3O8RA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
645
structure length
645
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
total genus 212
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8rA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8rA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA03
1HDTH 5JEEA 2O8LA 2JLXA 5CB8A 3KXLA 2WWYA 1LPKB 1GG6C 1F6BA 4IDPA 3BTTE 2NMVA 3BC1A 3ZIAA 3HR8A 1LY1A 1F2SE 1O34A 3L43A 2RGDA 5JI3E 1MOZA 2J0VA 1GL7A 1C5XB 5J4LA 1C2HA 4B34A 2Y81A 1Z0FA 2Z4RA 5GVRA 1VYVA 4XSGA 1KTSB 4WMEA 4U01A 1HEIA 3HWSA 1ZM7A 2IYTA 2GETA 2WPDA 1Q1BA 4MRPA 1EXMA 1A5TA 3IDQA 1GBKA 2PT7A 2ZPQA 5GVSA 4GRAA 1A82A 4K69A 2ZU5A 4HZIA 2IN2A 3ADCA 5ABWA 1QHHA 1XCGB 4QOSA 1XTJA 3PLBA 3ZZCA 4DWJA 2KJQA 3KB1A 5DP6A 2ZFQH 3A4LA 3I92A 3FP7E 2ZNKH 2IYZA 1GJ8B 5EQSA 1A2BA 4HLDA 3X1WA 3RXTA 2C8WB 3MMPA 5DP5A 5D3QA 1SZPA 3R8FA 4K1TA 4NA9H 2GESA 1XWIA 1AWHB 3NVAA 3IQWA 3AVXA 2BEKA 4X1NU 2ZE6A 5F9FA 2Z6BD 1KO4A 3HU2A 3HU1A 2QN6A 1X3SA 5JBTA 3K0SA 3ZH9B 1UJ1A 3TNFA 1PPBH 4ZHAA 2EQBA 3UXMA 3JVUA 1ZSKA 4XD7D 1Z28A 2GVFA 5G41A 4KELA 2ALPA 2DFTA 1OWDA 3CNOA 1BTUA 1YZUA 3TGPA 1HFDA 2O8CB 4KFUA 2ZRCA 2ZAOA 3VFEA 4DB2A 4MPVA 3U7FB 1GMHG 1O3MA 2HCJB 4ABYA 1CJUC 2Q6FA 3RWMB 4O97A 1KO1A 3WMEA 1O33A 1EFRD 1KAGA 2GJ9A 1GBEA 1YR9A 3FHTA 3TVDA 7GCHF 4MTBA 3TGIE 2HXSA 4NGAH 1BOQA 2LPRA 1EG7A 4KO8A 2B9LA 4GOJA 2GBLA 3FZDA 4NSVA 4WIAA 1RC8A 3AVVA 1E1QD 2FV8A 1AKSB 3VEQB 4WVPE 4X6PA 4D76A 1CQQA 3H86A 2I1QA 4ZDIA 2IHYA 2EFHB 3SJZA 2ZHQH 3Q7PA 3BORA 4GPTA 2Z3CA 1U99A 5EPYA 2AK2A 1Z6XA 4GFDA 3QZRA 3C4JA 4X8VH 1A4RA 1PQ5A 1IN7A 3PO1C 1DXWA 1PFXC 1XXHA 4NH0A 2XTZA 3NEYA 3GLHB 3DMDA 1H4WA 4HUQB 2O8BB 3Q8XB 2GTPA 4AY2A 3A80A 2PUQH 2XB2A 2RG3A 1OW3B 1NRNH 2J2UA 5SZKB 2ZRBA 1PPZA 2F7SA 2ZTZA 1O3GA 3B9FH 1EZUC 4QT8C 5A2MH 3OU0A 1O5GH 3IBGA 1V2TT 2ZUDA 1G5RA 3I5YA 2QEQA 4OHWA 1U8ZA 3U8TH 3PR1A 4ZIRB 2EI7A 3VNVA 3CF0A 4WH6A 1IXRC 8ESTE 4QGAA 4PC1A 1NVVR 2HNTF 2SGPE 1XEXB 1HXFH 2X1VA 1XUFA 2VB0A 1HJ8A 3S9AA 2AX4A 1YPHE 1KIGH 3FP8E 2J9NA 2R44A 4LJ6A 2FNAA 3S9BA 3D7MA 4XTRA 4D0GA 5EGMA 4YM9A 1ZRHA 5E0HA 1QQUA 3B9PA 2ZIAA 3QK1A 3K9GA 3BJIC 2HOBA 2Y8EA 1ZZZA 3ZZ4A 1TF5A 5EE5B 1V2ST 4Z8YA 2QF0A 2FYRA 5IDKA 3AVYA 2JJ1A 1UVOA 3A7VA 3ZZTA 2ZI5A 2QP4A 3EAQA 4KYUA 2EYQA 4FU9A 2WJVA 1F92A 3K0EA 5DI3A 2AEIH 4FCWA 1CT0E 3R8CA 1MTNB 5EU8A 2O8CA 2ECKA 4Q9HA 2DWPA 5F9HA 1XTKA 1D3QB 2ZI7A 2OE2A 1JQLB 2BDCA 1FZQA 4A8JC 1HIAA 3GCTG 4AD8A 3ATKA 2JJ8A 1HE1C 4DC9A 1PZNA 2NQ2C 1XKAC 2PMKA 2WMNB 2ODNA 4JL8A 4A6PA 1NFUA 2VWOA 2BM0A 3X1XA 3EG5A 5C4GB 1J17T 3ASZA 1EK0A 4D8NA 2ZYUX 3R3GB 4DBLC 2P0EA 2X2EA 4DXAA 1DG1G 4ITRC 4I4LA 3U98H 4INKA 2RHDA 2FSGA 4OHVA 4DLUA 3ATMA 4JYBA 2F9BH 2H7VA 1QBVH 3KN2A 2KAIB 3GLHA 3I32A 2ZC9H 2SFAA 2J1LA 2O8BA 1LVYA 5GJ4B 2AERH 3PMHB 5BN4A 3OAAD 5TCAA 1K28D 1XEWX 2EW1A 5GJWC 1C1SA 1BRBE 4CHAB 2VINA 2ZE7A 2P3UB 1LW7A 1W2HA 3ZYDA 3OIYA 5LH8A 4TMWA 3TSWA 1O2PA 2QGRA 5E3HA 1K9OE 2GK6A 5JBBS 3SHCH 1KMHA 1KSFX 1EFTA 6CHAB 4DLRA 4Y10E 1P62B 4U7DA 2PW8H 4CBOA 1B0FA 3TPIZ 1TAWA 1OXSC 2WPJS 5FBIA 5EXNA 3C7KA 1AJEA 3A82A 2AKYA 3X1YA 4TPIZ 3ZVDA 1SFQB 3GJ6A 2BY7X 3AF1A 4JK5A 5HKKD 3SUDA 4ZAEA 3EA5A 1XEXA 2CN0H 1AE8H 1TF7A 2VVUA 2FU5C 3A86A 2MSCB 2R9PA 3FB4A 4L4UA 5AUNB 4Y7AA 4O3MA 4ISNA 3GY4A 4XD7A 3RWOA 1HV8A 1SGCA 1TNKA 3MH7A 1DANH 4XVUA 1KYIA 5JBQA 1PJRA 4BFXA 1VG0B 1KDQA 1ZMLA 1W49A 2G83A 4IVQA 1MTUA 4QHTA 5IRCD 2YWGA 4OQNA 3KHVA 3MU4A 2BOKA 2JATA 3LH5A 1G30B 1ZM4A 4FWTA 2P3TB 2UUYA 2IYUA 1HAYB 1J70A 4PAQA 3RXKA 3OIVA 3A87A 1DAFA 2OC1A 1O2MA 3DD2H 1MD7A 2PR3A 1P9RA 3PM3A 1E1QA 2LCFA 1BMLA 2WJGA 2CEAA 2D2DA 1XEWY 3JVVA 1T5LA 1N8OB 2OM2A 3EC1A 1I2MA 3IO3A 2OTVA 2BBOA 2FI3E 1UCYH 1BMMH 4WXVA 1AK2A 4HAXA 2ATVA 1MCTA 4H42U 3TAHA 2C8XB 3L6PA 2ZDNA 4Q1AA 1W3CA 4TYDA 2AIQA 2ZRDA 3MRSA 2ZVQX 2ZCKP 3PB1E 4Q7KA 3L3TA 3MNCA 5L3SB 2ZCLP 6LPRA 3A4MA 1F0UA 1ZTJA 1GIAA 2QSZA 2F43B 1EJNA 1FI8A 4FMCB 1HE8B 1GCDA 8GCHG 5B57C 5KTYA 2BKEA 3MMGA 4OL0A 5FCKA 4UKDA 3GCHB 4BRWA 1PQ7A 1HAGE 1DT2A 4R98A 1SLVB 1M2OB 3CPEA 5DIFA 1LVBA 2AFIE 3BERA 2KAIA 2ZPRA 2R6CA 5CM9C 1KK2A 4DLVA 2BD9A 4PO8A 1SFIA 3SGAE 3SHAH 4LGMA 2ZFFH 4O3UA 5FR1A 3AV0B 3GJXC 2GJAA 5B6OA 1H1BA 2OBNA 1OIXA 2VF7A 1S82A 1JECA 3I62A 4GCHG 4FUIA 1DWCH 4JLKA 3FTQA 2IYLD 2ZO3H 3A8TA 2C03A 1ELOA 5DP4A 2PX0A 4O03A 1PLKA 2RHMA 5FUWA 3TLXA 1SHZA 2I6QA 3U61B 3SBKA 1T4GA 4OK5A 1PLLA 4AB8A 3CWZA 4ZXYH 1VG9B 4LHZA 5J4VA 2D4HA 1E1RD 2O8TA 4Z54A 3TNSA 4S2EA 2Y6TA 4I32A 1VJAU 2W2XA 4XDEA 1NP6A 4V02A 2C96A 3A8DA 1M7HA 2B7BA 2QRZA 2FH5B 4PC6A 1O0DH 2G5NA 1ZC3A 3RYTC 1F2UA 3CH4B 5FXLA 4YC7A 3WRXC 3RXRA 2ZSBA 4HDOB 1A4WH 1RYFA 1P9SA 1OFUX 4JJZA 3GEEA 3LD9A 1OYQA 4JLPA 3VKGA 1NESE 2ODQA 3S7HB 3W8NA 4MH0R 4PQRA 1ZGIA 4UNQA 1P3JA 2TBSA 3ZD7A 2OBOA 5DK1A 3VTKA 1U8AA 4YDSA 3AUXA 2DBYA 1UKVY 5TXGA 4HLUA 3IUYA 3EWAA 1OT3A 4X8TH 3G01A 3AM1A 2ZJZA 4G5OA 1XZPA 5G53C 3ZS9A 1BA8B 5FX5A 1C1MA 1WTGH 2W2TA 5FOXA 1ZHMA 2YVUA 3OY6U 4IOKA 2ZRPA 2G81E 3B1YA 3CX7A 2GJ8A 1AI8H 2FZZA 4ASHA 4BAKB 2AFQB 2QNRA 1FUKA 1GVZA 