3O8RA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
total genus 212
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8rA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8rA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA03
2QN6A 1QB6A 1T3HA 3ZVLA 2ZI9A 1X8LA 3MWLA 1QQUA 4JJZA 5A0AE 2BEJA 1GJ7B 4PAQA 3TSWA 1V2PT 1GL9B 2A5GA 1ESNA 4JZFH 1G64A 4FXPA 1KZ7B 4TZ6A 3FMPB 4B2LA 1SXJC 2A0QB 3RXGA 1NVXQ 1QGFA 3BRWD 2VP0A 1CA0B 3X1WA 3LQRA 3BG4C 2BXUH 1XF9A 3TJOA 3OHMA 2AWOA 2ZGXH 3HR7A 1GILA 4BRUA 2Q0HA 1WMSA 3HYTA 1NU7B 4OS2A 1E9RA 1DBSA 5DYIA 1OYYA 3O8CA 4OHZA 1VDZA 4BFTA 1KI7A 2GJ9A 5HYOA 3AF0A 1QG2A 1XCMA 4INKA 4ZKSU 5P21A 1G7RA 2OXRA 3MJHA 4MDFA 4K69A 4JLVA 2BDIA 4YOJA 1C1QA 5LD2B 3NKKA 4KTUA 3RXBA 4BFXA 1GWNA 3WHKA 4C0KA 3ZYCA 4AKIA 4HZUB 2IWHA 2WPLS 1LTQA 1Z2CA 1RC8A 3MMPA 4J0QA 2JDIA 5FBWB 1VYUA 3KHVA 2X2EA 5JWOA 2ZETA 3SI3H 2GAAA 5FUXA 1C2GA 3ZZDA 3ZZ0A 1OW3B 1Z0IA 4QJ4A 5JPMH 1NESE 2VIQA 2ZIQH 4YOIA 5FR2A 5FAHA 1KI8A 4DCNA 4R7ZA 1N6LA 1ZTLA 3A4MA 1W36B 2YOLA 1PQAA 4PTLA 2RG3A 1ELTA 1ZNWA 1G9IE 1W0JA 1SHYA 1TEVA 2VHUA 1O5GH 1BUIA 5TARA 4C0HA 2VHQA 1J14A 3UQVA 5CM8B 4QHSA 3TK6A 4DCDA 1DT2A 2CHAC 4ZAEA 3QG1A 3SGQE 4PSAA 4BECA 1FY3A 1GMCF 2STAE 1UBGA 3PEYA 1YPJH 1GI9B 1LVBA 1JEEA 2HPPH 3U6KA 1L1JA 5T1VA 3NBZC 2ILNA 1W4AA 2QY9A 4RJLA 2R6FA 2HLCA 1KK3A 2OBOA 3VX3A 2ODNA 1OH7A 1ZU4A 3V3MA 3DM9B 1J16A 1XJQA 1P6XA 2VIDA 3L8ZA 4E03A 1TPZA 3L0PA 2HYIC 2JLZA 1DICA 4GSYA 3K09A 1F6BA 3P20A 1THSH 3RWMB 4CBOA 4FUFA 3F9EA 5A8ZA 2WV5A 2NGRA 2KBFA 3ZZCA 2C3SA 8OHMA 2WKQA 4NYJR 4X8LA 3TVDA 1IOEA 3U6BA 1XTQA 1HJAC 3VEQB 2ZFQH 4LI0A 4KXFB 1J99A 3AW0A 3EQ0H 1NFWA 5LPEA 3A8BA 2QAGA 1XD2A 3LGIA 1QQ4A 3P70B 5B6OA 2CF8H 5DI3B 3GFPA 3RXFA 1F5KU 2QGZA 1GG6B 1UK3A 4G5QA 1WSSH 4AG5A 1GGDB 2J87A 3SUDA 3TH5A 5E8EH 3CF0A 4LXBH 3AVYA 1Z0AA 1ZGVA 1R5NA 2R62A 3RVBA 3RMNH 4EPTA 4WJG2 2P67A 1D6JA 1D6WA 4WF8A 1IXSB 1O2VA 1KJYA 3ZDQA 3SZEA 4E7RG 2BY8X 1ZMXA 3BB4A 2DFNA 1KIGH 1A5TA 2B7CA 4NDZA 4ABGA 3OIYA 5E2PA 5FBVB 2CE2X 1O3CA 3MWIU 3AP3A 4KITB 2V0BA 1KTTB 1FQKA 4Q7YA 1OXUA 3K70B 1G20E 1D4PB 4K81B 1RJ9B 1SKQA 5EP1A 2FSGA 1I4TD 1O2MA 2O0JA 1NT1A 4TL6A 4MYHA 2G0TA 1KO1A 3TJUA 3ELAH 2J0UA 4MNVA 2ZRCA 2BY6X 3HWSA 4K1TA 1XMSA 2CL0X 2JCSA 5DLQC 1YCPK 5FBEA 2TPIZ 1O30A 1O2UA 2EEKA 4PO8A 1XTIA 2FS9A 2OC0A 1T3SA 1YPEH 3U1IB 1WV7H 4IS5A 3TMKA 2IYLD 4KFTA 1VYVA 5FH9A 3GY5A 4MKGA 1OH6A 4WH6A 4K60A 2J0VA 1P9UA 2O8DB 3HGPA 2ZIAA 4V03A 3T2NA 1TLDA 4C0SA 2XW9A 5DP6A 4YLGA 1U8YA 3STIA 5GCHG 1CBWC 1KSHA 2DFLA 2D2FA 1O39A 1TX4B 3K53A 4LDJA 3F9FA 2O8BB 4Q01A 3THXA 1M1YE 3OAAD 1X3SA 4M9QA 3B1VA 1LS6A 2OC1A 1C5RA 3RXTA 5IDVA 1OB5A 1K1JA 1Q1QA 1T9HA 3AAUA 5FOVA 1B0UA 2FS8A 1IN7A 2W2XA 2A45B 4CVNA 1HURA 1ZINA 1V43A 4U5XA 3SV2H 2NZJA 1U99A 1GVNB 1YR6A 4IEIA 5TB5A 3D65E 2PX3A 3BSQA 2WPMS 4NSVA 3EPLA 2KSQA 3MFYA 2AEIH 3MAAC 3GLGA 1FAKH 1TALA 1AB9B 3SV8A 2O52A 1G30B 1U0LA 1K5DA 2V1UA 4ILEA 1G3UA 1CKEA 2FJUA 2ZRFA 1PVOA 3ICQB 4D76A 1F5NA 1ZM4A 2HYDA 1E2NA 2CXXA 2QENA 3BBPA 4AG6A 2J1LA 2YOHA 4US1R 4IW3B 1PYTD 1CRQA 2ZU4A 4AGKA 4RD4A 3RC4A 3DL0A 2RB4A 2ZRPA 3KCGH 4N1AA 1YZKA 3KB1A 1DITH 1CF4A 3LGWA 4QNMA 2D3WA 5C5OA 1EJMA 2Z94A 4GP7A 3NHAA 4KLZA 3CZQA 1AS3A 3PLKA 4FN5A 3SYKA 3LBNA 2NU3E 2V6NA 2UKDA 2XAUA 2VIWA 1UTLM 2PZEA 1V2MT 4LYHA 4HAYA 3WMFA 2GETA 4Q2KA 1SXJE 1ZMLA 4TQUS 2B8TA 4O2RA 4RZ2A 2EW1A 3CP7A 2GCOA 4IHQA 1O3EA 2WJVA 3IO5A 2ZRDA 3E3TA 5JBAS 1HUQA 5KNDA 3NUMA 2PMDA 2LPRA 2RGGA 5FR1A 5FL3A 1ZRBA 4XIGS 1BS1A 1SLXB 5EE1A 4EQ6B 4ZXYH 5BPEA 2ZGCA 4P4SB 2OTVA 3M35A 2WWHA 4S35A 3B6EA 5J4HA 3SFVA 4O97A 1T0HB 1CLUA 3LH5A 2A5DA 1RKBA 2BCJQ 1V2UT 5TXGA 3UPEA 4ZUHA 1O35A 1S6FA 4QGHA 3MWJA 3PMJA 2HCJB 4L8GA 4P32A 1XXDA 1W49A 1BRUP 1PLLA 3GP8A 1LPKB 5F03A 3CUEF 2GTPA 4RN6A 4K46A 4JVMA 4X6NA 2P8OC 3LA6A 5HZHA 1UAAA 2CK3D 2GBLA 3BEFB 4JYBA 4DLXA 3URDA 1ZP6A 3NIBA 1JRTA 4MVNA 3U7FB 1PJPA 5GJ4B 3WP1B 1WUNH 1JQJC 3DVLA 1IM2A 1K6MA 1F0TA 4C4PA 4ABEA 3SO3A 4Y8ZA 4RKOB 1XMNB 2RCEA 3VB5A 3Q3YA 4M9FA 3M5NA 2PKAA 2RHDA 1AKYA 2MSDB 3R9WA 1GBAA 1AN0A 2C98A 2CMYA 4BWYA 5AJZA 4XBBA 4Q4LA 1OP2A 1D8TA 1Z29A 1ZPBA 1P73A 4GRAA 3QSYA 1LVOA 1E36B 1GKYA 2O8CA 1LTOA 1G8GA 1NVVQ 2FTMA 1VG1A 2DWPA 1V2JT 4DUGD 2Z9GA 5LPNA 1T8UA 4TN1A 1TRMA 2F91A 1V2RT 6ESTA 2RGDA 4ASUA 1OPHB 2Q6TA 1BRBE 3CS0A 1TQDA 1P72A 1RFLA 4NIWA 3TH2H 4GDFA 2ZJBA 3RRYA 1AN1E 1TQ6A 3W90A 2HLDA 3NVAA 5HGGA 3R8CA 4HAXA 3I5YA 3PUYA 3X1YA 1VITG 4WY3A 4P0TA 2LKDA 3ZZUA 2ZU5A 2Z83A 4QL3A 2VVVA 4U00A 2FGJA 1HUTH 3GLHA 4ISOA 1TONA 2A3RA 4L15A 2R44A 4NA9H 4NYIQ 5EXTA 4GPTA 5SZJA 2IS6A 4AIIA 1DEKA 1EP6A 4DCTA 1T91A 5EQRA 1OV4A 2A4QA 4M1TA 3KQLA 3EZ7A 4Q1EA 1T8OA 3WYFA 2CCGA 1KYNA 3S7KB 2FN4A 2C03A 1E35B 3W3ZB 3PO1B 1EKBB 1OWHA 3IDQA 2OBMA 1GG2A 3IGFA 4PROA 2BBSA 1KMHA 2FE4A 5GJVC 1F2UB 3RXRA 3PV4A 3OIWA 1QBNA 2R3YA 1Y63A 5SZHB 3EDXB 2P5SA 1P3EA 3B2EA 4D82A 1JR3A 2WOJA 3LLUA 3TBKA 2QA5A 4HAZA 1HAGE 1WCZA 3PMHB 4D80A 4YMTA 4ZI3A 2ZS8A 3CRRA 2FFAA 4A0HA 4LJYA 1SGFA 4K1SA 2HDNB 1FW6A 1NFYA 2QBYA 3H0KA 2BKUA 