEA 1XPUA 4KTCA 4QL3A 1YKSA 2W0MA 1G1MA 1TABE 1AWFH 1YRAA 1D6WA 1LKAA 1OIWA 1OSSA 3CS7A 4IW4E 2LNCA 1U81A 4DSUA 4HUTA 2RGEA 5CLLA 1SC8U 1MOZA 4R9UC 1O3HA 4F4OC 4GOKA 4PQRA 3F6UH 4FI3C 4NYJR 1P60A 1DPFA 4LBZA 4DSOA 3A1TA 2EI7A 4C0KA 1J14A 5EG4A 4ABBA 5SZKB 2XCNA 1XU4A 3C16C 4XBBA 1EPTC 3N70A 3DZ8A 121PA 2AWNA 4V0MA 2ANKH 3A7TA 3U1IB 3U8TH 3RP2A 1O3BA 2IHBA 3VX4A 3AVOA 1C4Y2 1O2LA 1FY8E 4OS6A 1JJ7A 1K8RA 2VSOA 4N1AA 4JCNA 3NXPA 3A37A 1ZC4A 1S6FA 1LPGB 2OCVB 1PPGE 3ZVRA 4J2YB 1SSXA 5J4VA 2VSFA 1J8MF 3PLBA 2REBA 2KJQA 3TBKA 4M1SA 1S96A 2IYSA 2QTFA 3MU5A 2CLSA 1TF2A 4I99A 2DE9A 4WIAA 1GBFA 2R3UA 4JVMA 4Q7XA 1SXJD 2OC1A 5KSPA 4YXWD 4D0LB 4IVRA 2XITA 3P32A 1QJ7B 1JMOH 5KOYA 1HEIA 3RXGA 2Y7XA 3PWCA 1X8JA 2WSMA 2PR3A 2FYRA 2ZRKA 3SU0A 2C5LA 1MD7A 4JYVH 1UMAH 1QBOA 2OFOA 1U6QA 3E8LA 3PEUA 2HCJB 3TMKA 3GYLB 1GIAA 5KSYA 2O8MA 4YT7H 3PTNA 1GBTA 2RGDA 2IT1A 4F4JA 421PA 4Y8YA 1LNZA 2AFHE 1XX9A 4TYPA 3TUIC 5PTPA 2YWHA 2XC0A 2OC8A 2VA8A 1KHTA 1DAHA 5AFZH 1AA9A 1E37B 3UREA 1VTKA 1SFIA 2JLZA 1S1CA 1HNEE 1P2OA 4QM6A 2IS6A 3GJ5A 1NN6A 1DOJA 2PX0A 4DLRA 2X1VA 1FONA 2CL7X 3S9AA 2GZAA 1CJKC 1NVVQ 1M6NA 4IOMA 3FKQA 3ASZA 4US2R 3THYB 3H4MA 4GL2A 2ZDAH 1WOFA 1ORFA 2SNWA 1O3MA 3GDSA 1DY9A 1K22H 2A2QH 1DITH 2O8TA 3B85A 2ZPQA 1QHYA 1A2KC 3AVXA 1NU7B 2Q3HA 4DJZB 2BC9A 3M7QA 4PSKA 4AY2A 4Q7YA 2H1LA 4HLDA 2P65A 4C0QC 2FSFA 1DO0A 1R4AA 1XTIA 2QP3A 3SN6A 3GCHB 2RKOA 2C98A 4G5QA 3CWQA 2WAXA 3RS5A 4AWXA 1TFXA 4GP6A 1SGWA 3F9HA 2F1JA 3I5XA 3W95A 1DE7H 4G5GA 3SQXA 5G3YA 3TLOA 4ACBA 4ZKOU 1YC0A 1Y63A 1V2WT 5JB8S 4KFUA 3OYPA 3A86A 5GIBA 3Q9LA 3R9WA 2OAP1 4LJAA 1GAJA 1OXGA 3RXCA 1GI9B 1FNNA 1KO5A 3ZVBA 1N8OB 4EIWA 2ZRJA 1VCNA 2UWOA 2FI3E 4OHWA 1Q1ZA 3AB3A 1SBWA 1GNRA 4KXFB 4MDFA 1CHGA 3WYAA 4QGFA 2AL7A 2HNTC 2GT8A 1MABA 3NBYC 5FPHA 1HYLA 5EZ6B 4B2LA 4ZKRU 3DMDA 3RC4A 4C0BA 4OQLA 1PQ7A 1W49A 2TGPZ 3W94A 1BMFD 5B2ZA 1OSNA 3EWAA 2AFIE 1O5GH 5FTKA 2Q6DA 1BBRH 1OWKA 4Q9KA 1Z6YA 1GHYH 3QY0A 2P6NA 3JZMA 8OHMA 3OIVA 4A5TS 1M7GA 3IWMA 4ERNA 1TBZH 2ZDMA 1OHHD 5JPMH 1YCPK 1YLCA 5FPTA 2PEZA 1PPEE 2ANYA 3STIA 2GK7A 3F9GA 2P3UB 4Y79A 3PEVA 3V4RA 1C2JA 3D31A 5CK5A 4B74A 1DLKB 1JEDA 2F55A 1LVGA 1P09A 1ESTA 2WM9B 2W2TA 2ATVA 1Q1BA 1TMTH 1OXUA 3SJKA 1W5TA 2AS9A 4NCYA 1R5NA 3VHLB 1TRYA 3ZZCA 4ABHA 1TGSZ 1JR3E 4A0GA 1LF0A 1XRJA 2O5VA 3CF2A 2FGKA 1I2DA 4E07A 2G6BA 2ZJAA 3B8HA 1BTUA 5JJIA 1KXCA 3V13A 4H1UA 2VTKA 4TWYA 4PX9A 3G82C 2VB0A 5JBBS 3WMFA 3M0EA 3AVWA 1YGCH 4AOQA 2ZROA 1IXSB 4P33A 3TITA 1Z28A 4JJKA 3E6PH 3D7MA 4KAXA 4J0QA 2BLVA 1G9IE 4BFUA 1QHSA 1R2QA 2QTHA 3AEZA 4PFSA 2Y80A 4Q4LA 2NU2E 1WE2A 4FUBA 5EXPA 1ZM9A 2F7SA 4CEHA 4OS7A 1FDPA 4RZ3A 1KAOA 1X6VA 3CWZA 3HU2A 2P8OB 3ZIAD 1AQUA 1MUEB 2CGAA 1KK0A 1OLOA 2AIPA 1QQ4A 3BERA 3SU8A 2GRJA 3VFEA 4M1WA 3QDZB 2FDCA 2V54A 3KEEA 5FTNA 3R0FA 2ZI4A 1DXPA 4DDVA 1KXFA 2WOJA 4E22A 4KLZA 2GTBA 4UDWH 1SGIB 1J99A 3E91A 4CIDA 2R9PA 5J4KA 3RXBA 1ANBA 2V55B 4Q1FA 1L4UA 3GICB 4F49A 1V2OT 3TW8B 2G0TA 4NZYA 1IQHA 2VVVA 3EPJA 3SHCH 4Q47A 4M22A 2QEQA 1DG3A 4KSBA 2WPIS 5SZHB 2BD4A 1GBJA 1SHZA 1FZZA 3SU6A 1Z22A 4A4DA 4RFVA 1FUJA 3NC0C 1UHBA 1O3DA 2WKQA 2ZANA 2BV3A 2ZE5A 2GVFA 5DHFA 4OQFA 2ZJYA 3MCAA 4RFSB 4BANB 1XF9A 2CEAA 1KJYA 1EJNA 2MSDB 1GTVA 3QQ5A 2XTTB 3AP1A 1OJLA 1DFPA 3ADKA 3QTVH 4JLBA 3WRXC 