1CA8B 2GDJA 5A4JA 1TTTA 1DS6A 4PHGA 2GCTB 4Q7XA 3LRPA 1TQ6A 1JMOH 1G7TA 5DG6A 1KLJH 1SXJB 4DLYA 4CEIB 1D2NA 3OAAA 3RSOA 1RS0A 2HPPH 5L3SA 4CIDA 1CULC 2QM8A 3BTGE 2GCNA 2VIPA 3PMAB 3U60B 1EUFA 1XBTA 3O8BA 1XB2A 4Q4AB 1P57B 3P70B 4JMPA 3JZAA 1GJAB 4GP7A 4KGAA 4HB0A 4TL8A 4K1EA 4Z6AH 1D5CA 4JSTA 1MRSA 3K6YA 3CPHA 3Q5DA 1N6RA 2F91A 5C4MA 1DE0A 5HKKA 5FUVA 3AF3A 4PSKA 3P8NA 1G16A 2W2VA 5J5CA 3VQTA 3O47A 1XNJA 2BB4A 2KBFA 3U5ZB 5LPNA 4AYWA 4ACAA 1R8SA 4IDHA 1VCMA 3B1VA 1MKWH 2ZFSA 1GBAA 2IXGA 2QF3A 1PJPA 4TYPA 2A5AA 1E34B 3GDSA 2CL7X 2P6RA 3VHLB 1W0KD 3URCA 1S1CA 1TBRH 1QHRB 3SQEE 2H1UA 3BH6A 5CHAB 2JLRA 4TL7A 4PZZA 3TVTA 2P59A 3DOFA 3X2SA 3WHKA 1DVRA 2IX3A 2BJVA 4YONB 1KI2A 1C2FA 1NN0A 4C2TA 2O52A 2UUFB 4OI2A 1CR2A 2W6JD 4DT7B 5HGGA 5DYIA 1BMNH 1SGDE 1ZJ6A 4B3FX 2OK5A 5TV2A 2C99A 3QKSA 3TR0A 1SGFA 2P8OC 1GRQA 1G5PA 4IMQA 2QGZA 1YZKA 4D9QA 2CDNA 2V7QA 3E5HA 4CEHA 1C5NH 1VIAA 3V00A 1P2SA 4P33A 3PEWA 1XF9A 1XTSA 1TRYA 1A3EH 4DIHH 2UUKB 2BVSH 5AHGH 4Q19A 1GRNA 2F9NA 2J34A 1TU4A 3GLGA 4DHEA 1IJEA 1ZNXA 2G52A 3RXIA 3KQBA 2FPLA 1FQKA 4C30A 2Y5FA 1ELDE 4I8JA 4FXGH 4A6XA 5AFZH 4CH2B 1MU6B 4LZ4B 1P01A 2XSZD 1Z0AA 3GJ5A 1QJ1B 1DWDH 2GJSA 2ZDMA 1TFXA 1MBQA 1KXCA 2A5KA 4JBYA 4DVAU 5J4HA 1RRCA 5EE0A 1UHBB 3T62A 3EA8A 5L3QA 5DN6D 1LDTT 3PEUA 1QTFA 3ENSB 1BTHH 1MTSA 1J8YF 2Q3MA 3TUJC 4B2CA 4PHTA 2ZP0H 4UNPA 4CEIA 1X1SA 4M1KA 4FMCF 2ZRIA 1ELGA 3KJGA 4XWKA 3SI3H 1EFCA 1QB9A 1WQ1R 2GNOA 3T35A 3MWYW 2P94A 3NXSA 4WMDA 1WQSA 2YNMA 3IIKA 2ODEA 1V2KT 3OESA 4X6OA 4TMTA 1SG8B 3B1WA 4A4DA 2GXAA 1S4QA 4PANA 3KQUA 2BDYA 3DPUA 4B35A 5A8XA 2Q9CA 3A36A 3GY2A 2WINI 5HXFA 2QTHA 5KPDA 1MKXK 4M9FA 1IQLA 2ZECA 4V0MA 8KME2 2PBRA 3PITA 5AJXA 3FKQA 1SR5C 2REXB 5M04A 1Q0UA 4MYUA 2BCGY 5E7IA 1XRJA 1E1RA 4K8BA 4N1AA 1EASA 3RABA 4G0NA 3MHWU 1MH0A 1ZHRA 4AKHA 1YYY1 3ATLA 1PPFE 4X6NA 1NS3A 5EXTA 2OHFA 4WOPA 1QRZA 2H18A 1UK3A 1O2YA 2HYDA 4KBFA 1TADA 1KO5A 2H9HA 3ZV8A 1G20E 2UVQA 2AHOA 1ABIH 3L8YA 2GP9B 1A3BH 1Y3YA 4IXNA 4IEEA 1ZD9A 2H9TH 2TMKA 4RD6A 2ZM5A 3SGBE 4WAUA 1RFLA 4ABEA 1NRJB 3T1QA 2QBYB 3E6PH 2BLVA 3DVLA 4WZBE 3U7GA 4QHYA 2BKUA 2Y7ZA 3TGKE 3K0FA 5FR2A 1AKEA 2OV2A 2CMYA 1II8B 2A7QA 5IF9A 5I46H 1OXXK 3FMIA 1RIWC 2E9SA 4YO9A 3ZVCA 2AMQA 3MAAC 1AS2A 2H17A 1P11E 4YLUA 2DUCA 3P32A 2I4IA 1XUJA 4BFWA 1K21H 1GRRA 3B8HA 3ESTA 3C16C 5EW2H 4TLCA 4IW3B 4MVNA 1C2DA 1Q44A 4EFLA 3CWQA 3K09C 1EX7A 2G1JA 5J40A 1HQCA 3RNLA 1QHGA 1TA6A 1E9EA 2ZU6A 4CT4B 5L3RA 1PV4A 2V55B 1E0KA 3TK6A 4HUTA 2P95A 2PUXB 1O3NA 2XNSA 2A2XH 1NL3A 1NG9A 1DO0A 2F1IA 3DT0H 2PKAB 4XH9B 3WY8A 2WOJA 2X2FA 2DR3A 1NM6A 3QX5H 2FTMA 1UHBA 1AHTH 1P75A 3WNCA 2QV1A 5FBLB 1F0SA 1DM4B 3GICB 4LXBH 4AYXA 4TQ9A 1E2DA 5PTPA 2F55A 4DT1A 4J2YB 1KTVA 2BHGA 3ZVFA 1A0LA 3NG1A 1BH2A 3BBPA 1HAZB 5FBWB 1O2LA 5A09A 3JZ2B 4Q4HA 2WV9A 3BTHE 4DKXA 4Z0KA 4BZPA 2J0SA 2QAGC 1JNYA 3HR7A 3OX7U 2GCOB 3QBVA 1FJSA 2IOTA 2WAYA 1T4UH 4LV5B 1SC8U 3A88A 3ODFA 3CS0A 3PO1B 3VB7A 1W0KA 2WM9B 1IQIA 1IY1A 3AVUA 1MTWA 2N46A 3TUZC 4Z51A 1C5LH 1E2FA 4DG4A 2HF8A 1OYYA 1ZAKA 2GA8A 2V54A 4A0RA 4X2YA 1ETSH 4PR0A 4MYTA 5EODA 1AY6H 2EU8A 1ZP6A 4QBGB 4OQMA 4LJAA 1DY9A 5CDFE 1UJ2A 4PHFA 2IT1A 2CCKA 3A7WA 3KQNA 3GY6A 1QHSA 1MCVA 3GJ3A 1S0QA 3FP6E 5FFMA 1S5SA 1BO6A 1OJLA 5ANRB 2F9LA 1XMSA 2W6JA 4G3XA 3EA9A 4KP0A 1BRCE 1L2TA 1O2OA 4FI3C 2GKSA 4LYFA 2Z3EA 4M8NE 1ZPZA 3BIVH 1IN8A 2FM2A 2FGKA 4BAOB 3L8ZA 4A9AA 4HLCA 7GCHG 4E06H 4ZKDA 3LBIA 1MAXA 3BXZA 4BZXA 1LHFH 1HUQA 5KSPA 3S7KB 4HZUA 4HB2A 2JLSA 3BSQA 5A0FA 2EC9H 3UTUH 4A1TA 1R10A 2Z7FE 1V2QT 5JS8A 3KUCA 1II8A 2BY9X 4TYWA 2XSZA 5E0JA 2P67A 3ZVMA 4HAWA 3G5UA 4P4TA 1FZZA 4TT3D 3THYB 1L1JA 4FCTA 1I4TD 2FOBA 4NCNA 1TGNA 2A3RA 2W7UA 1SVPA 1QHNA 2DFLA 5DN6A 4HDQB 1SVMA 3LA6A 3K9XB 3URDA 1ZTKA 4OS6A 4URUR 4FUFA 4PZYA 1C2GA 4CH8B 2WYJA 1SGYE 2ODBA 4KI0A 2A78A 5IK2D 4B3DA 4C0KA 3RRNA 2IF2A 4LRWA 1F5RA 2RGXA 1O3FA 1F2TB 1OV4A 5HTKA 3QG5A 4EJSA 2ANCA 3EZFA 2GV6A 4AFQA 3ZYCA 4A8JB 1VYTA 4AYVB 2P6NA 1E3MA 3NHAA 1ZBDA 2BOVA 2H6MA 4C0LA 1JXMA 3E8LA 1G3UA 4HTCH 2GVZC 2J9RA 2VA8A 1NN6A 1YLCA 3E0PB 1SVIA 1OIWA 5DISB 3AASA 4PSVA 4AGJA 1TGSZ 4W5JA 3RLWH 5C1YA 4B6FA 3F8TA 2HXYA 4CW7A 3OFND 1ZNYA 3V12A 3V13A 3SS8A 2GCOA 3SNAA 4MKFA 1Z8RA 1O5EH 2VL7A 2V1XA 3CZQA 2FWWA 5DGJA 2QROA 3QGJA 1N1LA 3S9CA 2QMEA 4Q4LA 2I1VB 1L4UA 1O2TA 1YZLA 1RTLA 1E94E 5G3YA 2OXSA 4MA4A 1ZIOA 1YPKH 4NDZA 4FW9A 2XNIA 4PC2A 3R20A 3RXMA 3GY5A 1O3CA 3F9GA 2VJ1A 5EG4A 3TK1A 3F9EA 3P26A 1K1LA 1E2KA 2G51A 3CKLA 2WKPA 2ZCHP 3KQDA 4SGBE 1P9WA 1BIOA 1Y59T 2IYRA 2XTMA 3MU8A 5BPEA 3HATH 2X19A 5LB4A 3U6KA 2F9MA 3LGTA 1C4OA 5JJIA 3RS4A 1E69A 1IN6A 7LPRA 1GCTB 1VR1H 1E4VA 2IJD1 4NYIQ 4ESTE 1G21E 1QRXA 2R3UA 3BTKE 3L2OB 1DAMA 1C1OA 1TRMA 5FCRA 3B7GA 4NYMQ 1WCZA 3EYDA 2VHQA 1KSGA 3TSOA 3P92A 2ZVPX 2YOHA 2QG6A 2RA0A 3A37A 4AYYB 2RCNA 3EWSA 2ZROA 3EZ2A 5EPNA 2JJ2D 3LY5A 1AUJA 1GJCB 3THYA 3TJUA 1DLEA 3SUGA 3A6PC 1FPHH 2BD5A 1YZTA 4TWWA 4M9QA 2P16A 2V6IA 1O3HA 1E32A 1QJ6B 3TQFA 2NTYC 2NO9A 3UR9A 1NSFA 1S9DA 4XSHA 3K0CA 1DDJA 1FP7A 1KI9A 2ZDKA 1GBHA 4NKRA 