3O8RA

Visualizing atp-dependent rna translocation by the ns3 helicase from hcv
Total Genus 212
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
212
sequence length
645
structure length
645
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPVFTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HCV NS3 protease/helicase
publication title Visualizing ATP-Dependent RNA Translocation by the NS3 Helicase from HCV.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1b
molecule tags Hydrolase/rna
total genus 212
structure length 645
sequence length 645
chains with identical sequence B
ec nomenclature ec 3.4.21.98: Hepacivirin.
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 3o8rA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3o8rA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3o8rA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3o8rA03
1GZSA 4LK2A 2WBLC 1FJSA 2OFOA 1D9ZA 3T25A 3UWOA 1JPJA 1E2GA 4C7OA 1SXJD 3B8JA 2OC8A 3PTNA 1PZNA 4M9QA 3BFVA 1G7RA 1D6RA 1VECA 2YWEA 1HE8B 4KP0A 2HYIC 3TGJE 4NFEA 4KFRA 1G16A 2V1UA 4IXNA 1OT3A 4LI0A 2ZTXA 1NT1A 3SBDA 2ESTE 2ZP0H 3DEFA 3NXPA 3A1VA 4IW3B 1YPKH 1C5PA 1Z3IX 3EXAA 1XEXA 4LHZA 3C5HA 3JZMA 3NKKA 3U7EB 1CSOE 1TQ0B 4G5SA 2VJ1A 1TF7A 2WOOA 1XTJA 3WHLA 6Q21A 5A0CA 2VHCA 2PKSB 3HPRA 1MT0A 4XH9B 2OQ5A 1KK1A 4XBDA 5BRRE 1XJ0A 1ESTA 3P70B 1ZNXA 4LHYA 4FUEA 1NM6A 2IYYA 4AN7A 3VNVA 2XJ4A 4BFUA 3K0FB 1SVLA 5CYPA 4ESTE 1Z5ZA 1V2VT 4ACAA 2ODWA 4IDNA 4WVFA 1AQ7A 4XWKA 2P8OC 5K8TA 1EAWA 1ZOMA 2FYRA 5SZIA 1ZMXA 3K70B 4DWJA 3QUMP 1GCDA 1ZSLA 2XZOA 1KO7A 3R8FA 1U0JA 1M9UA 1KDRA 3SGBE 3DOFA 4U32A 3V9PA 4NSVA 1ZNYA 2XXLA 3DOEA 3W8NA 5ANRB 2AMDA 3F5FA 2VIIA 2WKPA 3ZVCA 1FNNA 4HAVA 4ZI2A 4ZKEA 1HV7A 4B6FA 5J4KA 4Q4AB 1N2CE 3PG5A 2ECKA 1Z2AA 1ARBA 1O31A 4Q7KA 3UQVA 4MUAA 3BEUA 3K0AB 5F8ZA 2GEUA 1OSSA 4Z1MA 3KIDU 4F92B 4PPNA 3KCGH 3E0PB 2YYZA 1JR3E 2TBSA 1NLFA 1ZP6A 2QMHA 3KXKA 4X6PA 1ZUIA 3CNNA 4HAXA 4E05H 4F91B 2VU8E 1E32A 1TADA 1R10A 1Z83A 3DHKH 1AZZA 2CEAA 3GLHE 4YONB 2O0JA 2PMDA 4Q1BA 1G8HA 1KYIA 3P32A 3VB4A 1FTNA 2KSQA 1MTSA 1HXFH 1XMIA 4OGXA 1QBKC 2P6UA 2OO7A 1O3EA 1SR5C 1JOUB 3MU5A 3AW1A 2ZREA 1PV4A 1JPNA 2A1DB 1Q12A 4JZIA 1P9NA 4OHXA 1QNJA 1PQ8A 4IVRA 1CR2A 4A0GA 2CL0X 1AWFH 3QKSA 4NL4H 1QHIA 1WBGB 3MNSA 2OLGA 1WOFA 3ZD6A 4NYMR 5FTNA 1S1CA 5E2PA 4QT8C 5TARA 4ISNA 2C8WB 2WPHS 2OE2A 3K9HA 3M35A 4HTCH 4DLRA 1NVVQ 4B2LA 2W5EA 3FMOB 4PC6A 2JLWA 1YF4A 4BECA 4FUCA 2OCYC 4IMQA 1UJ2A 1P05A 4VGCC 4X1PU 4LV8B 2FOGA 1EPTB 3HK6B 2PT5A 1PPHE 2ZCHP 2RA0A 1DARA 1Z6EA 1ZD8A 2F9UA 4JVNA 4LY6A 3GDSA 2OBNA 4AIIA 1T3LA 1IN5A 1BMLA 4E22A 4TL8A 2QP9X 3MH7A 3SYJA 1KNQA 3GLGB 4CH8B 1AGJA 1MKWH 1PLJA 1O5BB 1ZZZA 1Q1QA 2KE5A 4HSEA 4AYVB 1ZD9A 4URUR 3PLKA 1TX8A 2ZFFH 1ZU5A 1NL3A 3THOA 5C4MA 2BC9A 1B0UA 3QX5H 1AUJA 3D31A 3U1JB 2GGVB 3QDZB 4NYJR 1LY1A 1SPJA 3QF4B 3UOUA 2ZFRH 1P2UA 3ZVRA 2NZ8A 1E3MA 4FINA 1FUKA 3SUGA 1BA8B 1C2IA 1HURA 1DSUA 3SI4H 3FP8E 4YO9A 3ZZDA 1W4BA 2FZZA 3D8BA 2QQEA 1EJMA 4NCIA 1J15A 3BTQE 4YLQH 2DCUA 4B1TA 5FUWA 3TGKE 4W5WA 3MU0A 5AUOB 3T62A 3M36A 1Z0IA 2P8OB 2VRWA 5A09A 3LLUA 4B3XA 3UNQA 1NFUA 2XTZA 721PA 3M3VA 4JLDA 4RY2A 3P1JA 3I61A 4IMZA 2XSZD 1BT7A 1GMHG 1KO5A 1GI7B 4BZPA 1ETUA 4KLZA 3CWQA 3DFLA 1C5WB 1NJFA 4Q00A 4QBHA 5EE0A 2V3OH 3RM0H 4A8JA 1BBRE 3VX3A 4A1XA 1ANBA 1KKLA 2ORVA 4MKHA 4JYBA 3UG6A 2WUBA 2XNIA 3S1AA 1E94E 1Z1IA 2R6FA 2XZPA 4QGHA 3ATIA 5JWHA 1SQAA 2ZGXH 2AX4A 4WXPA 1AB9B 3PITA 1RD3B 3K09A 1XZPA 1G21E 2JETC 5DP3A 3J81k 1KI4A 1QHXA 4HDQB 4DIEA 3IQXA 4A82A 3P8GA 3DKVA 3TMKA 3OESA 5EOKA 1NO9H 1IN6A 2JIZA 2WWWA 1D6WA 1P75A 4IBLH 3TPIZ 2JH5D 2ZFPH 4NG9H 2CK3A 1C2HA 5FHTA 2WSSD 3ZVMA 4F4OC 4ABGA 1P0SH 2ZDNA 3RSLA 4TMTA 2QZ4A 5KSYA 2QXJA 1AIXH 3SGAE 2CF8H 2VGCC 3ZQJA 4X1RU 2ZIAA 2H5EA 5A0BA 4HAUA 1V2PT 4MVNA 4JK5A 1PUJA 3K53A 4OS7A 2J34A 4GVUA 3EC2A 1E1QD 1GJ9B 4KI0A 2EEKA 4QC2A 1R8QA 1FAKH 2A7QA 1RJ9B 4DIIH 1O3NA 1LHEH 3EA8A 1JALA 2GNOA 3D7MA 1FV9A 4UJ5A 2GKSA 2ODBA 2FS9A 5JDUB 2ZR0A 1NP6A 2LNCA 1S3GA 1XX6A 4Q1EA 2WWHA 1IM2A 1JMOH 1CLUA 1T31A 5KSOA 1EASA 1PYTC 1AIPA 3TK5A 1YBWA 3REFA 1LPGB 3VHXA 4WH8A 2D2DA 4INHA 3U7GA 5DISB 2BY5X 1GBTA 2F1RA 1DAFA 3AP2A 1ZGIA 4BZQA 1VCWA 4AZ2B 1KKMA 2NO6A 3IQWA 4HZIA 2WTUA 1XF9A 3ATMA 3SNCA 3ZZBA 1LCYA 4NCNA 5UKDA 2QAAA 1KK0A 1K1LA 1ZPBA 2RCEA 1I2DA 3RXVA 4HFPB 5FOUA 4DCSA 2QP4A 5DI9A 4YT7H 1MABA 1TIOA 5GWZA 2ZI7A 1DEKA 3EYDA 3RXTA 2BM2A 3T29A 1Z1JA 3K9XB 1Q1EA 2FOMB 2OFWA 3A1TA 1SC8U 3CF2A 1E2LA 1OIVA 2O8BA 1JRSA 4PO1A 4EFNA 2Y5GA 1YKSA 4BZXA 4IVQA 5DP7A 3KKQA 3M37A 1X3SA 1DWBH 4R8TB 3LD9A 1ZSJA 4HGCA 1H9LB 2BQ7B 2Q9AA 2BZ6H 4MNXA 3LFUA 3SV2H 5CM8B 3CS0A 3OEHD 3BTFE 4TWYA 1AFQC 3G01A 3SI3H 2OBOA 2QAJA 1THSH 3C7KA 2J1LA 5C2JB 1ZM9A 4NA9H 2YZ2A 3QENA 3AAUA 2E87A 3SV9A 2ZECA 3NPSA 1S9HA 1NFXA 5HTKA 2FOEA 4AYTA 3V12A 1RFNA 4NIYA 2D06A 2GT7A 1FN6A 2VO1A 2ZUBA 3STJA 4CRGA 1F6BA 3G5UA 2A2XH 2SGQE 3SR0A 3PMAB 2ZJBA 1G7CA 1K5GA 1KOFA 2XBYA 1FDPA 2ZO3H 1LTQA 3K9GA 3A8DA 1Z8IB 3PMBB 4JZ1A 1ZYUA 5GCHF 2R9VA 1DWEH 1O5AB 2R6AA 4TLAA 2OILA 2HGTH 1QR3E 2C93B 2P3TB 1S9DA 1P61B 1LF0A 1HY3A 