3F68H 2O8UA 4OHXA 3CZQA 3CRMA 3RC3A 1XTQA 7LPRA 4AGJA 2F9OA 4IFEA 3MWKA 4I1OA 4QNMA 5AR1A 3BFXA 2NZJA 4EPVA 3URDA 1Q0UA 1E9EA 2OT3B 1HIAB 4AFSA 1TALA 3MGCA 1NKSA 5GNDA 2ZEJA 3RS3A 2FFBA 4ZKSU 3MRSA 4AI6A 1AS2A 3ZYDA 2QGZA 4WZAE 2D3WA 3ZIAA 2IS1A 1TMUH 1UTPA 4KTSA 4NFEA 1C4V2 1RW4A 1MCTA 1CEEA 1KDQB 1P9RA 2SGPE 4I8HA 4CDGA 3H7OA 4AFZA 1GHBF 2KSQA 1DWBH 1HIAA 2VH0A 1C9PA 3P17H 1FMLA 2C8ZB 1T0HB 2TPIZ 2PMDA 3B5JA 2NO7A 4PPQA 2O8DA 1P2MA 2QE7A 4PXAA 3L8ZA 5DYIA 1QG2A 4BFVA 1E2NA 3NKKA 2OQ5A 3TJUA 5IDVA 1NO9H 3AVZA 2A5DA 1ANKA 2BX3A 2BKEA 1BMLA 1HAVA 2ZYWX 2ZXUA 3KJGA 5E7IA 1ZU4A 1AY6H 4Z8XA 1P2JA 2ZYUX 1CA8B 3GLHE 5DIFA 2RH5A 3A7WA 3BC1A 2QAGA 3IIKA 3PIRA 3U6KA 4TPIZ 4B32A 5AF9H 3AH8A 3PV4A 1E4VA 2PMKA 3SU3A 1E2GA 1CE5A 1GJ6A 1OE0A 1HE8B 4Z8YA 3QKTA 3S1AB 3OAAD 1WQVH 1U0JA 3LNCA 3WMEA 3W5JA 5KPJA 5HCIA 5JWHA 5BYJA 4Q2KA 4DT1A 5FTLA 4LJ4A 1YYY1 3U4QA 2Z3CA 4IC5A 1QVRA 2FPZA 3U98H 1OXXK 2IYVA 3BRWD 1GMHG 4I1UA 1Z3IX 3FHOA 2N1BA 4MGZR 1EB1H 3LBIA 2BMFA 2ZJOA 1TX6A 4TPYA 4JL6A 1GI0A 1FPMA 3X1DA 1KK2A 1OH5A 2TRMA 3SNEA 1XP8A 4Q4AA 2ZECA 1PFXC 1HT2E 3TJOA 1NLFA 1WBGB 4D76A 4B2AA 1EAWA 4DSNA 4YESB 1C1NA 1FNIA 4TQ9A 4JK5A 1KMQA 1YPHC 2IWRA 2D2DA 4AB8A 5LPEA 3ZZTA 1SVKA 3AW1A 2W00A 4ZHAA 1R5OA 2BHGA 3EA8A 4CRGA 3LDAA 1IAQA 1BMFA 1UKVY 4LI0A 2AYWA 1TNLA 1D9XA 1S8FA 3NZIA 1F2TA 4Q4AB 3M3VA 1BQYA 3T5DA 4N0EA 2R2AA 1QHXA 2KI5A 3NEYA 3TRFA 3TVTA 3AM1A 4PSVA 1ZZZA 3SJZA 5TXGA 2FLRH 2J94A 3R20A 4IMZA 2RGCA 4HAUA 4FUIA 3RDPA 3K70C 1KZ7B 1FY5A 1ZC3A 1V2TT 2IYRA 1RTKA 5AVDA 1I4LD 1QBVH 4HATA 3DO6A 2CJWB 4GPGA 5K7RA 4PO1A 1RFNA 4JBYA 1AFQB 3MG9A 3A4MA 4PAOA 5LB4A 4H1VA 2IS2A 3RLYH 3TGPA 1TBRH 2QYIA 3ZYEA 1YCPM 3SYJA 2GCOB 1U8YA 3TGJE 4IN1A 1RYHA 3KQBA 5UKDA 4DLWA 3U4QB 1D2NA 2ZWLH 4ZH8A 1JBKA 2BMDA 2Y6TA 3EDXB 1N3BA 1TQ2A 2DFNA 2FMJA 1TAWA 2XWAA 2YOFA 5A09A 1KTSB 1IQGA 4GSOA 2X77A 1A5IA 1CTQA 2J0QA 1L2EA 4EQ6A 3GJ3A 2VIOA 1HPGA 3QSYA 5SGAE 4CEIA 4NCJA 2B8WA 2GX4A 2Z3DA 1C1OA 6GCHF 3PFIA 1Y5AT 1F0RA 2ZI9A 4ZO4A 3LXRA 2GJ9A 3NBZC 3ICEA 5L6NH 1E32A 2QTVB 1GCTB 5BN3A 1N5LA 4IVQA 3A89A 4LBWA 1G7SA 4RZXA 2B7DH 4BEJA 5CIQA 1EFRD 1Q1QA 1OWJA 5C67A 3TJNA 4E09A 1L8QA 1D9ZA 1HFDA 2IXEA 2VHJA 1KAGA 2ZRNA 2GV7A 2QQ0A 1C5TA 3T28A 4CRWB 1TMBH 3SORA 1KSGA 1UTNA 1DEKA 4KU4A 2H17A 4NH0A 2ZEBA 5EP4A 4E05H 2VP0A 5JS8A 4MG3A 3PLKA 2BQ7B 1EAIA 5FTJA 2PFEA 5FUVA 1HRTH 2NU1E 3KIDU 2NPIA 1S5SA 4X0WU 4B3XA 2ZUBA 1PLJA 3HU3A 2QPAA 1DS2E 4PZZA 3M1IA 2ZFQH 1WBBA 4ZMAH 3RXLA 1N5JA 1X8LA 1B23P 1MAYA 4URZR 2H9TH 1Z2CA 2W5EA 1PLLA 2ASUB 2H2ZA 1FPCH 4DUGD 2PTCE 1Y59T 1UBCA 3PO1C 2VGCC 1GJBB 4GNKA 1X86B 4B6EA 1MKXH 3OF5A 1XD9A 1EASA 2REOA 2ZTYA 4OYHA 1EFCA 1KI4A 1JAHA 3TNSA 4Z54A 2PCLA 4WF8A 4NMMA 2EFEB 5GXPA 4NCIA 4U7DA 4YONB 3AK5A 3EPKA 4ASHA 4PHHA 5FBEA 1XEXB 3KQCA 4A2WA 4TL8A 2J0VA 1EFUA 4Y7AA 5HTKA 1PQ5A 1E38B 2PSXA 4LK2A 2GJKA 2JCSA 1UTMA 2FZLA 1GL7A 3BTGE 4KGAA 1O34A 4FVBA 1MQ5A 2A1DB 5AJZA 1O3YA 4IDNA 3A1SA 1EX7A 2NOAA 1O0DH 2JIZA 4DJTA 3RC5A 5IRCD 4B2BA 1EPTA 4P0TA 1ZD8A 2PLXA 3KKMA 4PO9A 4TN1A 4CZ2A 1BCUH 1NFXA 4ZUHA 4B3DA 1S82A 5GVSA 2FOHA 2H9HA 2OLGA 4UFFH 5KSOA 5TV2A 1D6JA 5LGOA 1GL0E 3DPUA 4O3MA 4B71A 2FDAA 1P02A 3L0SA 5HE9A 1I4DD 2AGIX 4AURA 1GVNB 3U3OA 5T6DA 1CVWH 1ZSLA 1ZD9A 3OSYA 1OFUX 1C4U2 4KVGA 1GL9B 