1BYUA 1KJYA 5KDLA 4LYAA 2SHKA 1E2EA 3PQCA 3K70C 4C2UA 1F2TA 3M61U 5FPSA 2M5TA 2VIWA 1CBWC 4A8JA 1V2UT 1R5BA 3EX7C 1FY1A 1UVTH 2K1QA 1OX1A 1N0WA 1CHOG 2WSMA 4Y79A 3SV9A 2PGBB 3BV9B 1UDXA 4MG3A 1HQYE 3RS3A 4ISIH 5EQRA 3EPLA 4Q1BA 3RXEA 1A5GH 1LQDB 1Z29A 4ISLA 4OS5A 2IXEA 1QF9A 4B2PA 1NRPH 3SU2A 1ANDA 4D0NA 3SQWA 4Q1CA 1UK2A 4NL4H 2GF9A 3MCAA 1Z71A 4A1FA 2BHRA 5B6LA 2VHUA 4LJ4A 2WPMS 1AU8A 4PZLA 4AKGA 4QBIA 4NPHA 3MYWA 4L15A 3RXOA 2ZUBA 1W8BH 2QI9C 2CE2X 3UMFA 2XBWA 3RXVA 3RLFA 4B48A 1CA0C 1BZXE 1TA2A 4GSYA 1GDNA 1NY5A 5JHHB 3RDPA 2CJWB 2ZRJA 2BDIA 2ANYA 4G5QA 3HKJB 3MD0A 5EP2A 1PUIA 4NE2A 3RUOA 1Z08A 2J0UB 4I31A 3TIUA 3T06B 2WOOA 4TT3A 1TAGA 1O2WA 3U4QA 3IKJA 4YLGA 3VU9B 1S1MA 2XOKD 3AP1A 4F93B 4FU7A 3PV5A 5I25A 2C2HA 3L0PA 5KOYA 1K1JA 4UXJA 2P3SA 2PTNA 1W2GA 1GHZA 3OZXA 5IK2A 1LS1A 4KTUA 1AGRA 4D7GA 2JGNA 2OXCA 3TLOA 4G5RA 5BXQC 1IHSH 1UBGA 2ZITA 1O32A 2L0XA 3VPKA 4LY6A 5P21A 1GHYH 7KMEH 2ZIQH 2PWXA 2Y5HA 1NRSH 1RW4A 4TYNA 3CIOA 1Z8IB 4R2IA 5EXLA 3LQRA 2VHTA 2AGIX 2ZF0H 4L9WA 3W3ZB 1V2VT 1XUKA 1ZVQA 2OQUA 2ZHWH 1DFPA 1WBGB 1OPHB 4Q2KA 1SULA 4ZI2A 2WJYA 1JR3E 3JZMA 1IQKA 1GGDC 4TTRA 3UWJH 2DWQA 3OFNA 1QB6A 4BAQB 2CF9H 5A0BA 2BX4A 2F9UA 4Z1MD 1O3PB 1G3EA 2JCSA 3RXGA 1Y5AT 4ZXXH 1HH4A 1KNXA 4CEJA 2VSXA 4FD2A 4WMFA 5LDDC 3AVPA 4UJ5A 3UANA 4MNVA 4AKIA 1T3LA 2F1RA 4GBMA 3BEIB 1RD3B 2AK3A 1W1WA 1R8QA 1QR3E 1AKYA 4CRWB 4YMVA 3QXXA 2ULLA 2UWLA 1EZXC 4AX9H 621PA 3UIEA 1N3BA 3RU4T 2NZJA 1FLEE 2R62A 4H1UA 1N5LA 4KSBA 3THOA 2XWBI 1W2KH 4NYIR 3K8YA 5TMPA 1G1MA 1P2TA 4ZUHA 1VTKA 1GDDA 3VR4A 3VAAA 4BLOA 3T34A 1A1RA 4X6MA 1MO6A 2OZEA 4NZQA 3P27A 4ZKRU 1MTVA 2PGQB 4DDUA 3TK9A 2QAAA 2NU1E 2GCHF 3NUMA 3LPRA 1SHHB 2FYQA 3LU9B 4TZ6A 1XX9A 4OHZA 4ABAA 2F9OA 1HBTH 1XEFA 3ZLJA 2Y5GA 4EPXA 1P04A 1YLDA 2HYIC 2B8TA 4IN1A 2J46A 1ZPBA 4HAUA 2PTCE 1NY6A 1F5LA 2QN5T 5FPYA 3T1VA 3R0FA 3THWA 1ZGVA 3TK5A 2JJ2A 4R9UC 4Y71A 1O87A 3RRMA 1AFQC 4JYUH 2FMXA 3VU9A 1FQ3A 1KK0A 4DCDA 1UVSH 2QXJA 4CDGA 5HCIA 1C9TA 2HLCA 5T6FA 4D4JA 3SC3A 4FUHA 4TSFD 1TU3A 3DKPA 3KKQA 2R6GA 2JH6D 3L0IB 3KB2A 4CRDA 1IAUA 4Y6DA 3QUSA 5DI9A 5KNDA 2P8OB 2G0TA 1F7ZA 3KUDA 4DLZA 2YNAA 1T4VH 4P32A 2GRJA 3P8OA 5H1YA 1D3PB 3GJ0A 1FFHA 2A7JA 3UNRA 1T8MA 2WWGA 4J0QA 2ANKH 5CK4A 3FMOB 1H9HE 2BVXH 3JZ1B 4Q1DA 3GLIB 4PPGA 1UTQA 1GWNA 1OSSA 1RJXB 2VNTA 4WJG2 2DCUA 4HYYA 4QBFA 2A2QH 2GWHA 2F9PA 2CNWD 1GI1A 2Z3DA 2PL3A 1JXOA 1EQ9A 2JETC 1NIPA 4YMUA 3HGPA 4HI3A 1K6MA 1OKKD 1KI6B 3TJZA 4AN7A 3SU1A 4AG5A 4KKDA 3AP3A 3UOPA 2QP3A 3RXBA 2VP2A 3BG4C 4M1SA 3QF4A 1GHBG 4NWKA 1DAEA 3DFJA 1KXDA 4G01B 5JJKA 2WUBA 4Q66C 2XC4A 2AFHE 4AI6A 5E95A 3AF2A 3E91A 2OCVB 3RS7A 1V2MT 2FEMA 4OQXA 4Q00A 1O31A 4A15A 1RTKA 1AN0A 2GK7A 3GLFB 1G4UR 1O2ZA 1J2JA 1SPJA 4M7GA 2VIIA 1TQ0B 1DUEA 4Q4JB 3SJ9A 1N6HA 1G18A 4NYJR 1LVMA 1TF2A 4BFYA 4Q5IA 3RMMH 5JRZA 2XOKA 1C2KA 2HNTE 5HYOA 3UQOA 2E87A 4IN2A 4K3JA 3TMKA 2N1BA 2REOA 1PVOA 2QXHA 4I8LA 4D81A 1XJCA 4JLBA 4MYCA 1II0A 1QL8A 1X6VA 4E09A 1NFWA 4LOYH 1UTPA 5K8LA 1V3XA 4GLYA 4OJQA 1ZJDA 3GYLB 2ZWLH 4UQOA 1C1RA 2BY5X 2I6SA 4RFSB 1HV7A 1Z0JA 2MSEB 1NFXA 4MLFB 1N6KA 1Q3HA 1UTJA 2B5TB 1SKYE 4C0JA 1KO7A 5C1BA 3GCOA 4K8YA 1AZZA 2XB4A 2O8DB 5FL7D 1K5GA 1DITH 1GHAG 1KXBA 3FAOA 1C5YB 3IEUA 3OF5A 9ESTA 3AKDA 2VSOA 2OILA 1RIWB 3M7QA 4Q02A 1MR3F 2ZSDA 1HAVA 5FL3A 4E7NA 2CVHA 4B2BA 2Q3HA 1SQOA 4FVBA 2IWRA 1O5BB 4M2LA 2GZHA 1N2CE 3A4NA 2A5JA 4TWZA 4TLAA 2D7CA 1RYHA 1MABA 3MO3A 2ZYTX 4A1VA 2QSYA 1JOUB 4M0LA 3K6ZA 4DSUA 3MWJA 1AVGH 2O0HA 1WP9A 2OC8A 1LVGA 3BH7A 3MGCA 3B1ZA 1P2IA 3R9WA 1TALA 2IS1A 3KTAB 3SDZA 1W0ZU 2K5UA 2A32A 1R0YA 1BHXF 1QJ7B 1MZAA 3FDIA 1UVUH 1KY9A 4V0NA 2Z9LA 3QLPH 1CKEA 1N25A 1JIRA 5JB8S 5B2ZA 1ZYUA 5HZKA 1Y5UT 1CO7E 1VKJA 4FVDA 1GVNB 1NN1A 2R9VA 1JRSA 1SVWA 3UG6A 3P95A 1TQ7B 4JSYA 4ABFA 4D0LB 3AGPA 5FUYA 4YMWA 2QAGB 3M7UA 6GCHF 5EZ5A 2V3HH 4EAQA 2NU3E 4E03A 1Z06A 1RRKA 4LC0A 2FFQA 3ZZAA 2FE4A 1OWJA 1C9PA 3AF0A 5AR1A 5EZ6B 1UADA 1QCPA 4C3ZA 4BAHB 2PLFA 5FTMA 2AGGX 5GJVC 2ZFTA 3NBYC 4EFNA 3ZVNA 2BD2A 1AD8H 2LKCA 2ZRHA 2ZI2H 1GTVA 1V6DA 2R2WU 3IGFA 3WP1B 3BWDD 3PV2A 1Z1JA 4FU8A 4K46A 4D80A 1DOJA 1MT0A 3VB4A 3C8UA 3ND9A 4LJ8A 1A0JA 1O30A 1TYNA 3THXA 4JJKA 1D9IA 1K1MA 1VITF 4IXMA 2PLRA 2ZS9A 2BZAA 3M3VA 2A30A 4DJZB 4IMZA 3DOEA 1KGDA 4NFFA 3ZYEA 1ZCAA 2OBMA 2ZRKA 3SI7A 1LHGH 4BASA 2ZTXA 1GI5A 1S3SA 4TLDA 1YZQA 1ESBA 1E2JA 2VHJA 4GNKA 1O3DA 1OXTA 4BLQA 2O0JA 3A1WA 3OEHD 1LHCH 1O2QA 3SGQE 1C2IA 3NWUA 4I7YH 4MPUA 2CJIA 2ZQ2A 2GAOA 4KAXA 1XDBA 1ZMNA 4FUCA 4QGFA 1IQMA 1GPZA 1LVOA 1RE0A 3QY0A 3VR3A 1XVMA 4WZ6A 1AIXH 2PCJA 1GI7B 1OKKA 1BTZA 1UK4A 5F2EA 2CHAC 1NKTA 2RAPA 2A2ZA 3SYJA 4BZQA 4TMZA 1HPGA 1DXPA 4QJ3A 2QY9A 3K09A 3UOUA 1P2UA 1P05A 2LNCA 1MKXH 3CX8A 2NU0E 3SW2B 1VHTA 3QVVA 3NXPA 2JLWA 3VGCC 3BS4A 3UWIA 3L0OA 1C1VH 1BCUH 1CJMA 3H7TA 5SGAE 3W95A 1RZ3A 3H7OA 3P8FA 3M1IA 3CW2A 5DJ7A 1SGPE 3STJA 5JMTA 4W5WA 2V6JA 3VMFA 3A8CA 4PFSA 2GD4B 1RGQA 4HB3A 2GZ9A 3ZZ5A 1AQYA 4P4SA 1T31A 4BNRA 2WJIA 3K70D 3OEED 2LKDA 4X2WA 3MJHA 3HYRA 4Y0YE 1C5VA 3BTWE 4QNMA 2CLDX 1KSJA 1OS8A 