1ELOA 2ZROA 1SVKA 5C1YA 3Q00A 3EZ7A 5JMTA 1SSXA 3QIAA 3A8TA 5SGAE 3QEOA 1EOJA 1ETRH 4NHOA 4OL0A 5L3SB 1SGDE 1XPOA 1UCYH 2FSHA 1VTKA 2IN2A 5SZKB 4YMTA 2JETB 4GP6A 3RXAA 1P9WA 1V43A 5SZJA 5TVKA 3DUXH 3ICQB 2C96A 5GCHG 2XWAA 3PV0A 1XD9A 1OP0A 4I1UA 1LDTT 3SNBA 1S6HA 4OHWA 1KZ7B 1P7CA 2Z5FA 1HAZB 1NN1A 3OSYA 1F5LA 1Z71A 4JYVH 5CB8A 2BVXH 4MNVA 5M04A 2AWNA 5HE9A 1O0DH 4HLDA 1VHTA 4AWXA 2A4OA 4ABJA 2CCJA 4NP6A 1HH4A 4LV6A 5JI2E 4MITA 1SMFE 2QXGA 2YVUA 4MRNA 3N70A 2FLBH 3VR6A 1HNEE 3CPHA 4BRWA 1GVZA 5T6GA 3QPUA 4QGGA 3CR7A 1HAXB 2CCKA 3ENSB 3FWYA 1K28D 3EC1A 2ZRAA 4DKXA 3QXJA 5LPRA 4QM7A 1F0TA 3PJRA 2IK8A 1X1SA 1KDTA 2H9TH 3CRW1 1MO3A 3GOVB 1EFRD 3PUVA 4ZH8A 4Q1DA 1DDJA 4JZEH 3T28A 4M2LA 2ZDVH 1JR3D 2C3SA 3RC3A 3QK1A 4P4UA 5JI3E 2FF7A 3AUYA 5CJ2A 4PZZA 1W4CA 1CBWB 3AKYA 2OCBA 2YOFA 3IITA 2QORA 4XE4A 2NO9A 3I29A 1H1BA 3SOSA 4L8GA 1BTUA 3V0XA 3TJVA 4GMXA 1GDNA 4CF7A 4P4TA 1RC8A 2WV5A 1MBQA 2P2LA 3HDTA 4H1UA 3KQKA 5B57C 2J92A 1E2IA 2V54A 1TAGA 2B5TB 3RXKA 2AN9A 3MCAA 2FP7B 4QXAA 3QTOH 1FN8A 1GITA 5GXPA 2ZRJA 5EP1A 4GZMA 4Y79A 4WZBE 4ZPXA 2BMJA 3TQFA 2JH6D 5FL7A 1ELTA 2BD4A 3PYHA 4ZHAA 1RYHA 3U4QA 1M74A 1GBKA 1R0YA 2GZ9A 1Y3UA 1Y3XA 3VQTA 3Q3JB 221PA 3QVUA 3WYGA 1TMKA 1VYUA 3S9AA 4MA4A 2G0TA 1YZLA 3BFXA 4G5GA 1G19A 3GP8A 2ZJ5A 2ZRBA 3LO5A 1DAGA 4D4KA 2ZETA 3SUFA 3PLBA 2NPFA 1GHBF 2WM9B 4XBBA 3V4FA 1OWEA 3MGCA 2ATXA 5GDSH 3AK5A 1G5TA 2HJGA 4D4JA 5EQQA 4Q9HA 3RM2H 3ELAH 1ZIPA 1XXHE 5KTYA 2V6JA 2BQWB 1Z0DA 1W47A 3E3TA 4CDGA 4P0TA 1ZRKA 3ZYDA 4Y11E 2GA8A 3ATWA 4UXHA 3PUXA 4R0IA 1CIPA 2HXSA 1E4YA 4A8JC 4GDFA 2YJTD 1J2JA 2GJ8A 5TJXA 4EDHA 3M7UA 3B85A 1GG6B 1Q1BA 3AVPA 3D65E 1PYTD 3VMFA 4B3BA 1GHBG 1W3CA 3E90B 2MSEB 4TLEA 1BH2A 4P4SB 1WQVH 1DPFA 3Q72A 2OEPA 3P95A 4Z8YA 4QJ3A 2ZGJA 1CA0B 4PHTA 1W11U 2RAPA 2DBYA 1O2RA 1SQTA 2DUCA 3ZS9A 3T15A 1LHGH 1JB1A 3Q7QA 2A5JA 3VNUA 3MRSA 1RS0A 4AC9A 1ZMNA 2CNWD 2WIBA 4WZAE 3X2SA 4N0DA 1ZW6A 4YMWA 4ISHH 2W0MA 3RMMH 3BFKA 5FR1A 3R8CA 4EFMA 2BY9X 1A4RA 5FPTA 4YLGA 4FUJA 1UTKA 1MH0A 2QF0A 2ZU5A 4JKYA 3QBVA 1TPAE 3K2UA 1R5NA 1G37A 3NDBB 3RXJA 3IKJA 1LW7A 5L3QB 2XXAA 5L6NH 3B6EA 3PENA 1TFXA 4UNRA 2VBCA 1XTIA 2V35A 1QBNA 2BLOA 4I31A 3GD7A 1II8A 3OU0A 3F9FA 1OE0A 1BITA 5HGGA 4TL9A 2E1RA 3AVWA 1DE7H 2GXUA 5E2OA 3PQCA 1TRMA 1CA8B 3W5JA 2VSOA 2AIPA 4ITRC 4Y8XA 3RRZA 3GCHC 3NH9A 4DZZA 1Q3XA 1HV8A 1YM0A 3SJCA 5HZKA 1HAVA 1WMSA 3NEJA 1S96A 3CPEA 3PB1E 1CGIE 4ABBA 2JJ2A 2XNDA 3BTKE 2MSCB 4ZV4A 3BJIC 1SULA 3E1SA 4Z51A 4Z8XA 1QL7A 3H4MA 2ZI2H 4ESHA 4PHFA 1G6OA 1HCGA 4LSGA 3UG7A 5FFMA 3FMFA 1CKEA 2J0VA 4UQOA 2Q6TA 1G18A 3EPHA 3AVYA 3AVUA 4Z0KA 1SHZA 1GBMA 1ZCAA 4C0JA 2ZIQH 3A58B 2O8DA 4NCHA 1G9IE 1DANH 2QAGA 1VCMA 4A6LA 1OYQA 1XXDA 2JJ1A 1KI7A 1I2MA 4TMWA 2AL7A 2HJVA 1TNDA 1HQYE 3U3KA 1XD8A 2P0EA 1SB1H 1P06A 3B7GA 5CK5A 1DOJA 3Q3KA 3T5DA 4OQXA 4I4LA 1DSTA 2DFNA 5E8EH 3I5XA 2RGXA 1KI6B 5E7JA 1NY6A 5DHFA 3U61B 3TW8B 3SE0A 4LCBA 4U01A 3U60B 3DD2H 2BM1A 3WMGA 2HRVA 2QN6A 2CXVA 4X1NU 2O52A 3MWIU 3MHWU 4HUQA 5DK1A 4ABAA 4Z6AH 1XBTA 3AM1A 1TABE 4FUBA 3GY8A 3QZRA 2WKRA 2XB2A 2AK2A 1JXMA 5A8YA 2DFKB 5E95A 4Q21A 2GJSA 4FWIB 3CRRA 1TWXB 1OXUA 3FAOA 1KI2A 4IN2A 2PTNA 4M9ZA 1PLKA 2C90B 4HLQB 1COWD 3VKHA 1LFDB 2WKQA 1ELCA 3UKDA 3LVRE 5DP6A 2IS4A 2HT6A 2ZC9H 1HFDA 2GCTC 4JVSB 3RXQA 2GK7A 4PSKA 2FH5B 3K65B 4NCYA 1JQLB 1FTSA 1ZHPA 3LGWA 4YOJA 8KME2 4Y0VA 1AKSA 1KNXA 1ZR0A 4TT3A 2GXAA 1SGIB 1YCPK 3RXFA 5JPMH 1TALA 3TU7H 3CS7A 4TZ6A 2V3HH 2AYWA 5C3NA 3OIWA 2P6NA 2AMPA 4WWYA 1GVNB 3ZZ0A 5B58C 1E9SA 1EUFA 1S83A 1NMZA 5AJXA 2IYSA 2F9NA 5FUVA 2X8AA 1N0UA 1XUGA 3TR5A 4BANB 4EAQA 3FOZA 2QGZA 1BRBE 2IS6A 3ESTA 2EYQA 2VP4A 1RKBA 1NNEA 2HNTC 5CLLA 1DICA 3QUSA 3VXFH 4FUDA 2GK6A 2LWIA 4Q2KA 2FSIA 2GZ8A 1BRUP 3THYA 1GL9B 2H92A 1C1VH 1T8OA 3FZZA 3LC5A 5ETXA 4BFZA 3JZAA 3RMNH 2WINI 2ZU1A 1ZNZA 2VVVA 1DE0A 4TTPA 4UXJA 4O3UA 2ANKH 3NVAA 3TJOA 1O2TA 3IO3A 2NG1A 1E9CA 2R2WU 3MNCA 3C16C 1EWRA 5LD2B 3SHWA 3NUMA 2Z4SA 1O34A 5HZHA 1G64A 4DDUA 3QI2A 1W46A 1K22H 5LH8A 3C5CA 2REXB 2F91A 2GX4A 2IS1A 3PO1C 1DVAH 2NO0A 5FOSA 1UBCA 2WWIA 1MABB 3A7TA 4AK9A 4HI0E 4BOHA 3U44B 5D3MA 1EP5A 4X8VH 3TSWA 1QRWA 4AGJA 2FEQH 4A4DA 1IN7A 1NN5A 1CJKC 1XZQA 4AKGA 2W6JA 3WYAA 2AH4X 1O2YA 5DI3A 3RLYH 1H9HE 1E1RA 1OH6A 2KAIB 2N1BA 1PQAA 1XXHB 2ZJOA 2G3YA 3N7OA 1IQFA 1OLOA 5C5OA 3DKPA 2DFTA 3ECCA 4W5HA 3K9NA 2BDCA 3P27A 4DIDA 1W0JA 4R98A 4UNNA 2VIOA 4DSNA 4CEHB 4NWLA 5J4SA 4D81A 3GCTG 3KKNA 2YKGA 2A5GA 1AKEA 1O5EH 1N6YA 4ILEA 4TWWA 1Y5BT 4PC7A 5G4BA 1C4V2 1O2JA 2GBLC 5DN6A 1FNMA 1Z6TA 3O8RA 4RZ2A 3QY0A 2B7CA 4IHQA 3SU0A 9LPRA 4LPKA 4BQSA 2JIZD 4GI7A 3U9AH 3SJOA 4BLTA 3EPKA 4OQFA 2AK3A 2IWHA 2YHSA 3IILA 1GHYH 2IYQA 2IYWA 4NCJA 1NRSH 2WV4A 1PPZA 5F6MA 3GFPA 4B43A 1OXVA 3SU8A 3AF2A 3PWCA 4UNPA 1O2UA 1VYTA 1QL8A 2IS2A 3TSZA 2GCTB 2ZYWX 3KKPA 1VHLA 4B47A 5F03A 2CJWB 3MWLA 2ZCLP 2VHQA 4BAOB 2ZRNA 1W12U 2QF3A 3H5CB 1DO0A 4GOKA 4ZKDA 1WV7H 1Z6JH 2P94A 4AG6A 4B75A 3RS7A 3Q3YA 5H68A 3FFAA 5HE8A 5LBIA 4M21A 3KQUA 2VP2A 1T4GA 2Z4RA 1QGFA 5A4JA 1N25A 4JVLA 4TTQA 1CS4C 1YZNA 3LBNA 1SOZA 1T0HB 1GMCF 4ZMAH 3AEZA 4Y8ZA 2Q21A 1V2JT 1D3TB 1L8QA 