3GLGE 1QGFA 4AYVB 1E9SA 2A4GA 1DWEH 4Q7JB 4NL4H 1P2KA 2CMYA 2NO1A 2ZRGA 2FGJA 1GJAB 5L3RA 2VBCA 3OIWA 3VHXA 1LMWB 4PHTA 1PLKA 3ATLA 2BHRA 3NDPA 5HGGA 1GZSA 3EAQA 2GDDA 1V43A 2P6UA 2PKSC 2OZEA 4Q7MB 1GBCA 2G1JA 2WUCA 2ZHQH 1P3CA 1QBNA 3D49H 3CH5A 2QP9X 1CJUC 3EZ6A 3S0NA 4DXAA 1RRFA 1O33A 2F91A 4L9WA 4LK4A 2MMCA 2Q6FA 1OXVA 1PPBH 3ZYCA 3CNOA 1HAPH 4F4CA 3A81A 4YMWA 1BTWA 2O8BB 2BYAX 2QZ4A 2BZ6H 4U01A 2ASEA 4WXPA 2HJVA 4ZV4A 5DI9A 1U8ZA 1FUKA 5JLJA 2ZCHP 5CK4A 1NIJA 4QT8C 3SV7A 1SQAA 3HATH 1K1LA 1OPHB 4KFTA 4D26A 1N0UA 3LBHA 3UR9A 2D7DA 1NRQH 2QU8A 2P94A 1OB5A 4DDTA 4BE7B 2SGFE 4F38A 2JLRA 3LJOA 3AKDA 2ZU1A 4EJSB 3T5FH 1E69A 3ZVNA 1BS1A 3F1SB 3CRQA 4PC2A 4Q1AA 4GOXA 1GVZA 1XCMA 1G21E 2ZRFA 3UPUA 3TH3H 4FMCF 4M9QA 3GEIA 4D0GA 5EQRA 1E2QA 2CCKA 1ESMA 3S9BA 1S85A 2I1VB 5A0BA 3K1JA 2A5KA 1C5QA 4PR0A 3U69H 3L0IB 3ZZ3A 1FQJA 5F8XA 1SB1H 1YU9A 1KLJH 4IBLH 4G5RA 1R0WA 3QKRA 1GBLA 2C03A 2J9NA 3IBYA 1NIPA 2V6NA 1A61H 1KXEA 4IDQA 2UWPA 2NO9A 5HKKD 1CBUA 3MNSA 3KQNA 2WMNB 3U44A 4HZIA 2AGGX 5F9FA 1P4SA 2V3HH 4LYJA 4UFGH 2J7PA 1QRXA 2E87A 3IO5A 2OC0A 2PHBA 4WJG2 3AVPA 2DFKB 3O8DA 4E7NA 4LRWA 2DWOA 1ID5H 2IPHA 3ATMA 3K0AB 2BCJQ 5T1VA 4HAVA 4P4TA 2YJTD 2WPDD 1TX4B 2GXAA 2ORWA 5JRJA 1RPZA 1T9HA 1SULA 1RXPA 2FSIA 1TU4A 2GBLC 1NN0A 3EG5A 4H6SB 1N5KA 2IJOB 1VDZA 4Q66C 2BVXH 5GJCA 4BZQA 2XNSA 1QHNA 1F7ZA 2ZRCA 1C1MA 2GCTB 4ZI3A 3TUJC 2IUSA 1TF5A 2HPQH 4JZKA 2ZETA 4X1PU 2RB4A 3FMOB 4CT5A 3RMMH 2GZDA 3WYFA 3T25A 4S2EA 4Q7ZA 2WPLS 5HYOA 3MHWU 1K1OA 1XTKA 1AFQC 4HFPB 2AK3A 1G9XA 2ZUDA 2VP4A 1NESE 1XB2A 2Z43A 1JPNA 3RXFA 1FY4A 2HUPA 1W7AA 3BAFA 2ODBA 3GPLA 1KKLA 1QJ6B 2XBXA 5JHGB 3F3YA 2W2XA 3G01A 1J8AA 2C9CA 2WWXA 4ZDKA 3I73A 1MZDA 2ZTSA 3NK8A 5LPRA 1ZPCA 4LX0A 1T8UA 3PMHB 1Z29A 1C5SA 3Q77A 1ARBA 4ISNA 1RTFB 3M7UA 2WINI 3UQVA 4LYAA 3GLGA 1VJAU 2XYAA 1EX3A 4TSFA 4Q4JA 3NWJA 4B6FA 1KYNA 5SZJA 3B23B 1KTVA 5ELXA 5GJBA 1QRWA 3Q76A 3LFUA 3NPSA 4RZ2A 1AGPA 3VGCB 3H1TA 1G32B 2J3EA 2QMOA 3IUYA 2STBE 3SR0A 3SEAA 1SVWA 1Q31A 4Y0ZE 3LH5A 1EB2A 2IYLD 2Z9KA 2G4UA 1Q12A 1ZNXA 1YLDA 4ASUD 1O2YA 4ZPXA 2AN9A 1H9IE 3BD9A 5AUQA 2BOHB 1O3EA 1KI3A 2FOMB 2F9LA 1MTVA 4IOLA 5E2PA 1W3CA 1EPTB 1G3IA 3B1VA 4ZIRB 3VR5A 1GDQA 1IQLA 1ELEE 1NRSH 3DT0H 4GP7A 2AGEX 4I7YH 5AJXA 3TVDA 5C4MA 2OXCA 4X2WA 1J9CH 3QX5H 3RC6A 2QC2A 4LHZA 2UKDA 1EZQA 4DLXA 5DGXA 5EGMA 2JASA 3HPRA 2G3YA 2GKSA 3ESTA 1N6IA 3U7HB 2VVCA 3GLGB 5FBVB 4RKEA 1EP6A 2ONJA 2IBMA 1W36D 3SNCA 1S9DA 2KBEA 1JRSA 2FX4A 3CPJB 1HTWA 3GY8A 1WCV1 4KO8A 1ZUNB 1HXFH 5JJKA 4PZYA 721PA 2ZIAA 2PKSB 4B3BA 5L3QB 1ZSKA 1MRSA 3L0OA 1QL8A 1Q44A 1WQ1R 2OBLA 1SGTA 2RHMA 1R7RA 1CR2A 1O37A 5GWZA 1OP8A 5KHOC 4NWLA 5E3HA 5CB6A 3CONA 1E9FA 1HAZB 3RC8A 1Z0DA 1BYUA 3FVQA 2VP2A 1E1RA 1C5NH 1TWXB 3KQEA 1Z83A 4TSFD 5HMAA 2ZVQX 4LJ9A 3RXRA 2VP5A 3E90B 1GKUB 3BTQE 2PLFA 1QHIA 4DIEA 3A85A 1W4BA 4BAMB 4JVNA 4JJZA 3D62A 2Z5FA 4DUGA 1W0JD 2JH6D 2CHVA 3EA5A 3Q7PA 1MT0A 1BYIA 2O0KA 1Z5ZA 1AO5A 3WY9A 1C5ZB 3CUEF 3PWBA 2TIOA 1MQ6A 4TL6A 1LCYA 3QE0A 4QBHA 4KKDA 4OGXA 2W7SA 3ZVMA 1QR3E 2A0QB 4ABJA 1ZRBA 4X2YA 2QT0A 4ESTE 2HV8A 4GMXA 2HXYA 4LHXA 2YOHA 2BIFA 5GDSH 2HXSA 2YC2C 3REFA 3UG6A 3MWIU 2OO7A 1F2UB 3T62A 3DEFA 3FYHA 1CF4A 5BPEA 4FMDF 3LRPA 2GNOA 4IVPA 3LV8A 3LGIA 4XIGS 1E36B 3AVQA 9ESTA 1MH0A 5HZHA 