3O8VA

Crystal structure of the tudor domains from fxr1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
102
Chain Sequence
LTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPSEGDEVEVYSRPCGWWLAKVRMMKGEFYVIEYYNEIVTFERLRPVNQNKTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of the Tandem Tudor Domains of Fragile X Mental Retardation Related Proteins FXR1 and FXR2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Fragile X mental retardation syndrome-related protein 1
total genus 22
structure length 102
sequence length 119
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3o8vA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3o8vA01
3FC3A 4PLLA 3L2QA 3EAEA 4A4HA 5C6SA 3OS0A 1SSFA 4BE0A 2L8DA 2X4WA 2LTOA 2MWPA 2XK0A 4C5GA 2GFAA 3OYDA 1MHNA 5KCHA 3M9QA 2R5AA 4QW2A 5J39A 4BDYA 1WGSA 4LD6A 3MP8A 2M16A 3L2RA 4BE2A 5FRNA 4E7JA 3OS1A 3C4SA 2X4YA 4GY5A 4L59A 3OYIA 2JTFA 2BUDA 2PQWA 2P0KA 2RI2A 3QKJA 3OYKA 4N4GA 3UT1A 3H6ZA 5CIUA 3DLMA 2RJCA 4IUUA 4PLIA 5IN1A 4C5EA 4IUPA 4EDUA 3OYHA 3LYIA 3PMTA 4HCZA 2HQEA 3NTHA 3OYNA 3OYLA 2EQKA 5D6XA 2RHUA 1XNIA 2EQMA 4PL6A 2QQSA 3QIIA 4RG2A 3ZEHA 3P8HA 3FEOA 4E7KA 5FROA 3SD4A 1WJRA 3LGFA 3S6WA 2LVMA 3LGLA 4E7HA 4FL6A 4QQDA 4A4GA 4IUQA 5KE2A 3OYFA 1N27A 4A4FA 3LX7A 3KUFA 5D6WA 5IAYA 3L2UA 2RHZA 5M9OA 2RHYA 1OYXA 2F5KA 4II1A 3ME9A 1WJSA 2D9TA 3F70A 3OMCA 2JZ2A 2E5QA 4Q5WA 2EFIA 3OQ5A 5J26A 2MWOA 2EQUA 2RHIA 2RI3A 4A4EA 4QQ6A 3QJ6A 3OYAA 2YRVA 1OZ3A 3PNWC 2EQJA 4C5HA 3NTKA 3NTIA 4UC4A 3E9GA 3FLGA 2CKKA 5D6YA 2WACA 2RJEA 4FU6A 5C0MA 3L2WA 4BACA 1H3ZA 3UWNA 3E9FA 2DAQA 4X34A 3OYBA 2BIVA 2XDPA 3LLRA 5FRMA 3META 2DIQA 3MEUA 3Q1JA 2M1HA 4BD3A 2K3XA 2RJFA 3PMIA 3DB4A 2RI5A 3MEAA 3S3MA 2GF7A 2IG0A 2FHDA 3MP1A 4IKFA 3O8VA 4Z02A 4IUVA 4NS5A 4OVAA 4E7IA 2HQXA 3OMGA 4QQGA 5KE3A 4IUTA 3DB3A 2O4XB 5KCOA 4C5IA 2K3YA 2EKOA 2DIGA 2VYTA 2R57A 2LCCA 2G3RA 2L89A 2L3RA 1OI1A 3PFSA 2R58A 3BDLA 3OS2A 2GFUA 1G5VA 3S3OA 3OB9A 3P8DA 3OYCA 2RO0A 3ASKA 4IURA 2LDMA 3GOXA 4E7LA 2O4XA 4B9XA 3CEYA 1RI0A 5KH6A 3L42A 3MO8A 2LRQA 4CRIA 3OYEA 3OY9A 2QQRA 2RJDA 4B9WA 2BKDN 4BDZA 3MP6A 3QBYA 4N4IA 2NLUA 3H8ZA 1OZ2A 4BE1A 2B8AA 2X35A 3MEWA 1KHCA 4ZTFA 2M0OA 2RHXA 3MEVA 3FDRA 3OYMA 3OYJA 4QVZA 3L2VA 2E6NA 2X4XA 3OYGA 4ZTJA 3OA6A 1WJQA 4N4HA 2R5MA 3S3NA 3LH0A
chains in the Genus database with same CATH superfamily
3CXCA 2KK4A 2DNUA 5DM7R 5GANd 2M51A 2HBPA 3JCMV 2M16A 4DQ2A 4DBRA 2Y4XA 1RAHB 5CIUA 2EYXA 1PCXA 2KYBA 2DD5A 3G6EA 2DKGA 5KYXB 1E6HA 2XHCA 3EGUA 2MIOA 2DA9A 3D7SB 3GIBA 3P8HA 2YDLA 3CCJA 2E1HA 1HXDA 4OMQA 2E3HA 1QKWA 2DL8A 1UB4A 2EYWA 2LP5A 3L2UA 5LJ5h 3CCMQ 3REAB 4FT2A 2EQUA 1TXQA 2E5KA 1BI2A 2CP6A 2EQIA 4KGVB 2JTMA 4J6XA 3RNJA 2A08A 2F1LA 3V7RA 2H3JA 3CBOA 3CCLA 1PSFA 1YCYA 2V8JA 3JCMQ 3CCET 2MYSA 4XU2A 2DXCA 2HZYA 4HKEA 