2Q3HA 3M5LA 3K0CA 3GLFA 5DP8A 2GCPA 4XTRA 1G2LA 2QBYA 5EUQB 4KBGA 4IN1A 2QY0B 2FPLA 3IPYA 1GGDB 1JAIA 1PJPA 1MO4A 3LW7A 1O2PA 3UNSA 5CJPA 4MYHA 1BTZA 3MMGA 1O2HA 4C0QC 2BEJA 4UNSA 1BRCE 3WYFA 1OWDA 4ASHA 2QTFA 3RRNA 2ZPSA 1TF5A 3QG5A 2ZRKA 4IXMA 2DWPA 3CB4A 5EXMA 3QGJA 3OE7D 1YC0A 1AZSC 1XEWY 5EU8A 1JRTA 1P10A 2QC2A 1BHXF 3UUZA 2IW3A 3BIUH 1EAIA 3BG8A 4NGAH 1BBRK 1DXPA 3ZZ9A 4TN1A 4UXIA 3EE0B 1Z2CA 4K81B 2J38A 5JHHB 2F1HA 2TPIZ 3GJ5A 3QXHA 4EQ6A 5GIBA 2OXCA 1U9IA 4K8YA 2BMGB 9ESTA 1HJAC 1ZTLA 1AN0A 1VITF 2RB4A 3UIEA 1C5UA 4AB9A 2PH1A 2P16A 3ZDQA 4ZDWA 4BAHB 3NXSA 1SLVB 5AUNB 4Q80A 1TPZA 3LAWA 3N5CA 1EG7A 1F0RA 4DCVA 1NZQH 4L9SA 5BN5A 2J3EA 2PX0A 2C8VA 2GMTB 2JLZA 1C5OH 3TGIE 3I4LA 4TLDA 4K60A 2IXFA 1CBUA 1SVMA 3NBZC 2BDYA 1IQIA 1VITG 3SZRA 421PA 3R7WB 2J0QA 1FW6A 4HLCA 5AUQA 2R0LA 4U5XA 3THWA 4IS5A 2OP9A 2OSBA 4F4IA 1DWCH 1II0A 3PMHB 2VF7A 4DT1B 4ZDJA 5E7MA 2P93A 2C9CA 2FG5A 3A8CA 2Z43A 4CVNA 2FPMA 5AJZA 2BD9A 2XWBI 4V0NA 4OBEA 1CTQA 3RVBA 3A7VA 4ZDIA 1U0HC 2WYJA 2P67A 3KXIA 3KZ1E 2O8EA 3VFEA 2XOKD 5HPYB 2B92A 1F48A 1YHNA 3WMEA 3LGYA 1A61H 4X8LA 1IQLA 3F6UH 3CNLA 1VJ9U 2ZTYA 3OTPA 1P2NA 2PR3A 4UFGH 1QFKH 5GPIB 1Z22A 1FX0A 1GBAA 3ZIAD 2UUJB 4ISOA 4WBSA 1AHTH 2PX3A 1ORFA 1YPEH 4HYYA 4M1KA 1ARCA 4ZDKA 1H9IE 4RKFA 4RFSB 3MD0A 4BFTA 2VHJA 1O2IA 3PEWA 1T6NA 5JBQA 2VTKA 1EESA 1INCA 4NA8A 1IQGA 1PPFE 2DHRA 4JZDH 3F9HA 1UADA 1A46H 4AG5A 5JSZA 1O3BA 2Q9CA 4DB4A 4NA7A 4ASUA 3WY8A 3BV9B 4Q4JB 3U8OH 2A0QB 5FI1B 2B8TA 1W44A 4PO9A 2VVUA 2BMFA 2MSDB 1TOCB 2EFHB 5KPJA 1NIPA 4HB0A 1SL3A 1F2TA 4DCUA 1S0UA 3EGKH 4ABIA 4A15A 2DE8A 1L0ZA 2BD7A 3UWJH 2XB4A 3DO6A 5KUTA 2FDCA 1BTPA 4DB2A 4IFBA 1EX3A 2PCJA 3WBJA 1HAHH 1WYKA 4U2WA 4ARZB 1XUFA 4RN6A 4SGAE 2ZQ1A 1DX5M 1ZPZA 1FZZA 4KVAA 4CH2B 2CDNA 1KXEA 3UMSA 1K6MA 1TGSZ 3QVVA 1P60A 5PTPA 1Q21A 5HMAA 2G9NA 3LOXA 1C4OA 4CR9A 3MU4A 5AR1A 2XX3A 3IIMA 2DE9A 4HATA 1ELGA 1D2MA 1HDTH 2VQSA 4DJTA 4DLTA 3UR9A 5IDVA 1ZAKA 4B3DA 3SBKA 1IY2A 1O2VA 2VWOA 3IBGA 4F7WA 1YYY1 3L0IB 3AUXA 4OQNA 4CEIB 4NKRA 1GI8B 3RU4E 4B76A 1QRXA 2GTBA 4KU4A 4YMVA 1YR7A 4BFSA 2FEMA 4DY7B 2XZLA 1Z06A 2B8WA 4PZLA 4WY3A 3UFAA 1HJAB 3K0FA 2WAXA 4B73A 2QIQA 2GETA 2R6DA 3RABA 4UFDH 3EZ9A 2OHFA 3UTUH 2ZI6A 2KJQA 2QU8A 2VP6A 3AVVA 3GLFE 5EG4A 3A4MA 7GCHG 1UKYA 1UPTA 1AA9A 3VR2A 3MO9A 3RXEA 1YRBA 4EPYA 4DCTA 2IEYA 2QM8A 4JLMA 3L0OA 1AQYA 3CRVA 5IDKA 3U3JA 4DLWA 4WF8A 2QTHA 5JBBS 3L3TA 1UTQA 1UO6A 1CF4A 4B2IA 2O0HA 1UTLM 3MO6A 2W2VA 4Q4AA 2AWOA 1XTSA 4MQBA 1A0LA 3FKSD 4TMVA 5A8ZA 2PJRA 3PLPA 3T27A 3K0AA 2OQUA 4M8NE 3W90A 1ELFA 4HB2A 2ZHWH 1OSNA 1CJUC 4OM9A 5HXFA 2ZDKA 4R2HA 1P03A 2OUKA 3M0EA 3QKRB 2A30A 1HGTH 8ESTE 3NEYA 3SNHA 2UZ3A 4LJ8A 1MCVA 3QO6A 1SI5H 3EPLA 1DY8A 2DY1A 1ELBA 4C0SA 1W4RA 2CHAB 4Q66C 2MMCA 1OWJA 3TJZA 1MTNB 5AVDA 1TGTA 2R8RA 4PC1A 1DY9A 2LKDA 4NCKA 2JCSA 4X8OA 2ZI9A 1O3DA 1GI0A 1JAHA 3UY9A 1N6OA 3AV0B 3I92A 3SZEA 1FZQA 2KBEA 2PTCE 1GWNA 6CHAB 1UKVY 1ETTH 2SNWA 3GJ0A 4GCHG 3AP1A 1CR1A 4QGAA 4R71A 4JLVA 4ZXYH 2CHVA 4CIDA 4O0MA 4LBVA 4URVR 4GT1A 3P26A 4JCNA 1OWHA 1CJMA 5DH9A 4LGMA 3NK8A 3PR1A 4ABDA 3SORA 4KITB 2D74A 3RDPA 1JJVA 4K8OA 4PZYA 1Q44A 4OI0A 1H8HD 4ZXXH 2BBWA 1EZQA 1CT4E 1G3MA 4LYFA 2GILA 1O2MA 1O3CA 4BLPA 2YOGA 1KI1A 2A5DA 1N5JA 4LHXA 3LH1A 2B8OH 1KO1A 1U98A 1QVAA 1EPTA 4D25A 1GBEA 1F5KU 2FI5E 2JJ2D 2XNDD 3M5MA 3TVTA 4BE7B 1SGNE 4QM6A 1D2EA 1O3MA 1HAPH 1DAKA 2FOCA 1AVGH 4D9RA 1J8AA 1ZHMA 2OCPA 4LJ5A 4M1OA 2ERYA 1DLEA 1G5RA 3K0CC 1WRBA 3GLGA 2Y5HA 1C2MA 1H8IH 1ZM3A 3M3SA 1M7BA 5GJVC 3SGQE 5B30A 4OI1A 3Q5EA 3P17H 3LONA 1FIZA 3IUYA 1Z63A 5EQTA 3ZZCA 3LJOA 4YT6H 1G4UR 1VYVA 5E7IA 5JEDA 4Q1AA 1FPMA 2A4GA 3MU8A 1XMVA 1SGQE 1O37A 4M1SA 3QF4A 5T6FA 1RYFA 4DLXA 2Q6DA 2V55B 3LIWA 1FOEB 1N6PA 2RGDA 2N46A 2FX4A 2BTCE 2BJVA 1P73A 2EW1A 1EFTA 1MH1A 2Z0MA 2OTVA 1OFHA 1L4ZA 1UVTH 1LHDH 3W8RA 1VGCC 4EPVA 2XTNA 1A0JA 1QBOA 2H1UA 3AQ4A 3C4JA 1U9IC 5FOWA 4X2VA 4O25A 2J41A 4Q9JA 1P11E 1KK3A 1SGFG 1N5KA 1VG8A 4NZYA 3S9BA 2ZF0H 4ZKRU 4EUNA 1BOQA 3UPUA 1VCQA 1QBVH 1G20E 1VCOA 4IDOA 3QPWA 3RWOA 1GBLA 4Q18A 2C77A 2H2ZA 2GZDA 1FAXA 2J87A 4INLA 1CR4A 5JRZA 1QB9A 4V0LA 3Q7PA 1KXCA 2JAQA 3KQHA 3F1SB 1VIYA 2BDHA 1G3QA 2F43B 3CENA 1V2OT 2A5KA 2BKEA 1HEIA 3SJBA 1OF1A 3SN8A 3KUDA 1RE0A 3MO3A 2C2HA 1L4DA 4DLZA 4TT3D 4CEJB 2UWPA 5DYIA 3AVQA 4XJXA 3BG4C 2J9NA 4OKSA 4KSBA 4BXWA 1GI1A 5CMXH 4OK5A 2QRZA 4Q9IA 1GAJA 3A7XA 1KDQB 3E2IA 1CP2A 4UJ3A 4IC6A 1FUUA 5A0AE 3P4YA 4KBFA 3ZZ5A 4ZUHA 4MNWA 4U00A 3B1WA 4DDWA 3EAQA 4ZKOU 1NLYA 3U3OA 3AAVA 2ZJAA 2A78A 1F2UB 4NSYA 3GYLB 1GRNA 4HUTA 4O9VA 1FP7A 2ZRGA 3KNXA 2RHDA 3PXGA 3GCNA 1AS2A 1XPUA 5KNDA 2ZJ8A 1ZM7A 1OB2A 2J4IA 4HDCA 1YCPH 1RJ9A 3GCGA 1SHYA 2GZ7A 1EQ9A 4JYUH 4C0AC 2QMEA 2C03A 4EPWA 1H8ED 1TNJA 1TF2A 1RIWC 1KLTA 1TX7A 2WVJA 2OUAA 4KJZA 2BBTA 2WICA 5C1XA 7KMEH 5G53C 2ZSEA 5AFZH 1A4WH 3H7OA 4NYMQ 4KVGA 1E98A 1Y59T 2VWNA 1OH7A 3PIRA 3LT3A 1E2QA 5J4YA 3RXGA 2Q3MA 2QEQA 3H1TA 2IC5A 1E9DA 1KAOA 3SYLA 2VHUA 1ACBE 4RKJB 1E2MA 3GQBA 4AFZA 1ZGVA 1DAEA 3URCA 5JJLA 1QL9A 1ZU4A 4CBNA 5LB4A 1HT1E 2VL7A 2G1JA 1QIXB 3FMPB 4AYXA 3GY2A 2J0SA 1JNYA 2ZSAA 1ZTJA 2ZE7A 621PA 