2O5VA 5CJ2A 5EJEA 5LPEA 1CVWH 1ARCA 1GDUA 1QVAA 5C1UA 3CRQA 1F60A 5C5NA 4MGIR 1W36B 1AUTC 2FOFA 1CRQA 2QM7A 3PIRA 1C4Y2 4H6TA 3TIFA 1TUIA 4EPYA 5AUOB 2AGEX 2IYXA 5E7JA 4E22A 1E2NA 1P10A 5J4YA 1OP2A 3AEZA 1OYWA 4C4PA 1ELCA 5G4BA 3UREA 5JPMH 5C5OA 1AMHA 1CGHA 1AZSC 4CVNA 1G2LA 1XMJA 5FHTA 4IDQA 1ZM2A 2BBSA 2BZ6H 4X8MA 1Z6TA 4JLMA 4ARZA 3FANA 5FL7A 1ZOMA 1OP8A 2VYFA 2NGRA 4QG7A 4I99A 1FN8A 1NVXQ 1HJAC 3D23A 1GHWH 5JCPA 2RGAA 1LF0A 4IVPA 1LTOA 1XXHB 1E2PA 2BDGA 1ZSJA 1S9HA 3FYHA 1G64A 3U8OH 1Z6AA 3QPWA 3DL0A 2F6RA 2AD5A 3A7XA 3WHLA 4CZ2A 1CE5A 3SU0A 1DELA 2ZI6A 3VB5A 1QZXA 1YF4A 5CK5A 3U9AH 2V6NA 2FS9A 1T3HA 5B30A 2DY1A 1HCGA 1HYLA 1CR1A 1IQNA 4GAWA 1EB2A 3CRMA 4K5ZA 1GI9B 1FPMA 4GPGA 2BY6X 5JFGA 4ZCIA 3B2EA 2ZXUA 1W0JD 1UAAA 2QQEA 1A0HB 3FOZA 2QE7A 3QTVH 3M35A 1Y3VA 4QXAA 2WPLS 2PJZA 2WWIA 1YHNA 5JBAS 3TRFA 2AS9A 2CBZA 3RAPR 2QQ0A 5DPAA 5FBVB 1OOKB 1GBFA 2CCGA 3T26A 1SGIB 4NMMA 4GI7A 4NZLA 1NNEA 1TRNA 2W0SA 2ZI3A 2D8WA 1CBWB 1CS4C 1YC0A 1MAYA 1GMCF 3RANA 4AFSA 3PWCA 4XE4A 1BYIA 1XPUA 2TGDA 1AZTA 3RC8A 1KZ7B 2RA3A 1OWKA 1SVSA 3M0EA 1S3GA 1E9CA 2R65A 1SLWB 4O2RA 1X8LA 1P03A 1GZSA 4FCVA 3OSYA 1HLTH 1B0EA 4AYTA 3D3QA 1MQ5A 3GISB 4UDWH 4R2HA 5EXPA 2ZJ8A 2OFXA 4RKFA 521PA 3F3YA 3LX8A 5DI3B 4D25A 3B78A 4EFMA 1K1IA 3GCNA 3SR0A 1SI5H 1LHDH 1PPEE 3TSZA 5JRJA 2F83A 1GMDF 4EJSC 3U1JB 4RZXA 4ILEA 2R6AA 4ABDA 2G88A 3W6PA 3KIDU 1HIAB 1XJQA 4DURA 2XTTB 3B85A 3M5MA 1F0TA 1Q20A 4ESVA 2WYGA 5J4SA 2H92A 4URYR 3U7EB 2IS2A 5DHFA 4CRGA 2DWOA 1IN5A 1CA0B 1KI8A 1VGCC 1O5DH 2ESTE 2HVXA 3MG9A 4II7A 1M7BA 2IEZA 2ZEJA 1XPRA 1PLJA 3OEHA 2SGDE 4M1OA 1GI2A 1FAKH 2BVRH 1GSIA 1ZM9A 1FUUA 2HLDD 5JHGB 3ZGXA 3LOXA 4DDWA 4OK6A 3Q3KA 1ELFA 4Y7BA 4ZHLU 5GWZA 1TX7A 4WF8A 3U3JA 1SQAA 3GCTF 2F1HA 2VP4A 2ZAMA 2SNWA 1T0HB 1QBNA 3R9IA 1YP9A 2QPOA 3LC5A 3RXDA 4UE7H 4PC7A 2A4OA 4YXWD 1OKXA 3HK3B 1TQ2A 1GI8B 4NFEA 1CR0A 3T1OA 3QGNB 1C5UA 4LBVA 3RRYA 3PTNA 2AMDA 1C1YA 2KI5A 3SQXA 5CDFA 4ZHMU 4NCJA 3PVSA 1BKDR 2BQWB 1JJ7A 1EAWA 2A1DB 1KMHB 2FX3A 1QHYA 1QB1A 2PJRA 1YPEH 2ZJBA 4RN6A 1G3QA 1G32B 3QIAA 1BRUP 1O36A 4DGJA 1Z7KA 2TIOA 1C4U2 3TR5A 3MUFA 4DCUA 1C5ZB 4FUDA 1Y8TA 2MSDB 2QPTA 3TW8B 1GUAA 4OI1A 5EQTA 1IBRA 3PLPA 2PKSB 3QUMP 3BD9A 4JLNA 1Z63A 1ELTA 3BEUA 5GXPA 2J59A 4I33A 2DE9A 1P3CA 1C1PA 1GGDB 3OEEA 4Q7ZA 1RXPA 4Q21A 5EXSA 4BANB 2AYWA 5HE8A 3KQCA 2JEOA 2ZYWX 3LXXA 1ZNWA 1P9NA 1RFNA 1Z2AA 1KDQB 3SZEA 3TJOA 1NLYA 4V03A 4GOXA 1N6OA 5DP9A 3ELAH 3AAVA 1H8IH 4R71A 1YGCH 3LO5A 1MTNC 3M4YA 3Q7QA 1R5NA 3LH3A 3SBDA 3RMLH 1G3CA 1EAUA 3BH0A 5KSYA 4IW4E 1PYTC 2P65A 2BMEA 2C8YB 1KJWA 3M6AA 5FBEA 3K0CC 2JASA 3W94A 1KZGB 1C5WB 3B60A 3Q76A 3LVQE 1WBBA 2ZE8A 5FBQB 1OIVA 1TEXA 4B2LA 4EQ6B 1T91A 2OFWA 1O3KA 2MMCA 1XMVA 2C98A 1JWTA 2PLXA 3B6EA 1K2I1 1VCWA 3RXLA 1XCMA 3E3TA 1YR7A 1QG2A 3ATWA 3KFVA 1IJFA 2A4QA 3A7YA 2ZJ2A 4V0OA 1US8A 3QEJA 4K81B 2OCBA 3Q3JB 5IT5A 3PUWA 3EPKA 4LPSA 4KITB 4ABIA 3MU1A 3HP1A 1BB0B 3CENA 1UTKA 1P09A 4YMSA 5KNBA 1INCA 4PPFA 1GI0A 3EPJA 1Z8JB 2F3CE 2DYKA 4OBEA 1JR3D 2A7CA 4WZAE 1QURH 3SJCA 1TMUH 1ZM3A 1GHXH 3GFOA 4P4UA 1THRH 3O8RA 1NO9H 1IQFA 2YOFA 3ZZDA 1Z8FA 5JWRA 3F0TA 3BTME 1Q31A 3MU5A 1SLXB 1AFQB 2QGNA 3QO6A 5L2YH 5JJLA 4NCKA 6CHAC 3ZVLA 1CR4A 4LCBA 1W0JA 1R4AA 2WUCA 5D3MA 4BWYA 3FMPB 5CIQA 3A8BA 4K8OA 2FOLA 4Y11E 4XOIA 4I1UA 2WPHS 1XTQA 2JH5D 2Z5FA 2ZJOA 2G77B 1UO6A 3PFIA 1J99A 1P60A 1GJBB 3PJRA 1T8UA 3SNDA 2HDNB 4Q9IA 4ON9A 1NJGA 1LNZA 4GHQA 3A7ZA 3UR6A 2XBXA 4MRVA 2ZE5A 5ESBA 4M1TA 3QENA 4W9MC 2PFEA 3BFXA 3W90A 4A7IB 4IJMA 3BB3A 2BXUH 2REBA 1SXJE 2R2MB 1OPXA 2JIZD 2WHXA 2YWFA 2XZOA 4KVAA 3C15C 3MU0A 1SOTA 1Y3UA 1ZMJA 3MFYA 2O8EA 1C5OH 1GKYA 4KTCA 4ZCMA 2JETB 3MH5A 1GWAA 1N6YA 1Q22A 1R7RA 1O39A 5EXMA 1J15A 1F2UB 4GCHF 4WBSA 2XCFA 3QXHA 1YCPM 1OLOA 3ADKA 4B71A 2FOCA 1G9XA 4FN5A 2FDCA 1I4DD 4TTQA 3P17H 5HMAA 2FSFA 1C5PA 4CYMA 1U0JA 1EFRA 1TX4B 4XIGS 5F6MA 3BG4B 1R0WA 1EB1H 1PPCE 1G5TA 4XSKU 3RDZA 1J16A 4ISHH 5CJPA 1IQGA 2YNBA 1LTQA 4B47A 5G3ZA 5FOVA 2EWVA 3AUYA 1U2RA 3G0HA 2F3RA 4NCIA 4AWXA 1YPHC 4MNWA 4FUEA 1M74A 3KQKA 3K2UA 4BECA 4EQ6A 1IN4A 1GHVH 3LXRA 2XITA 1L2EA 4B75A 4NU0A 1KSHA 1BBRE 2HCBA 4TMVA 1AN1E 2BJWA 9LPRA 3SEAA 1FY8E 5KPJA 4C0QC 1IQHA 4Y0VA 5TDHA 2EI8A 4QGHA 5L3VA 4MPWA 3GCGA 2BOHB 2P93A 3EIQA 2Z9IA 2ZDLA 4YXWA 1Z0KA 4DUGD 4KSCA 3KL6A 3RS0A 2GT8A 1E2GA 2FOEA 4I8KA 1HAHH 3MNBA 2OQ5A 3A7TA 3LH1A 2GXSA 4Q9JA 1UEJA 1GBBA 3NHBA 2W3KA 2XXLA 3RS5A 1NMXA 1CGIE 1HA3A 3K65B 1XD2A 1C2EA 1HAPH 1E6CA 1G4AE 2Q21A 1TGBA 3LONA 1CGJE 1KK3A 4QJ4A 1O5FH 2ZU2A 2IEYA 5FBRB 2QAJA 3SN8A 1EX6A 2GMTC 4BUJA 1BMFD 4JKIA 3R7WA 3RVBA 4BRUA 1FONA 2Q6TA 1TMTH 3GD7A 4PXAA 1O37A 2A4RA 1X8KA 4X1PU 5SZIA 3U3KA 2TPIZ 2ZGJA 3GDVA 2ZDVH 3SU4A 1TPAE 2B92A 3TVJB 1C9KA 1P2QA 3P8GA 3T1TA 4RSGA 1N0VC 4NA8A 2ZHDA 1G3BA 2FWRA 3RXFA 2B7DH 1TPPA 4QL3A 3EA0A 2WWWA 1IY2A 4IVRA 1FX0A 2H2ZA 1ETUA 2QMOA 1Q3XA 2C95A 1T8OA 4YT7H 1KDPA 1WB9A 1YBWA 4J1YA 1EZSC 1ESNA 4YTAA 2D74A 1K1PA 3QOFA 5TB5A 1ELEE 2YHSA 4B6EA 1E2IA 1SLUB 1WF3A 2XTNA 3W6OA 1L4DA 5GADl 5CIWA 1G41A 1LPZB 1NMYA 