3VB7A 1JXOA 1DARA 1LFDB 1FP6A 2NU0E 3U6BA 4W5HA 1P9WA 2ZDVH 1P04A 2ZR0A 3UKDA 1FY3A 5T6FA 5EQTA 4BPBA 2FESH 1TMKA 2IUTA 4MNVA 3AF2A 5EXXA 5C2JB 2BDHA 1FPHH 1RS0A 5DI3B 3QPVA 4EJSA 2B8TA 5J4SA 1DAKA 4JVSB 1GMHF 2ZJ5A 3DMNA 3PTBA 3SJOA 1FQKA 1OW3B 1JR3D 4Q48A 4MITA 2UUKB 2ZE6A 4RCYA 4CVNA 3SV2H 4RD3A 3ZZ8A 1PQAA 1XZQA 1J17T 1AQYA 3JVVA 1F2TB 2FU5C 3KXKA 4TTPA 3MU1A 1O5EH 4DURA 4U02A 4HTCH 2ZJ2A 1B7XB 2QRNA 3MH4A 3BEUA 1SVMA 4BAKB 3OEHD 1LVYA 1SQOA 3TK6A 1G8YA 1C5OH 3C15C 4DRZA 3C5HA 1JR3A 3I8XA 2QI9C 2BWJA 1O2SA 2OBQA 1NP6A 4KLNA 1HH4A 1SGPE 2W6JA 3KL6A 3SUEA 4X8HA 3GCTG 1OKKD 2YWFA 3UIEA 1TB6H 1C1RA 3FGNA 4QHSA 5JBCS 3GJ8A 3BEFB 5CHAB 1TUEA 2FLBH 1OH7A 2P3TB 1V2PT 2SGQE 4B2IA 1RYFA 2VIDA 2ILNA 4JZFH 3M37A 2JLSA 4GCHF 5FPKA 1Z8GA 3W5IA 1XUJA 2QENA 5AUPB 3PUYA 2X2FA 4RY2A 4OHZA 3TSZA 1XUIA 4XVQA 4IGDA 2J9RA 4TYDA 4G5SA 1C5MD 1WP9A 1KDTA 4B1TA 3GFPA 3CRVA 1NTPA 5HCNA 2FOAA 3FDIA 1XD8A 1CRPA 1T3LA 4WOPA 4EJSC 4LUCA 5J4LA 3SV8A 3THYA 3KDSE 4U5XA 5A0FA 1YBWA 3F5FA 1F92A 2PGBB 4UXJA 2V1UA 3RXEA 1QY6A 3LH1A 2X19A 4R98A 1K21H 2WUBA 2TGAA 2OBNA 2BJVA 2SGDE 5JB9S 1LVMA 3LGYA 2V6JA 221PA 2FOFA 1G8HA 4AZ2B 1P73A 2P2LA 2CHAB 1ZHMA 1ELDE 1O5CB 3ADBA 2DB3A 1G20E 5F2EA 4JT4A 3TQFA 3ODDA 1V2VT 2JDIA 2Q9CA 4NWKA 2XSZD 5L2YH 2V3CC 5FR1A 5EXMA 2R3YA 1NG1A 1YR6A 2JLXA 4OS5A 1R10A 2XJ4A 3FHTA 1TPAE 3RMLH 4Y11E 3LY5A 4JLNA 2O8EA 1E2MA 1MV5A 2FO9A 1N6NA 1UTJA 2ZS9A 4DOQA 2ZU0C 2W6JD 1G8PA 3K53A 2ZPRA 3DHWC 2QV1A 1VHTA 1BRUP 4IOJA 1J90A 1MO5A 3K6YA 2MSEB 2ZYVX 4BXWA 3TK1A 3SC3A 2GBLA 2RCNA 1X1SA 3Q72A 1OYQA 4UJ5A 1XEWX 1GUAA 4A0HA 5EQQA 1IXRC 2I1QA 1IOEA 2VF7A 2Z9JA 1FIZA 5GADl 1YE8A 1J2JA 4US1R 3E70C 2NGRA 1NVVR 5B6LA 4RFSA 2FPKA 2FX3A 3QVUA 5CJ2A 2O8CB 2BLWA 2HEIA 3RRMA 3VR6A 3IDQA 3QK1A 2W0SA 1BDAA 1K28D 1T8LA 1C1VH 1I4TD 2Z7FE 2VSXA 1M2OB 1ZIPA 4NG9H 3DM9B 1MH1A 1OP0A 3FANA 5DP8A 2Q0HA 3UOUA 1GBEA 1F2UA 4A1VA 1XVOA 2XXAB 4JL5A 2OHFA 5JBQA 1L4ZA 3KKQA 4JSTA 4YOGA 3E3TA 1HV7A 1IN4A 3EX7C 2J95A 3SQHE 1T3SA 1Z1IA 3BF6H 3W8NA 2GCPA 2ZC9H 2WICA 1WBDA 1FY1A 4CEIB 8LPRA 1IHSH 2EI8A 3H7TA 4ZDIA 1OF1A 3B9FH 1BUIA 4H42U 4CREA 1G17A 3QLPH 3WMGA 1U0LA 3C7KA 2QXGA 4ABGA 1JQJC 1RIWC 1UVOA 1J7KA 4RVCA 4Y76A 2LKCA 2BB4A 3EC2A 4TQAA 4UXHA 1AVWA 3TJVA 3OIYA 5KO2A 3L43A 1EWRA 2EU8A 4O9VA 2FOLA 3FOZA 4HEJA 2OE2A 2G00A 5L30H 4MPUA 1HY3A 3GJ7A 1L4DA 4HB3A 1M7HA 3W6OA 2ESTE 1SXJC 3SE0A 3LVRE 2H5DA 3N7OA 2BCGY 4KYUA 1GWAA 1F3OA 1XUKA 3RXDA 1JIRA 1XPOA 2ORVA 1HV8A 2P95A 1VYTA 4X2XA 4INKA 3KX2A 4IDPA 3AVVA 2OLJA 2A9KA 2OK5A 2AWOA 5C1BA 5BN5A 3RXKA 3FFAA 3CKLA 3MH6A 2R6AA 1O2NA 1SGQE 2WPKS 3V3MA 4FU7A 4BGDA 1Z6EA 1W4CA 2GK6A 3NEJA 621PA 3AV0B 4URYR 1ELGA 3UNSA 1SQ5A 2B7BA 1GBHA 1NVUQ 3HGNA 2IA5A 4D2IA 4E06H 3RM0H 2V9PA 1GHVH 4DCDA 3A7VA 2A4OA 2XZOA 1N6OA 4LHWA 3D8BA 4YM9A 3GMTA 5AK0A 3TR5A 3VQTA 4X8TH 1PPCE 1O32A 3TLXA 1SLVB 4GAWA 2GDJA 4V0LA 4PC1A 3ZDQA 3I32A 3LWNA 5LD2C 1AS3A 4D7FA 4DLSA 1MU6B 4DHEA 1RFLA 2IYYA 3OZXA 2C96A 1K9OE 1P3EA 3ZS8A 1NBME 1E9BA 5D3QA 3SHAH 3SYKA 2ALPA 2ZCLP 3LGTA 1IN6A 4TMTA 2YVUA 8GCHG 2IHYA 2Z83A 4TLDA 1SMFE 4X6OA 1EFHA 1W36C 5D3MB 1W4RA 1BRBE 3B13B 1GOTA 1W0YH 1FAXA 2O0HA 4PAQA 1T91A 2GXSA 3FMPB 3RRZA 4D80A 4FUCA 2HNTF 2BDYA 5DO9A 1MBQA 4TL9A 3R7WB 2AXPA 3LBNA 4UNPA 3GCHC 4JZEH 3KUDA 