1LV7A 1MU6B 3P8NA 1E0SA 4UKDA 1FY8E 1CE5A 1ZRHA 1YR8A 3CRQA 1NN6A 1E35B 5P21A 3K0EA 4RSGA 3LDXH 4RCZA 2FMXA 2H18A 1AE8H 4E5UA 3L0PA 3CRMA 3SU6A 3ZVFA 1EFUA 1S8FA 1OXSC 1GBDA 3RXPA 3RS4A 3I3SR 3T35A 4K5ZA 2AR7A 1MQ5A 1TQ2A 3A7ZA 2SGEE 4HEJA 1KIGH 1N6XA 3DT0H 5AUPB 5E0JA 3HPQA 4GZLA 4D9QA 3AKCA 1MD8A 1YU9A 1O5GH 2E9SA 1NN0A 2W26A 4YMUA 4UD9H 3SBEA 3KN2A 1X1RA 1EGAA 1W0JD 3P8FA 1JR3A 2TGTA 4LJYA 3VU9B 3B1ZA 4BEJA 1Z8RA 5KPDA 4FU7A 1VGCB 4NYJQ 2D7DA 4Q7LA 4Q02A 2IWRA 1X86B 1P2KA 2F9PA 4MRSA 1JECA 3RRMA 5AF9H 2VEDA 3B8HA 1J7KA 1FNIA 4WZ6A 1OFIA 2F4LA 3URDA 3JZ2B 4B48A 3DMNA 3GLGE 2ZCKP 3R9WA 2SFAA 2XGJA 3MJRA 3K70C 3PFIA 4Y7BA 1DM4B 2XBXA 2O8UA 1ZUNB 1NFWA 1DADA 3HPTB 1SGTA 1ONBA 2CMYA 3ZZTA 3VKGA 1U6QA 2NU2E 2Z9IA 2I1QA 3WMFA 1P9SA 1V3XA 1MTVA 1G32B 5IRCD 1O2LA 1FL9A 1ZHRA 4B44A 4JVMA 5L3SA 2ZGHA 5GVSA 4PROA 2PL3A 2FI3E 1EB1H 4EIWA 1M1YE 1Z47A 4I8KA 3M5OA 4XVRA 4TWZA 2GKVE 4LDJA 1WTGH 2VYFA 1NESE 1Z0FA 1FLEE 5C18A 3RXDA 1QURH 2J9RA 4X1SU 4B33A 3DDCA 4M1WA 4TL6A 2CBZA 5CIQA 4IDQA 5G40A 1TMTH 3SJAA 1QJ1B 2C04A 821PA 4OGYA 5IYTA 2H9EH 3MOCA 3HP1A 1C1UH 5FR2A 1WTHD 2GZAA 1RFLA 1JWTA 4WMFA 2WOJA 2FFQA 3L33A 4FMCF 2ZYUX 2OINA 3EARA 2IF2A 4JMPA 2IXGA 4KSCA 1MCTA 1G8YA 4DJZB 2GCOB 1E9RA 1W48A 1NS3A 1UVSH 5BXQC 5KDOA 3PMJA 1XTRA 4O2LA 4IOLA 3BK7A 2UZIR 2PLXA 2X19A 2FGKA 1QRAA 2H16A 3LKWA 3QF7A 1A3BH 2OESA 1AVXA 2KWIA 2NPIA 2CHQA 4RZUA 3HU3A 3OIUA 1C2GA 2ZITA 3MWJA 2W2TA 4MG3A 3RC8A 1RIWB 4CREA 1T3HA 1OX1A 1C9PA 3KJIA 2ONKA 3N2EA 4EPRA 4B2CA 2QCYA 3I73A 1EXFA 2JH0D 1F60A 1NFYA 1T0JB 3AVXA 2O8CB 2AKAB 2GV7A 1LS6A 3NDPA 1X7AC 4P32A 1S2MA 3DFJA 5I46H 3EG5A 4CRFA 4PSAA 4RZXA 1GJ5H 4L16A 4Z54A 1EPTC 3SU3A 1SKYB 3NIBA 1VJAU 4MQAA 3ATLA 1F0UA 2WPIS 4B2PA 2XC0A 1M8PA 1GHAG 2BCGY 2QMOA 1XTQA 2VNTA 5EQSA 4E07A 2FLRH 4IOJA 3MH4A 1U8AA 3KDSE 2ZRLA 1P2OA 1GI4A 2IJOB 3Q5DA 2JLQA 3PROA 3IG6B 1BBRH 1Z0AA 1PLLA 5GJCA 4CRDA 5H4IB 1O36A 3CF6R 2YNAA 3ITIA 5EE1A 1HTWA 1O2XA 3M7QA 1BQYA 1C5RA 1DWDH 3LGUA 4WW0A 1WU1A 1G291 2WJVA 5J40A 5EJEA 1C2LA 4GUXA 4Y7AA 1G17A 2RGNA 1C1RA 4DLVA 5KNBA 2XRCA 1SQ5A 1LVGA 3W5IA 3FP7E 1R5BA 3ONWA 5J47A 3W34A 1AGRA 5TY0A 2IHYA 1BIOA 2J7KA 1GTVA 2FS8A 1A0HB 3A7WA 2AGEX 3UPEA 1C5SA 2A45B 1ZUHA 3CO5A 2F9MA 2G5NA 4A5TS 3IEUA 5F8XA 2IBMA 1IQJA 4J1YA 3EIQA 2XW9A 3QTVH 4NMMA 4JLPA 4MDSA 4BLRA 3NHBA 2ZG0H 1XXFA 4A2WA 1NI3A 2DYKA 4ZHLU 3BF6H 4LZ1H 7LPRA 3LU9B 4D6PA 2GHIA 2QROA 4D2IA 1B5GH 4K1SA 4OS5A 1RIFA 4QBIA 4WXVA 1SLWB 4QGFA 3VKWA 2PZEA 1YKTA 3ICEA 2REOA 5DHAA 1RRPA 2G4UA 1XKBC 3NTUA 3PUWA 2GJAA 1PUIA 4H42U 1OXGA 2KB0A 5B6OA 1C5TA 2QRNA 1G3EA 5DO9A 2V7QA 3GDVA 2CLDX 5IT5A 4OJKA 2HOBA 3ZZUA 1O39A 1KLIH 3KUCA 1Z6GA 2ZHFH 4P4SA 3V00A 2NU3E 1QY6A 3IHLA 2PW8H 1TEXA 1QA0A 3QGNB 3OIVA 4ASUD 3KJEA 2H5CA 2BIFA 1TUIA 2X77A 1KXBA 3V3MA 1HB0B 1AB9C 1GI3A 4FIDA 4RD0A 3CH5A 2C9OA 2OXSA 3ODFA 1WXQA 4C0HA 1W2HA 2XITA 2OG2A 5F98A 4AFUA 3E5HA 2W6ID 4YXWA 4ESVA 2ASUB 3KQLA 4YQFA 2CXXA 1WBDA 2R2AA 1BO6A 4A2QA 3U98H 3E91A 1IQPA 2ZPQA 2FWWA 3RNLA 2D1JA 5L3QA 3DVLA 3OYPA 4BAMB 1WQ1R 4NE2A 3UIRA 2GXSA 5J4HA 2ZKSA 1P9UA 2W58A 2PLFA 2D26C 5T6DA 3FZDA 2OCAA 1SGPE 3G0HA 1IHSH 1COWA 2GCHF 1P6XA 4JBYA 2VP5A 1C5ZB 5C67A 3SHAH 2QT1A 2CE2X 2EVWX 1TQDA 3KKMA 1OFUX 4QNMA 1EKBB 4LYHA 3O47A 1IY0A 5FUYA 1KTSB 2RGCA 2GXQA 3THXB 5BW8A 1V6DA 2F6RA 4Q7JB 3ZV8A 4TL7A 2OAQ1 1W14U 2PFEA 4PX9A 4BTTB 2ZZUH 2Z6VA 5K8IA 1C2FA 1IXZA 1EFHA 1YLDA 2FDAA 2J59A 2O8MA 1P62B 3SNDA 3FHTA 2HLDD 4CRWB 1CHGA 1KMQA 2GP9B 3REGA 5KHOC 2PUQH 5J4VA 4NIXA 3ZVNA 4FN5A 2BDGA 5L3RA 3STIA 2FOFA 1PQ5A 1R8SA 4QJ4A 3ADKA 5EXSA 2YNMA 2BDTA 3K70D 4XWAA 3HKIB 1FMJA 1KJZA 1O5FH 5KSZA 1JXOA 3L43A 5IK2D 1TGCA 4DVGA 1SZPA 4TY7A 3SV8A 1O35A 3ZH9B 3DA9B 3MH6A 1MBMA 3S9CA 3RMOH 1MOZA 1PPEE 2XAUA 4AG1A 3SEAA 5C5NA 4U02A 2GF0A 1CRPA 1W1WA 2V4ZA 3LDAA 2PKAB 1FP6A 3RLFA 1BYIA 1E69A 4A2PA 4IVPA 1YZKA 2EFDB 1KI6A 2IUSA 4M0LA 1HBTH 2BEKA 2STAE 3TH3H 2OBLA 4KELA 1GKUB 3VR1A 5GNDA 1W36B 4C30A 3HKJB 5JEEA 1E79D 2AGGX 2DWQA 1R7RA 4INKA 4MRPA 3PUZA 3U8RH 4JZFH 1BZXE 2AFQB 2F9BH 1E2EA 1TLDA 2ZU6A 2F1IA 1TBRH 1MV5A 1GMDF 4K1TA 1OPHB 4QJ5A 4Q19A 1YVDA 4KCGA 3TJUA 1FY5A 2NGRA 2BLVA 5FPYA 3BE4A 5LDDC 1UEJA 3Q8XB 4OS1A 1V2RT 1KTVA 3RAPR 3PM3A 2PEZA 1O5DH 2BX3A 4Q4LA 1HJ8A 4TMKA 1UVUH 4BWYA 3BSQA 3BH7A 3A86A 4W5JA 1TOMH 3B1XA 2P65A 1UBFA 3LQRA 2Z94A 1OKKD 3KHVA 2KI5A 4ZAEA 1LVMA 5DG6A 1CHOF 1GMDG 1TUEA 3H7TA 2FU5C 1ZMLA 2PBRA 1HAYB 2NU4E 2TRMA 1XJCA 4TSFA 1GBCA 4FWTA 1TEVA 2F3TA 1QHNA 3KTAB 1SFQB 4H4FA 2F1JA 3RC5A 3MNBA 2Z9LA 2CHGA 1C1MA 1DITH 1THPB 4JLKA 1QDEA 5FBRB 2A9KA 3QEJA 1TRNA 1PJRA 2GJKA 1QB1A 3H86A 4NFFA 1DS2E 1G3RA 2AD5A 3VR3A 1XKAC 1UFQA 1QHHB 1NRRH 1CHOG 4AI6A 3RRYA 1P9RA 2ALPA 5KOYA 3U1IB 5DP4A 1LVYA 1WF3A 2ORIA 1G1MA 3SU2A 4WMEA 4CW7A 1O3LA 2VH5R 1P2JA 3W6NA 1KHTA 4M9SA 1GG2A 4KTCA 1UTJA 1G4AE 5CB6A 3ZS8A 1GSIA 3OZXA 4XD7A 5F9FA 3W95A 4OI2A 1ZIOA 3JVVA 1QJ6B 4DUGD 3U44A 3VFDA 2FSFA 4X8TH 1EX6A 4CT4B 2NZJA 1BRAA 1CBWC 1G5PA 1NU7B 5E0HA 2VSXA 1RZ3A 1GHWH 1RW4A 2WJJA 1PPCE 5CLQA 2O9QA 2GDJA 1MUEB 2LCFA 3GFTA 5JHGB 1K1MA 2KAIA 1XXHA 3GDUA 2NO1A 1GDDA 5EXNA 1N6LA 