3HDTA 3EC2A 4XBCA 1CA8B 4C0JA 2AWNA 1ZTJA 2XZLA 1XVMA 2XBYA 2ERYA 5FOXA 3EA9A 2NPFA 1KGDA 1W2HA 1CR0A 2OCYC 4BLQA 4ISHH 3PCRB 2WOOA 4PPGA 2ZPSA 2IYQA 2QQ0A 1SXJB 4GUXA 4I4LA 3REGA 2CGAA 2ZRLA 4JS0A 5HM2A 5DO4H 2V7QA 2ZSFA 3HU2A 1BCUH 1OP8A 3TH3H 1W0KA 3FFBA 6CHAC 1DDJA 4BEBA 4B2IA 3E91A 1CXZA 4OS4A 2FA9A 3RC8A 2VLIA 3T1OA 3TUJC 4UQOA 4A6PA 1IQGA 1HH4A 1Z1IA 3NEJA 3MRSA 1U9IA 1FIZA 1RTFB 4JKYA 2C93B 2SGPE 3LAWA 1GBIA 1KK2A 2ZZUH 1ETUA 5DN6D 4AC9A 5EQSA 4WMFA 4ZIRA 3OYPA 3TH4H 3QY0A 2A7JA 2FGKA 4Q5IA 1ZYUA 1H4WA 1MAYA 2XC4A 2GXAA 5KSYA 3A8AA 4JMYA 4HTCH 3CKLA 2P65A 4JZEH 2OM2A 4LOYH 2R0KA 1ELAA 4C2TA 1CHOG 3UOUA 1BRCE 1A2CH 2LNCA 1O33A 4Q1AA 3NDBB 3ND8A 2ZU0C 3RS0A 3QGJA 5L3SB 1LHGH 2GMTB 2WJHA 2ZO3H 1ZSLA 2BZ6H 3NKVA 2C5LA 3KDSE 2FODA 3NBYC 3Q3JB 4UXJA 2OG2A 2BHGA 2XB2A 2FU5C 3IQXA 1Q1ZA 5AJYA 5GJCA 1WOFA 1KDRA 3S1AA 2AS9A 4XWKA 4HI3A 4LRWA 1ZCBA 2ASEA 4MPXA 1KXBA 3R3GB 2OCAA 1B0EA 3A7YA 4GI7A 4MTBA 4DY7B 5FUYA 2WJJA 5EP4A 3ZYDA 1HTWA 1GHZA 1CBUA 4EDHA 3SJ8A 5JBQA 2CHAB 1D2NA 3IHLA 1D9ZA 1ZUIA 2CJIA 3AKEA 3B82A 2XZOA 1KY2A 2PT5A 1Q2WA 3JZ2B 3CIOA 1YPLH 1SOTA 1E2QA 2TRMA 4TL9A 5JWHA 4TYDA 3EZ6A 3ICEA 1MZAA 2W83A 1O5BB 5BWMA 1CJUC 1FQJA 3UG7A 4TYWA 3ZVBA 3B9FH 1SGPE 4QGGA 2BD5A 1VG9B 3I32A 3ND9A 1UBFA 3AB3A 1K1LA 1CQQA 7ESTE 3FOZA 5JSZA 1U2RA 2D62A 4JL8A 1KO4A 4MRNA 4NWKA 4QHYA 4JVLA 4TYQA 1HJAB 4X8VH 4YMWA 2J7PD 4M22A 3ZZ9A 5EXPA 2HJGA 1D2EA 4MNYA 1C9PA 3R20A 3S7HB 4X2YA 3KQDA 5FTKA 3GDSA 4BUJA 2ZRHA 4LHYA 2PLFA 2O8FA 4CF7A 2AIPA 1UK2A 1THRH 3DDCA 1JPNA 1ZZZA 5L3QB 2F1HA 2FSHA 5EE9A 1MO4A 3W6PA 2GZ7A 4LGMA 1ZD1A 3REFA 2QT0A 2WJIA 1MZDA 2IXGA 4UFDH 1V2OT 3F0TA 3U3OA 5CYPA 3DOFA 1TUEA 2ULLA 3MFJA 5G40A 2ATXA 1EFRA 3DZDA 4KAXA 2VNTA 3FMOB 3SJ9A 2OINA 2IHYA 3MO6A 4E09A 5FBLB 2VWOA 1ORFA 3QJYA 4OQNA 1KSFX 1BO6A 1IY1A 1SVLA 1XDBA 2CVHA 3RABA 3V4FA 4WZ6A 2AMQA 2AH4X 4KYIB 2QP4A 5CMXH 4K1EA 5HMAA 2A78A 2J3EA 2R6AA 3A7TA 2WV9A 3TNFA 5L6NH 1GITA 3AF2A 2ZEBA 1GVZA 4YTAA 1VMAA 4MG3A 2JJ8A 3OE7D 2Q6DA 5GADl 1L1NA 2KWIA 4MYUA 4M2LA 2SGEE 2VF7A 2GXQA 3MU5A 1JJ7A 4MDEA 1O2IA 2OQUA 4X1SU 1AS2A 3KKMA 3T15A 4BFZA 5K8LA 2RGXA 3E6PH 5A8YA 2ANCA 4ZI2A 4BXSA 4Z6AH 2DBYA 1J8MF 4B34A 3S69A 2J46A 4Q18A 3E8LA 1EX6A 1GJ9B 1PPZA 1O31A 4MGKR 1HEIA 1QHNA 1GDUA 2IYWA 1HXEH 5KTYA 1OSSA 3CNNA 3EPJA 3B5JA 2WIBA 3W95A 1Y5BT 1E2GA 1DAEA 1SBWA 1XU4A 3K0FB 2H16A 4DVGA 4TWYA 4MRPA 3V4RA 3LW7A 3PWCA 3QZQA 3U5ZB 4KI0A 1K9OE 3SW2B 3FB4A 3CLVA 2DYKA 3GJ0A 5B58C 3TJNA 5DO9A 2Z4SA 5HKKD 1VTKA 2ZGJA 4MH0R 1C2HA 1OXXK 3NBXX 4HLDA 4A92A 4D2IA 3CR7A 1L7VC 2ZG0H 3KFXA 1NLZA 5BN4A 1HT1E 5JB9S 2VIIA 2WUBA 3KEEA 1K1OA 3MU1A 3HU1A 2W6ID 2D2DA 5AUPB 1E2EA 3QLPH 1T0JB 4KVAA 1O3JA 2HWLB 4Q7KA 1SKYE 2FESH 3HU3A 1JNYA 2FOFA 3WNCA 1O3GA 1ANBA 4BAKB 1P2IA 1GJDB 1ELEE 1XKBC 4Y10E 1MT0A 4K2YA 4NBSA 4B3GA 3OSYA 3KN2A 2PLRA 4PC2A 4TMKA 1S85A 1QHRB 1W2GA 3SJAA 2BM0A 2TGDA 5DHFA 2Y6TA 5JHHB 2YV5A 5CK4A 1P9WA 1O2ZA 2D8WA 1EG7A 1E4YA 3ZH9B 3QPVA 1ETRH 4TWWA 3BTDE 2FFQA 3WMEA 4YQFA 1EK0A 4A82A 1KY3A 1T7CA 2CL7X 1CVWH 2FFHA 4D9QA 3V9PA 2JAQA 2AD5A 5CE1A 4BLSA 4AYWA 4V0LA 3NXSA 4PQRA 2ZQ1A 4HI0E 1DY8A 1G8FA 1MTWA 2WPIS 1UCYK 1KAOA 1VCOA 4YDHB 5FFMA 1TGBA 3CPEA 2AGEX 1GFIA 1Q20A 1CGIE 4MPWA 3FZZA 1JAIA 3IBGA 3RXEA 2F4LA 3SJOA 4DDTA 4J2YB 4JL5A 3WY9A 1TNGA 1AUJA 4QHTA 4DCSA 1AKSA 3LLMA 1XWIA 2QROA 4L9WA 1NZQH 4PHTA 5KNCA 3LH3A 4UNSA 4M9XA 5JBBS 4X1PU 2OK5A 2ONJA 1P75A 4C30A 4R71A 3OZXA 3TLXA 4JSYA 2QPAA 2ZA5A 2VYFA 2O8TA 4X6MA 1G4UR 1LDTT 2ZDVH 2H1UA 1TAGA 1EQ9A 1BIOA 1KY9A 2V55B 4MDSA 2P5TB 7GCHF 2QEQA 221PA 2YHSA 1ZSJA 3UR9A 1AGPA 3BFVA 2CN0H 2EFGA 4PHFA 3QK1A 1D2MA 4UD9H 1ZR0A 4LJ7A 5FPYA 1US8A 1VR1H 4Q4HA 1XTRA 4KYUA 1TPPA 2DWOA 4NYMR 4B6FA 4NCYA 1KSGA 1F0SA 2XWAA 5D3MA 1I4DD 1ZVQA 1FZZA 3RSOA 4D6PA 2H7VA 1T8MA 3LD9A 2P8OB 2Z9IA 2CHVA 3F5FA 4Z51A 1DARA 3T34A 2NG1A 4M8NE 5C5NA 3NEYA 3LNCA 5JRZA 1BJUA 3FE2A 4TPIZ 3FWYA 1HCGA 3MH4A 4I99A 2HVXA 2ZAMA 2QP3A 3F6UH 3TAUA 4JJKA 4MRRA 1WBDA 1NC6A 1OT3A 1GAJA 1MH1A 1O32A 3W5JA 4B1TA 3LKWA 3I62A 1EPTA 3BJIC 4DT1A 2AHOA 3L3TA 1AQUA 3EXAA 1FONA 4IDOA 3PEUA 1NL3A 1PQ8A 1S0RA 1P60A 5KOYA 4UFFH 2P95A 2CBZA 4LK2A 1S0UA 1D6RA 1C2KA 1XZPA 4Z8XA 4IKEA 1KXCA 2J4IA 4GLYA 3BIFA 1BOQA 3KX2A 3K9GA 4NP6A 4HZHA 3ZV8A 1HYQA 4Q1DA 1GBTA 3ZYEA 4BLTA 1VIAA 4KVGA 1XD9A 2QXIA 2SGFE 4E05H 3GJ5A 2V6IA 2FEOA 2C8YB 2BLQA 2GDEH 5CYOA 3BAFA 1FUKA 5FOUA 4RSPA 2N42A 3PENA 1N6NA 2GA8A 4C2UA 1ZRKA 2I1VB 1CT0E 1B7XB 3P8FA 1SKYB 4FUGA 4OQLA 1SVMA 2A5YB 4O25A 121PA 1TA2A 4XOJA 3WBKA 3QE0A 2NO1A 2F43A 2AKAB 5E2OA 3RM2H 5DH9A 1BTXA 2GCHF 2D06A 4FU9A 2ZTYA 2XBWA 4A8JB 3GD7A 3IWMA 2WSMA 1S83A 2Q9CA 1DUAA 5KU1A 2E9SA 3PUXA 4LYFA 1TMKA 4TTPA 4FVBA 2BDCA 2WJGA 2ZHWH 3LX5A 4GMXA 1GBMA 4NZYA 4NCJA 2AXNA 5E4FA 4PQFA 1AWFH 3W6NA 4ZPXA 1QF9A 4V0ME 4FUDA 1IN6A 3AVZA 2SHKA 2IA5A 1XX6A 2FV8A 4ZDIA 1MRNA 2BV3A 5IYTA 1NN5A 3EX7C 3I1FA 5EXNA 1A0HB 5KUTA 3QPUA 1EWRA 1V6DA 3K0CA 2OBLA 2Z0MA 1LHDH 2C9CA 1G18A 5DP3A 1DX5M 2W2TA 1ZNZA 4BZXA 2EFHB 2YNMA 2B0FA 4DKXA 3G82C 1AMHA 