2C99A 3FWYA 1NMYA 3O8CA 1NC6A 5EE1A 3KQKA 3A8BA 2DUCA 3PITA 2PGQB 2F3RA 5FOSA 1SHHB 2VWOA 3A83A 2ZU2A 4MGKR 3BOSA 4DCTA 1G5RA 2ZRIA 1UVUH 4NYJQ 1OXTA 1IY0A 1WQSA 1SVPA 4DT1B 1EUFA 2WJVA 3BG4B 2QN5T 4Q5IA 2UVQA 1EZXC 1G8GA 2ZGCA 1OH6A 3ATWA 5FHTA 4EFLA 1G2MA 2QSZA 2WVJA 2OAQ1 4K81B 1GBAA 1VECA 1C1YA 5JFGA 3UWJH 3NHAA 2ZI7A 1QA0A 5LDDC 1ZJKA 4XBCA 4YO9A 2QG6A 2BQWB 1KXDA 2PZFA 1BA8B 2OCPA 2REXB 1UCYK 3GFOA 3DKPA 2FFHA 7KMEH 4M1YA 1TX7A 3KN2A 2GHIA 2C8XB 2ZR9A 3CENA 2BLQA 1CHOG 2P16A 4HZUA 3W9YA 5H68A 3ZVLA 1A2CH 4FMCB 2ANWA 3U3KA 4NFFA 1GBKA 1QL9A 3VB3A 2WZQA 2Z9LA 1KI1A 3UXMA 1XBTA 2MSCB 3CR8A 5KU1A 2KAIA 4FCVA 1SGRE 1WXQA 1XCGB 3QBTA 1CHOF 4PZLA 2GD4B 1N25A 1M7BA 3I3SR 3WHKA 4XDEA 2CCGA 1Q1EA 1E4YA 4DEYA 2ZU3A 1C5YB 3BS4A 4OK5A 1CR0A 1M1YE 4TMXA 1BB0B 1VG9B 4FCWA 2Y5GA 1C1SA 4Q18A 1EGAA 2WJIA 1CO7E 1C5LH 4WY3A 2CK3A 3WYGA 3DL0A 2J4IA 1AUJA 5DP6A 1UF9A 1C2GA 3RANA 1AKSB 3U8RH 1F48A 1GI7B 1II8A 2I4IA 3B60A 4ZKEA 4YOIA 1SVOA 1XXHE 4JZDH 5EXLA 1P06A 3IHLA 5DLQC 3I72A 2VP6A 1W0JA 4L4UA 2OBMA 3PMJA 2NTYC 2Z4RA 1FFHA 3KTAB 2RDLA 2ZA5A 3BH7A 2GVDC 1BITA 2VLIA 5EXNA 4D4MA 1SGDE 4ZCLA 3CF6R 1ELAA 2H18A 2VIWA 1GHXH 1QJ1B 1G30B 3HWSA 1YF4A 1N0VC 4A92A 2G52A 1W5SA 3W6PA 3HDTA 1CJVC 3HKJB 1UPTA 3K9NA 5DKMA 5C3NA 4OI0A 1TQ7B 1GBBA 2ULLA 1UJ1A 2BD3A 1NKTA 1UJ2A 2Q3MA 3T2NA 3GLFB 2FS9A 1Z0KA 5F3WB 3BFVA 5DP3A 1MKWH 3T12A 3UANA 3L82B 1VITH 2OV2A 3AGPA 4MRPA 2EC9H 3WBKA 5FX6A 4M7GA 1LTQA 1WA5A 4MA4A 4BZPA 3RS4A 3BK7A 3MO9A 2CF8H 1XKAC 2Z9IA 1W2KH 1QRAA 5F9HA 1UHBB 4L5BA 1M74A 4CT4B 1NRPH 2GGVB 5KUTA 5HR5A 4MNWA 1TNKA 2C77A 4GI7A 1A3BH 5J4HA 2ZU4A 2GCNA 3F9FA 4WMFA 3B2EA 3FAOA 4E7RG 5DNYB 1SVSA 1NL3A 3P6ZB 2WBLC 4IOKA 3EASA 1UFQA 3PV2A 2D8WA 3BIFA 1WUNH 4QGHA 4GBMA 4Z0KA 3EPLA 4D81A 3EE0B 3OAAA 5HZKA 1O2QA 4UJ3A 1A5GH 3UQOA 1K6MA 2IJD1 2HCBA 1NFWA 3BH6A 1GKYA 3A7ZA 3MTYA 1TL7C 4GOJA 1TNHA 3EQ0H 2ZI3A 4I8GA 1T6NA 5BRRE 4OL0A 4I1VA 2FEMA 1SKYE 3P20A 4LGMA 1IQFA 5BW8A 1E98A 1N2CE 3ITIA 4WXRA 3GY5A 3GJ0A 3UMRA 3U3RA 3PUVA 5P21A 1AU8A 2ZHWH 3LPRA 4NIXA 2RGAA 2OTVA 1P0SH 2AXNA 1E1QD 4TMWA 3ZS9A 1U9IC 5HKKA 4D4LA 1G5PA 3ZV8A 3CIOA 4PC3A 3AKYA 2HJGA 4NA9H 2FMXA 3TE6A 4I81A 3UPEA 3K9GA 4RSPA 5F8ZA 3K70D 3E0NB 2BMJA 2BXUH 1WSSH 2J0SA 1NN3A 4OI4A 1ESAA 4JMYA 3U7FB 4PPFA 4JLVA 3R7WA 2ZFTA 1G3UA 4TLAA 2ZYTX 2VP9A 1P03A 4IN2A 1US8B 1D6RA 4X8OA 4YTAA 4MPXA 1YZTA 2FEOA 3RSLA 3ECCA 3SUDA 2XOKA 5EOKA 3A8TA 3H09A 1QFKH 1GJ5H 3QZQA 1BJVA 2RA0A 5ETXA 1V2MT 1DAEA 1G3DA 1LQDB 3ZH9B 2QF0A 1ZNZA 1WYKA 1UTLM 2J41A 5L2ZH 1AWHB 1Z71A 4IC6A 4NU0A 1THRH 1OX1A 4NYIQ 2BBOA 3AP3A 1CA0C 3K0SA 2XGJA 4A8JB 4ABIA 4BLOA 1X1RA 3LC5A 4D9RA 2HYDA 1T8OA 1P2QA 1U9IA 3H0KA 2O0JA 3NH6A 1RRGA 3DM5A 2EFCB 1V2LT 3RS2A 1G2LA 4A7IB 4AFQA 2J87A 1NN5A 1T7CA 4Q7LA 3P8NA 1DAMA 3LGUA 3NBXX 1VCWA 1OWDA 1MKXK 4A6XA 4I8KA 2QMHA 2CL6X 4M1TA 2RA3A 3P8OA 4K69A 3SI4H 2GAOA 1TLDA 4ABYA 3ZD7A 3SN8A 3ICQB 3M5OA 1P2NA 4Q02A 1NS3A 3CO5A 3PENA 2PZEA 4OK3A 1TGBA 3K65B 2VWLA 1WAYB 4DEXA 3SJAA 1W7XH 1MO4A 3ADDA 1WV7H 3CS0A 3B82A 2GTPA 4DB4A 1AGRA 3J81k 2ODYB 3E2IA 3DA9B 1G4UR 4PQYA 3QXSA 4HB4A 4CHAC 3MO6A 4ILEA 4JYTA 1QB6A 1TTTA 2EFGA 3GDUA 1S6HA 1W47A 3G0HA 2NO0A 2ZRBA 5DO4H 4WH6A 2ZJ8A 1Y3AA 2FV8A 5A5GA 1WTGH 3PLPA 4Y8ZA 1OYWA 1NPMA 4GRAA 3RXVA 3DKVA 