3OE7A 5DP9A 1NF3A 1OPXA 1E34B 1SGWA 3KB1A 1UDWA 2ANBA 5BWMA 1XM1A 2HCJB 2HF9A 3ZVAA 5C46F 2R0KA 4I33A 4CEHA 3T26A 1JR6A 3K1JA 3RYTC 2UWLA 2A4QA 4Y10E 3QNUA 1KLJH 1V2QT 3KFVA 2HNTF 4QG7A 2RGNC 1N0VC 4AYYB 3TH2H 3TLXA 3IIKA 4BFWA 4Q1CA 3TBKA 1O38A 5DP5A 4NWKA 1JXPA 2RG3A 1J8MF 1GL7A 2AKYA 1FFHA 1A1RA 4A9AA 1GHXH 1S82A 1XUHA 4JYTA 1NVXQ 3TH4H 1CT0E 1I4TD 3QSYA 5A5GA 3TNSA 4ZO4A 1BCUH 2ZRDA 2W00A 3SS8A 1UAAA 4M1MA 1II9A 4MH0R 1BJVA 1LMWB 3PVSA 4U30A 4D76A 3LBIA 5T1VA 2VIVA 1MO5A 1D3PB 2RGGA 1P57B 5JB9S 1RXPA 4A36A 3MJHA 4IDHA 1GBFA 2XJ9A 4N1AA 5AHGH 5ABWA 2QE7A 1T8UA 1DFPA 2GZHA 2CJWA 1EAXA 1S0RA 5FXLA 4M1TA 1NRQH 1GJ6A 3FMIA 2YINC 4US0R 3HU1A 3BTDE 2LKCA 3QBTA 2OT3B 1GG6C 2XTTB 1HUTH 2IYTA 4TYYA 4YOGA 2RCNA 4D7FA 4RFVA 2H8KA 2IUTA 4G5RA 3VAAA 1CA0C 4FUHA 2GVFA 2BOVA 1RPZA 4IKEA 2FYQA 5DO4H 2CF9H 4EJSC 1EX7A 5A8XA 1GRQA 1KYNA 4DCDA 2AS9A 4MYUA 3VR4A 3T5GA 4PQYA 3ZZ3A 2XOKA 3Q9LA 2VINA 4GHTA 4RD1A 3KEEA 1TU4A 4LX0A 4D4LA 4B71A 1C2KA 5FTLA 2FFHA 4AOQA 4F93B 1R0XA 1DUAA 5ESTE 4LYAA 3ZIAA 2B21A 5DNYB 1HYQA 5GADl 3SDZA 4RKOB 4MGZR 4URZR 3QKUA 3KQBA 2ZRFA 3NBXX 2XCFA 1N5IA 1N8OB 4TMZA 3UREA 4XOIA 3BB4A 2G0NA 1BMNH 5C20A 2EQBA 2ZHDA 3GCOA 4L15A 1XEWX 2ALVA 4DG4A 1SQOA 1MTWA 4F38A 4XFQA 3TH5A 2HVXA 4JLOA 2C8ZB 3GJXC 1Z6XA 1NROH 2ZXUA 1OXTA 3M7TA 5BYJA 3GJ6A 4DC9A 2X2FA 4WXIA 1KDOA 4BTIB 2C4FH 3UWKA 3RXBA 2PGQB 1W8BH 3TIUA 3D23A 3KX2A 2Y7XA 1S4QA 1JIRA 5JECA 1HLTH 2P5TB 3ODDA 3TVJB 5FPKA 4NPHA 4W7SA 3KJHA 5L2YH 3E0NB 1R0ZA 4OJQA 1GUAA 1UHBB 3A81A 5FCRA 1NTPA 1MD7A 3LBHA 3ZVDA 4MPWA 2IL1A 1G8FA 5C1UA 4D8NA 4WMDA 1HAOH 4MGIR 2P59A 3SV7A 2AMQA 1EZUC 2J94A 5FTMA 1HUQA 2QSZA 2Y82A 2UKDA 3R7WA 2UUFB 1RTLA 1SXJB 1CU1A 2YC4C 2J45A 1ZINA 1CEEA 4JJKA 5AK0A 2FPZA 4PANA 3B82A 4DT1A 2DPXA 3NC1C 1OB5A 2C8XB 2HF8A 2GBLA 4IDPA 3R20A 3LV8A 2EWVA 2Z7FE 2FMJA 1L7VC 3DHWC 5FBWB 1C1YA 3L6PA 1MRSA 2VP0A 3SFVA 4KYUA 3GEHA 1RTKA 3LNCA 3W6PA 4XOJA 1C5QA 5LPNA 1GHVH 4Q48A 2PHBA 5DYGA 1MKXK 1V2UT 1TTTA 2FFBA 5GVRA 3OTJE 4PPQA 4WVPE 1YR9A 2DR3A 1WDTA 1U94A 3HR8A 4KHZA 1GI9B 2HV8A 4FUGA 3T1OA 4I8LA 3B1VA 4XBCA 2D62A 3GYMA 4CR5A 5TDHA 4OS2A 4RFSA 3CP7A 2GJ9A 4TTRA 3FKSA 3KGPA 3AF0A 5BPEA 3BIFA 2ZUCA 1D9IA 5JFGA 1B0EA 3GEEA 2JLXA 1IQNA 4K2YA 5F2EA 1O2SA 3I77A 1BHXB 4KKDA 4GP7A 4ABEA 3GLIB 4AX9H 1W5SA 4Q4JA 4AGKA 4U7DA 4IC5A 2IF0A 1WE2A 1W13U 3SJKA 3BTWE 4NIVA 4EJSB 3C15C 1WBBA 3LGTA 3FHCB 1OH8A 2BWJA 3DM5A 4ARZA 4Q1FA 1I4LD 2G52A 5FAHA 1C5XB 2I3BA 3SOPA 3MFJA 4PC3A 5FOXA 1VPLA 3SUDA 1EK0A 3NKVA 3P8OA 2BBOA 1GL1A 1BKDR 2RH5A 5K0HA 1ESMA 5CYOA 4FU8A 4URYR 2VIDA 2IT1A 4C0BA 4J2YB 1AKYA 2FA9A 2VF8A 1ELVA 3NZIA 4X0WU 5HR5A 1VZQH 2QA9E 1J8YF 4CEIA 1SOTA 3SJIA 4Q5IA 4AFSA 4F4CA 4I1SA 1H8HA 4MPXA 2ANCA 1TA2A 3NHAA 2WUCA 1SHKA 3A80A 1YPHE 2QYIA 5F8TA 3ATKA 4FW9A 3W3ZB 2YNBA 3FP6E 3D3QA 3CLVA 4I7YH 1ZJKA 3D62A 5LD2C 3QXXA 2A5YB 1DPOA 3TSOA 1GM5A 4IJMA 2ZHEH 4TQ9A 2HNTE 1S6FA 2OC7A 1E4VA 3CM0A 5K8LA 1Y8TA 2VHTA 3WRYC 1C5VA 2Q6GA 3BRWD 5IF9A 1O3KA 4Y8YA 2BM0A 2IHBA 1NG9A 1UTMA 1KMHB 4URXR 2ZS9A 2Z9JA 2EFCB 3PCRB 2FWRA 4XVUA 4FMBB 1ZC4A 4X8UH 1O2WA 4GSOA 4Q01A 1DOAA 1O87A 2Y7ZA 1MRNA 4FCVA 1UTPA 2BXTH 2Q6FA 4MYTA 5EXLA 5FOVA 2Y81A 2HUPA 2ODNA 2FN4A 4JL6A 3B1YA 3ZVGA 1K8RA 4M4SA 3Q85A 1WCZA 1OKXA 1OYTH 2OZEA 4DEXA 1Q2WA 1TGNA 1UTOA 8GCHF 4Y0ZE 2V7QD 3QKRA 1HYLA 2QV1A 4LBZA 2J0UB 1XD2B 1CT2E 2BD8A 4C2UA 4JL8A 1FY1A 3PV2A 2ERXA 4BUJA 1Y3VA 1QB6A 3C27B 4EPXA 1DS6A 1G6HA 3EASA 2QQ0A 3GJ4A 2EA3A 4YXWD 2YWFA 4QBFA 1PVOA 2Z3DA 3HYRA 4YM9A 1N6RA 2ZUDA 3RXIA 2GV6A 8GCHG 1E2JA 3B5JA 3NWUA 1O3PB 2ZU4A 3K6YA 4TPYA 1X8JA 4PAMA 3V7TA 1V5WA 3ZQ6A 1N6HA 3GFOA 5SZHB 1TNLA 5BN4A 2IX3A 5FBIA 4K8BA 2IYUA 4X2YA 3L8ZA 4HAWA 2R3YA 2VLIA 3OIYA 1E9BA 2YV5A 1TPPA 4OQLA 1HAIH 4MTBA 2Z6BD 5ESBA 3U7FB 1WQSA 1P12E 1NBMD 3C8UA 3U2QA 3VGCC 3I8XA 1W7AA 2JEOA 1Q31A 4FCTA 1TONA 1MO6A 3I62A 1Z0KA 3U69H 3A7YA 3L8YA 3TNTA 4ZCMA 4AY2A 2FE4A 1GJ8B 4E7RG 4PTLA 2ORWA 2ZPTX 1YR6A 3WBKA 1N1LA 3MTYA 1ZBDA 4I81A 1QG2A 4DSTA 1KY9A 1UKEA 4MNYA 2GEDA 1E2NA 1F2SE 2NWNA 4X8MA 1Z28A 1YPHC 4HZUB 4PHGA 1NVUQ 2G51A 521PA 1C4U2 2ZQ5A 3A8AA 1DG1G 1P3CA 2IA5A 3BS4A 2WJYA 1DELA 5CM9C 5E0GA 3X1ZA 2ZRIA 1BMFA 8LPRA 4JKIA 2ANWA 1GGDC 2EI6A 2GF9A 1ZYOA 1TQ7B 1QJ7B 1TBQH 2A31A 4US2R 1M2OB 2PEYA 1T8MA 3QKTA 2JLRA 1H8EA 3RC6A 2R2MB 4GL2A 3U6KA 1A2KC 1AVWA 3SQXA 2G88A 4Q47A 2RKOA 2CMKA 5JLJA 4GLYA 4ISLA 3KKOA 2RHMA 4QNRA 1V2ST 5EXTA 1VR1H 1QCPA 1A1VA 3UMRA 4BRUA 3MMPA 1FQKA 2V3CC 4ERNA 2CJIA 4FCWA 1KY3A 4I32A 4ZIRB 2D7CA 2G77B 1X6VA 4TLCA 2XYAA 1W2GA 4TYPA 1QHGA 2BMDA 1N3BA 5DPAA 1KTTB 5TB5A 1GMHF 2JKHA 3PV5A 1GDQA 1T5LA 4E7NA 3M3TA 1J99A 3FFBA 4KO8A 4G0NA 4RCYA 4G5QA 2ODYB 4X6OA 2PWXA 3GICB 2PMKA 1I4DD 1LVOA 5FBVB 2ZDLA 2VWMA 4Y0YE 1IN4A 4PQFA 2GMTC 3QWCH 2ZU0C 1XU4A 3T1VA 4X8SH 3UK6A 2FEOA 4A7IB 1F7ZA 3A82A 2F43A 1AQUA 2MMGA 3A87A 2FFAA 1N0WA 4GOXA 5TCAA 3TUJC 5EXPA 1XP8A 1W10U 5C4GB 1LQEA 1NY5A 3RS3A 3LGVA 2SNVA 4BASA 4BFYA 3NG1A 4LBWA 4CEJA 1HT2E 5H8WA 1HPGA 4FXPA 1A82A 1OP8A 1G8PA 3O8DA 8OHMA 1KDQA 3LVQE 1YGCH 3NBYC 1UTNA 3CZPA 2C5LA 1EJNA 1T7CA 3VB7A 1O5CB 4JT2A 4FMDB 3CW2A 3R9IA 