5TCCA 3M37A 2AMPA 3RM0H 3DHKH 1XJ0A 4BAMB 5AUPB 4GZLA 5EP3A 1GITA 1GILA 4LDJA 4US0R 3HYTA 3BGWA 4OQLA 1YKTA 1ID5H 2FDAA 3QKSB 2QL6A 1W5SA 2GXUA 2J4IA 4CEHB 1AGPA 1NZQH 1KXAA 1GBJA 2FEQH 2FO9A 4QJ5A 3H1TA 2EWWA 1J14A 3ECCA 1OE0A 1E9AA 4EPTA 1T32A 3GLGB 2W0MA 2W00A 5TJXA 3ZS8A 3TGJE 4A1XA 4FMDB 4C7OA 4DSNA 2IJOB 2R3YA 2J94A 4WH8A 4Q01A 2CLSA 1JR3A 4MGYR 3SZRA 3I72A 1V5WA 1S84A 1GBCA 1JXPA 2RGCA 4GMXA 4CR5A 1WUNH 5L3QB 2WSSD 2WWXA 1QY6A 1FIWA 2VVVA 5DO4H 1IXSB 3AKCA 4YMTA 3CX6A 3M3SA 2PZFA 2V0BA 5FH9A 3LAWA 3TKLA 2C9OA 1O3BA 3V3MA 3IITA 1W4BA 2VEDA 1E0AA 1HB0B 2Z9JA 2R8RA 3BIFA 3QKUA 5CYOA 3BRWD 1IQPA 4MYHA 2VO1A 2XGJA 821PA 2CL6X 4A0HA 4A2PA 1KJZA 3LW7A 5C46F 1A7SA 5BRRE 3QXSA 4PPNA 5DO9A 4QC2A 3KGPA 4RZUA 2OC0A 1AB9C 5H70A 1BTXA 3BTQE 3ZZBA 1SOZA 3LGIA 4RD4A 4OS4A 2OLKA 4YOJA 5DGXA 2HUPA 1UPTA 1P72A 1TX6A 2PH1A 1XUGA 1HURA 1RRPA 1D3DB 2JIZA 2OAQ1 3LGYA 2C8ZB 3WYAA 3SFVA 1TMKA 4ZO4A 3IIJA 2GZ8A 2RKOA 3TH2H 1MU8B 3OTPA 2J95A 6GCHG 2AXPA 2FOMB 5AJWA 1VJ9U 3UWKA 2ZU0C 1DLKB 4EPVA 1A7JA 2D7DA 1C5QA 2CHAB 5ETXA 4G5GA 2ERYA 3RC3A 3F6UH 4ZKNU 3U3RA 4AURA 2V3CC 4CBNA 3SYNA 5E2OA 2BMDA 3GFTA 3C14C 3PLKA 3LFUA 4OGXA 1C5MD 1GAJA 3BFVA 2BM1A 1U9IC 4PAMA 2KSQA 3DZ8A 1G7SA 1TBQH 3C41J 1KI3A 2OSBA 3K0FB 121PA 1JBKA 1TWXB 2G3YA 1X7AC 1MZDA 4LV6A 4DZZA 1NVVQ 3SJOA 2CF8H 4FXPA 1GFIA 5DE3A 1VITG 3SJ8A 3V4RA 1SGRE 4TN1A 2BD7A 2ZR9A 2G5VA 5FAHA 1G8PA 2J3EA 1Z6YA 1TL7C 1FNMA 2JJ1D 1O2SA 4I1OA 3DMNA 5C20A 2OP9A 1E0FD 2ANWA 3U1IB 4I1SA 2BD8A 4R0IA 4DUGA 1P6XA 1LKAA 5FTLA 4LK2A 2FSIA 3I73A 1ZYOA 4DSTA 3ZZ8A 3ZZ6A 5L30H 4DRZA 1XX6A 5B64A 2PZEA 1A5IA 1W0YH 3U3MA 4BLSA 3QKRB 4H6SB 2Q9BA 1EESA 3UPEA 3ADBA 1TGCA 3K0AA 4VGCC 1Z1IA 4S35A 1NN5A 1K22H 4YDHB 4X1QU 3RC5A 2R6FA 4B43A 2W3IA 2EFGA 1BDAA 5FPKA 3RXPA 4DCSA 3SNHA 4XJXA 4HFPB 4DT1B 3D62A 2RB4A 3NCLA 2BQ6B 4Q4HB 5E7MA 1N6XA 3OIWA 2RGBA 3C5CA 2YC2C 2V9PA 3I1FA 2CL0X 2A9KA 1ZPCA 1HJAB 1HJ9A 2O8MA 1TOMH 1P4SA 1Z5ZA 5GJCA 1ETRH 1GJ5H 1CJTC 1Z6EA 4NG9H 2CK3D 2OO7A 1J90A 2VIQA 3H09A 1VG1A 5FX6A 3NKKA 1DPFA 1W46A 3EXAA 1GG6B 5JCZA 4XBDA 2G4UA 4GSOA 4UXHA 1CEEA 2H57A 1IHUA 3BIUH 2GHIA 2ZREA 4GL2A 2FI4E 4XFQA 1HAXB 4NIWA 1GG2A 1BJVA 1PPGE 4FUBA 3FFGA 1NU7B 5GIBA 2VPPA 4ZDJA 1LKBA 1WMSA 1C4V2 4JYTA 2DE8A 1OXGA 2C04A 1JJVA 1DADA 1KDTA 5AUQA 4Y0AA 5HE9A 4LZ1H 1VCQA 2STBE 4JYVH 1KOFA 2Z6VA 3KXIA 2DFNA 1BTYA 4B2AA 3DO6A 1SMFE 1NKSA 4TTPA 4ZKEA 5IDVA 1IAQA 2PSYA 4AK9A 1E99A 1O3LA 3FGNA 3A81A 4LOAA 1JEDA 4JVMA 8LPRA 4HZUB 3OY5U 5AJZA 5DYGA 4QKQA 2GVDC 1DSTA 4JK6A 2ZHFH 1RRFA 2YZ2A 1THPB 2ZTYA 5EE1A 2FESH 3ZZ7A 4PHHA 5FOTA 2H5EA 2VP5A 3H5CB 3T29A 1EXFA 4Q7MB 3FVQA 3ZZUA 3SUFA 4QHSA 1OFTA 3SOPA 1DX5M 2I3BA 1A61H 1D8TA 3RS2A 4P31A 5DNYB 2WSSA 3NH9A 4LYHA 1WTHD 4ISOA 2XXAA 4FMDF 4LYJA 4C0AC 4K2YA 4LJ9A 5A8YA 3A1UA 4QFMA 1A2CH 2PZGA 1YCPK 4B44A 1JPNA 2P5SA 5FUXA 2V1UA 3LGWA 2ALVA 4M9SA 3CONA 1CT4E 1TNGA 5F8XA 3WP0A 4EJSB 3VB6A 1BIFA 4IFBA 2YV5A 4BFTA 1E38B 3RHFA 3KKPA 1CP2A 3UPUA 3QKRA 4UONA 2QP9X 3B8JA 5A0CA 1TIOA 3BAFA 1PYTD 1JALA 2FFHA 3NC0C 3MI4A 2FX6A 3SJBA 4GMDA 3B23B 1VGCB 1SL3A 3C27B 3A8AA 4CRAA 2IUUA 3MFJA 2ZU3A 4O25A 4ZH8A 1VECA 1OP0A 3FFBA 1N6NA 4B73A 1J7KA 3T5DA 4B1TA 2DB3A 2UZIR 2ANMH 3GEIA 2BDBA 2C93B 2UWOA 4PC3A 4RD2A 2STAE 5CE1A 2ONJA 1KIMA 4AGKA 4YOGA 5DLQC 4ABGA 4LI0A 1GMCG 2ZFRH 3HPTB 4BFUA 3RXAA 2A5GA 1KY3A 5DHAA 2F3TA 3KX2A 2J38A 3KJHA 4LSGA 1G19A 3ITIA 2WMOB 4M22A 2J7KA 1ZNZA 1IQEA 1K1NA 4ZMAH 1EATA 2GKVE 1FTSA 4PROA 1YRAA 4EDHA 1NFYA 2Z4SA 3QXCA 4O9VA 4Y8YA 1NVUQ 4U5XA 1QNJA 3FZZA 2FG5A 3BOSA 4YQFA 2JLZA 1CTQA 3CH5A 4X2XA 3I29A 4MKHA 1EGAA 4ZDKA 2DPXA 1GMDG 1E2HA 3MH6A 2EFDB 1U94A 4G5SA 3DM5A 3QKTA 1VG8A 3ONWA 3SBEA 2QZ4A 1N6LA 4OI4A 1NIJA 1SQ5A 1ZD8A 4JT4A 3CRVA 1KNQA 1NU9A 1UBCA 3E1XB 4BPBA 1WOFA 4U02A 2LWIA 4AFUA 1OSNA 2FJUA 1CU1A 4D4LA 2QT1A 4CR9A 5EQQA 2B8WA 1T6NA 2J41A 2ZRFA 1M34E 4Q47A 1O2RA 1FNNA 3I4LA 3GPLA 4Y76A 2XBYA 1O3YA 1D6WA 1EOLA 3ZVBA 4U00A 1J8AA 5K7RA 1ACBE 4N0EA 4TPYA 1J9CH 3VKHA 2ZFPH 2F4LA 1TPSA 2ORVA 5K8IA 3U44B 2OCAA 4E5UA 3FE2A 1AKSA 1Y3AA 4CREA 1H9IE 1VZQH 3AK5A 1Z0IA 1A46H 4JBWA 3E16B 3PUVA 5JLJA 2BMFA 1VMAA 4RJLA 1NN3A 4W5HA 4Y8ZA 3PEVA 2BC9A 3GP8A 2OAP1 4CT5A 2NIPA 2VQSA 2F1JA 2CK3A 2XC5A 4BLRA 2IUTA 4BFZA 1EJAA 1SGQE 2NO7A 3GY8A 3D49H 1C5SA 1YPLH 4AORA 4PO1A 4HUQA 5KO2A 2D26C 1W4AA 1W4CA 1XU4A 2QMUA 4MNXA 1EP6A 3A58B 5GPIB 3ZVAA 3VNUA 1XMIA 4F38A 5LD2C 1Z6JH 1TLDA 3BFKA 1L4ZA 2QA5A 3RC4A 3RP2A 4ZI3A 4AG2A 4NSYA 2VH5R 1OWHA 1B7XB 1G3IA 4E7RG 4ZPXA 2W6ID 5JZVA 1P2VA 4DLXA 1RVDA 4NHOA 3BTFE 1AM4D 1E2MA 1CHOF 1KTTB 4DW2U 2Q6DA 3RU4E 4ZIRA 5J47A 4JBXA 2G9NA 1D2EA 2JH0D 3WRYC 2C9YA 2FPKA 3A83A 1ZSLA 3KJIA 2VGCC 5JECA 3LQQA 4LHVA 5EXXA 2ZRMA 4IGDA 3ICQB 5KHOC 2WKQA 3SNEA 4F4JA 3GDUA 4HLQB 2QU8A 1AVWA 1ZJKA 1GCTC 3AVOA 4EPWA 1SVLA 1U98A 5CITA 2BQ7B 1GKUB 1NJFA 2VP6A 4TL6A 2AN9A 1O3IA 3U4QB 4JLOA 1KO8A 1WXRA 2BBWA 5FPHA 4BFSA 2JAQA 2FF7A 2BX3A 2IPHA 4UNNA 4CRBA 1AFEH 2BVNA 1AS3A 4WWYA 2XJ4A 3AW0A 4GP6A 4CGZA 1E37B 2BDTA 3E90B 1DUAA 1QA0A 5K0HA 2KWIA 