1VQMQ 3S3MA 1J3TA 4Z02A 2KT8A 1VQ6Q 1T0JA 3M4GA 2XICA 3CD6A 2EGAA 2VGNA 3CMAT 4C8QE 2WSEE 3GOXA 2CUDA 4C8QC 2W0ZA 1RLPC 3G71A 2HD0A 4M7AD 3M4YA 2EPDA 1YHQT 2L3QA 2F2XA 3SWNB 2X4XA 1XQHA 3CC4A 2DL3A 4M7DB 2LZ6B 3SDZA 3VV0A 1OOTA 4M77B 1VYUA 1D0ZA 3CPWP 2HQHA 1WGSA 2NUTA 4B6MA 1AHJB 4BE2A 1KQSS 4PJLA 1YCSB 1W2BA 2LQ8A 2GTOA 3LH5A 4IUPA 2RQVA 2K79A 4RG2A 3JCMd 3QIIA 1M1KU 3VUZA 4BI4A 2DJQA 5FROA 1WJRA 5GAMf 1WI7A 4J83A 3LGLA 2K2VA 3JSCA 3PT9A 4M77E 3MJXA 4M77C 1OU8A 4E7SA 4QVDA 1ZA2B 2GTJA 3LX7A 2FG0A 1K73U 3A8GB 1UGQB 1WA7A 2JNGA 1QVGS 4JRKA 1NYGA 4A4KA 2COZA 5GMKh 1UHCA 3G6ET 4CI0C 1O9SA 4C0GA 3RBBB 5FW9A 1IXDA 1PC0A 2KVQG 3Q1JA 1N9SA 3PIPA 1KC8U 1PRMC 1LPLA 2K3XA 1SG5A 2CSIA 2O31A 1NE8A 2NUPB 4NS5A 2MI6A 5GAOn 1YJ9T 4KGXB 3DB3A 4AFZC 1MUZA 5KCOA 4PJOD 2GCXA 3CC2A 3EHQA 2DJZA 4OMNA 3QG1A 2LCCA 1GCPA 2DXTA 2L3RA 3CCLT 1UEBA 3A98A 5KH6A 1UGRB 2LRQA 2RQRA 4F04B 8ATCB 3TVTA 1KIKA 3M54A 2J6FA 2JS2A 2L3PA 1WLPB 5FLXE 1D0XA 2KEAA 4XTUA 5HK0A 3HRUA 1MHNA 1CSKA 2FEIA 2KNBB 2DEUA 2QQAA 5GAOm 1I0CA 3OS1A 4KULA 2HKQB 4C92D 5LJ3h 3QKJA 2B86A 3JCMc 1UFFA 1VQOA 1T3SA 2QTVA 1PD1A 2LT1A 2IIMA 2RJCA 5LJ3d 2HL5C 3OYHA 1YITQ 1YJWQ 1IHVA 2LX7A 2QQSA 3ZEHA 3M56A 3HP9A 4M7AA 3CD6Q 2YHTA 3NMZC 2EJ9A 3PE0A 4OP0A 3U23A 5CKFA 3OYFA 4R0KA 1N27A 1AWWA 1N8RC 3EFOB 5HY6A 1QP3A 2KE9A 4C92G 1K0XA 1M90R 3H0HA 4E6RA 4BI8B 2CYZB 1WIEA 2LJ1A 4Y91A 2M9UA 3L2WA 4BACA 4M7DE 3CCUA 4MZPA 3OYBA 4J7IA 3I56Q 1AWOA 1S1NA 1V29B 5GMKi 5DLQE 2D6FA 1JXOA 1W2BS 4M77F 1IGQA 1KSWA 1K9MR 1KC8R 5HK3A 1R0BG 2ZPFB 2M02A 4NL3A 1AEYA 2QA4Q 3G4SA 1I4K1 4LDYA 1OPKA 2ZAEA 4LN2A 1BKBA 2CDTA 4LUDA 2QAZA 1CKAA 5KYYB 3CEYA 5DLOA 2K7AA 1K8AU 1G3TA 2RJDA 2RB6A 1F1BB 4M77G 1KHCA 1YJNQ 3VS6A 4X9CA 2J05A 2SRCA 1WHMA 1TS9A 1TU0B 2KBTA 2GGRA 4PLLA 2VXFA 3EAEA 4KH1B 1NPPA 3PGGA 2E6ZA 1BYMA 2DILA 3OS5A 2DERA 1Y7XA 2ZGWA 4PFZA 2P0PA 2DZ9A 2NYSA 4CC2A 2LMJA 4EDUA 3HHTB 1WFWA 4KH0B 3NGPA 2EIFA 1YITA 3VYGA 4AFUC 3JCMX 3SD4A 2LCSA 1YBYA 2K4YA 4M78B 1C6VX 3X20B 1HSQA 3CCVT 4FL6A 2LC4A 2CT4A 2BZXA 3UA6A 1Z9ZA 3OW2S 3ME9A 1WJSA 3R6OA 4OMPA 2XD0A 2QDLA 1VQOT 2RNAA 2EQJA 1LNXA 2CZ0B 1H641 1SRMA 1G83A 3QJYA 3H9NA 4R56A 2XDPA 4C8QB 4M78C 1V1CA 4BY6B 4M7AG 1M1KC 3PMIA 1RAAB 2O01E 2DL7A 1WZOA 4IUVA 3M58A 1ZSZB 3RDVA 1TOVA 3OB9A 3EGDB 2RO0A 3CCRA 4AG2C 5HKCA 3PIOA 3JB9D 4B9XA 1OPLA 2EVRA 2L0AA 1VQ4Q 3WVEB 4B9WA 3N5BB 3AT1B 4ME7A 4M4ZA 4M75C 2J7IA 2XI9A 2G6FX 2KYMA 4C92B 1MGQA 4ZTFA 1H3HA 4WCIA 2D0QB 2ZZDA 3BW1A 1VQMT 4FYWB 4C8QD 1H3ZA 5KYWA 4C8QA 1ZSZC 3BY7A 1Y0MA 4C5GA 2GFAA 3M9QA 1IRXA 3HRTA 4XAXB 3UA7A 5L23A 1KQ2A 2DXBA 1AT1B 4XU0A 1VA7A 3UT1A 1UG1A 2F5TX 3KFVA 1N9RA 1UJ0A 4AMCA 1MNEA 1WYXA 2YUPA 4E7KA 2DLPA 2NUTB 2WSFE 3LGFA 4WF2A 1SSHA 4PJOA 1GCQA 3VJPA 4J5YA 4C92A 5IAYA 3OW2A 1VQ7A 4II1A 2RD1A 3NFCA 5FU6C 3EFRA 4M78D 