1HNEE 1NP6A 2JIZD 2JLRA 4XFQA 4IOMA 1GCTC 5DP7A 4PX9A 1P04A 3RXCA 1BDAA 4YLQH 1C5NH 4ACAA 1W0JD 4B47A 5FOTA 3BWDD 2IOTA 2G8TA 2GV6A 4DIDA 2FTLE 5HPYB 3D6TB 3BFXA 4TTRA 4FWTA 5A0BA 3DEFA 1FTNA 1E2FA 1CHGA 1NNEA 3QF7A 4I32A 4PC7A 1A82A 1ZRHA 3BFKA 4OK5A 1L8QA 2ZCHP 1OLOA 1PPGE 1ZUHA 2P6NA 5GJBA 3AK5A 2PUXB 2UUYA 1G8PA 1S1CA 3VB6A 4MPVA 3KTAA 1GNPA 1RIFA 4B44A 2A32A 1UVSH 1VJ9U 4FU8A 5F3WB 1AS0A 5J4LA 2BQ7B 2EC9H 1F3OA 2GDJA 4P4UA 2QGRA 3GMTA 4YMUA 2PTCE 1EZXC 1KO8A 4JZ1A 3G5UA 3KZ1E 5DP4A 5B30A 4TZ0A 3B60A 1RRGA 2C9OA 4H1UA 2NQ2C 3VR3A 1LPZB 4EJSC 1BKDR 2G1KA 4B3FX 1TTTA 1JR6A 4TMWA 1W4CA 3AEZA 5FPHA 4EIWA 1SGDE 3NWUA 4LHVA 3QKRA 1G32B 2BOHB 4OI1A 2NU0E 3DHKH 4DW2U 1VECA 4JYCA 4D8NA 3VKHA 3BERA 1D3QB 1RRKA 5EE3A 1AZSC 2Y81A 2ZHEH 2OC8A 2FOAA 2ZU1A 1AFQB 1TGNA 4JVSB 3PFIA 4LZ1H 2GKVE 3OEED 1XJCA 2DWQA 1A0LA 2AERH 1C9TA 1FNNA 1EZUC 2HCBA 3PVSA 2DE9A 3H2YA 1TGSZ 4AG2A 3SU8A 1KSNA 3ZZ5A 2AFHE 1R4AA 3EPKA 1H1BA 1U94A 2J95A 2GT7A 4B33A 1GBJA 2C4FH 2FOBA 4ZKOU 1HXFH 4RD2A 3RMOH 1Z8JB 3ZVCA 2J92A 1YYY1 1HAVA 3IPYA 4DSOA 3K2UA 3QXJA 2QMHA 1UVOA 2CK3A 3C41J 1ZD8A 3RU4E 2O8EA 4G5OA 5GVRA 1X7AC 5CDFA 2D4HA 1VHLA 1PPBH 4WXRA 2VQSA 4GZMA 1EAXA 5KYKA 5EQQA 1BMMH 1IQJA 2XX3A 3A84A 2Y82A 1S5SA 3THYA 5EGMA 1O2TA 1T32A 5LPFA 4V0KA 1V2WT 2I6SA 5FUVA 2CLDX 3U1JB 4X8MA 1Z5ZA 1TNLA 1UTOA 3N5CA 2I1QA 1WQSA 1K8RA 1Y3YA 3D3QA 4HSEA 1AM4D 4D26A 2X19A 3MH6A 1P62B 2H57A 2FYQA 4F4OC 2VWMA 1O2KA 1EZSC 3JZAA 5EOKA 4FUJA 1GDNA 4XH9B 1P2MA 1IQFA 5DP5A 1A0JA 3BH0A 2ZP0H 4BFVA 2ZRJA 5GDSH 5IK2D 3F1SB 3RXIA 4TMXA 5AJVB 1ID5H 4HB3A 1EJNA 1XPRA 1FIWA 1LMWB 4MA4A 1N5LA 1ESAA 3M3VA 2Q6FA 1ZNYA 3GY8A 1RRPA 1UCYE 1NN1A 4US0R 1GVKB 1XM1A 2BDGA 3H09A 1E9BA 2BDBA 3KQCA 1GI6A 4OI4A 1FY4A 4HEJA 1EXFA 2OAP1 2TGTA 3Q76A 3RXSA 2WPJS 3A7WA 4CHAB 3PTNA 4Y79A 4AKHA 4DLTA 3V00A 1NMYA 3DKVA 4PAOA 1UEJA 3N2EA 3HPRA 1C5LH 4LV8B 4OQXA 2ZF0H 2R3UA 1MO5A 1QJ7B 5EPYA 3GJ6A 4RSGA 2CL6X 3WBJA 4EAQA 2BQWB 3AAVA 1SGCA 5JZVA 2OILA 2IUUA 2GK7A 4B6EA 1H8HD 5EU8A 2HXSA 3GJ7A 5LD2C 3QUMP 2WYGA 3FZDA 2YYZA 2YVUA 4CIDA 4XE4A 2EFCB 3DM5A 3H1TA 4IFBA 2KAIA 5F6MA 1ZAKA 4A7IB 2ASUB 1FMJA 1KO5A 1YCPM 3B13B 1PJRA 4QNRA 1SFQB 2QY0B 2ZE6A 1A5HA 3RC5A 3FHCB 4AYYB 1ZIOA 3SNEA 1G3MA 2A1DB 1WDTA 2B6HA 1A1VA 2ZU6A 3DT0H 2OAQ1 4X8SH 1G19A 4R2IA 1ETTH 4UXHA 4WZBE 4OS1A 4CBNA 1GDDA 1OHHA 3N7OA 1UHBB 1XEWX 4X6OA 2FX4A 2REBA 3JVVA 2GCTB 1Q3XA 1S3SA 1KOFA 1Z7KA 2G6BA 4JLOA 1JXOA 3F3YA 4O3TA 1CRPA 4AB8A 5DN6A 3VPKA 1G8HA 1KNXA 3SHAH 1UTMA 4YMSA 2C99A 2ZVQX 5H70A 3W9YA 4LZ4B 4C0QC 2IYSA 1SGFG 2NU2E 4UE7H 2A5IA 2ZDMA 1G7SA 1ABJH 3K6YA 3VR5A 4NA7A 3LY5A 1YR7A 3RU4D 3WY8A 3F9HA 3ZLJA 1M74A 1G7CA 3QKSA 2WPHS 4QBHA 1LVMA 2FPZA 1T8LA 3ITIA 1DWDH 1GI2A 1DG1G 3VHXA 1PPFE 1Y5AT 1GNQA 3P95A 1JIMA 4JLBA 1E9AA 4D0LB 3I8XA 1UFQA 3CW2A 1TEXA 4FMBB 2AGGX 1HIAA 2Z4RA 3Q77A 1UKYA 5E0JA 2OC7A 1E0SA 2ZREA 1XUKA 4JK6A 3VFEA 1N6KA 1M8PA 1DO2A 3LXXA 1G3CA 4DC9A 3SUFA 4UNNA 1RW4A 2D2EA 2D7DA 1GI7B 2REOA 2WMOB 1GG6C 4I8LA 3C8UA 4HUQB 3SYLA 4NIVA 3BTME 1C1MA 2ZSDA 1TF2A 1PQ7A 2ODWA 1H9LB 3T28A 1NY22 2A4GA 2ODBA 4ASHA 4BTIB 2BQ6B 1RTKA 2CXVA 3GQBA 4U7DA 3A7VA 2WICA 1MKWH 2EFDB 2VA8A 1GBCA 3BG8A 1UPTA 1QBVH 4AKGA 4Q9JA 3TR0A 2PWXA 4DB2A 3AQ4A 1U98A 2B92A 1IQHA 4A6XA 4YLUA 1ZM2A 3SUEA 2ZJYA 2V3CC 1ACBE 1QVRA 4DT7B 4M53A 4UONA 5CITA 3FFAA 2EWWA 1AWHB 4GCHF 3HPQA 2NOAA 4K8BA 2J7PA 3SNDA 1CEEA 4ASUD 1XCPA 2VJ1A 1U0HC 1MQ5A 4QOSA 4ERNA 1CO7E 4I1OA 1XEXB 1S8FA 1MKXH 2HLDD 3VXEH 5C18A 2WWXA 4LHZA 4NCNA 2MSEB 3WHLA 3U98H 4BPBA 2BMDA 3T1QA 2WKPA 4URVR 2DY1A 1FJSA 4DXAA 3LWNA 3B1WA 1JBUH 1Z6TA 4EPXA 2ZCKP 3RHFA 1ZU5A 3T5DA 3BGWA 3MSXA 5AHGH 2BWJA 2IC5A 1HFDA 4PZZA 2ZECA 1E69A 4TWZA 4IXMA 2MMCA 1OWEA 4DJZB 1N8OB 3MLEA 2VIPA 4AOQA 4IN1A 4A1XA 3VFDA 1ZUNB 3UMRA 1MTNB 2DB3A 4B74A 2BY7X 4P3YA 4D4KA 1W7XH 2ZDLA 1ELCA 4BZPA 1XBTA 3PUVA 3MU8A 2PR3A 5CJPA 2RDLA 4ISLA 2Z7FE 4KV9A 3P1JA 2AK2A 4UNPA 4DSUA 2Z3DA 3GYLB 1M7BA 2QXGA 3OE7A 2BVXH 1KZGB 4RZXA 5F8TA 4JT2A 2PZGA 1EX3A 1QFKH 3FKSD 2ODPA 4CEHB 1NN3A 1W5SA 2AGIX 4HB4A 2SNWA 2NU1E 1ZTKA 2ZSBA 1GMDF 4H1VA 3E70C 1GKUB 2HOBA 1QHHB 2FSIA 1N3BA 2QU8A 2QSYA 4BFUA 2GJSA 3C14C 1LV7A 1J8YF 1KYIA 2VO1A 2V7QD 2ZUDA 1G3BA 2AK3A 3L2OB 4DDVA 1GM5A 1W0KD 1UO6A 1OE0A 3PUZA 2Z6BD 3ODDA 2CNWD 3AVWA 3ZS9A 1MMJN 2WM9B 3SI4H 1VCIA 1QZXA 4XD7D 1YPHC 5SZIA 1G2LA 1WQ1R 3UG6A 4NWLA 2G83A 2P6UA 5IT5A 3AH8A 1WTHD 5HKKA 3T5FH 1OSNA 3GY7A 5K0HA 5JS8A 1KNQA 3EIHA 1R8QA 1P9SA 5C4MA 3DKPA 4BLRA 3BB1A 2WPKS 3BV9B 5I25A 4E7NA 2OSBA 3ZZ8A 1UVUH 1WA5A 3M5OA 4FVDA 2KE5A 2IYZA 2W6IA 1C5VA 1O5FH 3SJIA 1FAXA 1ZHMA 4IJMA 4HGCA 5H68A 3HP1A 4PPQA 3PB1E 1KTSB 2ATVA 3SQEE 5EW2H 4RKEA 3HKIB 2NO7A 2GBLC 3WP0A 2BBOA 1H8ED 1SC8U 4KO8A 3VR6A 4I8KA 4EPVA 4OHYA 3SN6A 4C7OB 1BYUA 1YZLA 5DGXA 3EZ9A 3TVTA 2WSSD 2FYRA 2H5CA 4BTUB 1A2BA 5KDLA 3EIEA 1N6IA 3A7XA 2WAXA 4IOJA 4RZ3A 1Z3IX 1VG0B 3DUXH 5HTKA 2F55A 5J4YA 2G5VA 4KSBA 4JLDA 3SU2A 4KFRA 2BY9X 1TU4A 5BYJA 4UDWH 3BORA 1EESA 2BDTA 3CRVA 4ZDJA 5L2YH 1AIPA 2OT3B 1EASA 1YKTA 2EI6A 