3SJAA 2GV7A 2HEIA 1T5IA 3PUYA 2Y82A 4O0MA 2OINA 2WIAA 2XEXA 3D8BA 1L7VC 3PXGA 1QRAA 4DOQA 1ELVA 3VKWA 2FZ4A 2HALA 2OUKA 4JMYA 1TNJA 4DLWA 3U3OA 3KQLA 2V7QD 2FP7B 1T8TA 3QZQA 4XOJA 1V2NT 3CPJB 5FI1B 3LIWA 3B82A 4H4FA 1AQUA 3F5FA 3U44A 5LB2A 4Q9KA 4URWR 4U30A 4L16A 3ICEA 1QBOA 2ZPSA 1WRBA 4TLBA 4D6PA 4GT1A 1Z6GA 5BW8A 4F91B 2GEDA 1GP2A 1UTLM 3LW8A 1WE2A 4ABBA 1PUJA 2R6DA 4JVLA 1NT1A 1Z83A 1S2MA 1W7XH 1QIXB 4OM9A 1XP8A 1HY3A 4CEJB 4KBGA 1L0ZA 2FPZA 1J8MF 4UFEH 1GL9B 2E1RA 1COWD 2WV4A 1N0UA 2AD1A 4LHXA 1H8HD 1SXJD 1DE7H 4YESB 1NBME 3IPYA 2XZPA 1AGJA 1YJ5A 4UNSA 3PMBB 1R2QA 4RZ2A 3AW1A 2BTCE 2Z9KA 2FGJA 3F68H 4MITA 2GMTB 3AGQA 2Z43A 3SJIA 3WMFA 1F48A 1W48A 5E8EH 3SFZA 1E79D 1NTPA 1UKZA 3KDSE 3WYGA 5HM9A 3PROA 3GLIE 2RGEA 3KF2A 4C0SA 3EZ9A 4OHXA 2OC7A 1KI1A 2ATXA 3G82C 1TNHA 1C2JA 1GJ6A 4IOJA 2AWOA 2FLRH 5AWFC 1IONA 1FMLA 1OXUA 3QG1A 421PA 5HPYB 1E0JA 2OLGA 3REFA 3BTEE 2QENA 2FFAA 3C5HA 2ZZUH 3THWB 3TU7H 1O3JA 1L4YA 3OHMA 2ZPTX 2BDAA 4U32A 1GBLA 2G1KA 2ORWA 3V4FA 4D4KA 1Y3WA 7ESTE 4LHWA 3MJRA 1EFUA 2UZ3A 3E0NB 3RMOH 4BEJA 1Z2CA 3BG8A 1GDQA 1MO4A 1GBIA 3MTYA 1D6RA 4INHA 1ZW6A 1KDOA 1LPGB 1FQJA 2ZGBH 2IF0A 4JL5A 1FY4A 2YYZA 1YPGH 3GLFE 1ANBA 1JB1A 1AVXA 1RIFA 1ABJH 1BQYA 1Q1QA 4V0KA 4EIWA 4L9SA 1MV5A 3HK6B 1IM2A 1FP6A 3CRRA 3IBYA 4O2LA 2P3FH 3Q72A 4BGDA 1UTOA 3IHLA 2IYWA 3UNQA 5ELXA 3EZ7A 1ZRKA 1VIYA 1ZU4A 1OF1A 3EQ0H 3U7HB 3AAUA 5HCNA 5DP8A 1FUJA 4BLPA 1GM5A 4U2WA 4GHTA 4JL6A 1NC6A 2F43A 2FX4A 4DCVA 3S1AB 1KMQA 1GJ7B 2FMJA 2W6IA 3PEYA 2WPIS 1QG4A 3IHWA 1E9FA 4DSOA 1O5CB 2ILNA 2D2FA 3QF4B 1UF9A 2XNDD 4RZ3A 1ZCBA 2GZAA 5C3NA 1GI4A 3T61A 2OCPA 1DAKA 2GCPA 5GCHF 4NTZA 1QHXA 4BEBA 1YKSA 5C67A 3UMRA 3RXUA 4DEYA 2HJGA 3PMJA 4L5BA 2BD4A 4URZR 3MWKA 2ZKSA 4XBBA 4N3NA 5F8ZA 2RCEA 2V3OH 1P3EA 4Z8XA 1QDEA 1S8FA 1ZRBA 2J5XA 1S96A 1AB9B 1DEKA 4RKJB 4MGKR 2ZGHA 4B3XA 1AQ7A 4TL9A 4NYMR 1BOFA 4AKEA 1NI3A 1UDWA 2VIVA 1EAIA 2HF9A 2ZJAA 1E9DA 1GHBF 2JLYA 2HWLB 4X8HA 1FW6A 1EP5A 4HEJA 2D3WA 3MSXA 2XW9A 5JDUB 4X1RU 2BD3A 3GJ4A 1ZINA 4F4OC 4NIYA 3FHOA 2ZR7A 1ELBA 2H5DA 4KFSA 5JWOA 4DLTA 1Z47A 1HAOH 1XPOA 1LF5A 4JKYA 5FTJA 4MQBA 4IBLH 3ODDA 1O3AA 3NBXX 1Q12A 4PTLA 1KLTA 3ZJYA 2XAUA 4PO9A 3ZD6A 1P5ZB 2ZQ5A 3VR5A 2O8WA 3A1SA 2OCYC 3NDBB 1P2KA 5DH9A 4Q18A 3I8XA 3SV6A 2AR7A 3TH4H 4NBSA 3PWBA 1GBDA 4BQSA 1X8JA 3IIMA 2EI6A 4KVGA 1CLUA 2RGNC 4WW0A 4RD0A 2A45B 3QNUA 2WJHA 1SSXA 4Q7LA 1V2LT 1Z22A 3GEHA 3VX3A 1W11U 4CRCA 2ZHEH 2IWHA 2QXGA 1HAVB 1HYQA 3DM9B 1S6FA 1P12E 5C1XA 1WXQA 1SGWA 1FMGA 3FMFA 3N70A 2PX3A 1TQ4A 4XTCS 3F9HA 1VPLA 2ZGCA 3NPSA 4KU4A 3SOSA 5KNCA 3SZNA 5K8UA 1MABB 4URVR 4ZV4A 4KV9A 1COWA 5DP7A 1G8HA 1OXVA 4LV8B 3RM2H 1H8HA 3A85A 1SXJA 4XWOA 4D9RA 2V35A 3EAJA 3TUIC 4DLSA 2CE7A 1GVLA 2VP0A 4TY6A 3QPUA 4JYCA 4D2IA 3SU3A 1GHAF 4LBYA 3WMGA 4Y8XA 5E0GA 5BQ5A 1C5TA 3S1AA 1TBZH 1BJUA 1XM1A 4VGCB 3LWNA 4PQFA 2OG2A 4Q4AA 4IOLA 4UEHH 2VF8A 2GZ7A 5AK0A 2D62A 3QXJA 1E9SA 3QTOH 1HTWA 4BLTA 2VTKA 2NO1A 1E79A 2YOGA 5C18A 4MDFA 1UMAH 2WKRA 1G8GA 4CF7A 1KK1A 4KLZA 4PX9A 2FI5E 2SNVA 1GNQA 1BBRH 2Y7XA 3HGNA 3R9XA 4IDOA 4D26A 1THSH 4Q1FA 1CHGA 2BMGB 5FI0B 3I77A 1TNDA 1XXFA 4INLA 3KQHA 2ZI9A 3LNCA 1UKEA 3SYKA 1ANKA 1Q57A 1O2NA 2YWHA 1UKYA 5A5GA 4FWIB 2WBLC 3A1VA 1TE0A 3KKNA 2GGVB 3TBKA 1M8PA 1W7GH 1KI4A 5DP3A 3NKVA 2GTBA 3UMSA 1D4PB 3DEFA 1JI0A 1NLZA 5BYKA 3QI2A 1XMNB 2ZRGA 3NEJA 2H8KA 4YZUA 5SZJA 1W5TA 3N2EA 3I61A 2J0QA 2HT1A 5J4QA 1RRGA 1X86B 3N2IA 3THXB 1KY2A 2PHBA 3A1TA 3MLEA 1U8YA 2IS4A 3IPXA 5H8WA 1ANEA 1S83A 3T5FH 1E35B 5JSZB 4LUCA 5G40A 1D9ZA 2HJVA 3QBTA 4NZYA 1G37A 3SO3A 1KAOA 2X77A 4ZKSU 2C4FH 3QF7A 2IUSA 3L33A 4R7ZA 1TPOA 1TMBH 1YE8A 4F92B 1OB5A 2QCYA 3AVQA 5KU1A 1G6HA 2GZDA 5AJVB 4DIEA 1P8VC 3SV2H 1OFHA 3PG5A 4A36A 1BTPA 1EWRA 1U9IA 1G3DA 2IHBA 2BY8X 1O35A 2W58A 3WBKA 1Q1EA 2ZU1A 4EKDA 1SGNE 2VWNA 2ZA5A 4V0LA 3UFAA 1C2LA 1U6QA 1BITA 4Q7JB 4FMBB 1NY22 4DEXA 1QHIA 2J7PD 1R0ZA 4Z1MA 4DB4A 1DPOA 4W7SA 2BLQA 2XNDA 2WJJA 3Q9LA 3ZVGA 1EPTC 3NZIA 1WQVH 2QPAA 1Q21A 4JLAA 1O2VA 5F8TA 1W44A 1WYKA 2THFB 3LJOA 1H8ED 1D9XA 1QGFA 1JPJA 1VCNA 5EP4A 4M9ZA 5JEDA 3B13B 5EE9A 1FAXA 3T2NA 2Q6GA 3CB4A 4OK3A 1GI3A 1W7AA 4RCZA 2ZTSA 1V2WT 1XXHE 2PSXA 3GMTA 3PV0A 5IYTA 1CXZA 1G7CA 2UUJB 4UFDH 2EYUA 4KJZA 1SBWA 4DIIH 3I8SA 2ZU4A 4TYYA 1RJ9B 3RXSA 4GVUA 2PT5A 2GILA 3E2IA 2BDHA 2ODPA 4P4SB 4UJ3A 2AIPA 1K8RA 4JZ1A 4LPKA 1O3OA 1DSUA 4JZKA 5HR5A 2XYAA 1GI6A 4TWYA 3N7OA 4JLDA 2Q1JA 4ESHA 2A31A 3ADDA 2SGEE 1DY8A 3U8RH 3B1XA 4XVRA 2FTLE 3EIEA 4C0BA 1SGFG 1HT1E 4WA7A 2ZR0A 3F1SB 5A0AE 1S0UA 3I78A 2VH0A 3QSYA 4NP6A 3WYFA 1GJDB 5FOUA 2FOGA 1IXZA 2C77A 3CR8A 2WWHA 5T1VA 4SGAE 1VCOA 2IBMA 2B7CA 4QGGA 1H9LB 2P2LA 1XKBC 1O38A 3CM0A 4HAYA 4TSFA 4NCYA 4ARZB 1GNPA 1YZGA 2QC2A 2QBYA 3SHFA 1ZIPA 1NRQH 1W13U 3LDXH 1MRNA 2C8VA 2RH5A 2GDEH 2VVCA 1LMWB 5JSZA 4IHQA 2ODWA 2OBLA 5FTKA 1C1NA 4BTTB 4TY7A 4ASUD 1ELAA 1U81A 2ZGXH 2W83A 5FTNA 1B23P 1V43A 2D06A 1FY5A 3VXEH 1EKBB 3V0XA 2FFBA 4UFGH 1I4LD 4Q48A 5DSZA 1O2GH 221PA 2IXFA 4KTSA 2B21A 3CF2A 1GL1A 3EW9A 1TQDA 2VWLA 1TPZA 4QBHA 4BFVA 