4PPNA 2PW8H 3ZVCA 3FE2A 4LC0A 2D62A 2QM7A 1LVBA 5B58C 3OTJE 1AVGH 5TVKA 1WF3A 2EQBA 2FOGA 4C0SA 5A0CA 1KO7A 2IXGA 2B9LA 4Q9LA 4A0RA 3ZVGA 1E2JA 4GT1A 1OIVA 4Q80A 1QURH 5DSZA 4LJ8A 1ZPBA 4ABAA 1X3SA 1T8TA 2YWGA 1C2EA 4XWOA 1FN8A 4Q00A 5CLQA 2RCEA 3UWOA 3P27A 3K0FA 4WXIA 5GJWC 4CEJB 4MKHA 3DFJA 4RI0A 4INLA 2HGTH 1BO6A 2CV3A 1MTNC 2CCJA 4NPHA 2BDAA 3TR0A 1QL7A 2ZSAA 1E99A 1Z6XA 4Q4HA 1KI6B 5A0AE 2WHXA 3HPTB 3QO6A 2DWQA 3ZJYA 1GG2A 4BRWA 1QB9A 4K60A 2OBOA 2NZ8A 1C2DA 4DC9A 2B5TB 1F0TA 2QXJA 1N8OC 4EPRA 4Y71A 3MO3A 1Z63A 2VL7A 5JI2E 2E9SA 3C5CA 1CR4A 1VKJA 4HAWA 4ESVA 4NYIR 2ZPSA 1TU3A 1BTPA 1R6BX 1OFTA 1UEJA 4DCUA 4DCNA 2F9NA 1V2UT 5C1UA 1F6BA 3MU8A 1HJAB 2XBYA 1K1PA 2A5AA 3KQDA 1VMAA 1KLTA 1C9TA 3TH2H 5BN4A 2TGDA 3SDZA 1O3FA 2EVWX 4X6MA 3BBPA 1P9NA 4HDOB 1BMAA 2O8WA 1VYUA 5IK2A 1D9IA 1CR1A 1GM5A 5M04A 1MO3A 1PPHE 4RD6A 3SUGA 2H1UA 4EQ6B 4QJ5A 1KO1A 1FMJA 2YOLA 4ZDJA 1VR1H 2GEUA 4YQFA 1NJGA 1N0WA 1TQDA 1CIPA 1ZNWA 1ZM3A 1TE0A 5C1XA 1KK1A 2VYFA 1GVKB 2FH5B 4O3TA 2FEQH 1FXYA 2Y5HA 1ZP6A 4R7ZA 2K5UA 2I3BA 4TMZA 1J8YF 2GMTB 4FU8A 3SFVA 1Z6JH 5JEDA 2JJ8A 3QKUA 1VGCB 2GJSA 3UATA 1OYYA 2WWFA 4K46A 4BASA 4X8LA 3IEVA 2VH6A 5GJVC 4A1FA 3T15A 4RKOB 3AP2A 3V12A 7GCHG 2XAUA 5TARA 2QAJA 4C0LA 1C5RA 1RGQA 2F3TA 2A2XH 3SUFA 2VIPA 3UMSA 1IN8A 3FKSD 4TWZA 3SJ8A 2CVFA 2H7VA 2FXRA 5AUNB 2AMPA 4LZ1H 4BAOB 5ESBA 3JZ1B 1AIXH 1JBUH 1UBGA 2BDGA 1OXSC 3SGBE 1U90A 1VCOA 3RXMA 3Q5DA 1DAIA 3HK6B 1IXZA 3FPAA 3BH0A 1O2IA 3ZZ5A 2DFTA 2ZU5A 4ZAEA 2BZAA 2A78A 3GEEA 1UVPA 1SXJB 1C5UA 1GFIA 4KI0A 6CHAB 1DTSA 3BTME 2ONKA 3K6ZA 3HYTA 4JLJA 5DN6A 4R8TB 4IW3B 4ZIRA 4D4KA 1EOLA 5C1YA 3PM3A 1US8A 4DSTA 4YMUA 2WV5A 5DJ7A 1KKMA 2C8WB 3CZPA 3TK9A 1P3JA 4OS2A 1V2JT 4JYUH 4AD8A 2V1XA 2A5FA 1ANDA 2JJ1D 1O3GA 2WOOA 3VX3A 2QE7D 4CF7A 5EUMA 1HCGA 1GI1A 3GCOA 2BMEA 3GJXC 1BRCE 1O2KA 4KP0A 3QXXA 5AFYH 1C1TA 4K8OA 1QVAA 1OV4A 1CBWC 4W5JA 4L15A 3EGKH 4A6PA 5E7MA 3FP8E 1ZAKA 1BKDR 3SI7A 1AZSC 2PTNA 2W26A 4JBWA 3KGPA 3M35A 4O97A 4FWTA 1TPSA 2O8BA 3SQWA 4FN5A 4CW7A 1OHHA 2AKAB 1CT2E 4BAQB 3U2QA 4WVFA 4A8JA 3NC1C 4NGAH 3NTUA 5FBRB 4M53A 1P9UA 1J16A 1GI8B 5T3HA 1P2SA 4OQMA 4X6PA 1YZQA 3KZ1E 2AR7A 1KYIA 3KKNA 2C2HA 1VIAA 4IDHA 1I2MA 4QHTA 2JLQA 3PMBB 1C2IA 1WCZA 3T26A 2IF0A 2GWHA 2GP9B 2ZRAA 3EW9A 1O3PB 5EODA 2Q21A 1N6YA 1UVTH 1XM1A 2ZCKP 2B8OH 4B75A 1CP2A 3PVSA 5T6GA 3OEED 4LOAA 2VIQA 2C9OA 2GZHA 3MMGA 1S9HA 2WMOB 4XTCS 3GY6A 1AE5A 1JI0A 4LPSA 1PV4A 4AX9H 1ANCA 5KTYA 1F2SE 3MNBA 4FUJA 1HUQA 2XJ9A 4CHAB 1MD8A 2BD7A 1IJFA 2WV9A 4GDFA 2TGTA 4JT2A 3L0PA 2FA9A 1OP2A 4D7GA 5C46F 3PMAB 3B7GA 3GD7A 2DHRA 1NY22 5JCPA 4II7A 4YXWA 3LIWA 1OIXA 3MYWA 1O2XA 3TNTA 4XBDA 2HVXA 1FP7A 1PQ8A 1MTNB 4NSVA 3A7XA 3TGIE 1K1JA 1RJ9A 2O8LA 1A0JA 4WAUA 4MKIA 2Y8EA 2CLCX 2TMKA 2AERH 4GCHG 3T29A 4OS4A 5E0GA 4X8UH 3AVYA 4YMSA 1XXFA 1C2LA 1LDTT 1S3SA 2PCJA 3VB6A 1ZBDA 5H1YA 3M5LA 2VNTA 1V2RT 2OLKA 3A8AA 1O2JA 3RXTA 2ANCA 3EXAA 1KI7A 4V0ME 1EJAA 2VEDA 2H9EH 3CX7A 4ABFA 2G83A 5JZVA 4YLQH 3GY4A 4GPTA 5JECA 4QBIA 4K8BA 3EZFA 2G88A 4M9FA 1Z1JA 1UBEA 4X6NA 1WRBA 3AAVA 1Y3VA 1KLIH 3K0FB 8GCHF 2ORIA 2QPTA 3BTDE 1A0HB 4B33A 1X7AC 3RU4D 1ETUA 3T5GA 3TKLA 3U3MA 3JZ2B 2DBYA 2ZJBA 4AKEA 3UNQA 4OM9A 4M0LA 2ZZUH 4HZUB 3K9XB 3TNFA 5DP7A 4B3CA 1WXRA 2AFQB 1P5ZB 3D3QA 1JIMA 