1NPRA 2EJFA 2EAYA 2EFIA 2RI3A 5FU7C 2DTHA 2DTOA 2KY9A 4ZNXA 3L1AA 2CKKA 2V26A 5C0MA 4FU6A 3CXCP 2FL7A 3EG1A 1M3BA 2P0QA 1ZUKA 2YRDA 4PJMA 2YWWA 1WQ7A 2DIQA 2DMOA 5KYUB 1TWBA 2F2VA 4RTYA 5AYFA 1Q86U 5GAOr 1VOMA 4IKFA 1K9MC 3OMGA 3CMAQ 4MZTA 5FU6B 4VUBA 3H0FA 2DK3A 1D0YA 2RQUA 1OI1A 4AT1B 2K5IA 1N5ZA 3SB2A 3ASKA 4E7LA 1WHKA 1QCFA 1K8AR 3HL8A 1I81A 2CH4A 1VQPQ 3WVDB 4M78F 1V76A 4BE1A 1Q82U 2BTTA 3VKIA 2E4HA 1FWZA 3FDRA 4E2FB 5CCAA 3L2RA 1G3SA 2DVEA 4M78A 1BIBA 3L2QA 2VUBA 3GLXA 2EYQA 3V8JA 3OYDA 4XQ3A 3M0TA 1IB8A 1K1ZA 2LX9A 5FRNA 1ZQ1A 3J81E 2E12A 2DL4A 1JU5C 1QMCA 4L59A 3SWNA 1U3OA 2BUDA 4N4GA 4GBQA 4IUUA 2F2WA 4HCZA 2Z0WA 2DTIA 2KAFA 1XNIA 3G4SQ 2V1RA 3INZA 1G3YA 3QWYA 2FO0A 4PK4A 1RACB 2OAUA 3QDRB 3E19A 4M7DG 4A4GA 5KE2A 1PD0A 5I21A 2QEXA 2AKKA 2F5KA 3VS0A 4Q5WA 1QP2A 1M9SA 1M90C 1HD3A 2CH4W 2CT3A 4UC4A 2MPXC 2JTEA 4M7AE 5CKEA 2CP5A 1W4SA 4A53A 2JMCA 2M1HA 4J8OA 1OEBA 5GAMd 2KROA 3MEAA 5GAN6 4M75A 3JB9I 3CBMA 4MMKA 3O8VA 1PNJA 4JRPA 2DRMA 2DX1A 2JN0A 2ROLA 4C5IA 2ESWA 2DIGA 4RCBA 1PHTA 2DBKA 3RESA 5LJ5d 2CP7A 2OTJA 1G5VA 4LNPA 2LDMA 2O4XA 1KD1U 1Q81C 2D0NA 1UGPB 4M75D 2FPEA 4D6WA 4C0DB 2FB7A 4HCKA 3CCUT 4O5VA 3SEMA 1QKXA 1ZBXA 4JZ3A 1B3QA 3UF4A 1ZHIA 1OULA 4EMKB 3EFSA 3M0RA 4LUEA 5CO7A 1BK2A 4N4HA 2R5MA 3M59A 1YWPA 2C0TA 1GCQC 2CGHA 1OX8A 2A36A 2R5AA 3CC4Q 1NJIC 1AWXA 2PVDB 1Q86C 2KXDA 3G4ST 1M3CA 2JTFA 2BZYA 2PVOB 4HVUA 3TSWA 1AZEA 1M1GA 3H6ZA 3A8LB 4RTWA 2DZCA 2X4JA 2DETA 4PL6A 4HVWA 4PJOE 4KT0E 1LCKA 1GFCA 1WHHA 3E2UA 2EW3A 2LNHB 3CCQA 1X2KA 4LD9K 1NLPC 1NEGA 4EMKA 4PJNA 3KXTA 3M0SA 3M0PA 2QQ9A 4DEYA 2XDBA 3I56T 3QZ9B 1AD5A 4C5HA 2DD4A 1JEGA 1B34B 5LJ3f 3NTIA 1VQKA 2WACA 1K73R 3RKXA 1D1CA 1M2OA 2YLBA 3MEUA 4J9EA 5GAN4 2JW4A 5GAOp 3DB4A 3CCMA 4ATOA 1IHWA 2RA2A 4OVAA 3JCMW 4XTZA 5GAOl 3BE3A 1UHFA 2RH2A 1UGSB 3NPFA 1MNDA 4M7AF 3CCVA 2XMFA 2A0FB 4F14A 4BB7A 4JJCA 2A7YA 1X2QA 4CRIA 3FB9A 5CKHA 4DOWA 2NLUA 5L8RE 1NYFA 2CP3A 3CCEQ 4ANJA 5GAMg 2ZPHB 3E1SA 3GBQA 5IHNA 3EGDA 3OA6A 4DOVA 3LH0A 4OB3B 1GBRA 5CAIA 1VQ8A 2X4WA 2XK0A 4Z8AA 4BI3A 5GMKl 1O75A 2ZPBB 2Y4YA 1YIJT 4ZGEB 1X01A 4WTOB 4OMLA 3JAME 1VQ5Q 2MK5A 2FRWA 4OB1B 5IN1A 4C5EA 5GAN3 2C0OA 3V8LA 4EPCA 3CCVQ 1VQ4T 5GANg 2RQWA 1KJWA 1VQ9Q 3FEOA 4BUGA 3CMAA 1I1JA 3CBPA 4XTVA 4AFSC 3VU3C 1EX4A 2VB6A 4A4FA 2RHZA 1OYXA 3THKA 2PZ1A 2DRKA 1Q82C 4PJOB 3V7SA 3FLGA 2LNVA 2EBPA 1VIEA 5LJ3j 4QT7A 3UWNA 4N0AC 2J6KA 2A28A 1R77A 1GRIA 2BE9B 4XTXA 3JB9G 5GJWB 2GNCA 2NUZA 1ABQA 1I07A 4JLIA 4FW1A 4RTZA 2GF7A 1ZLMA 2OTJQ 1TH7A 3MP1A 1LJOA 2X9HA 5ECAA 5IH2A 2OX7A 2IPOB 1IREB 1ABOA 2RPNA 1PWTA 2V8IA 3OSSC 4PJOC 3ZBDA 3PVLA 4DA4A 1VQ9A 2FYKA 5A0LA 3CMEQ 3FJPA 5CKBA 3QXEB 2HKNA 4FT4A 5LJ5f 1RI0A 2HL3A 4QKUA 1BCOA 1G2BA 2KT1A 1JJ2A 4V2SA 2BKDN 4BDZA 1U8RA 2OTLQ 4M75E 2M0OA 3G1JA 3CCQQ 4ZTJA 2JVVA 1HK9A 4E7ZA 