5TVKA 3VB3A 4F4CA 2CNWA 3UIRA 3X1DA 1O5AB 4WXIA 2H16A 5EP1A 4RFVA 2HNTC 1E98A 3LT3A 2UKDA 3QWCH 5GJBA 3P4XA 1YQTA 4AG6A 2TGAA 4XVQA 2SGFE 3OIUA 1QFKH 2WICA 4WY3A 2OT3B 2PKAA 2KE5A 3SUEA 4BXWA 4UNRA 4Q9LA 1WSSH 4K1SA 2GEVA 2P6UA 2KBEA 5L6NH 1OH8A 1O2HA 4D7FA 2ANBA 3SE0A 2ERXA 1TONA 3MWLA 1E9BA 1DTSA 2QORA 2NOAA 3PUZA 4B3BA 1P73A 3WNBA 3GY7A 1BT7A 1FN6A 2JKHA 1R6BX 1ZTLA 3LGUA 4IS5A 2QUZA 2Q3FA 5EW1H 3UY9A 5CLLA 1UFQA 1P02A 1JQJC 3PV4A 2GJKA 3A84A 3EC2A 3UATA 3SNCA 3GLHE 2JDID 3IWMA 3H2YA 3TAUA 2O8UA 5FOWA 4K60A 2V4ZA 1A5HA 1U0LA 2WIBA 1RJ9A 1AO5A 4ABJA 1W36C 3KCGH 5LD2B 3RLYH 3SYLA 2YOLA 1SHYA 1UTNA 2QMHA 3SU6A 2GBLC 1S85A 1G3MA 2OBQA 1N6IA 3AVTA 3D65E 1F3OA 2FN4A 2W5EA 2Z83A 4X1SU 3BK7A 1UBEA 1O2XA 4D82A 1FOEB 1Z0DA 4NWLA 3OTJE 2GAAA 3VXFH 4HDCA 2FOHA 4M4SA 2C9CA 1AWFH 1HGTH 1KKMA 1ZR0A 5T6DA 5F3WB 5HZHA 1HAIH 2TRMA 4NCHA 1G291 2OLJA 3RSLA 4AIIA 3NDPA 1CT2E 4MDSA 2VGCB 3TW4A 3KEEA 4M9XA 3DZDA 2Q0HA 2G4TA 3ZVEA 1F5NA 3KZ1E 3SI4H 1DG3A 3EGKH 2WTUA 3V9PA 3W9YA 3GJ7A 3IQXA 1DAGA 4X8OA 2HT6A 3CNLA 5AVDA 1A1VA 1P06A 2XX3A 4I8HA 1YCPH 1T9HA 3W8RA 1VYUA 1GMHF 2FA9A 4N0DA 4ZROA 4GUXA 3WBJA 1OHHD 3Q77A 2J7PA 3KKOA 5JS7A 2HV8A 4ZCLA 4Q7YA 3UG7A 3LC3A 1S81A 3K9LA 3TNTA 1O3EA 3DHWC 2ZI4A 3P4YA 1ZHPA 1DOAA 1GL0E 2PV9B 5GNDA 1E36B 3HDTA 3EDXB 2IYVA 1JAIA 4JT2A 4M1MA 3VR2A 2R0KA 3BEFB 2GT7A 3AF4A 1T8NA 8OHMA 1YZNA 1L1NA 4NONA 2MMGA 4LK4A 2G6BA 2XBVA 1XTIA 4KXFB 1H8EA 2H5CA 2Z94A 3MOCA 3BF6H 3LDAA 1G6OA 3CS7A 4JIMA 1BTWA 4MRSA 4POAA 3LVRE 3CRW1 1ZLRA 1ESMA 2QIQA 3DDCA 4FIDA 2VSFA 4Q80A 3M5LA 1XUHA 4BTIB 3S0NA 3AKYA 4C9BA 1FTNA 3KFXA 1CSOE 1QL9A 3GFPA 3SNBA 1SQTA 2BWJA 3LLMA 3RU4D 3IEVA 3MNSA 2VP9A 5BN5A 1LFDB 2D2EA 4F7WA 5LBIA 1A2KC 1XXDA 4JZEH 3K70B 4A2WA 1NVWQ 2WV5A 1W4RA 1UCYE 4B33A 1XUIA 5BN3A 4B3CA 2CHQA 2CCJA 2GEUA 1TB6H 5FOSA 2C5LA 3SU8A 1ONBA 1DICA 1TNIA 4KHZA 1YU9A 2O0KA 1PPHE 2ASEA 3AQ4A 1ESAA 5EOKA 4LBWA 1G8FA 4PPQA 4KODA 4OKSA 2ZRLA 4IC5A 2GX4A 3HPQA 2HPQH 1QVRA 2ZANA 4HGCA 1YVDA 1SKQA 2FOAA 1N5IA 4X8LA 1K1OA 1LQEA 2YWEA 3EE0B 3TJNA 3VHXA 1P7CA 2YKGA 2CHVA 2GF0A 3SORA 4OGYA 3PCRB 3WY9A 1G3RA 3O8CA 1KLIH 2A5YB 2ZRNA 1PQAA 3PTBA 4PAOA 2VWMA 4WXPA 3K9NA 3L0SA 3H4MA 3T27A 5UKDA 2DFKB 3ZV9A 4QM6A 3RXQA 5KUTA 5AF9H 4MKGA 1YPMH 1P0SH 4A6LA 3NK8A 4ASUA 5LPFA 4HATA 3GYMA 1US8B 5KYKA 1XCPA 4X2VA 2J87A 1W12U 4C0HA 1XVOA 1EJMA 2Z0MA 4HZHA 1O2UA 1AA9A 1C5RA 2W7SA 3TH5A 1G36A 1NRRH 3MWIU 2G0NA 4MPXA 1NROH 1DBSA 5JYIA 4R8TB 4GOKA 3STIA 1M7GA 4ZKOU 1X1RA 3CP7A 2NO6A 1K5DA 1LS6A 2A7HA 1U90A 3ASYA 3TQCA 4YT6H 2EFCB 3I3SR 3KL4A 4AOQA 5JWHA 3PUXA 1EWQA 1ODFA 1UCYK 3LGVA 4NYJQ 5BYJA 2IYSA 3LLUA 1UVPA 4JZFH 3FKSD 3TJVA 4A5TS 3K9HA 5D3MB 1B0UA 2A4GA 2BXTH 4A0FA 3M5NA 4IDNA 2V8OA 3FVFB 4LC1A 3EASA 4IEIA 2AWNA 3ATIA 3BTDE 3UNSA 3W34A 2IA5A 2JLUA 1VCIA 3MO6A 1MMJN 1OWIA 1NBMD 2PKSC 4MRRA 2SGAA 2A0QB 1SGEE 3GQBA 2CHGA 2VBCA 2AL7A 1YRBA 1VCPA 1MKYA 3P6ZB 4B76A 1C1WH 4B32A 4KFRA 1GVKB 1AIPA 1ESTA 1KXEA 3F9FA 2BV3A 2JDIA 3HPRA 3VX4A 3AVZA 2QTFA 4RSPA 3CO5A 1HXEH 3LBHA 3FWYA 2Q9AA 1BHXB 4Q03A 5AFYH 5TY0A 4X0WU 3EARA 3NBFA 3ZVRA 2O8EB 1FDPA 1D2MA 1H65A 4M1YA 1MO3A 2CV3A 5LGOA 5KDDA 5KSOA 1AZ8A 3LKWA 4Q1EA 2CGAA 2WAXA 3K53A 2Y80A 1TABE 3M7TA 3KJEA 2J45A 3QPVA 4IC6A 3NBZC 4DCTA 3M5OA 3SQHE 3DUXH 3LJJA 4X8SH 4IKEA 2VHCA 4NIVA 2IYYA 3VR1A 1N5JA 1CJVC 1GBTA 4MNYA 1TGTA 4BTUB 1SVOA 1KDRA 1RPZA 1XD8A 4HSEA 2PEZA 3QJYA 4YLQH 1FIZA 2FSHA 2BCJQ 4ABHA 1IOEA 1EOJA 2Z9GA 1KHTA 1P2JA 2XWAA 1MH1A 4A2QA 4QM7A 4URXR 1PQ8A 1OH6A 4QNRA 4E05H 2CJWA 1M9UA 2CVFA 3O8DA 1E96A 2ZETA 4H1VA 3KQEA 1NG1A 4EPRA 4MDEA 1OHHA 3VR6A 2J0UA 1DAHA 2NPIA 1MBMA 2BMJA 1WU1A 5CLQA 3RMNH 3SJKA 3RRZA 3ZZ9A 1DWBH 1JAHA 4LX0A 1KI7A 6ESTA 3UUZA 1AE5A 4ERNA 5LPRA 3IG6B 1LHEH 5AJYA 1XD2B 2QY0B 4FUJA 2GDDA 1DS2E 4CHAC 3CZPA 3FHCB 1FMJA 3ND8A 1TOCB 2W26A 1NPMA 5HM2A 2EA3A 3R7WB 1CRPA 3ETLA 1Z8GA 3J81k 1LB1B 1MUEB 1ORFA 2NG1A 2BYAX 4AZ2B 4A82A 2SGQE 3GLGE 4LZZA 3NWJA 4OI0A 4US2R 3P1JA 3BB1A 1MQ6A 5EUQB 4B3GA 3CNNA 1OH5A 2AXNA 5GCHG 2XC0A 8GCHF 1P9UA 1U0HC 2BLOA 2ONKA 1G7RA 1FX0B 3V7TA 1NLFA 2QT0A 1HT2E 4US1R 1D6JA 3EZ6A 1EZQA 2XCNA 1YR6A 5H4IB 4MGZR 1IOZA 3GOVB 4TQAA 4KFTA 1H8DH 3RXCA 3P20A 3T25A 1M1YE 2ZUCA 2TGTA 2VLIA 1ETTH 2D1JA 721PA 2XRCA 4RKOB 4JZDH 3CF6R 4FUGA 4WXRA 1G2MA 4L8GA 4RY2A 1L1GA 3K1JA 1CBUA 1IQJA 5L2ZH 1MKWK 4LWZA 2GCHG 1FV9A 5CB6A 1YR8A 4G1UC 5L8VA 3GJ8A 2PCLA 1TUEA 3NIBA 4HLUC 4M21A 2HGTH 1G17A 3D6TB 3DFLA 4RI0A 1KKLA 3D31A 5CM8B 1BUIA 1N8OC 1ZU5A 3SV8A 2FPMA 3PENA 4A0GA 2FZLA 1FL9A 4V0ME 2FEOA 3ZQJA 5E4FA 1HNEE 2RDLA 1E2LA 2R0LA 4PQYA 2A5FA 1ZUIA 2PMDA 1OYTH 3UK6A 4XWAA 1CF4A 1BS1A 4C7OB 4DDVA 1VITH 1ZC4A 3MO9A 4F4IA 3EA7A 5C2ZA 2BM2A 1TNLA 2HLDA 1O2IA 3GY3A 3E70C 5JBCS 4XBCA 1L8QA 1DAIA 2ZJ5A 4DCNA 5JB9S 1FXYA 3GCHC 1SVKA 4OJKA 2YC4C 5A8ZA 3I5XA 3FKSA 2CLCX 4RCYA 2XJ9A 3W5JA 3AVWA 2BLWA 3E1SA 2B6HA 4MKIA 1ZUNB 2ZS8A 4AG1A 3T12A 4F49A 5BWMA 1E0SA 1NF3A 1DVAH 3OE7D 2JLVA 3MNXA 2OFOA 4MUBA 2FIRH 4GDFA 4TMXA 1OFIA 1VHLA 2ODYB 2GXQA 1NBMA 4MUAA 2JLQA 3VFDA 3W6NA 1T0JB 