1DT2A 3B1ZA 2BMGB 3PYHA 1KI9A 1W2HA 1GL6A 1VCMA 2O8FA 1GVLA 2YNAA 1DADA 2Z94A 1A1VA 4IJMA 2HF9A 1TX8A 3BGWA 3LO5A 5FL3A 5JRZA 3B1XA 4RCZA 1JB1A 1BHXF 4G1UC 4B43A 3ZVDA 2XNIA 3FVFB 3OESA 5J4YA 2RGBA 1TRMA 4HI3A 1MBMA 2GZ9A 5I46H 1O39A 1V5WA 5IF9A 1QB1A 4DLUA 2DFLA 1NF3A 1VPLA 4KBGA 1RTLA 3LA6A 2J5XA 2QMUA 1O35A 4PO8A 4EPWA 1O31A 4O0MA 2QF3A 1DSUA 2CHAC 4XVUA 1GG6C 5FAHA 1R8SA 5KDLA 2GV6A 4IEEA 1ARCA 1OFHA 2P6RA 3E16B 3BTWE 2PBRA 3DHKH 1LS1A 4ZKNU 3CW2A 4EPTA 3QWCH 3AUXA 2WIBA 1Z7KA 1YQTA 4RD2A 1U0HC 4UNSA 3ZVEA 4NYMR 1YZUA 3WP1B 1R0XA 2C9YA 2IF2A 2D4HA 4Q01A 3RU4T 3L8YA 3I92A 1P8VC 3SJCA 2BX4A 3GLHA 2F1HA 2C95A 1SG8B 3MFYA 3FFGA 2ZRHA 4AG5A 4TMVA 4C0JA 4NIYA 2VHTA 3TQCA 3KJEA 3CP7A 4MRNA 821PA 2BD9A 1Y3WA 5G4BA 1II9A 1UDXA 1NBMD 1OPXA 3CH4B 1H8IH 1O2WA 2FN4A 2CE2X 1UCYH 3I8SA 2QP4A 1C2FA 3CPHA 2CJWA 5EW1H 1U94A 2OESA 3GY3A 1RRKA 5A8YA 1Q20A 2BEKA 4KBFA 1YKTA 1K2I1 4DVAU 3AKCA 1DE0A 1ZINA 4NHOA 2BM2A 1CBWB 2WYJA 3TSWA 1XUHA 2LWIA 2RHDA 4UNQA 2OP9A 4QFMA 3X1XA 4MGIR 3UG7A 1EK0A 1ZJ6A 5L3VA 2VU8E 5EE0A 4UE7H 4IFBA 4CR9A 2QAGB 2F43A 3VU9A 1NY6A 1GHAG 4TYNA 1Z8IB 2F1RA 3WRYC 4DCVA 2JDID 1AK2A 1IQPA 4D4JA 2PLRA 3QEOA 5CYPA 2JLUA 1EWQA 4FCTA 4MRRA 4A2QA 4ON9A 3AUYA 2ZNKH 2BKUA 3SJIA 5DYGA 1K1MA 3B6EA 4QGGA 4I31A 3LVQE 2FE4A 4U2WA 4BFZA 4ITRC 5I25A 3Q3JB 2D1JA 1RIFA 3MJRA 3NG1A 1XCPA 1P2VA 3EC1A 3DOEA 2G5VA 4OS1A 1T0JB 3TAUA 2ZFRH 5DG6A 4TTQA 3PO1B 2WTUA 4JLAA 3FZDA 1L4YA 3UWKA 2Q9BA 4BOHA 3PV5A 4O3UA 2IC5A 1E96A 1W14U 2ODQA 1RC8A 1SXJA 4A6LA 4ARZA 1E0SA 1HBTH 3E1XB 3ZZ4A 5ESTE 1O36A 4AC9A 1T32A 2THFB 3P4XA 3TU7H 2HLCA 2OCBA 3LONA 3GP8A 4Y0AA 4BTIB 1E3MA 4AKHA 3WXMA 1A82A 2VHUA 3RWOA 3RXPA 1NM6A 3EA9A 1GMCF 2F9MA 3EA7A 3HJNA 4TTRA 5F8TA 1HE1C 5EXTA 4JBXA 3S7KB 2A31A 3NIBA 2QA5A 1EZSC 4CRBA 5C20A 3WP0A 2N46A 5KDOA 1MZAA 3PCRB 3T27A 4P32A 2VF8A 4HGCA 2EYUA 3EPHA 3U61B 3QVVA 1BZXE 2UWLA 2FS8A 1UO6A 2BVRH 3GJ6A 5FI0B 4U32A 4BFWA 3HPQA 1DLEA 1UKEA 4I4LA 2O8FB 1UEIA 3R9XA 2GXUA 4TMKA 1HAOH 3H5CB 2O8DB 3LAWA 1CGHA 1YJ5A 4AG6A 1IQJA 4UNNA 1BJUA 4XSHA 1JALA 1UAAA 3FZZA 1AHTH 3JZAA 2ZSFA 4DGJA 4H9GA 1BTYA 3AF3A 1LO6A 3EYDA 1MAXA 2CJIA 1TOCB 1D4PB 1G7CA 2VO1A 4DIIH 1NFUA 4A1TA 5LD2B 3TH5A 1QHHA 5JYIA 3VFDA 1O2UA 4TL7A 1HYQA 2ZI6A 5EUQB 2HT6A 2R0KA 4NA7A 2QL6A 3BSQA 1GI3A 4AK9A 3UY9A 4NIWA 1N6LA 1KIMA 1AZZA 1O3JA 2SGAA 3O8RA 2ATXA 1YPLH 1HA3A 1BTXA 1E1QA 3I4LA 2A4QA 4BXSA 5CDFA 1S2MA 3B78A 2UZIR 1KI8A 1Z6GA 4R71A 3ZLJA 1DWDH 2IL1A 3RMOH 1FW6A 3Q85A 2P67A 3BTEE 2A5IA 1RE0A 2XB4A 2D2EA 1GI5A 1KSHA 4M8NE 2JJ2A 1ZPZA 1PJRA 2R6DA 1AKEA 2FZZA 1IHUA 2HRVA 3MSXA 1KI6A 2TBSA 2ALVA 1HAHH 1F5LA 2BY8X 4MKGA 2J7PD 4XWAA 1A4RA 3KKPA 3BTFE 2B6HA 3KB1A 4AYWA 4YZUA 1SZPA 4CRFA 4KCGA 1MKWK 1LW7A 2YINC 1W0KD 1SKQA 3OY6U 4DLTA 1DS6A 2RMKA 2BM1A 4JKIA 1G3EA 2GCHG 2VHCA 5JEEA 1U99A 3RLWH 1UK2A 1SQTA 3Q3YA 3W3ZB 4LXBH 1YZGA 3CX8A 1XXDA 1TYNA 4RZUA 4TYQA 3IIMA 3Q8XB 2W6IA 3CF0A 4NZLA 4SGBE 3HYRA 1JECA 2IYQA 1A4WH 5J47A 1TF7A 1VG8A 4OJQA 3U5ZB 2BM0A 2B7CA 1NROH 1W10U 3MFJA 1ESBA 3THWB 3C41J 5K8IA 1GRRA 2I6SA 4TT3A 1AZTA 4B2PA 1XVMA 5C5NA 3U3JA 4K2YA 1E0KA 1XDBA 4FMDB 2BBSA 4HAYA 1C2HA 1NVWQ 1QHGA 2RAPA 2DE8A 1U2RA 3ONWA 1AE8H 1JRTA 2C8VA 3LW8A 1W0ZU 3D65E 2XC4A 1AFEH 4K1EA 5B6OA 4E03A 2QXHA 5LPNA 1AN1E 1O2ZA 