3O5ZA 5C6SA 4M7AC 1SSFA 3HFOA 2MWPA 2VGMA 1N6AA 4FM4B 4QW2A 4JRIA 1M30A 3C4SA 4ORZA 3X28B 4AFQC 1SEMA 2KXCA 4PLIA 4ELYC 1GXIE 1UUEA 2FZGB 2K3BA 2EQMA 2HMAA 2HSEB 1FX7A 3CCJT 3EG0A 3JB9F 3WXMB 1BBZA 1VQ5A 5GMKm 4FSXA 4JS5A 1G8XA 1SRLA 3URGA 2VASA 4FIBA 2ZPGB 3X25B 4HXJA 1MV3A 2JZ2A 3AHUA 3A8MB 3R6NA 3CCSA 4RTUA 4QQ6A 5GAMe 1Q95G 2YRVA 1OZ3A 5D6YA 3CCRQ 2OTJT 2FVUA 2DO3A 1KFZA 1UE9A 2DXUA 3VS3A 3H41A 2AT1B 4F7UE 2E41A 5IXFA 2CZ6B 1ACMB 1WXUA 2MMPA 5GMKe 2FPDA 2JMAA 4J9IA 4OMOA 4FW2A 4E7IA 2HQXA 3CPWA 2O4XB 3TCJA 2KRSA 2LJ3A 1UJYA 4FYYB 2QEXT 3OYCA 4IURA 3QO3A 2XDDA 2NWMA 1Q7YR 2IVWA 2RQTA 4L6V5 2QXFA 3EH1A 3PVQA 2I2LA 3DLLA 1PSEA 3CPWS 3RIRA 3GPLA 3V8KA 3HRSA 1YFNA 1YHQA 4E47A 3G7ZA 4FYVB 3X26B 3S3NA 1JO8A 4FCYA 2ROTA 1H8KA 4Y28E 2PUOB 4C0ZA 4HA8A 4PJOF 1ZSZA 1WHGA 1M1FA 2YUQA 2O88A 1SPKA 2YUOA 2JS0A 5LJ3e 2QQBA 3CCJQ 4Z88A 2E10A 4PKCC 3LYIA 5A2QE 4ESRA 4KUIA 1U06A 4OGCA 3UDCA 3CMEA 4M77A 4RCCA 2DVJA 4N0AA 1AWJA 1C0MA 4HVVA 3JCMf 1FMWA 3LW5E 5KYWB 2XKOC 1SHFA 2KRMA 4ELZC 4CC4B 1DJ7B 5GJVB 1TSFA 2RHIA 3BDUA 3UPUA 2MOXA 1WHJA 3G71Q 4LDUA 1M2VB 1T3LA 2RJEA 2VVKA 2H3EB 1SKUB 2CS7A 2ED1A 2KSSA 6AT1B 2C0IA 2K57A 2WSCE 3META 3RMSA 4MDXA 5J3BA 1HJDA 4BD3A 4HT8A 3NHNA 1VQLT 3VRYA 1VQNT 2YXYA 1RL2A 1QVPA 4M7DD 2QEXQ 1YI2Q 3DKMA 1YJ9A 2JM8A 1G3WA 2VYTA 3HTRA 1VUBA 2O2OA 1VQOQ 4C0FA 3CCUQ 3EG9B 1N8RR 1D1AA 4F7UG 1W1FA 4PFPA 3REBB 2JM9A 3OY9A 2NUPA 3VS5A 1P92A 2LQNA 3SWNC 2DM1A 1NZ9A 2B8AA 1XJWB 5KYUA 2RHXA 2QI2A 4DEXA 2E70A 3OYGA 3FIFA 1PRLC 5DY9A 1QVGP 4FYXB 3FC3A 4CC3A 1WDXA 3OS0A 2D8JA 8AT1B 2LTOA 2QK0A 3CCMT 2O9SA 2HEQA 2ZPIB 4GLMA 1YJNA 4LDVA 4ZGJB 3CCEA 1NEBA 1K73C 2X4YA 4IIMA 1OQKA 2RI2A 1CKBA 3DLMA 2OAWA 4Z89A 4J9DA 4NL2A 2E64A 5CVIA 5D6XA 2RHUA 2HNIA 2D8HA 1M2VA 4QVCA 4CC7A 3P8BB 3M0QA 2DYIA 1OV3A 2PNIA 2VXEA 1ZBJA 2VWFA 4A63B 3JCMg 4JPBW 1WNLA 3FJ5A 2H8HA 4ZN3A 3KUFA 1K4US 3G71T 3CPFA 5M9OA 2ZPEB 3GNGA 3F70A 1YIJQ 2BE7D 3C12A 5AT1B 1VQMA 2OI3A 2AK5A 3OBWA 4A4EA 3QYHB 1IZ6A 3A1PA 1Y96B 3RKYA 2A3LA 4XK8E 1LOJA 4M75G 3I55A 1KHIA 3QWXX 4M7DC 3EG9A 5IT9E 1VQKQ 3E9FA 4X34A 3LLRA 4JLGA 3CC7T 1MV0B 3I9QA 4GLKA 1YI2T 1W2BP 4RMOA 1X6GA 2CUBA 2SEMA 1M8VA 1X6BA 4XU3A 3VYHB 1E6GA 5LJ3g 4BY6C 3TSZA 3M0UA 2XIDA 4HCBA 1S72Q 3S3OA 3GNFB 1WXBA 2CZ1B 1Q81U 3IQLA 2XG8D 4O6JA 1QVFA 5KYXA 1OZ2A 1M8MA 1ZSGA 1ZUUA 2KR3A 1WPYA 1VYTA 3QDFA 3V7CA 2RF0A 4F7UA 3CCSQ 4M75B 1RLQC 4C92C 1FMKA 4RTVA 2COYA 4OF1A 2CSQA 2L8DA 1VQ5T 4BDYA 3JCMh 5CK9A 2KQWA 5GAN7 5GANh 1BI3A 5CQXA 1VQ9T 4LDWA 2CREA 4XTWA 1VQPT 4OMMA 4F17A 2CZ7B 1JQQA 2HQEA 3OYNA 1K9AA 2LQWA 3RUXA 2E3IA 2GQIA 1S72A 5GANe 4M77D 2AZSA 1YNZA 4KUDK 2LVMA 4E7HA 3M5AA 3CCQT 3T9NA 3I5SA 4DBQA 1YJ9Q 1JJ2P 1WX6A 3HKSA 1QW1A 1RADB 3UATA 3I56A 3VS4A 1NBEB 1PKTA 3VRZA 1KK7A 3QSUA 1VQKT 3QJ6A 3OYAA 2QGGA 1NG2A 1RAIB 3NTKA 