3BTGE 1NRJB 2ZITA 2ZKSA 3EA0A 2IYXA 1QL7A 1KTVA 1MBQA 2NO0A 2GZHA 5BN3A 1O5CB 2Y7XA 4QKQA 3QWCH 3R7WA 2C2HA 2F83A 2GVDC 1VITH 1IOZA 4H6TA 1WXQA 5CM9C 1O34A 1IQKA 1YZGA 5H1YA 1TQ4A 2OXCA 3FTQA 3P6ZB 1BBRE 3I77A 3CX7A 4URWR 3L8YA 3K6ZA 2G51A 1YF4A 3TUIC 4ARZA 1C1UH 1N5JA 1E9CA 2FF7A 1O2PA 2N1BA 4LC0A 5EE5B 3VR1A 4SGBE 3QTOH 4THNH 4CRGA 1U90A 3BE4A 5AUQA 3GCNA 1AZZA 4CEJA 2BD8A 3U8OH 2ZTXA 2QC2A 3GJ8A 4AORA 1E2LA 4Q4AB 4Z8YA 4YMVA 2ZRAA 3MJRA 1V2QT 5A5GA 3EG5A 5J4SA 1J17T 2C04A 3GICB 4P33A 1FX0B 4GHQA 2JA1A 1UBCA 4FMDB 1QVAA 3U9AH 4XVQA 4D7GA 5I46H 1X8JA 5AUOB 4FCWA 2XOKD 1YE8A 4MGZR 1IQIA 3W8NA 1VCNA 4BE7B 1XXHB 3K0EA 1J9CH 1E2IA 2ZU3A 2PT7A 1DM4B 2WWGA 3RLYH 1EFRD 3H86A 1NIJA 3K9LA 1O3LA 1W0ZU 3IITA 4H9GA 2AXPA 3CS7A 1TFXA 4ABAA 2YZ2A 4INHA 3RS4A 1QL8A 2OO7A 3U4QA 1O3KA 3IKJA 3Q3KA 1IHUA 2BD2A 4U30A 521PA 2TMKA 4POAA 2QT1A 1YM0A 2J5XA 3VU9A 2ZROA 1RYFA 3RMLH 2FZLA 1XMIA 3PM3A 1SFIA 4AFSA 3K0AA 1U9IC 3A36A 1TRYA 3EA8A 4DSNA 4CYMA 3W5IA 1UCYH 1BOFA 2ZAOA 2ZHQH 3L6PA 4RFSA 5EXXA 1FMGA 3PLBA 2XRCA 1IAUA 2H9HA 3MNCA 4DGJA 1UTPA 2XTZA 1OXTA 4QT8C 4TQ9A 3U44A 2JETC 1F2TA 4PAMA 2IYTA 2H5EA 4AG1A 3TVJB 1K1IA 2ALVA 2O9QA 3LJJA 1ELOA 3BOSA 1F2SE 2IPHA 1N6OA 1E79A 4PO9A 2QZ4A 2W0MA 1G3QA 1Z0DA 2BD7A 4XVRA 5FBIA 4M1WA 4OYHA 1MABA 5F2EA 1D3DB 3U60B 3P27A 1B23P 2QE7A 8LPRA 2PH1A 5AUNB 5KDOA 4Q7JB 2Q3MA 2P2LA 3SGBE 5DSZA 1DAIA 4NG9H 1O0DH 1L1GA 3B9PA 3ZD7A 2BCGY 4AWXA 3ZGXA 5JS7A 4X8TH 4G3XA 3VB4A 4NSYA 5CLLA 1DXWA 1KXAA 4ABHA 5GPIB 3M37A 4MRSA 3SN8A 1DVRA 2XJ4A 1TMUH 1HAZB 3S9BA 1SGNE 2O8MA 4X1NU 3KQHA 3MNBA 1N6XA 1Z63A 1O3MA 5DI9A 1SQAA 2ZI6A 2G77B 2QM7A 1WYKA 3MO9A 2BD4A 5GCHF 4KBGA 3VR2A 1TAWA 4JLMA 2NTYC 3VNUA 4NONA 2CCKA 2ANMH 4IVPA 3QKTA 1KAGA 1B0FA 2ZS9A 3QUSA 4DDUA 1O3IA 4O3UA 3VXFH 3ONWA 2ZPQA 2GMTC 1W36D 1OYQA 1A1RA 2WWIA 4BTTB 3BEIB 4LJ5A 2VP9A 3I3SR 1R6BX 2UUJB 2BDYA 2B8OH 3B1YA 1GHAG 3GFOA 3BIUH 4OK3A 2JIZA 1J90A 3QVUA 2ZJOA 4DCVA 4WOPA 2ZTSA 1OKKD 4JZDH 1OJLA 1KDQA 4KHZA 4TMVA 3N70A 4LJ6A 4VGCC 2QAGB 3THWA 5G3ZA 1XD2B 3M3SA 2FEMA 5DE3A 3KXKA 1RIWB 4RD0A 1W46A 3UK6A 1LPGB 4DG4A 2A7QA 4Y6DA 4JL6A 1G3RA 3MUFA 2GDDA 4LJ8A 2GXSA 1MTSA 4DVAU 2GF0A 2GGVB 1NKTA 4BNRA 3QF4A 3U3JA 1ELGA 1YPHE 5CB8A 2ZRGA 2NWNA 3TRFA 2UWOA 3ATWA 1HT2E 2BJVA 2V54A 2XEXA 1UVTH 2EFEB 5GJWC 1Y3AA 1QHXA 2ANYA 2LKCA 5EE0A 2Y5FA 1E3MA 2ZHDA 2ZR0A 1QJ6B 2ERXA 2UUKB 3U3RA 4I1UA 1YLCA 3A89A 4C9BA 5B2ZA 1IN8A 2P3UB 2W0SA 5E0GA 3S0NA 2JLUA 5DHAA 1S9HA 3H7OA 2THFB 3SU6A 3ZIAD 1EAUA 1FPCH 2ANWA 3UMFA 5D3QA 1AU8A 1DUEA 1XUJA 2J0UB 2ZSEA 3GCHB 3EWAA 3VKWA 2TBSA 3OEEA 3KJGA 1WRBA 1ESTA 1A2KC 2A5FA 3LW8A 4D0GA 2GT8A 1XEFA 1RE0A 1RS0A 5K7RA 2PEZA 3RLWH 2ANKH 2J59A 1BTYA 3K70D 4CEIA 1NBME 4WAUA 1Z0JA 2J9RA 1ELDE 2GJAA 4BRWA 1OFTA 1MU6B 2QN5T 4JLNA 2CHGA 3THXB 4LWZA 4XSGA 4Q00A 2VTKA 4M1MA 2Y8EA 1FY8E 2HRVA 2FO9A 2G55A 4Q47A 3Q5EA 3GJ3A 3SU0A 1O3YA 4G5SA 2BOVA 2R6CA 4N3NA 4Y7AA 1NG9A 4AFZA 2Q9BA 2ZE7A 2QF3A 2XXAA 1HY3A 4WXIA 2HGTH 4RKJB 1EFCA 1N6PA 1G7TA 2AFQB 3GLGB 5JECA 2RHMA 1Z28A 4V0MA 3E1XB 3AF3A 2FIRH 4BAHB 2CCJA 4NZQA 2QA9E 1E32A 2PKSB 4DLWA 1N0VC 4ISIH 2IUTA 3GLFA 3ZVFA 1SQ5A 3C27B 4IXNA 4UNRA 3ZVGA 2BMEA 1XZQA 5IK2A 1V2TT 3GEEA 5EUQB 5LH8A 5LPRA 2VHCA 1JR3E 3EASA 1Z1JA 3DOEA 1RD3B 3QXCA 4XDEA 4O0MA 2WVJA 1FTSA 1C4V2 3CENA 1CJVC 4MGIR 1R10A 1A5GH 2GK6A 3T61A 1N0UA 1MKYA 1NO9H 4Y8YA 3ZVNA 4BANB 2P3FH 1XD8A 2A5AA 2OFOA 2BYAX 4OKSA 3NPSA 5ABWA 3MNSA 2JJ1D 1VITF 4ZKRU 4EFNA 1W12U 1C2LA 1W2KH 4NU0A 1TOCB 3E16B 4HLUA 3EZ2A 1D9XA 3AGQA 2ZQ5A 4TSFA 1ZC3A 4GBMA 1P2TA 1ZC4A 4BGDA 2GCOB 2HV8A 1DAKA 1G5TA 1JAHA 4B48A 2G88A 4Y76A 1BH2A 4YZUA 3LH1A 1F0RA 2PBRA 1RPZA 3U3MA 1FQ3A 1HE1C 4DJTA 3PQCA 2XZPA 4IVRA 4DBLC 2BTCE 3X2SA 1MAXA 2RGEA 1Z47A 3I61A 1H8HA 4ZCIA 1LS1A 1GHBG 5IDKA 2NU4E 4AURA 1KXFA 3IPXA 1BHXB 4JYVH 1K21H 3I5XA 1EOJA 1H8IH 4Y0ZE 4DIEA 5G41A 3M5LA 3QZRA 2QPTA 1G37A 4MQBA 3RXVA 4Q4JA 5C1YA 3GCOA 2ORWA 1AHTH 3I4LA 4WWYA 1AGJA 1QRXA 2AMPA 4ZHLU 3WYGA 4GOKA 1DXPA 2ZQ2A 1LFDB 2NO6A 3PIRA 1MO3A 4JK5A 1ZJKA 1UBEA 4B3CA 2F1JA 2IS4A 5ANRB 4DLSA 4IC5A 1E0KA 1EX7A 1GHVH 1ZW6A 2IYRA 4OQFA 1U81A 1CU1A 1QR3E 2W5EA 1E4VA 3D62A 2ZFTA 3ZV9A 2PCJA 3CH5A 3TIFA 1T4VH 3FFGA 3OY5U 4W5JA 2W26A 3U69H 3W6OA 2KI5A 4X8HA 4K8YA 2PGBB 1II8A 1XNJA 3EWSA 1NBMD 5F9FA 3A88A 1N5IA 1FUUA 1O37A 1P12E 1KI6A 4QG7A 2J9NA 1MO6A 3RS3A 2PKAB 3L33A 3TW8B 3NBFA 2IEYA 2QL6A 2R6DA 2QAAA 1JOUB 3MU4A 1BBRH 1TNIA 2EA3A 3GJ4A 1E96A 1OIWA 4EPWA 3AVTA 4B71A 1J15A 5DGJA 2O8CB 3F68H 4DIHH 3ADCA 5G3YA 4Q1CA 2GCNA 1SL3A 4E5UA 1XUHA 4ACBA 1VGCB 3BTQE 2PHBA 1WP9A 2YWGA 2A5JA 1C2FA 1CHOF 4FMCB 4URUR 1O3DA 4NYJQ 1E2HA 1E2JA 1GJ5H 3ENSB 3RXDA 2G4TA 4NH0A 2BC9A 1EZQA 4Z1MD 4DSTA 3IIKA 1RRCA 4Q9IA 4MITA 1VYTA 1OPXA 1S2MA 2A2ZA 2VP2A 4U32A 2HT6A 2ZS7A 2R0LA 2FWWA 1HV7A 5FTMA 4CR5A 4ZKEA 3GLHB 5DP8A 1O2XA 3KXLA 1CGHA 4PHGA 2YOGA 2ZJ2A 2HNTC 4LCBA 3I92A 2V8OA 2C90B 3NDPA 1N6YA 3ZQ6A 1NROH 1KMHB 5FI1B 1BTWA 1BB0B 1Y59T 3L0SA 3SORA 1BA8B 1TGCA 4A2WA 6GCHF 1FDPA 3TK9A 1AFEH 1KKLA 2WHXA 3UWJH 3SQHE 