3U6BA 5EZ5A 1ESAA 5EGMA 2FGJA 1TA6A 4DT7B 3RSOA 1EOLA 1F2UA 2VIPA 1HIAB 1NRJB 1US8B 1CJVC 1DBSA 2OFXA 3CF0A 5LPEA 4ZROA 4TSFD 1ABJH 4BXSA 3T1QA 2R9PA 4A92A 2H7VA 3NC0C 5H1YA 3FPAA 1AD8H 4D0NA 3SW2B 1YRAA 1GHZA 1NLZA 3F9EA 1KO8A 1OHHA 3ASYA 4FVBA 1LS1A 2ZRPA 3LA6A 3R3GB 3VGCB 2HXYA 4NZLA 1F3OA 4JSYA 1B7XB 3LJJA 3FB4A 3BTME 2G55A 1S5SA 4G5OA 3AVOA 3ZVEA 1XVMA 5AWFC 3QE0A 2GTPA 2A2ZA 5LPFA 3QG1A 2A4RA 1S3SA 1KI9A 3PTBA 2YOLA 1P04A 4DLUA 1OFTA 4X8HA 2QGRA 4WA7A 3DPUA 4DGJA 4O03A 1L4UA 4XD7D 2Q0HA 2PZFA 1IHUA 3BH6A 3RS2A 2BBSA 3W3AA 3GY7A 4BLSA 1MR3F 3DZ8A 4G01B 4KFUA 3A83A 2ZR7A 3P92A 1X8LA 3R9XA 1ETSH 1R6BX 4MRRA 4VGCB 1GFIA 3FYHA 1Z6YA 3TIFA 3AP3A 1D6JA 3KL4A 1OP2A 3FHOA 4BLOA 2Y5FA 1P2IA 3EQ0H 4NONA 2QG6A 5EP3A 2AXNA 2QXIA 3SHFA 1T4VH 2JATA 3U3MA 1ODFA 4E03A 4QOSA 1GMCG 2HCBA 5BQ5A 4B2AA 1AJEA 3SU1A 3TNFA 1O33A 2H57A 1W0KA 3E70C 1CJTC 2OXRA 1A5TA 3VU9A 2QPTA 2P5SA 2K5UA 3EWAA 3CR8A 5B2ZA 1N6KA 3GY6A 3GPLA 1TE0A 4BFXA 1IAUA 4ZKNU 2CN0H 5EW1H 1ZSKA 1BTYA 3OY5U 3MI4A 4YZUA 4QL3A 2QL6A 1Q3HA 1KI8A 3MNXA 2QPAA 3LC3A 3RXRA 3AGQA 4JS0A 2WPLS 4BGDA 4CYMA 3AB3A 2A7HA 4K69A 1ANEA 2ZE8A 4PFSA 1OOKB 2ZGBH 3BTHE 1NMYA 3DM9B 1X8KA 1TMUH 2GVZC 2ILNA 2I4IA 2RGBA 3H0KA 1O2KA 2ZI4A 1OWKA 3AGPA 2A2QH 1VG1A 2IYRA 1D4PB 1W0ZU 3SO3A 2QE7D 2ZFSA 1H8DH 2D8WA 3GLHB 4IFEA 3CX8A 1K5DA 1YPMH 3L2OB 1ZJDA 4DBLC 4MKGA 1GOTA 4LZZA 5EUMA 4LOYH 2F7SA 2EFGA 3Q3XA 3A84A 1RRGA 2EU8A 4NDZA 1PQ7A 4J0QA 4P33A 5JJKA 5J5CA 1L1NA 3UANA 2W7UA 3RXHA 4DRZA 4KYIB 1J90A 1N6NA 2IYLD 3AVTA 2CHAC 1VDZA 1SGCA 3TRFA 1P2SA 1Y3YA 1CQQA 1MTNC 1WA5A 3SC3A 1P3JA 2FODA 3QJYA 2GCOA 4B3CA 1XUJA 2RDLA 1DXWA 2CL6X 5C2ZA 4V0KA 4BLQA 3SU5A 5FCKA 5FPHA 2WWXA 4XTCS 1VITH 5GJ4B 1K1OA 3C41J 2O8FB 1P2TA 3ETLA 4JT4A 3M1IA 4S2EA 6CHAC 2LPRA 1GDUA 3I32A 1G41A 2V8OA 2GAOA 1UF9A 2VGCB 2BDAA 2GT8A 3RMLH 1R0WA 2J7PD 1KSNA 3CIOA 2OAP1 1T32A 4CBOA 3A89A 2O8CA 2JDID 3SQEE 4P3YA 5KDDA 2F83A 2XC4A 3VXEH 3GEIA 1AZ8A 4LHWA 4EKDA 3I5YA 2W6IA 1NVVR 4GBMA 4OHYA 1NVWQ 1C5YB 5E4FA 3RXSA 1AN1E 1CO7E 5TV2A 4US1R 4C4PA 4JLAA 2GDEH 2WPDD 2RMKA 3MFYA 2F3CE 1LKAA 4LJ9A 2FM2A 1U99A 2Q3FA 4Q7MB 2ODPA 1RRKA 5JWRA 4TMXA 2QSYA 1W4AA 1HAGE 3ZGXA 1BMMH 2G00A 2BCJQ 3ND8A 3TVDA 2GD4B 3SJZA 1J70A 2R44A 3OAAD 3SZNA 3CPJB 1BJUA 1XMNB 1KK2A 3CZQA 3AF4A 5A2MH 1BYUA 5BN3A 4POAA 4DHEA 1TMBH 4C7OB 1P2QA 1CGJE 3IPXA 1AY6H 2QPOA 5A0FA 2SGFE 4RD6A 2WJGA 4Y0AA 2WSMA 4OS6A 2ZR9A 1U0LA 2BLQA 2QI9C 2WAYA 1BS1A 2BZAA 4I99A 1D5CA 1F5RA 1BTWA 4NIWA 1AO5A 2HLDA 1SBWA 4Q7XA 1U90A 1XEXB 1AFQB 4FMCB 2A3RA 1TPSA 5FBQB 4OHVA 3AASA 4NBSA 4G1UC 2BY8X 1XWIA 4MDFA 2PGBB 4QHYA 1GWAA 3LW8A 3VTKA 2WPJS 2J2UA 2I6QA 4DSUA 3RP2A 5IK2A 1ZLRA 3QXSA 3BGWA 1EZXC 1S0QA 1AGPA 2C99A 3BTEE 1DAHA 3MWYW 5HKKD 2ZVQX 4NTZA 4UONA 1HJ9A 2G8TA 3LXRA 1TQ6A 1W49A 4X1QU 2WWFA 3LY5A 3FVQA 3RC4A 4JMYA 3WY9A 2UUKB 3WP0A 5JJIA 1MKXH 2AD1A 1W2KH 1Z0JA 4V0MA 2FV8A 5FBLB 4XVQA 1C1NA 4QKQA 3PV4A 4IGDA 1QQ4A 4CRCA 5I25A 4TYWA 3NH6A 2IUUA 3RXUA 1HE1C 1O2NA 1DT2A 5DGJA 4KTSA 1C1PA 1V2KT 1GNPA 3BORA 3BTTE 2YWHA 2BVRH 1K21H 3B9FH 1P09A 3SJ9A 1Q3TA 2ZJZA 2FI4E 4LBYA 1SGYE 3CX6A 4AD8A 4PAOA 4X2WA 3ZZ7A 1XFAA 1T8NA 1OYWA 2PLRA 2XNSA 3MAAC 2BLWA 4HB3A 1EFCA 1E79A 1IOZA 3EZ2A 2ZAOA 2FIRH 1AE5A 3X1YA 1UK2A 4DW2U 1TNKA 1MQ6A 3K09C 3IWMA 2YWGA 1OJLA 3RHFA 1Q57A 2AERH 3ZZ4A 2AIQA 3IGFA 1DUEA 2RGEA 2BJWA 2H17A 1OW3B 1LO6A 1CGHA 1QHSA 3THXA 3GJ8A 4OK3A 3SYNA 4B74A 2NOAA 3UATA 2F9OA 1UBGA 4I8HA 2G6BA 2IYVA 2V1XA 2K1QA 1IBRA 4DIHH 2Z83A 1AMHA 1NRPH 3AKDA 2NO7A 2PZGA 4D0LB 6ESTA 1ZJ6A 5FH9A 4LZ4B 4MKIA 3V13A 1OKKA 1TPOA 4MDEA 3QKSB 2PUXB 1XMSA 2HYDA 1JBUH 2QNRA 2BB4A 1TAWA 2QENA 2F55A 1UCYE 2ZRHA 5J4LA 2NMVA 3BBPA 4ZCLA 2HALA 1LNZA 2FX6A 2OV2A 5ELXA 3B9QA 1HA3A 3S7HB 1ZRBA 2ZA5A 1M34E 2RGAA 1AUTC 4JLNA 1A2BA 4DLYA 2VVCA 1JI0A 2Z3EA 4II7A 5KNCA 1QHYA 2ZU2A 4HDOB 4B35A 1AZTA 2ZFQH 1R4AA 4K3JA 2PKAA 5AJVB 2ATVA 1J17T 2BOHB 3HWSA 5FBEA 3HR7A 1YPJH 3AF1A 2OLKA 2ZRCA 3LX8A 1KZGB 4UNQA 4C3ZA 3SU4A 1SVWA 3TK9A 5JS8A 3TUIC 2JA1A 4XSKU 4FU9A 2SGDE 1SKYE 1A3EH 2EWWA 3IDQA 4P31A 1WAYB 4RI0A 4BTUB 2ZE5A 2G5VA 4DUGA 1C1OA 1IJEA 5KO2A 3RS0A 4Z1MD 1D3DB 2VA8A 3BWDD 1XJQA 2ZAMA 3ZVLA 4RD3A 1T8TA 3K8YA 3UMFA 4QFMA 1C1TA 2CV3A 1O2ZA 3T2NA 1IY1A 2W3IA 1VMAA 1M7HA 1G3CA 1AS3A 1C5NH 1DLKB 4H9GA 3AW0A 4LK4A 3KQEA 1ANKA 3RLWH 4KFTA 3RXOA 3NWJA 1GI2A 2BMEA 2P6RA 2GAAA 1YZTA 3I72A 5FUXA 2OLJA 4DEYA 2GEVA 3B23B 1TX4B 4MUBA 1JBKA 3TKLA 5GJBA 4TYNA 4FI3C 4PAQA 1ABIH 5JBAS 4GAWA 3BTGE 1BIFA 1RRCA 1E2PA 4KODA 1PFXC 2CL7X 1SGEE 4A8JB 1D9XA 2A5AA 2CLSA 5HCIA 3QOFA 4ABFA 1LVBA 3I8SA 1UVOA 5L3VA 2TGPZ 1TYNA 2XBWA 1GP2A 1B0FA 3S1AB 4H6SB 2WJIA 4YOIA 1E96A 1UJ1A 2QM7A 3X1XA 3RDZA 2TGAA 4AURA 4WH6A 3VEQB 2A5FA 3HGPA 1KSJA 4O2RA 4LPSA 2O8TA 3H2YA 2A32A 3KTAA 1J14A 1S1MA 5EXXA 3MUFA 1TL7C 3QZQA 1BMFD 3QQ5A 3EDXB 4Q4HA 3OY6U 1Z07A 1O3YA 2ODQA 1WSSH 1UBEA 4YLUA 5HCNA 4LJ7A 4ISIH 3T1TA 3TR0A 1IHTH 2VPPA 4HB4A 4I8GA 1E9FA 2A7JA 3PUYA 1QHHA 2ANMH 3G82C 4YDHB 4PC2A 1WCV1 4V0ME 4ZCIA 2ASEA 3WNBA 4MPUA 2BY7X 3GY5A 5DE3A 1Y5AT 1G9XA 4MPVA 4KAXA 1NPMA 1NIJA 4PXAA 1GILA 3P4XA 5FPSA 3B60A 1OS8A 