1ARKA 4RTTA 2J06A 1QVFP 3JV3A 1M90U 4M78E 4X9DA 3SFMA 2J6OA 1WHLA 2VV5A 3GF5A 4JDSA 1Q7YC 1M3AA 3ZL7C 1K0SA 4JZ4A 2EYZA 2PVGB 4D8KA 4QQGA 2KI7A 2EKOA 1KQ1A 1X75C 1Z9QA 2DYBA 4M78G 3CXCS 5LJ5e 3P8DA 2OTLT 1R0CB 2V8KA 1B34A 4FSSA 3OYEA 3LWHA 2DEQA 1YJWT 1Q81R 2RM4A 2HSPA 3CCST 1I5OB 1QCNA 3OBYA 4LE9A 1SF9A 3H0IA 2JUFA 1TUCA 2P4RA 1VQ8T 4QVZA 1EFNA 1PG5B 3OW2P 5IXBA 1D1BA 1YP5A 2AHJB 5KCHA 4ZN1A 2MCNA 5EG2A 4LD6A 2K6DA 5CQYA 1KQSP 2PTKA 3RMQA 1WQWA 1Y07A 2W10A 4EMHA 3X24B 2DPPB 1QVGA 1M1KR 1YN8A 2RK2A 4JJBA 5GAMj 2FPFA 4OB0B 3VS1A 1H92A 1FXXA 1BI1A 2QTXA 3C95A 4QQDA 1M5Q1 1YWOA 1FMVA 2QGFB 3J80E 2QA4T 1VQ6A 5D6WA 2E65A 4MZMA 5I2MA 2EGCA 4MDWA 4EMGA 5HCKA 2D9TA 2O9VA 1BU1A 1VQNA 1BIAA 1MMAA 2AIRB 5I22A 4EMKC 4XU1A 4OGEA 3PNWC 1KQSA 4Y92A 2PUKB 4OB2B 3L2ZA 2ENMA 2FZCB 2AZVA 1PKSA 5FRMA 2BIVA 1BI0A 4J9FA 1XTDA 4KBMB 1EIFA 3EH2A 1UGVA 2RK1A 1VIFA 4IUTA 5EC7A 4EIKA 1JBMA 2K3YA 3JCMb 1X43A 2L89A 5FWBA 2R58A 2HAXA 3TREA 5LJ5j 1PM3A 3RR6A 3CC2T 2ABLA 5IHIA 3HSBA 2QQRA 4LXCA 1NJIR 1ZA1B 2KMTA 2MF2A 4HT9A 1SHGA 5CKDA 1QVFS 3ULRB 3I55Q 4LDXA 3OYMA 2KDSA 2GBQA 4J6WA 5A0DA 1VQNQ 1YHQQ 1MMDA 1KG1A 2C06A 1VQ7Q 1VQLA 2DBMA 5IHKA 3MP8A 2X51A 2LQKA 3OYIA 5KYNA 2PQWA 5D7UA 4RKUE 2FRYA 3BFMA 3PMTA 3NTHA 2EQKA 4JUVA 1QWEA 1BCMA 1U5SA 4C8QG 3HPWA 3JB9H 4J9CA 1GFDA 4DBFA 4IUQA 4J9HA 4D8DA 2K9GA 1YI2A 3TQ7P 1Y96A 4RG8A 5FU7B 3M55A 3EHRA 2Y90A 3OQ5A 1RAEB 1K76A 3MPUB 1NM7A 4C92E 3GP8A 2PU9B 2YLCA 4JRQA 2ZCFB 3QZ5B 5LJ5g 1VYVA 4TVRA 1YIJA 3SHWA 3C94A 1X27A 3TU4K 1C1AA 4F16A 5CR2A 2GQVA 1OU9A 2YRCA 2QA4A 4P5NA 2RI5A 1I5LA 2IG0A 3JRZA 1MMGA 1IO6A 1EZZB 5KE3A 2I0NA 1QCOA 3CC2Q 1JJ2S 2BZ8A 1D09B 1Q86R 3BDLA 2GFUA 1D3BB 2LT4A 1X6OA 2XU8A 3A8HB 3I55T 2JJ9A 4K11A 2QDYB 1U1TA 1Q7YU 1M27C 3QBYA 4IIOA 4N4IA 1RAGB 3VS2A 1VQ7T 5GANj 1ZX6A 2COWA 2E6NA 3L2VA 4PJOG 1WJQA 3TEEA 4A4HA 5GAN2 4BE0A 4X1VA 3I35A 1B7TA 4R55A 5J39A 2DE0X 4RTXA 3QHSA 2EYYA 3G6EQ 2DF6A 2KGTA 2L5QA 2ED0A 3JCMP 3A8OB 4F7UB 2K5LA 2P0KA 3PTAA 1K8AC 3CMET 3OYKA 1QWFA 4KRTA 4AG1C 2LJ0A 5I11A 1T0HA 1TUDA 2JT4A 4XTYA 9ATCB 1YITT 4KGZB 3JCMe 1E7OA 1OX9A 4J6YA 2LCLA 1M4ZA 3RKWA 2K5FA 2FZKB 1RAFB 2HCKA 3OMCA 3QPHA 2E5QA 1ZUYA 2EGEA 3CC7Q 1WXTA 1LVKA 3CCLQ 5GAN5 3E9GA 3ZFJA 3EGXB 1UECA 2VC8A 1NLOC 1KD1C 1Y71A 2HBWA 2DAQA 2YSQA 4PFOA 3J7AF 3MHXA 1RUWA 1VQPA 1S72T 1JB0E 1BB9A 4JJDA 2FHDA 1UTIA 3EG2A 3QYGB 2X3WD 3LWIA 2R57A 2V1QA 2G3RA 2YUNA 3PFSA 4C0DC 1Y57A 2QYZA 2QASA 1TTHB 2P4TA 3L42A 3MO8A 2L3SA 3CCRT 2DFUA 4NOYA 2X35A 3CD6T 2VKNA 1NJIU 1X69A 2CP0A 3OSVA 4YTLA 1KD1R 2YT6A 1JRIA 5GAN8 3MP6A 4M75F 4DBHA 3OYYA 1YJNT 5GMKj 1KC8C 4M7AB 4ZGDB 2EWNA 4A54A 2D1XA 1GBQA 2DL5A 4E7JA 3KBGA 3VUBA 4GY5A 3ER0A 2OTLA 1AOJA 1VQ4A 1AZGB 3I5RA 3EFOA 1YJWA 3OYLA 2P84A 3EGXA 4MMLA 5I2SA 2EKHA 3A5ZB 2ATCB 4M7DA 3S6WA 1VQ8Q 1R8OB 1RABB 