4GL2A 4ZH8A 3RWOA 2QBYB 2H92A 4Q9HA 3PG5A 3LVRE 4OS6A 4KTSA 1GRQA 5J40A 3T1TA 2H5DA 3SQXA 1E2KA 4Y0VA 2ZI5A 1JBKA 4M9ZA 2ZI2H 4CRDA 1A4RA 4D4MA 4F4IA 1BTUA 3ATMA 1Z0FA 1P57B 3RC6A 5C67A 1GHXH 2P93A 1L0ZA 1FZQA 2WPDD 3T12A 3D23A 3LRPA 3SJCA 3E0NB 2IF2A 3ZVMA 4QJ3A 1AE5A 1GJ4H 1G1MA 4A8JC 2BMFA 3MNXA 1N5KA 3CNLA 1HQYE 3LBIA 4HB0A 3RMMH 1CJMA 5JDUB 1Q21A 1P06A 3UMSA 2REXB 3AVVA 1PQ5A 4C0LA 4I7YH 3JZ1B 1M7HA 4Y11E 4HZIA 5LGOA 4LC1A 1J8AA 1PYTC 4HUTA 5EW1H 4AK9A 4YM9A 4XWAA 4A1VA 4ZIRB 3VKGA 1NU9A 4YDSA 3U8TH 4YESB 1SZPA 1P2OA 4TMTA 4LHWA 3E1SA 2FZ4A 2ZJZA 5AR1A 1DAMA 1W4BA 1QIXB 2J34A 1MTVA 4FUIA 2JETB 1SXJD 2UWPA 4D4JA 1KHTA 2FEQH 3Q8XB 1DFPA 3TGKE 1TWXB 4M1SA 3CF2A 1XFAA 3FKSA 1EP5A 3FMIA 2W6JD 4IRUB 1C5XB 3UWOA 3SYNA 5C4GB 2YC2C 2W7SA 2ZDKA 1MKWK 4DEYA 1TU3A 1NMZA 2FI4E 1C5MD 2QCYA 2XITA 1PLJA 2SFAA 2A9KA 3V13A 2PFEA 1R0XA 1K5GA 1C5YB 4BASA 1E99A 3SYJA 5T6DA 1D3PB 3ZZAA 2BBWA 1P0SH 3S1AB 1ELFA 3NH6A 3BTWE 2CNWA 4IW4E 3HYRA 1OHHD 3S9AA 1C5TA 4X8UH 1E1RD 1DO0A 3UPUA 4XD7A 1EFTA 1RJXB 3E5HA 4I1SA 3KKPA 6Q21A 4WZAE 4ZROA 1U8ZA 3UTUH 3HGNA 4GMDA 3RNLA 1EJAA 1MKXK 1P11E 2FPLA 1R2QA 2QUZA 5JB8S 2QMOA 3MH5A 2P6RA 2NPIA 3FP7E 1FMLA 3ZZ4A 3MH7A 1G291 2BLOA 3VB7A 4MKFA 1G6HA 4NCIA 3THOA 3RP2A 2BJWA 2O8WA 1X1SA 1IY0A 3TK5A 2WJYA 4WXVA 4RD6A 3SFZA 4NGAH 1AGRA 2Q3FA 1XB2A 1VHTA 1E6CA 2XTMA 2Z5FA 2BKEA 4MYCA 5FCRA 3BB3A 3PITA 3U8RH 2OZEA 1T4GA 4ZDWA 1H8EA 2F9UA 4HAVA 1QRAA 1C1OA 3T62A 2ZNKH 3BH6A 4B2BA 4QJ5A 1OIXA 4YC7A 5JSZB 3AV0B 4LBYA 3V0XA 1S96A 1ANDA 1C9KA 1CT4E 4OJKA 2WSSA 1KI1A 1MD8A 2F1RA 4K3JA 3SHWA 3P4YA 1KJWA 3SZRA 4FMDF 1P2NA 2RCNA 3GY3A 4VGCB 4DEXA 1FV9A 4MPUA 1FNMA 1LQEA 1ZBDA 1GRNA 2O8FB 1NVUQ 3FGNA 1F7ZA 2FLBH 1AFQC 2J0SA 1YBWA 3CBQA 1O2RA 2HF8A 4XSHA 6LPRA 4DLZA 1O3HA 4KCGA 2ZGHA 4X2XA 3A8TA 2Y5GA 1BMFD 3GYMA 2GZ9A 1GKIA 1GL7A 6GCHG 1SR5C 1IJEA 1XPOA 2ZWLH 2W2VA 4EJSA 2VH0A 3ODFA 2BVSH 3NK8A 1AQ7A 5CHAB 4BFYA 1O2JA 5E0HA 4DRZA 4GHTA 2FWRA 2FM2A 2AR7A 1TL7C 3VHLB 5BXQC 4JYTA 1CP2A 1UF9A 5DKMA 4Q9LA 5E7JA 2CJWA 3A1SA 1XTSA 5AFYH 3PYHA 3ASZA 2ALPA 3OIUA 4QGFA 2IT1A 1LVYA 3SJBA 1TX7A 2R65A 1GHWH 4HAUA 2F9OA 2KBEA 1HE8B 2WYJA 2GZAA 4P31A 4F91B 3SHFA 4XJXA 4ON9A 1FY5A 1MD7A 3SBKA 2VIOA 1BITA 2EWVA 1HAOH 2WBLC 2C9YA 3RDZA 5EP3A 4BAQB 4B73A 4OBEA 4RKFA 2GVFA 4OQMA 2JLQA 4OJQA 1MUEB 1SGWA 3QKUA 2FPKA 1CR2A 2XOKA 3QX5H 1AI8H 3BTFE 3VR4A 1ANKA 421PA 1YR8A 2XB4A 3A1UA 4MUBA 4XVUA 2BHRA 1FL9A 8GCHG 3GEHA 1XJ0A 3PMAB 1OWJA 2FDCA 3CWZA 2VINA 4HDCA 3M61U 1IBRA 1ETSH 4BLPA 3UIRA 2ZU2A 3RC3A 3RXMA 1Z08A 4OI0A 1EATA 2J2UA 1QBKC 3FANA 5FX5A 3OX7U 4UNQA 1J70A 3SEAA 1NFXA 4DLRA 3IEUA 3LX8A 3GLIA 4HB2A 3QDZB 1ZMNA 4CHAC 3EAQA 3TGJE 3D49H 3T5GA 3A4NA 2R2WU 1NS3A 1NRQH 2F1IA 4M1OA 4ZKNU 4TY6A 1HB0B 1FN8A 4GT1A 3GCTG 1SI5H 3SHCH 3GFTA 1KXEA 4IOKA 3LIWA 5HCIA 1E37B 2GJ8A 4M9SA 1TBZH 2XNIA 4AKEA 2BEKA 4TMZA 2VWLA 2HNTE 2C96A 1BMNH 1TIOA 1KSJA 1BZXE 3IIJA 3AF1A 2RGBA 4KJZA 1G9XA 1V5WA 3FKQA 1UTKA 3ESTA 1A46H 2DUCA 3A6PC 4V0NA 1NN0A 4LJ4A 5JCPA 4M0LA 3LXRA 1IXRC 4D9RA 1ZD9A 1QHYA 3D8BA 1GI4A 3AF4A 1GSIA 2SGAA 2ZI7A 3CRMA 1AK2A 3OIVA 3DZ8A 2H9TH 2FOHA 1AVXA 1ZLRA 5B6LA 2FP7B 2TGPZ 721PA 2GNOA 1IQLA 3PV5A 4NFEA 4IBLH 1R5BA 2OHFA 3TQFA 1OH5A 1XTJA 2EU8A 1Y8TA 1D9IA 1QRWA 1OWDA 3ECCA 4B3BA 2GD4B 4D4LA 2VB0A 3UWIA 3A58B 2ESTE 1LVGA 2FNAA 2H8KA 5KO2A 2D26C 3QEJA 1HA3A 2P0EA 1EFUA 1BTZA 2GCTC 5EP2A 3SOPA 3SV6A 4FIDA 3QNUA 4F92B 1XXFA 4LYJA 1E94E 1V2ST 1JQLB 1Q3TA 4BFWA 2X2FA 4HZUA 5E95A 3STJA 1IQMA 1GI8B 1FXYA 1AKSB 2GEDA 2FXRA 1DWBH 2V4ZA 2NIPA 4LHXA 3FP8E 4Q03A 2I3BA 1LQDB 4V0OA 1TNHA 3W34A 4JBXA 3GJXC 3CH4B 3CRQA 5AFZH 1TOMH 1DAFA 1AO5A 1S82A 1DE0A 5DYGA 1S3GA 1WCV1 3LFUA 2PSXA 3QEOA 2FI5E 1E2DA 3R9IA 2X77A 2LCFA 4DB4A 3U7HB 3KUDA 1GOTA 3DMDA 2A2XH 1H65A 4I81A 1F48A 4F38A 2L0XA 4D25A 5L8VA 1W0YH 4FUCA 1W44A 2VH5R 1WBGB 4Y0AA 2CMKA 1UJ1A 3AGPA 5KSPA 3EGKH 1US8B 4Q4HB 1QB1A 4ZCLA 2M5TA 4EFLA 1SQTA 3TUZC 3UWKA 1OKKA 1VCMA 1YPGH 1IXZA 5D3MB 1G4AE 1EAWA 4EUNA 1KMQA 4Y0YE 2GEVA 1XUIA 1RFNA 1T5LA 3TNSA 3VX4A 1BT7A 1QRZA 2PSYA 2V3HH 3M7UA 1WAYB 4HATA 4S2EA 1UDXA 2G0NA 3EE0B 4UKDA 1NVVR 4L9SA 1TQ2A 2P3TB 1KI9A 1O3PB 3M36A 2JATA 4BEJA 1GCDA 1AY6H 2OD3B 4ABYA 1EPTB 4G1UC 4DT1B 3Q9LA 5HR5A 1BYIA 3T27A 1ZHPA 4Y7BA 4FUBA 1P5ZB 3EPHA 1HRTH 4DOQA 1SVKA 4X1RU 4A0GA 1D3TB 1LHCH 1MCTA 1Q12A 3CPHA 1Z06A 3BH7A 4BFSA 3A8CA 2FSFA 5DI3A 2X8AA 2A7CA 4MNWA 1RVDA 2F9NA 1JPJA 1J2JA 5L3VA 4J1YA 2X1VA 2B5TB 3CR8A 4B32A 4NYIR 1PUJA 3SDZA 2OCBA 3IUYA 3ZIAA 5JJLA 4JBYA 2UUFB 3A1VA 3WYAA 3M1IA 5CDFE 1YPKH 3AVQA 5DISB 1O3FA 1O87A 3KJEA 4TLAA 3MO3A 1EOLA 3V7TA 4P4TA 1N6HA 3PR1A 2ZJAA 2JASA 3TITA 1TNJA 3C5CA 3EAJA 1TX8A 3GDUA 4AZ2B 3TQCA 5JJKA 1R7RA 3B1ZA 2F43B 1P2VA 1AKEA 2IN2A 2C8VA 1QG4A 4TTQA 2UZIR 3KQUA 1EGAA 2IEZA 5C2ZA 4MRVA 5H4IB 1O5AB 1GBLA 2CLSA 1NSTA 2BD3A 2F7SA 5T3HA 5BRRE 4FD2A 3KFVA 4FCVA 1N8OC 1RJ9A 1GJAB 1S84A 3PUWA 1MTNC 1L4DA 2WTUA 4I8GA 2N46A 3RXLA 3ZVAA 2KJQA 1W4RA 2H17A 1PFXC 1GPZA 2Y5HA 4PPNA 2IS1A 1IHTH 4TYYA 3DFLA 3P17H 3DFJA 1IQPA 