1D8TA 1MAYA 3ZYCA 3P20A 2VIWA 1P2VA 1GBHA 3LXXA 4CGZA 4KXFB 2GESA 4YMSA 3BERA 3B78A 2CVFA 1VKJA 1K1NA 2FXRA 1TB6H 3GCHB 3AH8A 2CCGA 4EFLA 3LX5A 1UMAH 2H5DA 3AF3A 4OS4A 3VHLB 1C5MD 2BD2A 2THFB 1P5ZB 1G7TA 3QXCA 1LHCH 1K9OE 3W94A 4M9FA 1GL0E 1FI8A 1UK4A 1UDXA 4BNRA 3WNDA 3Q77A 1L2EA 4N0EA 4JBWA 2V6IA 3ZD7A 1XMJA 2BD5A 2ZWLH 3F68H 4KLNA 4JJZA 2XTMA 1YZGA 2NU1E 3OEEA 1IAQA 1KGDA 2J95A 5JRJA 4S35A 3GCTF 2TGDA 1SLUB 4AKHA 4DDTA 2GCNA 4RD2A 1OIXA 5HYOA 2O8BB 5CE1A 1Q0UA 3WP1B 2ZYTX 5K8UA 1GI6A 2D2EA 3X1WA 2PJZA 2NU0E 1KI3A 2AGIX 4JIMA 1O2GH 2H6MA 1TQ4A 1AM4D 3JZ1B 1FUJA 1K1IA 3NCLA 1AWHB 3TW4A 4GNKA 2OD3B 1BOFA 1THRH 4MGYR 4UFFH 2WMOB 3V4RA 4IEEA 1AFEH 3A6PC 3OFNA 2UVQA 3KQNA 4OHZA 3MU1A 4M22A 3ZVBA 3E16B 1Q22A 1RRFA 2J46A 2KBFA 1A5GH 1XRJA 3T34A 3A88A 1E6CA 5FX6A 1ZNWA 4GPGA 2NTYC 3SNEA 1GBJA 1U8YA 3T12A 1UM8A 4FXGH 4NZQA 1XCMA 4LUCA 4THNH 5EE9A 3ZV9A 4IEIA 2OK5A 3T06B 5HM2A 4X2XA 2FNAA 2O8WA 2FTLE 2ZTSA 1E2DA 1OHHD 2CK3D 1FPHH 4CRBA 3EW9A 4PO8A 4WIAA 2O8LA 1Y5UT 2B0FA 5FI0B 5AFYH 2JLVA 3KF2A 3BB3A 2EI8A 1FY3A 4ACBA 3T5FH 3A36A 1N6IA 2XC5A 2Z9KA 1QRZA 1EP6A 4QHTA 4V0OA 3F8TA 2I1VB 2B7DH 3WXMA 1IQEA 4A6PA 3MH5A 4WXRA 1TBZH 2G81E 2IEZA 5EE5B 1P4SA 1VCIA 5KYKA 1NMXA 3M5NA 1YQTA 2JGNA 2ZJ2A 3ZYEA 2G83A 2Q9BA 2AHOA 3K9LA 3FANA 1K1JA 2FOBA 1AI8H 3C1KA 4B3GA 2UUYA 5TXGA 2F9LA 2PSYA 1SKQA 2BDIA 5EP4A 4URWR 1NG1A 4BPBA 4A0FA 2PV9B 5JB8S 1LB1B 2G1KA 1C2DA 3HU2A 2QT0A 5FX5A 3TITA 2DB3A 2YOHA 4LJ6A 3ZJYA 3I78A 4XSGA 1FMGA 3R0FA 4WAUA 1TNIA 1EXMA 4TLBA 4RKEA 3EA9A 1EJAA 1NKTA 3TQCA 1A5IA 3U3RA 5T3HA 3SQWA 4B6EA 5HM9A 1KSHA 1W0KD 2O5VA 2WJHA 1XUKA 1ANCA 1JJ7A 1Z8GA 1L1GA 3ZLJA 121PA 1R2QA 1ZPCA 2BHGA 1VG0B 1GRRA 3AVZA 2QGNA 2BXUH 4ABYA 4OI4A 1SVOA 5G3ZA 4O3MA 2OCVB 1UHBA 1EB2A 1DAMA 1E0AA 2J5XA 2FOAA 1G3BA 3EWSA 4DSOA 3DZDA 4SGBE 1FIWA 4EPTA 4HLUA 2GRJA 3A1SA 5EPYA 4C9BA 2D4HA 3PO1B 1C4Y2 1RGQA 2ZYVX 1O2QA 3I1FA 5CIWA 3SV6A 1SXJA 3KXLA 3LH5A 1CVWH 1J9CH 1QA7A 2HDNB 3CONA 3LRPA 5H70A 4TY6A 1ZMJA 1JEEA 4C2TA 3ADDA 2HWLB 1Z6AA 1LQDB 2TIOA 1MU8B 3GY4A 2BV3A 2IOTA 3EA0A 3CUEF 5TMPA 1P2MA 1W0YH 1GVKB 1Z8JB 4AORA 2IYXA 2EFEB 3SI7A 2REBA 3UNRA 2BHRA 1J16A 3FGNA 1KIMA 4DDVA 2QAGC 4DXAA 3KB2A 4X6MA 3RS5A 4GOJA 4YDSA 5G3YA 2N42A 4FUIA 1G3DA 2ZSDA 3U4QB 2ZNKH 2RA3A 4DVAU 3OHMA 2W0SA 1KAGA 1W36C 3DMDA 1H4WA 1VCNA 1KXDA 2ZGCA 3SFZA 4CRAA 1LHFH 1IXRC 4D0GA 1R5OA 4I1VA 4V02A 1SVSA 2AFHE 1W5TA 1GKIA 3GLIA 1L1JA 1E2HA 3TUZC 1KY2A 3E6PH 1Q20A 4H1VA 3CNOA 2WHXA 4ON9A 5DSZA 1DVRA 1Z7KA 3LQQA 2M5TA 2C78A 1GCTC 4EJSA 1RTFB 1LPZB 5JCZA 4Y76A 2ZS7A 3D49H 1CXZA 4D82A 4RSPA 1W7XH 2FESH 3SNAA 1B23P 3EPJA 4YESB 4D26A 4AB8A 1OH5A 1NN3A 4A0RA 4K46A 4LWZA 2UWOA 2VH6A 5JS7A 1YE8A 1E99A 2CE7A 2QMUA 1YLCA 4CHAC 1H65A 3SJ8A 1IONA 1UEIA 3EZFA 1O30A 1YZUA 5JBCS 2ZU3A 4XWOA 1XB2A 2B7BA 1S81A 1V2LT 4JLJA 1IQMA 3K0SA 1Y3AA 1UVPA 1SFIA 2ZSBA 1IOEA 3PEYA 1A7SA 1IN8A 4XDEA 1OV4A 4BAKB 1ANDA 1PPBH 3TLOA 1NBMA 4BFVA 3IBYA 4ABHA 3TE6A 3H84A 3LGIA 3F0TA 1T91A 1S84A 1IXSB 4X6NA 3KL6A 3SQHE 1O3AA 1E0JA 3ASZA 2QN5T 1G30B 1E37B 3M6AA 2XXAB 2V0BA 4WJG2 2JASA 1SVPA 3B9PA 1SHHB 7GCHF 4NYIQ 2QUZA 2EI7A 4Q9LA 4IOKA 1C1QA 3QN7A 2FX3A 1EATA 4B3FX 4LJ4A 1II8B 2GCHG 4MYCA 4XIGS 2WYGA 1IQHA 4DURA 4V03A 2XEXA 3K6ZA 5EP2A 3T61A 1ID5H 3BN9A 1MKWK 5EE3A 2BQ6B 3U5ZB 5FL7D 3NBFA 3FVFB 3EZ6A 2Z3CA 4C0KA 2ZANA 1KMHA 3UR6A 1HAVB 4HI3A 5B6LA 2STBE 5D3QA 2HT1A 3C14C 1IQKA 5KU1A 5K7RA 1O3GA 1P8VC 4Y71A 4KV9A 2PCLA 4KTUA 2D3WA 4CZ2A 2OBQA 1FQJA 4Y6DA 1ZCBA 3MSXA 4OK6A 4A1TA 2P95A 2FTMA 3Q76A 2CVHA 1JEDA 2EC9H 5CDFA 4FD2A 3X1DA 1KXAA 2ZQ2A 4DOQA 4B32A 2C9YA 1ESNA 1KXFA 2ZFTA 2Y6TA 2HPQH 2J0UA 2VP9A 4LYJA 1XD2A 3B13B 1LTOA 3EIHA 4LV5B 4L9WA 1M6NA 1BUIA 2VWLA 1GJ4H 4MRVA 2D2FA 1L4YA 1C2EA 4MKFA 3FKQA 5IHPA 3QPVA 4RJLA 3U8TH 5F9HA 1TNHA 2NQ2C 2VSFA 2O8DB 5DGXA 2QAGB 3SN6A 2BKUA 5AJWA 1MKYA 1Q1ZA 3VB5A 5L30H 4AYWA 4GMDA 3BEFB 1NSFA 2W7SA 4HZHA 1GJDB 2ZVPX 1JIMA 3WHKA 1JQJC 3LH3A 1ZTKA 3M61U 1FQ3A 4AFQA 5DLQC 3EAJA 1DTSA 1N5LA 2B6HA 3A37A 1GNQA 1NKSA 4GCHF 1BMAA 3SHCH 1HXEH 2WV9A 5CHAC 5CITA 1T5IA 3RXLA 1K1PA 5FL3A 2A5IA 2C95A 4ZHMU 4PPGA 1SXJE 5E3HA 3QLPH 5KDLA 3VX4A 1YCPM 4JK6A 4N3NA 1EWQA 1DG3A 1GVLA 2XSZA 2P3UB 1Y63A 1GKYA 1C9TA 4G3XA 4GRAA 4HUQB 1GBBA 1GCTB 3BXZA 3VB6A 1HQCA 2AFIE 4LC0A 3A1UA 1G8GA 1O3HA 1KJYA 3IO5A 1NJGA 2FOLA 5L8VA 2R65A 1XDBA 4L4UA 3TGPA 1MZDA 1XCGB 4CHAB 2BD3A 4HZUA 3BEIB 1VIAA 2ZS8A 1LPKB 3RWMB 1GIAA 2QXHA 4B34A 1V2WT 4MGKR 1P3EA 1FMLA 4LXBH 1BTHH 5JCPA 3F3YA 2A7CA 1ZVQA 4KGAA 4R2IA 1OWIA 1TU3A 1AKSB 4TYDA 3HK3B 1UKZA 5JWOA 1QHRB 4QBGB 1XCPA 2SGAA 1S85A 3AKEA 3GJ7A 3GLIE 3TJNA 2W2XA 1P72A 4AKIA 1XPRA 4M53A 4TYQA 4Q4HB 2WSSA 2HLCA 1G3IA 1DO2A 1WUNH 2GWHA 2BDBA 4BEBA 1N8OC 4FMDF 2F9VA 4RD4A 1G7SA 5EZ6B 1CR0A 3ADCA 1WB9A 5DIFA 4GFDA 2VIQA 4K1EA 3OF5A 1LKBA 3HYTA 1T9HA 3ND9A 3E1XB 1E1QA 4I1OA 2W3KA 1SVIA 4ZIRA 2TMKA 4E09A 5AJYA 1MAXA 4B2BA 4PSVA 2JJ8A 2EYUA 3THYB 2ZTZA 2P3FH 1NSTA 3MG9A 4BAQB 3LPRA 4D4MA 2JJ1D 2GVDC 3B2EA 1Z29A 4I8JA 4QRHA 5EPNA 4KFSA 3L0SA 1TGBA 3VR5A 4W9MC 3MLEA 1O2OA 1W36D 5DKMA 4A1FA 2XBVA 4IW4E 2ZI5A 4Q7YA 2FO9A 4CT5A 