2F69A 4J7FA 5FWCA 2A37A 1HYOA 4JJNK 1I8FA 1MMNA 2JXBA 2MAMA 2CP2A 2RHYA 2OJ2A 4HCCA 4M7DF 5J26A 2MWOA 3MKDA 5GAMh 4L5GA 3CQTA 1W70A 3CC7A 2RMOA 1D3BA 1JXMA 4PJJA 1TUGB 3MCAB 4C8QF 2ECZA 4JS4A 1W6XA 1XOVA 3FRNA 3JB9J 1TG0A 2L2PA 2RJFA 3JCMJ 7AT1B 2M0YA 5LL6S 3VS7A 1QQJA 1K9MU 2X3XD 3C0CA 1A0NB 3M57A 1AVZC 3CC4T 1UDLA 4F7UF 1RI9A 2KRNA 1QLYA 1B07A 4J9GA 2RN8A 3OS2A 1VQ6T 3RERA 1U1SA 2AKLA 3EG3A 3HFNA 1FYNA 5A0GA 3QUIA 1N8RU 4OMFB 1Q82R 4C92F 3H8ZA 2JOYA 1GL5A 3MEWA 5GAOq 5KYYA 3MEVA 2QG9B 2HDAA 3OYJA 4J9BA 2EJGA 3M53A 1IGUA 2K2MA 4RUGA 5GANf 1VQLQ 4PNOA
chains in the Genus database with same CATH topology
3CXCA 4C8QA 5C6SA 2KK4A 3BY7A 4M7AC 1SSFA 3HFOA 4C5GA 2MWPA 2VGMA 5DM7R 1N6AA 2AHJB 2GFAA 4FM4B 5GANd 5KCHA 3M9QA 4QW2A 3HRTA 4JRIA 4ZN1A 2HBPA 4XAXB 5EG2A 3JCMV 4LD6A 2M16A 4DQ2A 5CQYA 1KQ2A 3C4SA 3RMQA 1WQWA 1Y07A 2DXBA 4EMHA 4XU0A 3X28B 3X24B 2DPPB 2Y4XA 3UT1A 2F5TX 5CIUA 1QVGA 4PLIA 2DD5A 4ELYC 1GXIE 3G6EA 1N9RA 2DKGA 2RK2A 2XHCA 5GAMj 2EQMA 4OB0B 3CCJT 1FX7A 3GIBA 3P8HA 4E7KA 3JB9F 3WXMB 1VQ5A 3CCJA 2WSFE 3LGFA 5GMKm 2E1HA 4WF2A 1FXXA 4FSXA 1HXDA 4JS5A 4PJOA 1BI1A 3VJPA 2QTXA 3C95A 3URGA 4QQDA 1M5Q1 4FIBA 4J5YA 2ZPGB 3J80E 1UB4A 4C92A 2QA4T 3X25B 1VQ6A 5D6WA 5IAYA 3L2UA 3OW2A 2E65A 1VQ7A 4MZMA 5LJ5h 5I2MA 4EMGA 4II1A 4MDWA 2RD1A 3NFCA 2D9TA 5FU6C 3EFRA 1BIAA 2JZ2A 1NPRA 4M78D 2EJFA 3A8MB 1VQNA 2EAYA 2EFIA 3AHUA 4FT2A 2RI3A 2EQUA 4EMKC 3CCSA 4QQ6A 5FU7C 1BI2A 4XU1A 5GAMe 2DTHA 4OGEA 2DTOA 2YRVA 1OZ3A 3PNWC 2JTMA 2KY9A 4J6XA 3L1AA 1KQSA 2PUKB 4OB2B 2CKKA 3L2ZA 5D6YA 5C0MA 4FU6A 2FL7A 2OTJT 3V7RA 2P0QA 2H3JA 3CBOA 2FVUA 5FRMA 2BIVA 2DO3A 3CCLA 1BI0A 1PSFA 1YCYA 2DXUA 1WQ7A 2DIQA 2V8JA 3JCMQ 3CCET 4XU2A 1XTDA 2DXCA 1EIFA 4KBMB 4F7UE 4HKEA 2E41A 5AYFA 2CZ6B 3S3MA 1Q86U 5GAOr 2MMPA 5GMKe 2RK1A 1VIFA 4IKFA 4Z02A 4E7IA 1K9MC 2HQXA 3OMGA 4IUTA 3CPWA 4MZTA 2O4XB 5FU6B 3TCJA 1JBMA 2K3YA 4VUBA 3JCMb 2DK3A 3M4GA 2L89A 2XICA 1OI1A 2R58A 3CD6A 2K5IA 2HAXA 3TREA 2QEXT 5LJ5j 3SB2A 2VGNA 3OYCA 3CC2T 3ASKA 2WSEE 4IURA 4C8QE 3GOXA 4E7LA 3QO3A 3HL8A 1I81A 4C8QC 2XDDA 3WVDB 3G71A 2HD0A 3HSBA 2IVWA 4L6V5 4M7AD 4M78F 2QXFA 2QQRA 3M4YA 2I2LA 3DLLA 1PSEA 3CPWS 2KMTA 3RIRA 3GPLA 2MF2A 1YHQT 4BE1A 1Q82U 3VKIA 4HT9A 3V8KA 1FWZA 5CKDA 1QVFS 4LDXA 3HRSA 1YHQA 3FDRA 3OYMA 4E47A 3SWNB 2X4XA 5CCAA 1XQHA 2KDSA 3G7ZA 3CC4A 3X26B 3L2RA 3S3NA 1G3SA 2DVEA 4J6WA 4M7DB 5A0DA 4M78A 1BIBA 3L2QA 1KG1A 2VUBA 3GLXA 3SDZA 3VV0A 2C06A 4Y28E 2EYQA 2PUOB 4M77B 3V8JA 4C0ZA 3OYDA 4XQ3A 1VQLA 4HA8A 4PJOF 1M1FA 1WGSA 3MP8A 1AHJB 2LX9A 4BE2A 1KQSS 5FRNA 1ZQ1A 3J81E 2E12A 5LJ3e 2QQBA 2LQKA 4L59A 3SWNA 3OYIA 2BUDA 2PQWA 1W2BA 2LQ8A 4N4GA 2E10A 4IUUA 4RKUE 4IUPA 3BFMA 3LYIA 4PKCC 3PMTA 4HCZA 5A2QE 3NTHA 2DTIA 2EQKA 4KUIA 2KAFA 4OGCA 3I55A 4JUVA 1XNIA 3UDCA 3CMEA 3JCMd 4RG2A 4C8QG 4M77A 