2RH5A 3A1WA 4TLBA 3PROA 1Z8FA 5A0FA 1GJ6A 1THPB 1PLKA 4LJ9A 4D81A 5F9HA 3HPTB 1GJCB 3P8NA 1IQEA 1C4U2 3AVOA 3QVVA 2QV1A 1HAYB 1SOZA 2ZJ8A 4U2WA 1Y5UT 1LW7A 1RZ3A 1E79D 2O8DA 1T5IA 2CDNA 1OFUX 1RXPA 4YT7H 1GMCG 1OKXA 3NC0C 4MYTA 2VHJA 1YKSA 2WWWA 2QE7D 2ZRKA 5ESBA 5B57C 1BHXF 5G4BA 1BQYA 1FUJA 2QORA 4YOGA 2O8BA 2PUQH 4BLOA 5E7IA 3KJIA 3PLPA 2RAPA 4AFQA 3HATH 2VRWA 2F9MA 1OYTH 2I6QA 3TSZA 4ZDKA 1C5UA 4JBWA 1YJ5A 1E98A 2QF0A 2ZSAA 2BXTH 2GV7A 2QMEA 2G9NA 2O0KA 2JJ1A 1N1LA 3AM1A 2BMGB 2FX3A 1UVPA 5FTLA 3KTAB 2BX4A 1ZIPA 1XUFA 3U7EB 2RGNC 1E0FD 3HR8A 1W11U 2P16A 1XKAC 1XTKA 2XWBI 1SLVB 1E34B 1CGJE 2AX4A 4ESHA 1NI3A 3B78A 5SZKB 2OCVB 1P9NA 1F5LA 2FMJA 1K2I1 4JZIA 4MKIA 5C1BA 1C1RA 4MLFB 1HPGA 2IYVA 3PJRA 5HM9A 3BS4A 1VG8A 1KI2A 1Z6EA 4TT3D 1RTLA 3QKRB 4R2HA 3QTVH 1Q1BA 2WV4A 2QIQA 1TPAE 3I29A 3FHTA 4FUHA 1I2DA 2PW8H 3UQOA 5CIWA 2G4UA 1COWA 2BBTA 4FMCF 2CEAA 1INCA 2XNDD 1O2SA 4B3DA 1P2KA 4ZV4A 3PTBA 2ZANA 1OWIA 4WMEA 4YXWD 4JLAA 1MV5A 1O3OA 4UFGH 2C8XB 5SGAE 4Q7ZA 2BIFA 1C5OH 2B21A 3PMBB 821PA 4CT4B 1QURH 1NF3A 1T4UH 5F8ZA 1RGQA 1DLKB 2Q3HA 4JCNA 4FI3C 4TLDA 1NIPA 1KIMA 1QA7A 1ELBA 2J7KA 1DLEA 1QNJA 5FOWA 4EQ6A 2VIVA 3QPWA 1YZTA 2JLWA 4P4SA 1HAVB 1N0WA 1ZGIA 1DS6A 4XOIA 5FI0B 4WMDA 2O8EB 1EAIA 1GHYH 5FL7D 4LBWA 1K1PA 2Y80A 3TAHA 3KGPA 5EXSA 1C1NA 2PMKA 3QOFA 2PX0A 3EYDA 1YQTA 1KI3A 4TYNA 1NBMA 1E9EA 3L43A 3THYB 2ZEJA 4TLCA 1Z8IB 1W48A 1K22H 3TGPA 1GJ8B 4M21A 5DNYB 3GY4A 3U7GA 3X1XA 4M7GA 5DIFA 1P8VC 1O2LA 4Q21A 3C4JA 3WMGA 1TYNA 5J47A 1WU1A 4IN2A 2ZC9H 4DLVA 1SGIB 1QY6A 1KDTA 1TRNA 2ZDAH 1DAHA 5C46F 4YO9A 5CIQA 2B7DH 5TJXA 2PJZA 1M6NA 1GI0A 3BTEE 4AB9A 4NYMQ 1TX6A 3RS7A 4IDQA 1GDQA 1C4OA 3ATLA 4Z1MA 3ZS8A 5ELXA 4LJAA 1Y3XA 4DLYA 2IK8A 3ATIA 4DWJA 1P2UA 4C0BA 1BIFA 5F98A 4CH2B 1TBRH 1WF3A 1I2MA 1C2DA 4PSVA 5JFGA 2C8ZB 4A6LA 3DPUA 1E2PA 3KJHA 1Z6XA 1DPFA 1NLYA 1NLFA 1II9A 4Z54A 4LBVA 3HK3B 1Z07A 5AWFC 4IVQA 3VAAA 4A2QA 3OU0A 5FBRB 3AVPA 5CLQA 3UATA 2VL7A 2ZFSA 4PZYA 4LPSA 2HALA 3MGCA 3Q00A 3MMGA 1AZTA 4Q19A 5EXLA 1SVOA 2D1JA 2OLJA 3GY2A 4NE2A 4AYVB 1G3IA 1A3EH 1C1SA 3BTHE 3QN7A 4URZR 2A7HA 4IMQA 2ZFFH 4Q02A 4WVFA 1C2JA 1P10A 4G0NA 3UR6A 2Y7ZA 2XNSA 1DAGA 2OV2A 1KK0A 4HLCA 4PC1A 1GL1A 4LK4A 4RZUA 2QM8A 4I8HA 3BG4B 1TE0A 2XC5A 4OHWA 1L4ZA 4X6PA 2BOKA 2KAIB 3BIVH 1I4LD 3KB2A 3SC3A 1ONBA 3Q7PA 1Q31A 3DO6A 2VF8A 1GI3A 1YR9A 1BBRK 3OY6U 1T6NA 4PC6A 1LCYA 4Y71A 2WPDA 4KTCA 1QBOA 1F2UA 4R0IA 2Z3CA 4KU4A 2DPXA 2WIAA 3PV2A 4PZLA 3PV0A 4B35A 4G5GA 2QRNA 2HJVA 3TJVA 4YONB 4QBGB 5L30H 3EC1A 3K9NA 1E9FA 1NRNH 5FHTA 4TSFD 5C1XA 4JLJA 1GBFA 3C16C 3AKYA 1O3AA 3E0PB 1JI0A 3AP2A 2V6JA 3L82B 1ZM3A 2AYWA 2PV9B 3UREA 3SNCA 1II0A 1GI5A 4A0RA 3TSOA 1YHNA 4X1QU 2ZRNA 1SXJA 1AJEA 2WKRA 1LHEH 3EZFA 4KSCA 2FOEA 1Y3WA 4KODA 4CZ2A 1HAXB 4HLQB 1X1RA 3BXZA 3KF2A 2W6JA 2CLCX 2YJTD 3QKSB 2G00A 4B43A 3K09C 1AIXH 4JIMA 4ZXXH 2XYAA 3A4LA 3MOCA 2DFTA 2A4RA 3WRYC 2J38A 4LX0A 2OP9A 5UKDA 5EG4A 5TCAA 2A31A 2ZI3A 1G16A 4R8TB 2GWHA 2JH5D 2OLGA 4NPHA 1SMFE 4N0EA 2ZVPX 1P09A 5DG6A 5CK5A 1IONA 4FU7A 2ZI4A 1HIAB 4PO1A 3IIMA 1E1RA 2YNBA 1W7GH 3V12A 3QXHA 2XSZD 4A9AA 4TLEA 2QAGC 1EB2A 3OEHD 2H6MA 1AVWA 1RIWC 5EJEA 1O3NA 2JEOA 2AL7A 4AN7A 5LB4A 1DANH 4PSKA 1FPMA 3F8TA 3LBHA 1UADA 2WAYA 4C0AC 2IBMA 3KL4A 4FINA 4PXAA 2JJ2D 5L3SA 1P61B 1UKZA 2LWIA 3VQTA 4NCKA 3LPRA 5KPJA 1C1VH 1HDTH 2F6RA 3K65B 3QG5A 2ZPRA 4JYUH 4V02A 3QI2A 3A7ZA 5IHPA 2OUAA 5TDHA 5FX6A 4NIYA 4AI6A 4OGXA 2SGQE 3RXJA 5J5CA 1YP9A 5PTPA 3IO3A 1E2MA 3W8RA 1MTUA 4RD1A 1AD8H 1P2QA 2JLVA 2VBCA 1OXGA 1IAQA 1NSFA 1JIRA 2A30A 1H9HE 3QXSA 4WW0A 1IHSH 4KFSA 1E9DA 5GNDA 5JJIA 5GVSA 5JWRA 1S6HA 2EVWX 3O47A 1ELVA 4F93B 1TMTH 4L5BA 5TY0A 3SI7A 1G3EA 1AZ8A 3GCHC 5JEDA 3ZZTA 3TU7H 2CF9H 3SNHA 4JMPA 2GAOA 2ZGBH 1S9DA 3TR5A 1W8BH 4AFUA 1ZJ6A 3T29A 4TL7A 1DSTA 4KLNA 1BMFA 3GCGA 1T8NA 1B5GH 1R0YA 3CB4A 2NMVA 1VJAU 3SUGA 3ADDA 1L2EA 2XC0A 2ORIA 2ZUBA 4CREA 4B75A 1VCPA 3MI4A 2F9PA 1GI1A 4NZLA 2O8UA 3KQEA 1F60A 1Q0UA 1M34E 1LB1B 4I31A 3JVUA 4NKRA 2Q6GA 3KKOA 1U6QA 2K5UA 2RKOA 9LPRA 1G5RA 4O3MA 1C1TA 1XPUA 2ZJ5A 1DELA 5LB2A 1ANCA 1FNIA 1NN6A 1BJVA 3NTUA 3BN9A 2SGDE 4PFSA 1QTFA 5L3QA 3EIQA 1D5CA 2EQBA 3RANA 3DHWC 3RAPR 1EXMA 4JKIA 3SBEA 2ZYVX 5J4KA 2WWYA 1GBHA 3GEIA 4ESVA 4HLUC 1NPMA 2HT1A 3KNXA 2ZR9A 1NM6A 2QNRA 4M1KA 5JRJA 2VEDA 4ABDA 2IX3A 4IDNA 1SPJA 3K0SA 2HXYA 2B7BA 3T35A 1HJ9A 4SGAE 2ZUCA 3AVXA 4ZO4A 3IEVA 1CBWB 2VGCC 2PKSC 2H1LA 1FLEE 1LNZA 3KQKA 2V35A 2ZYUX 5BN5A 2A5KA 1YZQA 2GKSA 1GNRA 3LV8A 1NRPH 5DPAA 4GFDA 3FMFA 1JXMA 1SSXA 2XTNA 4AYTA 4NCHA 2RA3A 1G36A 4MQAA 4F49A 5EODA 3SU1A 4JLPA 4O03A 1VCWA 1C1PA 1XXHE 4LOAA 4LYAA 1UTJA 3GDVA 3PEWA 3NXPA 1PV4A 1OXVA 2IJOB 1KK1A 1A61H 4EPYA 4X2WA 1HAPH 3LVQE 1O2GH 4KKDA 1SLUB 4M4SA 1QB9A 2YKGA 3CPJB 3AKDA 3VGCC 3QIAA 1L4YA 3T25A 1TADA 3OFND 4B76A 1KXDA 2B8WA 2J94A 4BXWA 2V3OH 3A1TA 5F8XA 3ZZ7A 3ATKA 1BTPA 3K0FA 3GOVB 1PPEE 1TGTA 3BF6H 1SGRE 3AUXA 3LOXA 4U02A 1A4WH 1FI8A 1ANEA 1YLDA 2VWNA 1G2MA 1W47A 5K8IA 1DTSA 3LGVA 1UJ2A 2V1XA 1SB1H 2JLYA 1QL9A 2VH6A 4QM6A 