2X1VA 2R62A 1MZAA 1Z8FA 2Y80A 2Y8EA 2WMNB 4PQRA 3JVUA 1GJBB 1NBME 1XTKA 1XUIA 4OYHA 5FOTA 2WPKS 4HLUC 3HATH 2CLCX 3TK1A 1A7JA 2PSXA 1BTXA 2ZRMA 1SXJC 3UOPA 1M7GA 1O3JA 2R6CA 5D3MB 1ZC3A 4LOAA 1TX6A 1G3UA 4AG2A 2DWOA 5FTJA 2QP3A 1IJFA 3RANA 1U81A 1FY4A 7ESTE 1D2NA 1E2FA 2ZI3A 4UFEH 1L2TA 1MMJN 5DI3B 3RUOA 5EQRA 2WPMS 3OEHA 4L5BA 3GJ3A 1FXYA 2ANYA 2BYAX 3FTQA 1C1WH 1GJAB 1HIAA 2B9LA 2R3UA 4M9XA 6GCHF 1US8A 3KQDA 1CULC 1NU9A 5CHAB 1O3IA 1ZM4A 4RZ3A 3KJGA 3SUEA 3ZZ6A 1E2KA 4R7ZA 2HPPH 2ZSFA 3DL0A 2JLSA 2AXPA 5G41A 4UDWH 5LGOA 1ELDE 3ADBA 2O0KA 5CDFE 1YPGH 4FVDA 2OBMA 4PHHA 1SGFA 1UCYK 1O32A 1WP9A 4JSTA 1DAIA 1OIWA 1HRTH 2P3SA 1U8ZA 2FOHA 3F9GA 4FUFA 4NH0A 4C0LA 2NIPA 3EX7C 1RJXB 3BC1A 1YZQA 2BVNA 1VCPA 2Q1JA 6GCHG 3CKLA 5J4QA 2ZPRA 4JLBA 1QG4A 1Z08A 4GSYA 1O3FA 1QVRA 2JLUA 1FONA 4LRWA 4Q03A 2QY9A 4RVCA 1U2RA 3GISB 3W6OA 2HEIA 2I6SA 1T8LA 3O8CA 3HGNA 3CX7A 3CWZA 1T3SA 3S0NA 1XVOA 4A6XA 1AS0A 3KQCA 2IJD1 3EA5A 3A4LA 4ZKSU 3IEVA 2VH0A 2ZE6A 1ZM2A 1TNGA 2BVSH 3A4NA 1Y3WA 1GJ7B 2C8YB 5C1BA 4NU0A 2AEIH 4H6TA 1KSFX 2IXEA 1GJCB 3A85A 2PT7A 4Q7ZA 3M4YA 1V2MT 3SYKA 4MLFB 2J7PA 5BYKA 1ELEE 5B64A 2L0XA 1AK2A 3GLFB 1YJ5A 2JDIA 4JZKA 1F0SA 4NYIR 1V2TT 3OEED 2QBYB 3GMTA 1C1SA 2ZJYA 4M1YA 4HAYA 1A2CH 3ZZAA 3VPKA 1LF5A 2OC0A 3A1WA 2ZHQH 2W83A 3RU4T 1C5LH 2W6JD 3VB3A 2FJUA 2WPDA 2ZDMA 3HJNA 4R9UC 5EW2H 1C9KA 3N2IA 1E1RD 3CBQA 1BDAA 1NY22 4E06H 3GY3A 3OX7U 1EFRA 1OYYA 1KO4A 3RXCA 2R6GA 3D6TB 2H9HA 3FFGA 2SHKA 2F3RA 2PKSC 1E9EA 4F4JA 1VG9B 1E0KA 4Q9KA 3OFND 1D3QB 5JYIA 4JBXA 2FZLA 4LJAA 2ODEA 3OAAA 3EA7A 2FSGA 4PPFA 4EQ6B 3IIJA 2QA5A 2BX4A 4YTAA 4TQUS 1QQUA 2ULLA 2Z9GA 1NRNH 5KSPA 4AKEA 4F49A 5DN6D 3GLHA 3S69A 2GDDA 1XNJA 3BIVH 3WRXC 1E0FD 2YC2C 3UWIA 4TPIZ 4WOPA 1AU8A 1W7GH 4IOMA 4DCNA 4JYCA 3PWBA 2IPHA 3PEUA 1KSGA 1O3OA 3BH0A 1E9AA 5F3WB 3H09A 4TQAA 4O3TA 2ZEJA 1PPGE 2SGPE 1K2I1 4LC1A 2OC1A 3A8BA 1V2NT 4A0HA 3MWKA 2H1LA 2BOKA 3FDIA 5JZVA 2G4TA 4JL5A 1TRYA 5GJWC 2ONJA 2IYZA 3W9YA 4ZI3A 4O97A 1ELAA 1GNRA 2FZ4A 3THWB 1G2MA 5FTKA 3CH4B 1GPZA 1OXXK 2WWGA 3LWNA 2QTVB 4OQMA 3BG4B 4QHSA 3FE2A 3RU4D 2O8FA 3KFXA 3EIEA 1ESBA 5HKKA 3UQOA 1CRQA 2XCNA 3PEVA 2OM2A 3LLMA 1NC6A 1G36A 1GI5A 3TAUA 5CK4A 2V6NA 4DLSA 5DJ7A 5LB2A 1XEFA 1FPCH 1KJWA 2O8EB 4UE7H 3L82B 1A5HA 1UK3A 1XX9A 2BY6X 1P01A 1RVDA 3BOSA 2VB0A 1WXRA 4HAZA 2DFLA 1F5NA 1EZSC 1YP9A 2C98A 3BD9A 3BB1A 2WIAA 3IHWA 1BB0B 3WNCA 3TAHA 2X2EA 1F92A 4GHQA 4D7GA 2WWYA 6LPRA 2JLYA 4IRUB 1FX0B 1SG8B 3TK6A 4M7GA 1SLXB 1KDPA 2CGAA 3MYWA 2V9PA 1C2JA 3U7HB 1QZXA 5EODA 3BAFA 3RXMA 1E36B 2ZEBA 4D80A 1QF9A 4GPTA 2ZDAH 1ZD1A 1E38B 5L2ZH 4TZ0A 1GHAF 5TCCA 1GL6A 5JSZB 1P02A 4PR0A 1GBIA 4LHVA 4YC7A 1MTUA 1EAUA 3UXMA 2FPKA 4XSHA 3E8LA 3P6ZB 1YPLH 2WZQA 1QTFA 1SGRE 3O8BA 5JBTA 1T4UH 1F2TB 3S7KB 4A1VA 4UEHH 3ZZ8A 2CNWA 2ZM5A
chains in the Genus database with same CATH superfamily
4Q9NA 1BCSA 4LK2A 1GT6A 3HCBA 1R0LA 3OZIA 1FJSA 3NHJA 2ZG6A 4Z9AA 1T6ZA 1K4YA 1WHSB 3VH3A 3V46A 1D0SA 3PTNA 1PZNA 4KUGA 1G7RA 2YWEA 1HE8B 2HWYA 3Q8WA 4NFEA 4KFRA 2V1UA 1FBNA 4HFRA 1OT3A 2NZYA 3PC7A 3HZRA 5F1KA 1FSGA 3WWYA 2ESTE 1U0FA 2ZP0H 4V3CA 4OHFA 3NXPA 3ABZA 5CFNA 2VDLB 1FB5A 3A1VA 1YPKH 2GARA 3EXAA 2GZSA 1XEXA 3C5HA 1KPIA 4WNAA 1TQ0B 3AEYA 4FT4A 2FZ5A 3COJA 1TF7A 1G20B 2WOOA 1XTJA 3WHLA 2BE7A 3BXGA 4JJ4A 1X94A 5C0TA 1ESTA 5CVTA 4FUEA 4QUAA 4AN7A 3VNVA 3L84A 3EVZA 3AIKA 4YTEA 4D0SA 1JHOA 1OJ7A 2YFKA 5H4HA 5CYPA 3JVEA 4ESTE 4WXMA 3DVQX 1SUPA 1J1ZA 3DFUA 1QZZA 3C45A 2CWDA 5CVUA 1AQ7A 1YR3A 2Z98A 4Y6RA 5K8TA 2QKYA 2PH5A 4DWJA 1GCDA 2XZOA 1PQ4A 4ZGWA 4W6ZA 3QUTA 3UBTA 1U0JA 1ZNYA 2XXLA 4RIGA 3UHPA 3CW8X 4DMRA 2AMDA 3ZBTA 2WKPA 1ZEJA 1B3BA 1FNNA 4ZI2A 1KYVA 1HV7A 1KZHA 3L06A 1JG7A 3Q9SA 1Q50A 2WYOA 3OZFA 4Q4AB 2WD7B 3PG5A 2ECKA 1Z2AA 4Z4QA 1O31A 4Q7KA 1W93A 5JS1A 3Q41A 2H9YA 5F8ZA 2GEUA 4LY0A 3PD1A 3TSCA 2R8BA 1SIUA 1YZ3A 1NLFA 2K8IA 5E2IA 5GV8A 5DPMA 1ZUIA 3CNNA 2WUFA 4E05H 2FJPA 2VU8E 3MWDB 1UBMS 3PA8A 3W2IA 3HY4A 1Z83A 3KR0A 3CLSD 3DXZA 1NOJA 1R0SA 1KYQA 2O5CA 3PQEA 3FHLA 1M2EA 4I5GA 1KYIA 3LX6A 4DNXA 1KQFA 3DE0X 2KSQA 4OGXA 4E70A 4EGJA 1JEJA 5BOSB 2IDMA 1O3EA 2JEZA 1AQ6A 1B8PA 4IDCA 1PV4A 1JPNA 1Q6YA 4KQWA 1Q12A 1P9NA 4IZOA 3LUDA 1PQ8A 3TZLA 3TZ6A 3P4UA 1OPRA 1AWFH 2VJYA 4JP8A 5CNKA 2GYUA 4YVFA 3MNSA 2OLGA 4QUGA 4FGLA 3STYA 3SXPA 3MINA 1HSOA 2YMLA 4ISNA 2C8WB 2OE2A 4TS1A 3BN3A 4HTCH 4J75A 3KDPA 3HB0A 1PBTA 3C6MA 4UAJA 5EIEA 1Y0BA 1YDGA 3Q7IA 1FUYB 3F2HA 2M1XA 5K3EA 2JF0A 1YF4A 4I66A 2WDZA 1AKVA 3BZBA 3WC4A 4NULA 4BO2A 1UJ2A 2FOGA 3HK6B 3BWBA 2ZCHP 1C2TA 2PZLA 2M6LA 2QZPA 3HNPA 2XBMA 1DARA 1GADO 1ZD8A 2JBWA 4JI0B 1UXHA 1BMLA 3EC7A 4UMEA 4ITVA 3MH7A 1KNQA 3BSWA 5I3CA 3GLGB 4F60A 3GEPA 1K08A 4HSEA 2RG1A 5H9VA 1CZRA 1ZU5A 1NL3A 5HQTA 4LRUA 1Q77A 2I2AA 3BF7A 1AUJA 1S7GA 4UULA 3U1JB 1LY1A 1SPJA 3QF4B 4WMLA 1GPYA 1P2UA 4B4UA 3I9FA 4HDMB 5J2UB 1E3MA 3P0JA 4AMZA 2C5GA 3FP8E 4EYSA 3D8BA 1M1YB 3CZCA 4P3OA 4NCIA 2VG8A 4PEVA 4TN5A 3PR3A 5CB4F 4FYXA 2RI6A 4IDFA 3WLNA 3MU0A 4QOIA 1DFGA 1SNYA 1ZO8A 2P8OB 3LLUA 4B3XA 3GX1A 1YOVA 1AK1A 2XTZA 2WYUA 3P1JA 3DBLB 1YHYA 2XNHA 2G9RA 2CV0A 4Q00A 1NPYA 4CMAA 4OXXA