3QIIA 1M1KU 4RCCA 3HPWA 3VUZA 4BI4A 3INZA 1G3YA 5FROA 4N0AA 3JB9H 1WJRA 5GAMf 4J83A 3LGLA 2K2VA 3JSCA 2OAUA 3PT9A 3JCMf 3QDRB 4M77E 3E19A 4M7DG 3LW5E 4A4GA 4IUQA 5KE2A 4M77C 4QVDA 5I21A 1YI2A 2XKOC 2QEXA 3LX7A 1Y96A 4ELZC 4RG8A 1K73U 3A8GB 5FU7B 1UGQB 2F5KA 3M55A 2JNGA 1QVGS 1DJ7B 4Q5WA 1QP2A 2Y90A 3OQ5A 4JRKA 4A4KA 1M9SA 2RHIA 5GMKh 4C92E 1M90C 3BDUA 3GP8A 2PU9B 3G6ET 2YLCA 4JRQA 3UPUA 2ZCFB 4LDUA 1O9SA 4C0GA 4CI0C 4UC4A 3QZ5B 5LJ5g 2RJEA 4TVRA 1YIJA 2CS7A 3C94A 4M7AE 1H3ZA 2KSSA 3TU4K 5CKEA 2K57A 2WSCE 1W4SA 2KVQG 3META 3Q1JA 3RMSA 1N9SA 4A53A 2GQVA 5J3BA 2M1HA 4J8OA 5CR2A 5GAMd 3PIPA 4BD3A 1KC8U 2K3XA 4HT8A 2QA4A 4P5NA 2RI5A 3MEAA 4M75A 5GAN6 3JB9I 1I5LA 2IG0A 1VQLT 1NE8A 3JRZA 1VQNT 3CBMA 1RL2A 4MMKA 1QVPA 1HK9A 3O8VA 4M7DD 4NS5A 2MI6A 5GAOn 1YJ9T 5KE3A 4JRPA 3DB3A 3DKMA 5KCOA 2JN0A 1YJ9A 1JJ2S 2GCXA 3CC2A 4PJOD 2DJZA 4C5IA 1G3WA 2DIGA 2VYTA 4RCBA 3QG1A 2LCCA 2DXTA 1VUBA 2L3RA 3RESA 3BDLA 5LJ5d 2OTJA 2GFUA 1D3BB 4C0FA 1G5VA 2LT4A 2LDMA 1X6OA 2O4XA 1KD1U 4F7UG 2XU8A 1Q81C 3A8HB 3CCLT 3I55T 1UEBA 1UGPB 4M75D 4D6WA 5KH6A 1UGRB 2LRQA 4C0DB 3OY9A 2FB7A 2QDYB 1U1TA 1Q7YU 3CCUT 1P92A 4O5VA 3QBYA 4N4IA 3M54A 3SWNC 1NZ9A 1ZBXA 2B8AA 1VQ7T 2RHXA 5GANj 1ZHIA 2QI2A 2E70A 4EMKB 5FLXE 3EFSA 2E6NA 3L2VA 3OYGA 4PJOG 3CMAT 5CO7A 1WJQA 4N4HA 2R5MA 3FIFA 3M59A 5DY9A 3FC3A 3TEEA 4XTUA 4A4HA 5HK0A 3OS0A 5GAN2 4BE0A 2CGHA 3HRUA 2LTOA 1MHNA 4R55A 2R5AA 3CCMT 5J39A 2QQAA 1NJIC 5GAOm 2PVDB 2ZPIB 1Q86C 1YJNA 3OS1A 4LDVA 4KULA 3QHSA 4ZGJB 3CCEA 2X4YA 1K73C 2L5QA 3G4ST 3JCMP 2JTFA 2PVOB 3A8OB 2K5LA 5LJ3h 2RI2A 2P0KA 4C92D 4F7UB 3QKJA 3PTAA 1M1GA 3JCMc 3OYKA 3CMET 1VQOA 3H6ZA 3DLMA 2RJCA 2LT1A 5LJ3d 3OYHA 3A8LB 4NL2A 2DZCA 2E64A 5CVIA 2X4JA 5D6XA 2RHUA 2HNIA 4PL6A 2QQSA 3ZEHA 3M56A 4QVCA 3HP9A 4PJOE 4KT0E 3P8BB 4M7AA 2YHTA 4XTYA 2EJ9A 1YITT 4OP0A 3JCMe 2VXEA 4J6YA 5CKFA 3OYFA 1N27A 2LCLA 3JCMg 1WNLA 1M4ZA 4ZN3A 3RKWA 3KUFA 3CCQA 2K5FA 3G71T 3CPFA 5M9OA 1N8RC 4LD9K 5HY6A 4EMKA 1QP3A 2ZPEB 4C92G 3OMCA 3GNGA 3QPHA 3F70A 3KXTA 2E5QA 3C12A 1VQMA 2QQ9A 2XDBA 3OBWA 4A4EA 4BI8B 3QYHB 1IZ6A 3I56T 3QZ9B 1Y96B 2A3LA 3RKYA 4XK8E 1LOJA 2CYZB 1B34B 2DD4A 4M75G 5LJ3f 3NTIA 4C5HA 3E9GA 4Y91A 3ZFJA 1KHIA 5GAN5 1VQKA 4M7DC 2M9UA 2WACA 3L2WA 4BACA 2VC8A 5IT9E 4M7DE 3CCUA 4MZPA 3RKXA 1KD1C 1Y71A 3E9FA 2DAQA 4J7IA 4X34A 3LLRA 2YLBA 4JLGA 3OYBA 3CC7T 3MEUA 4GLKA 3J7AF 1V29B 5GMKi 1YI2T 3MHXA 5GAN4 5DLQE 4RMOA 1VQPA 5GAOp 1S72T 2D6FA 1W2BS 4M77F 1M8VA 3DB4A 1JB0E 4XU3A 3VYHB 3CCMA 5HK3A 5LJ3g 4ATOA 2ZPFB 2FHDA 4BY6C 2XIDA 4NL3A 4HCBA 2RA2A 4OVAA 3JCMW 4XTZA 5GAOl 3QYGB 4MDXA 3LWIA 3G4SA 1I4K1 2RH2A 4LDYA 1UGSB 4M7AF 3CCVA 2R57A 2G3RA 1BKBA 3PFSA 4C0DC 3S3OA 3GNFB 4BB7A 2CZ1B 2A7YA 1Q81U 3CEYA 5DLOA 2P4TA 3L42A 3MO8A 4CRIA 2XG8D 4O6JA 1QVFA 1K8AU 1G3TA 3FB9A 3CCRT 2RJDA 5CKHA 4DOWA 