2CE7A 2YWHA 4LY6A 2GCPA 3UOPA 2OE2A 4A1FA 4B2AA 3HKJB 4X0WU 1QDEA 1OB2A 3I8SA 2F3RA 4CW7A 2G81E 5HXFA 1K1NA 2QXHA 4BZQA 1C5PA 3MWYW 3KKNA 3MCAA 2Z9JA 4CR9A 1LO6A 4R9UC 2JLSA 1MU8B 1OS8A 4M1YA 4K5ZA 4ESTE 3RXOA 1HAHH 1WTGH 2BM1A 2H2ZA 3R7WB 1C2MA 1G3DA 4I1VA 1FP6A 1C1WH 5KHOC 4OHVA 4XTCS 4CRFA 2WINI 3URCA 1XUGA 3K9XB 3FP6E 1NY5A 1IJFA 1HV8A 2MSCB 4ARZB 2BZAA 1M2OB 2FX6A 1NTPA 2FZZA 4IDPA 4E06H 1OX1A 1DADA 1NJFA 2OBNA 4PHHA 3C15C 4Q48A 1TABE 3DMNA 3MTYA 5EUMA 5C1UA 4CEJB 4Q66C 1Q22A 2BVNA 1DY9A 2OLKA 2PZFA 1Q57A 2QAJA 7KMEH 3SNBA 1SVPA 4G5RA 3JZMA 1TNDA 1F5RA 2K1QA 1EWQA 2EI8A 3ZQJA 4KGAA 2OQ5A 2VVUA 2ZE5A 1VGCC 4GAWA 1QCPA 3ZVRA 5LBIA 4OK6A 2QG6A 2J45A 4GPGA 1J7KA 2QTHA 1DS2E 2ODYB 2VP6A 4DHEA 1W5TA 4U01A 2DCUA 3SZNA 5KNBA 4IFEA 2YWFA 3LDAA 1IN4A 3RS2A 2ODEA 3CX8A 1OP0A 3BC1A 1O2HA 1NY6A 1GHAF 2ZCLP 2GEUA 3OTJE 2HNTF 1NJGA 3U4QB 3EARA 3OF5A 2QPOA 3RRNA 1Z8GA 4JVNA 3QGNB 4WH8A 2XGJA 1JEDA 1Z22A 2H18A 1QHIA 4TQAA 2UVQA 5JCZA 3TLOA 3KQBA 3KKQA 3MHWU 1NMXA 4H6SB 3RXAA 3VU9B 1GVLA 1E1QD 2FOGA 4QM7A 3I78A 1XX9A 1XMJA 4ZCMA 2PL3A 5TMPA 2RGAA 1P4SA 3K0AB 4Q80A 3FHOA 1W1WA 3HJNA 3G0HA 4F7WA 3M6AA 2CHQA 3H4MA 4INLA 4RFSB 2VPPA 2W3KA 1VKJA 3SNAA 4WVPE 3LU9B 3A8DA 1VZQH 2AMDA 1CJTC 1OF1A 3U44B 1ZMJA 2JH0D 3KL6A 1F2TB 1C4Y2 2NZ8A 3ZJYA 1CT2E 1LKBA 2BM2A 4DIIH 4Y8XA 1UTQA 2YNAA 1P2JA 2WWFA 3I73A 5FPKA 1HJ8A 2GTBA 1Q44A 3RDPA 1KO7A 1OIVA 5AJXA 5BW8A 5JI3E 2Z3EA 4A36A 4IMZA 4NIXA 1MABB 1W13U 1O5DH 3QQ5A 1SVWA 1Z8RA 4MKHA 1AQYA 3RM0H 4QXAA 3EA5A 2XCNA 1S4QA 4NFFA 3PWBA 3MWKA 3LGTA 3RYTC 1XCGB 1SGTA 1HBTH 3OAAA 4IEEA 5FTJA 4H4FA 3SJZA 4JT4A 1YVDA 3K8YA 4HDOB 5FTNA 3L0IB 1NG1A 4ABFA 1W14U 4NL4H 4OL0A 4HAWA 3BTKE 2ECKA 3TNTA 2ZYWX 3LGUA 3GLFE 1C5ZB 3ZZBA 1X8KA 1TQ0B 4PQYA 3TE6A 3ZVEA 4E07A 2FH5B 5FOSA 1A3BH 3OESA 1Q3HA 1P7CA 1A7SA 2JDID 4A0FA 4A1TA 4NA8A 4EKDA 1TF5A 4A8JA 5L2ZH 1ZSKA 4MUAA 2STBE 6CHAB 2A2QH 1JRSA 1W10U 2VVCA 1Z6GA 1FP7A 2F9BH 3CO5A 1UM8A 3Q85A 4L16A 4FCTA 2XTTB 3VB3A 5C20A 3QENA 3ETLA 3WRXC 1MH0A 4A5TS 1OYWA 1MOZA 1N6RA 1SGYE 1TNKA 2XBXA 1Z6JH 4MGYR 1KDQB 1TBQH 7GCHG 3GLGE 5EXMA 3D31A 2QP9X 5JHGB 3THWB 1ZNXA 3HK6B 1YCPH 4BOHA 3O8DA 1C5SA 1SVIA 2B9LA 1C1YA 2QYIA 3WXMA 1XEWY 4GZLA 3QF4B 3ZD6A 3QBVA 2P3SA 5TV2A 3FVQA 9ESTA 1Y3VA 3R8FA 2PGQB 1C2IA 2ZHFH 1G41A 2GRJA 1UK4A 1VPLA 1Z0KA 2P94A 3AASA 4ISNA 2C95A 2IXFA 3Q5DA 3SR0A 4RVCA 1XMVA 3KXIA 5JBCS 2IS2A 1C2EA 1SG8B 2E87A 1IY2A 5LDDC 2ODQA 1TMBH 1RYHA 5KPDA 1PPHE 5BQ5A 3GPLA 4TT3A 4PANA 4RD3A 2FOMB 1K28D 1T3LA 3B8JA 5IF9A 3E90B 3CNOA 1WE2A 4A15A 1S0QA 2ZFPH 3LC5A 3GISB 3FAOA 3AP1A 1MCVA 2WZQA 2XNDA 2FOLA 1P02A 4PPFA 1GHBF 1PPCE 1O2NA 2O5VA 4YXWA 4FUEA 5L3RA 2OESA 5TCCA 1WQVH 2ANBA 3SU3A 2AKYA 1O2YA 2FMXA 5E3HA 1FY1A 2BMJA 4BQSA 2YOFA 1WXRA 3S9CA 4FWIB 2FOCA 4W5HA 5CHAC 4CEIB 1V3XA 1OOKB 3NH9A 4OI2A 3UNSA 1SHKA 1R0ZA 2J41A 2G1JA 1IN5A 1OFIA 3CM0A 4WIAA 5FL7A 1N25A 5K8TA 2HF9A 2GCHG 4XSKU 4ZHAA 4HYYA 3M5MA 3AVUA 1ARCA 1GRRA 2DHRA 5AJWA 2OCPA 2IHBA 1Y3UA 5B64A 3J81k 3P32A 3UY9A 2CV3A 4QRHA 4DUGA 1DWEH 5M04A 4TYPA 1DE7H 4B2PA 3K1JA 3P8OA 4CGZA 2Z9KA 5AK0A 1TUIA 4ZHMU 2GESA 2XXAB 2GHIA 3P26A 4F4CA 3RXHA 1S1MA 4K8OA 2BB4A 2Z6VA 1AA9A 4JLKA 1TB6H 5CJ2A 4GOXA 5E7MA 1U8AA 2PEYA 4X8OA 3RU4T 1UDWA 1AVGH 1CR4A 3R9XA 4CRCA 2VHTA 2JH6D 1ZPCA 3T06B 4I33A 1GL0E 3PEVA 3X1ZA 1NVWQ 4DURA 3E2IA 2QXJA 3C1KA 4GP6A 1MQ6A 2ZRIA 2BLVA 4CRAA 1CR1A 4ITRC 3GLFB 4KBFA 1CA0C 4UJ5A 3TGIE 2P59A 1SULA 4Q7XA 1JMOH 1YU9A 1CTQA 1PZNA 1QA0A 1HQCA 2Q21A 3UNRA 2F9LA 2NO9A 2QGNA 1V2NT 2YINC 1O2QA 2C77A 1KI4A 3AKCA 1IQNA 3F9GA 3T1VA 2QI9C 2R2AA 3A87A 1DWCH 3MD0A 3UIEA 2O8LA 2TGAA 3VTKA 5T6GA 4B3XA 4A4DA 1ZCAA 1LY1A 2A4OA 3Q7QA 3GLHE 4YT6H 4OGYA 4Q1FA 3SS8A 3FVFB 5IRCD 3AW1A 3MYWA 4B2CA 5H8WA 2BDHA 1YRAA 3LO5A 2G5NA 2BLWA 1EB1H 1ESBA 4R98A 2VGCB 1R0WA 1ZJDA 4ABBA 3EA7A 2GZDA 3LONA 1VCQA 3FDIA 3SJKA 2UWLA 1P9RA 1DVAH 4MNXA 2Z9LA 3CONA 2OUKA 2XJ9A 5GWZA 3NG1A 3W94A 2GZ8A 4CT5A 4DLUA 4KP0A 1JXPA 4Q1BA 1L4UA 3B7GA 1W36C 3KIDU 3NZIA 1SVSA 2DFKB 4LZZA 4Q4JB 3OTPA 2FFBA 3I72A 4W7SA 2VSFA 5JYIA 1M9UA 2OFXA 1DOAA 1DOJA 2AN9A 4RCYA 2FG5A 3TPIZ 3VGCB 5A09A 1JWTA 3SOSA 4GNKA 1GMHF 1ABIH 2PTNA 2BVRH 4FXGH 1Z6YA 2OFWA 4URYR 3DD2H 3RXKA 1ZM7A 1Z83A 1XVOA 3X1DA 3QO6A 1ZHRA 1OWKA 3PXGA 2F9VA 1H9IE 2Z43A 1NKSA 4JSTA 3NC1C 2J0QA 5HZKA 5K8UA 1II8B 2W00A 2W7UA 3VMFA 3M4YA 1KI6B 2RA0A 2XCFA 1N2CE 5EQTA 3N2IA 2YC4C 3A83A 4KELA 1CULC 3UUZA 5DJ7A 2H9EH 2GXUA 2ZYTX 1E0AA 1HYLA 4LV6A 3C5HA 3Q72A 3Q3XA 1COWD 2QMUA 5FPTA 5JLJA 3UANA 5BYKA 2IF0A 4Z0KA 3QXXA 2ZR7A 1UKVY 2EYQA 3B8HA 4N0DA 1KDOA 1UHBA 1DPOA 1R8SA 3A80A 5EZ5A 2JLXA 3UFAA 1U0JA 2Q1JA 1SHHB 2ZPTX 2ZRBA 4US2R 1ARBA 4NMMA 1V2KT 2ZFRH 1OXSC 1GGDC 2QTFA 2XSZA 3M3TA 3OEHA 4W5WA 5A2MH 4CRWB 8KME2 4L4UA 2AD1A 3SU5A 1T31A 1ZPZA 3VNVA 4F4JA 4BAMB 1O5EH 4DCUA 3DA9B 1CIPA 2C8WB 2C78A 1O38A 5AF9H 1O3BA 2JJ2A 3SE0A 1JJVA 5KSOA 1O2WA 3B9QA 4G01B 1Q1EA 1O2OA 1LHFH 2OXSA 5ESTE 3RLFA 1EPTC 5FCKA 5DK1A 1WBBA 1SHZA 1P03A 2E1RA 3TKLA 3IG6B 5TVKA 3K70C 4UEHH 3RUOA 3RRZA 4XWOA 