2FLBH 1SB1H 1Q3TA 1D3TB 1T8LA 2O8FB 1P2MA 4D4MA 4RD3A 1QBKC 3SN6A 4OYHA 3U6BA 5F03A 1Z07A 1DARA 4AFZA 2OUAA 3OYPA 4LJ7A 3Q3YA 2F9VA 2OD3B 3QN7A 1LV7A 4GZMA 1WV7H 1GKIA 3H84A 1O2JA 3QEOA 3LX5A 2C78A 3LBNA 1S0RA 2RGNA 1LO6A 1P2OA 4WVFA 4TLEA 2NU4E 2IW3A 2ZEBA 3CR7A 4DDTA 3CLVA 2EFEB 3ZIAD 2WWFA 4BOHA 4BXSA 3AB3A 1MO5A 4QRHA 3GLIA 1JRTA 2ZYVX 4HI0E 4DJTA 3KXKA 4M1WA 3ZQ6A 1TEVA 2ZSEA 2N42A 5SZHB 1WCV1 4TYQA 1V2JT 2XZLA 4LJ5A 4I81A 1XD9A 2ZG0H 1HUTH 4RVCA 1EFHA 1Q1ZA 2ZRAA 4PSAA 2WPKS 3Q3XA 1EPTB 3UKDA 3BE4A 1KI6A 1O2KA 3EIHA 5FPTA 1BBRK 2VIOA 3T15A 2QE7D 4HAZA 2WPDD 4KYIB 5C2JB 4UD9H 4Y0ZE 3W5IA 1FPCH 4OS7A 3UQVA 2OXRA 3LV8A 3AKEA 1VDZA 1WDTA 3NC1C 3QE0A 4TZ0A 4NIXA 2BEJA 4EUNA 3BN9A 2QXIA 2ZSAA 6Q21A 1C1QA 1XFAA 1AS0A 2ZSFA 2H1LA 1CIPA 1RTFB 2VIDA 3ZZ0A 2VH6A 1GJ4H 2B0FA 4BE7B 3SU5A 3GLFA 1HRTH 1T3SA 1G8YA 4TQUS 1S6HA 1R5OA 4H9GA 3T28A 2ASUB 4Q4JA 3M36A 3A89A 3IO5A 1ZD1A 5E2PA 2QRNA 2UWPA 4M53A 1C1UH 3C1KA 2IC5A 1UEIA 1KXFA 2GCTC 1QRWA 1WBDA 5H68A 3HJNA 3H0KA 4JLVA 2ZQ1A 1WA5A 1SXJC 3SV7A 1E9RA 3TITA 1I2DA 4YOIA 1N5KA 1YPJH 3KNXA 2G8TA 4JCNA 2EEKA 4B2IA 3M3TA 4OQFA 3IILA 2HRVA 2C3SA 4LJYA 2CMKA 1ANCA 3DKVA 4E07A 2CXVA 2JA1A 3ZDQA 3K0AB 3PYHA 5CMXH 2QTVB 3Q85A 1RKBA 4MQAA 2J92A 3RXHA 3B9QA 5IHPA 1W36D 1W14U 4A92A 4AB9A 2AH4X 1V2PT 5T6GA 1Q2WA 1MD8A 1JBUH 2VU8E 2ZS7A 3T5GA 3CUEF 5CYPA 1ARBA 1UM8A 1E4YA 5F98A 2NWNA 4KLNA 2C90B 4RFSA 1EX3A 2O9QA 4JZIA 1FY3A 3RC6A 5J4KA 1N6PA 2BBTA 2A5DA 4LBZA 2O8FA 3WNDA 2KB0A 1E2QA 2OESA 2O8DA 2TGPZ 5K8TA 5TARA 1GL6A 4RKEA 2NZ8A 3CBQA 3U2QA 1CJKC 1V2OT 2R2AA 1C2MA 1BMAA 3EPHA 3NTUA 3ZZ3A 4UXIA 1SHKA 1UBFA 1XZQA 4TMKA 1KSNA 2X8AA 4I1VA 2G55A 2FODA 4HAVA 5ESTE 1QA7A 1B5GH 2DHRA 2IL1A 2B8OH 2QA9E 1ZMXA 2OEPA 5CHAC 5EE3A 4JVSB 4CRFA 4LHYA 2CXXA 3Q00A 3L82B 2ORIA 2YJTD 3B5JA 2A5IA 4THNH 1QHHB 1OH7A 3BB4A 1M6NA 1JIMA 3MH4A 5KSZA 1JEEA 1WAYB 4NA7A 5GDSH 2YINC 4IRUB 1YM0A 4JLJA 1C1TA 1FNIA 1IY0A 3N5CA 3Q5EA 5EUMA 3KTAA 4IOMA 3QVUA 2NO0A 2WZQA 1OWEA 3W3AA 1UTMA 2FS8A 4ACBA 2QYIA 2IS6A 2AKAB 1EPTA 1Y63A 4I8GA 2IK8A 3S69A 1F5KU 3FFAA 4MRNA 1DWEH 1TX8A 1P61B 4X8UH 3AP2A 3REGA 1Z3IX 3VGCB 1NSTA 1GOTA 1EAXA 4O3TA 4AC9A 4B74A 2G00A 1Y5BT 2ZDAH 3QQ5A 3SHWA 1BRAA 2P5TB 2VRWA 3QDZB 1GJ9B 3AH8A 3TH3H 3U69H 1SKYB 5T3HA 1XTRA 1IHTH 2QAGA 4ZDWA 1F0RA 4OHYA 5B58C 1DO2A 4UFFH 2NPFA 1GBMA 5KDOA 4IFEA 1V2RT 3DA9B 4P0TA 1KYNA 2FXRA 4DVGA 2NU2E 2ZJYA 2XXAB 1LCYA 1SGTA 2EVWX 1NMZA 4RD1A 3KKMA 3FPAA 3HU3A 4JVNA 5JI2E 1G9IE 3NH6A 4KCGA 3X1ZA 4HB4A 1GNRA 4OS1A 1W47A 3OE7A 3UWOA 4DIDA 4FINA 2RGGA 2PEYA 3TE6A 1QQ4A 5DKMA 3WXMA 4OS2A 1QL7A 3RXJA 3HKIB 4JS0A 1W10U 2IYQA 1R0XA 4P3YA 1P2NA 1JR6A 1OB2A 1II9A 1Y3XA 1BMFA 2BIFA 1ZUHA 4DY7B 1T7CA 2H9EH 2WVJA 2RMKA
chains in the Genus database with same CATH superfamily
5JEEA 1ULZA 2O8LA 4MI6A 5CB8A 3KXLA 4ARSA 1OZFA 2I03A 1F6BA 4IDPA 3BTTE 4WFIA 4I19A 3OQBA 3ZQ4A 3N8NA 4Y18A 5JPDA 1RHQA 1CUHA 3QYPA 5BSGA 3AY0A 1PEDA 1B0AA 3MWEB 1F2SE 1O34A 4AROA 2XYQA 2J0VA 4BB6A 2BGMA 4JI4B 3CPSA 5AOVA 5KJFA 4NXMB 3QU4A 5GVRA 4EX6A 4I1RA 2JNWA 3Q3IA 1FK8A 4XSGA 1PT6A 4O4JB 4ZJZA 2BFFB 3VHRA 1PKXA 3WLSA 4UOQA 1V96A 1XCBA 1Q1BA 1A5TA 3M49A 1TRHA 4EHLA 1LNQA 2HMUA 3LG2A 1FJXA 5L4SA 4HZIA 3RGGA 3IT3A 5I7WA 3ZZCA 2ZUSA 1IVNA 2BGUA 3W2GA 3QWBA 3Q11A 2VF5X 1ZGCA 1RDFA 3A4LA 3I92A 2PQ6A 5U4XA 1GJ8B 4LJRA 1USKA 3X1WA 4UBKA 2C8WB 1J00A 2H54A 1N2XA 1SZPA 4OB7A 1E60A 5CT4A 5FLYA 4HR7A 1OC2A 2MT9A 1G2OA 1YXMA 1PEKE 1XWIA 3IQWA 3EGEA 2D5LA 3HU1A 5HNKA 2JIDA 3CHYA 1A5SB 1UJ1A 4DBLE 1PPBH 4KI7A 2BH2A 4PQEA 3GT4A 4XD7D 1C4XA 4HQ6A 2ALPA 2P6OA 1OWDA 4JY7A 1GU7A 3WNVA 5IBRA 4IMRA 1BTUA 1HFDA 2PU7A 2GPWA 5HFAA 4DB2A 3I64A 4GKAA 4CV0A 2HCJB 4NU6A 1L9XA 4F7DA 3RWMB 3WMEA 2Y2UA 2GJ9A 4KQCA 1E6UA 4KUGA 3TGIE 2IBTA 2HZ7A 2FMUA 1BOQA 5IKMA 3IBCA 3OZAA 2B9LA 2GBLA 5CCDA 5F35A 1BGXT 5DNVA 2WSIA 2QNIA 3CCCA 3MN1A 4GUDA 1OX6A 3KPWA 3NX4A 4X6PA 4D76A 2G5TA 1CQQA 3H86A 3WGUA 4ZDIA 1UXJA 3UAZA 2I1WA 5CTAA 1MJFA 4QX6A 5HKOA 4YUYA 2BHLA 1PG5A 1IN7A 1W5EA 1V6SA 4NH0A 2XTZA 3NEYA 3GLHB 3WGGA 3M2PA 3R24A 2QRJA 2G7MC 3Q8XB 2GUGA 2GTPA 3FZQA 1D04A 3HV2A 1EVQA 2PUQH 2XB2A 2RG3A 4ZZ0A 3UH1A 1Y3FE 2GA9A 4WK0B 2F7SA 3HCAA 2ZTZA 1O3GA 1DC7A 2Y1LA 1U1DA 2WHEA 2VAXA 4JCOA 4GICA 1V2TT 2ZUDA 4ZVSA 2QEQA 4RY8A 4RENA 3U8TH 4QARA 3RJ5A 4NVRA 3B1KA 4JB8A 4RTLA 1IBKB 3H05A 1MB2A 3SPXA 1D7AA 2QPLA 1HXFH 2WVAA 3KZCA 3G8CA 1RP1A 2AX4A 1YPHE 4D5EA 1KIGH 3IPLA 3FP8E 4Y1GA 5FT9A 3S9BA 1YDFA 5HF9A 1T4CA 2QLNA 4PV7A 4XTRA 5IM5A 2QTRA 5E0HA 3G9TA 2ZFUA 3GLTA 3BHMA 1Y7HA 4JODA 3QK1A 2A92A 3STHA 1QIJA 5EE5B 2RC6A 4MVJH 5BPHA 1JDZA 3TRJA 2FYRA 4B8ZA 1FFSA 2RDMA 2H7YA 3AVYA 3T7SA 2JJ1A 3HJBA 3PDUA 3S55A 3A7VA 2FPOA 4X5OA 1T1EA 3EAQA 4KYUA 4CCYB 3UOGA 5C3MA 3EIOA 2IDKA 4TM7A 1F92A 1KDYA 3K0EA 4R1OA 3R8CA 3VTAA 2ECKA 3DD1A 4CL3A 5F9HA 3P0FA 1XTKA 3BD6A 4TV8F 2BDCA 3S44A 2DUNA 3I1YA 3K35A 1WZNA 4XB6B 4A8JC 4Y1EA 1NT4A 3GCTG 4DTCA 4JP3A 4GSKA 2Q0SA 4KGVA 3MOIA 4L4RA 3KZOA 3S2UA 2HVYB 2ODNA 3VPGA 5E4YA 4A6PA 3I0MA 4OGGA 5A5FA 2VWOA 2BM0A 4MCHA