2HDNB 4KHZA 1QTFA 4B73A 1W2GA 3SV9A 3QXHA 1H4WA 3IO3A 3SNBA 1GJCB 5LPFA 1TEVA 3GYMA 1NBMA 3RYTC 4QKQA 3SNHA 1BIFA 1C4OA 4QJ4A 4L16A 4W5WA 4RN6A 1RKBA 1T4VH 2FFQA 3FFBA 4A1XA 2W3IA 2HLDA 4BLTA 2XX3A 2EW1A 2DR3A 2A5JA 1C2MA 1SGFA 2UUYA 1VITF 3UK6A 2HPPH 3A8DA 2SGEE 1ELBA 3QPUA 3STJA 3S7HB 4AB9A 2ECKA 1J15A 3T34A 2EA3A 4EAQA 2ZR7A 4TYWA 3QUSA 4K3JA 4LZZA 4RKFA 1E2DA 3MU4A 1TGCA 3Q5EA 1PYTD 1ELOA 3OTPA 3GLHB 1YR7A 4ZDWA 1GP2A 4GFDA 3P1JA 2HLDD 4MUBA 4HB0A 2J34A 2WJYA 2CNWD 5EP2A 4EDHA 1UDWA 1EATA 1N6XA 1BMNH 2G55A 1ZM2A 3HGPA 1ZTLA 4V0NA 1O2RA 1W7GH 4JVLA 4Y0YE 4UD9H 7GCHF 3U7EB 1ZYUA 2JJ1A 5FR2A 1LHEH 3ETLA 4J1YA 3BB4A 1KGDA 2Q6GA 3RRYA 2OG2A 1O5DH 1XJCA 2R8RA 2FSHA 4LCBA 1G5TA 1DX5M 1GL1A 4ARZB 1IONA 4NDZA 3P8FA 4B2CA 5EQSA 1LPKB 4LPKA 3A87A 4A0FA 1O2OA 4K5ZA 4QNRA 4JYCA 2XSZA 4JK6A 1L1JA 3QTOH 4DG4A 1G7RA 1A3EH 5GVRA 4W7SA 1P11E 1HQCA 4BFYA 3U7GA 1OYTH 2WYGA 1O3OA 2LCFA 3GCNA 1E1RD 4WH8A 4LWZA 4Y8XA 4LBYA 4URVR 1HURA 2B21A
chains in the Genus database with same CATH superfamily
4DIFA 5EUCA 4GOMD 1BWSA 2NUAB 2ZAGA 1EZ1A 3GT7A 2RI0A 2NU8A 1OLXB 2CL5A 2DY1A 3LY8A 1F2DA 1F0SA 3N0XA 1RYZA 1CLUA 2PJUA 4CR5A 3F3KA 4R83A 3NOOA 4MQ6A 4C6HA 3AFNA 3D7LA 4FZ5A 4ETIA 4ZICA 1NWCA 3WGVA 5IC6A 5KTOA 1P2IA 5TEVA 4A9AA 3KXIA 2ILVA 5DK6A 5TQ0B 1H2XA 3RHFA 4DYHA 3FB1A 4BNXA 4D8TA 5BUCA 3F1LA 3MQ2A 4D7AA 5PNTA 4HWKA 4JJFA 5FBHA 2WF9A 5IK2D 1CT0E 2E4VA 1TVKB 3U56A 1JIQA 2BELA 3IE0A 1ODKA 1OT3A 2ONZA 1XD2B 3GU3A 5AM2A 3B6JA 3VU9B 1XXHB 2FFRA 1PUJA 1EE1A 1X2BA 4G0QA 4RTSA 4GMHA 5DE3A 1KVRA 1TZCA 2X13A 2NWNA 4M86A 2BDCA 4INHA 2VATA 3FIJA 4YROA 4BO1A 3ADCA 1L5WA 4KTVE 1GADO 2ZPTX 4GPAA 2B5WA 3FZEA 2ZE7A 3L9WA 4MGHA 3COWA 3QKSB 5J40A 1PQUA 1C7RA 1AKMA 1FTNA 3R7BA 4X63A 3QPWA 1SGFG 2Z6QA 2MSNA 1F2VA 4G0UA 2P6OA 4BXOA 1PBNA 3DZGA 1E0JA 2D7JA 3HVIA 1R8QA 1WEHA 1VL0A 1WUJS 3I5MA 4AJ2A 1QV9A 2AEJA 3T1HB 4X8SH 3PWZA 1H0KA 3RBZA 4DG5A 4PLWA 4LOKA 4CMCA 3BWDD 3CTMA 3M5MA 2VGCB 5DBIA 3OMWA 1ZW6A 4C7VA 1GBDA 4RD0A 1AZ8A 1SHYA 4K2AA 1MX3A 1VM6A 2J3LA 2XQKA 5DDIP 1GQFA 5EJ5A 2FSVA 4NK4A 4D8NA 4ZT3A 5K8VA 1VCIA 3R6DA 2Z98A 2CHFA 1ZUHA 3GIDA 5JYBA 1N2ZA 2FUG6 1KQFA 3V6MA 1NQTA 2VHWA 1SAYA 3QMMA 4FDUA 2GERA 1FX0B 3Q3HA 4CQMD 2X0JA 4EB0A 2O8CA 1ESNA 1Z08A 2A7XA 1DICA 1TC2A 3QE2A 4FEYA 4FYYA 5JYEA 3Q7SA 5KTRA 1KH3A 5ADVA 2QGNA 3HADA 1SD2A 1VRVA 1THPB 1X92A 2G1UA 2IZOA 3JWIA 4DT7B 5BUQA 3V1TC 1FTGA 3RI3A 3GG2A 1DPGA 4GIBA 1O3IA 1UBKS 4PANA 3HK3B 3WLHA 1K7SN 5BW5A 2W3KA 3D3KA 3SGAE 3MIIA 4F12A 3HZOA 3IQDB 3UJDA 1SVLA 3AMVA 1HB0B 3QFRA 4YDSA 1K7XB 2QA9E 1PAUA 1XPJA 3DBVO 1HEYA 5HYVA 2XTMA 4JOSA 5HGXA 4H7IA 4Z4QA 1EG7A 1GILA 2Z8XA 4KE7A 1E5DA 5AOVA 3NBQA 4KXUA 5AVVA 4ZXXH 3N0WA 1AMNA 3IR7A 1Q3HA 3IH5A 1CGIE 5MGNA 3MWDB 3K9LA 2A2ZA 4ZPJA 4OL9A 1CRWG 1KVTA 1PL7A 4MUJA 3QF4A 1DUVG 1PDOA 3L1JA 5JQGA 1NX6A 4RYLA 1DUAA 1HEUA 1QIGA 2B94A 2ZRDA 3RAPR 4DILA 1A46H 3BFKA 3RXHA 3SC2A 3HJFA 4BNJA 2CN0H 4WCDA 3WNCA 5EOVA 1ZOPA 4O4IA 2Q2QA 5HNKA 2Q5HA 5T6BA 4IMQA 1XTSA 2J3QA 1KNQA 2YHSA 5EJFA 5HF9A 1G5QA 3W8EA 2HWXA 1R6DA 1J5XA 3D43A 3F8TA 4CG0A 4K03A 3CVJA 2OSBA 3IILA 1WXFA 3RS0A 1Y8TA 1F0UA 2FJUA 4UCWA 3FMIA 3OWXA 2XDQA 1AKTA 4MPTA 1PP4A 4YAOA 3ZWYA 2NU7A 5T41A 3DEYX 3CUSA 4BQRA 5HWSA 1RMTA 3URCA 2B1RA 1PCXA 4HEHA 1SFQB 4IIFA