4URXR 5JI2E 3MU0A 2UZ3A 1X86B 3A82A 4ZMAH 1R5OA 3SQWA 1GIAA 2HEIA 1UMAH 4IDHA 2IL1A 1RRFA 1C5QA 1CE5A 3GY6A 4O2LA 1FPHH 621PA 1YZUA 1A5IA 4HUQA 4E22A 2SNVA 4CDGA 1JALA 2HUPA 4CH8B 2R9PA 3C7KA 5HCNA 2ONKA 3UNQA 8ESTE 3TIUA 1MRSA 3TW4A 4PR0A 1O36A 1TA6A 4Q7MB 3H84A 3CRW1 2XXLA 4OS7A 3RRMA 4ABJA 3U61B 1E9SA 4QBFA 3SU4A 4AYXA 2G3YA 2W3IA 5HE9A 1GBBA 4TL8A 1HGTH 1TPSA 4TY7A 3WNDA 2EYUA 3B23B 2GVZC 1JR3D 4RFVA 2HPQH 4C3ZA 1CSOE 1ESMA 3LDXH 2IYUA 1X6VA 1SLWB 3P92A 4WA7A 5ETXA 1G17A 1GJBB 2CVFA 3ZVDA 1SGEE 1XEXA 3FPAA 5EPNA 4AGJA 4RCZA 2W58A 5FXLA 1Z6AA 3NCLA 3ADKA 1G5PA 4OHXA 1ZM9A 2R9VA 4DZZA 3RS5A 1GBDA 4UXIA 4RI0A 1G21E 1GZSA 4GVUA 5J4VA 4LV5B 1AB9C 1YC0A 2IWRA 1XRJA 3D7MA 3O8BA 3LC3A 2ZM5A 2V9PA 1P05A 4PC3A 2RMKA 2WMNB 4XTRA 4HFPB 2WUCA 3K9HA 3P4XA 3ZZ3A 4OM9A 3B1XA 3K0CC 2IXEA 1YGCH 5A8XA 1GMHG 2BY5X 2VP5A 4QBIA 3GLIE 1E38B 1KKMA 1CJKC 2BDAA 5C3NA 2YWEA 5JMTA 1E0JA 3UKDA 1LF5A 4A2PA 1BRAA 1C5WB 1P01A 1VIYA 4GOJA 3O8RA 1P3CA 3IBYA 1P3JA 2I4IA 5EZ6B 5J4QA 3TJZA 1W3CA 1KJZA 3U3KA 1UTNA 2GP9B 4CEHA 1W7AA 2Q9AA 8GCHF 1FOEB 3H5CB 3BK7A 2DE8A 3RSLA 1GL6A 1QHSA 1QHHA 2BD9A 1GTVA 5DP9A 3BD9A 2R2MB 1UEIA 4OS5A 2D74A 3OFNA 3L0OA 3AUYA 3CX6A 1A7JA 2VP4A 2OBQA 2QRZA 1BTHH 2MMGA 1GCTB 4NHOA 1DSUA 2AFIE 1KDPA 3NHBA 4O9VA 4GSOA 3U2QA 3MG9A 4H42U 5GIBA 3RXUA 5HE8A 1V2LT 1WB9A 4NTZA 5GXPA 1MR3F 3A37A 4QGAA 3GCTF 3KUCA 3M7QA 3CWQA 3A81A 4EFMA 4ZKDA 4II7A 4WXPA 1TPOA 2BX3A 1LF0A 2EI7A 1SQOA 4LSGA 2D7CA 4IOLA 1F0UA 4GCHG 2JGNA 2QTVB 4RY2A 2R6GA 4LUCA 1KLJH 1QJ1B 4AX9H 2RGNA 5CB6A 1SGQE 1FFHA 2PLXA 3T26A 5A0CA 4WBSA 3CF6R 2IJD1 1YRBA 3EW9A 2QSZA 1YZNA 2VU8E 5KDDA 1P2SA 1CS4C 3M7TA 2IYYA 3QBTA 1GUAA 4C7OA 5KSZA 5JBTA 1AUTC 3LQQA 4EJSB 5FBQB 4FW9A 1GBEA 1TQ7B 1XP8A 5FPSA 3ZZ6A 4QC2A 2GF9A 4KFUA 2FLRH 3CZPA 1ZOMA 3SV7A 3LT3A 4EPRA 2QQEA 1GWAA 2R8RA 1NRSH 3TK1A 3ADBA 1GP2A 3BTTE 1TF7A 2FDAA 2CJWB 1DG3A 5G53C 4D7FA 1JECA 5AVDA 1NFUA 1ODFA 5T6FA 4BAOB 3A86A 3IHWA 5C2JB 1EFHA 3NWJA 2XBVA 5JEEA 3R0FA 4I8JA 2GJKA 2ZE8A 3M0EA 1MBMA 1Z2AA 1F92A 3H7TA 3SBDA 2G52A 4UJ3A 1K1MA 3WNBA 1G8YA 1JB1A 2PCLA 4LPKA 2ZDNA 2F3TA 2OEPA 1QHGA 2VSOA 1Z71A 3B85A 1OH8A 4CRBA 3LJOA 1M7GA 1HAIH 1KLIH 4HDQB 4IC6A 3RXPA 2RGCA 3UXMA 1FN6A 2IUSA 1AE8H 3BEUA 1V2VT 4AD8A 2KB0A 3SGAE 2FPMA 1NRRH 1G6OA 3P8GA 3W3AA 1H8DH 5A4JA 2ZTZA 1GMDG 1HLTH 2GX4A 3IILA 4IGDA 1YPMH 5FUWA 4TPYA 1BMLA 2FI3E 4Q4AA 3A85A 2VSXA 1ZYOA 3PO1C 2JKHA 1GBKA 3IQWA 1FX0A 2TIOA 2DR3A 1L2TA 3ASYA 4AY2A 4Q9KA 3RXQA 4LBZA 2PJRA 2AIQA 4X2VA 4UFEH 7LPRA 4XBDA 1OFHA 4DDWA 2ZXUA 1LKAA 4Q7LA 4D0NA 1EUFA 3GLIB 1BMAA 3FYHA 1PUIA 4W9MC 3LGYA 3KQNA 1E1QA 2GILA 4QFMA 1UKEA 1T8TA 2F3CE 2ZRMA 2IW3A 4JZKA 2O0HA 3SV9A 2ORVA 1XXHA 1KLTA 3G01A 4ABIA 1S81A
chains in the Genus database with same CATH superfamily
2QN6A 5A04A 3FPHA 2XRYA 4H7IA 3TSWA 2I7TA 3OP1A 3D3WB 4WI1A 4RAOA 1R16A 2IU4A 2A0QB 3RXGA 3K6RA 1YBFA 5HIAA 2C8KA 2XUKA 2PSHA 2LP6A 1XE3A 1IJKA 3KB8A 2ZGXH 3HR7A 4XIFA 2AE2A 2Q0HA 3HYTA 4LDRA 4OS2A 2QRHA 1YQEA 2NPOA 1DBSA 4AW9A 4OHZA 1LJLA 3DMFA 4EMTA 1KI7A 2GJ9A 2OM6A 3TNYA 2AFIB 4EMBA 3TLCA 1QG2A 3PPXA 2ZIFA 4DR4B 5P21A 5C81A 2WMYA 3JYOA 5M3BA 3EVFA 4ZOEA 1KYYA 5LD2B 1G2OA 4YO7A 3NKKA 2BTQB 2MSLA 4HQNA 3PJFA 3WHKA 1DKQA 1OU4A 4G9EA 4DIKA 1KFKB 3CF4A 2IWHA 1G9SA 2IYNA 5JROA 2JARA 3D0QA 2O3TA 4DCMA 1IUOA 5JVDB 4IGAA 5JPMH 2GVNA 1NESE 1CQJB 4YOIA 4RS4A 1C3VA 3A31A 2ZTVA 3GBPA 1ZTLA 4YO8A 4ZK6A 3GZJA 1PQAA 5C8XA 2AZ4A 4V39A 2UZAA 1A4IA 1SHYA 1O5GH 1VJDA 4ATNA 5ES4B 4P81A 2W6QA 4YUWA 5CM8B 1XCJA 2J08A 4DCDA 2CHAC 2NXJA 1R88A 5IM5A 1RKQA 1KH3A 1TC1A 4JEUA 1TUBB 4IJQA 1QTIA 3VNBA 4OHKA 3K1YA 3DDUA 4QEDA 4KMRA 3NNSA 5TC4A 1YPJH 5CFQA 4UTRA 1H6AA 2HPPH 1L1JA 3NBZC 1W4AA 2R6FA 2L19A 1ZU4A 1XZ8A 2WJ3A 4HJRA 2H1WA 3DM9B 1J16A 5K0LA 1LBQA 2GFHA 3L8ZA 4MS1A 1BCSA 1TPZA 3ML1A 2JLZA 1DICA 3K09A 1F6BA 3UCEA 4FQ5A 1ZVJA 3RWMB 4CBOA 1RNLA 2V0CA 4B81A 3F9EA 3HM2A 4P7KA 2NGRA 4OB8A 1ECBA 2B9EA 4JHLA 4NYJR 2WKQA 3IP5A 4X8LA 3U6BA 1XTQA 1HJAC 3QOYA 3DONA 4Z2AA 4BP1A 4WT7A 1FY2A 3PC6A 4LI0A 3AW0A 5B1EA 3C43A 1QP7A 1T5TA 4JUBA 4ZCTA 3A8BA 1CUSA 2C82A 2YMMA 4MDYA 3DTTA 3KZVA 1I10A 1F5KU 4TVSA 4G5QA 1WSSH 4AG5A 1WNFA 2BLNA 1CPYA 3TH5A 1LK7A 3Q5GA 3IXMA 4LXBH 5TLSA 1Z0AA 5FORA 1PNTA 4AZWA 1M8FA 4II3A 3RVBA 4WLUA 3EZLA 1ZX1A 3VVBA 1YS4A 1D6JA 2P2YA 1O2VA 2HH9A 4OMFG 2POCA 4EYKA 4JQOA 2FPWA 1KJYA 3IDSA 3SZEA 4KYTA 3G6WA 3DHYA 3BB4A 3DBRB 4K9DA 1KIGH 2B7CA 4ABGA 4ER0A 5E2PA 4I6GA 3AP3A 1N2GA 4YJFA 3ROQA 3O9VA 2V0BA 1OOEA 1WQ4A 5FLXA 4Q7YA 1FYEA 1U2DC 3K70B 1G20E 2AIRA 4K81B 1RJ9B 3NBUA 3NT4A 1I4TD 5FLEX 4FFLA 4G24A 4M76B 1AQJA 4MYHA 2OD9A 4MK4A 2AOTA 2FX2A 5FI5A 1Y8RA 1MNAA 2ZKLA 5A71A 3RQIA 3PNBA 4MNVA 2ZRCA 2BY6X 2I2DA 2JCSA 5DLQC 1YCPK 1RHMA 3VYVA 1O96B 1UAGA 3UJPA 2FS9A 3V34A 5IM4F 1YPEH 3U1IB 5B4UA 4QULA 4IS5A 1FNDA 3W5BA 4MKGA 1OH6A 4QICA 4N39A 4WUVA 2ZIAA 1TLDA 2Y1FA 4PCUA 2QV7A 1RE1A 5G1OA 4RIFA 5AK3A 2OG1A 4HZGA 2NVBA 1KSHA 2D2FA 4X6YA 3ED1A 4I4TA 4MVJD 3F9FA 3NEAA 4Q01A 3WLNA 3OAAD 2BAGA 3TZBA 5HQJA 1LS6A 2OC1A