2RB6A 2NLUA 1OZ2A 4NOYA 5L8RE 4M77G 2X35A 3CD6T 1KHCA 1NJIU 3OSVA 1WPYA 5GAMg 4YTLA 4X9CA 2ZPHB 3V7CA 4F7UA 3E1SA 1JRIA 4M75B 5GAN8 4C92C 3OA6A 4DOVA 3MP6A 3LH0A 4M75F 4OB3B 4PLLA 2VXFA 3EAEA 5CAIA 4OF1A 1VQ8A 2L8DA 1NPPA 2X4WA 3OYYA 2XK0A 3PGGA 5GMKj 1YJNT 1KC8C 4BI3A 1VQ5T 5GMKl 1O75A 2ZPBB 2E6ZA 2Y4YA 4BDYA 1BYMA 1YIJT 3OS5A 4M7AB 4ZGDB 2EWNA 3JCMh 4A54A 5CK9A 2KQWA 4ZGEB 1Y7XA 5GANh 5GAN7 4E7JA 1X01A 2ZGWA 1BI3A 3KBGA 2P0PA 3VUBA 2DZ9A 3JAME 4GY5A 3ER0A 5CQXA 1VQ9T 2OTLA 4LDWA 4XTWA 1VQPT 4EDUA 4OB1B 5IN1A 4C5EA 5GAN3 1VQ4A 3V8LA 3HHTB 2CZ7B 2HQEA 4EPCA 3OYNA 2EIFA 3OYLA 1VQ4T 1YJWA 1YITA 5GANg 3RUXA 3VYGA 3JCMX 1S72A 4MMLA 5I2SA 3FEOA 4BUGA 3CMAA 5GANe 3A5ZB 4M77D 4M7DA 3SD4A 1YBYA 2K4YA 4M78B 3S6WA 3CBPA 4KUDK 2LVMA 4E7HA 3M5AA 1R8OB 2F69A 4J7FA 4XTVA 3T9NA 3X20B 3CCQT 4FL6A 2LC4A 3CCVT 3VU3C 4JJNK 3HKSA 1I8FA 1QW1A 4A4FA 2MAMA 2RHZA 3I56A 2RHYA 1OYXA 3OW2S 3ME9A 1WJSA 4HCCA 3R6OA 3QSUA 4M7DF 2XD0A 1VQOT 5J26A 1VQKT 2MWOA 5GAMh 1Q82C 4L5GA 3QJ6A 3OYAA 2EQJA 3CC7A 4PJOB 3NTKA 1LNXA 2CZ0B 1D3BA 3FLGA 3V7SA 1H641 2LNVA 3QJYA 3MCAB 1VIEA 4C8QF 5LJ3j 4JS4A 3UWNA 1M90U 4M78E 4N0AC 4X9DA 3SFMA 2XDPA 4R56A 3JB9G 4XTXA 4C8QB 1XOVA 2VV5A 3FRNA 4M78C 3JB9J 3GF5A 4JDSA 4BY6B 4M7AG 4JLIA 2RJFA 1M1KC 3PMIA 3JCMJ 2GF7A 1Q7YC 2O01E 5LL6S 1TH7A 3MP1A 4IUVA 2PVGB 1K8AC 1K9MU 1LJOA 4QQGA 3M57A 3M58A 3CC4T 4F7UF 1IREB 2EKOA 1KQ1A 1X75C 4M78G 3CXCS 2V8IA 3OSSC 3OS2A 4PJOC 1VQ6T 5LJ5e 3OB9A 3P8DA 3ZBDA 4DA4A 1VQ9A 2FYKA 2RO0A 5A0LA 3CCRA 1U1SA 2OTLT 3RERA 2V8KA 3FJPA 5HKCA 3PIOA 5CKBA 3JB9D 3HFNA 3QXEB 4B9XA 4FT4A 5LJ5f 1B34A 1RI0A 5A0GA 3QUIA 1N8RU 3OYEA 3LWHA 2DEQA 1YJWT 4OMFB 2RM4A 3WVEB 3CCST 1JJ2A 3OBYA 4B9WA 4C92F 4V2SA 2BKDN 3N5BB 4ME7A 4BDZA 1U8RA 3H8ZA 4M75C 2JOYA 2XI9A 4C92B 3MEWA 5GAOq 1MGQA 4M75E 2M0OA 2JUFA 3MEVA 4ZTFA 2D0QB 1VQ8T 2ZZDA 3BW1A 4QVZA 3OYJA 2EJGA 1VQMT 3M53A 4ZTJA 4C8QD 5GANf 2JVVA 4PNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FC3 A;  4PLL A;  3L2Q A;  3EAE A;  4A4H A;  5C6S A;  3OS0 A;  1SSF A;  4BE0 A;  2L8D A;  2X4W A;  2LTO A;  2MWP A;  2XK0 A;  4C5G A;  2GFA A;  3OYD A;  1MHN A;  5KCH A;  3M9Q A;  2R5A A;  4QW2 A;  5J39 A;  4BDY A;  1WGS A;  4LD6 A;  3MP8 A;  2M16 A;  3L2R A;  4BE2 A;  5FRN A;  4E7J A;  3OS1 A;  3C4S A;  2X4Y A;  4GY5 A;  4L59 A;  3OYI A;  2JTF A;  2BUD A;  2PQW A;  2P0K A;  2RI2 A;  3QKJ A;  3OYK A;  4N4G A;  3UT1 A;  3H6Z A;  5CIU A;  3DLM A;  2RJC A;  4IUU A;  4PLI A;  5IN1 A;  4C5E A;  4IUP A;  4EDU A;  3OYH A;  3LYI A;  3PMT A;  4HCZ A;  2HQE A;  3NTH A;  3OYN A;  3OYL A;  2EQK A;  5D6X A;  2RHU A;  1XNI A;  2EQM A;  4PL6 A;  2QQS A;  3QII A;  4RG2 A;  3ZEH A;  3P8H A;  3FEO A;  4E7K A;  5FRO A;  3SD4 A;  1WJR A;  3LGF A;  3S6W A;  2LVM A;  3LGL A;  4E7H A;  4FL6 A;  4QQD A;  4A4G A;  4IUQ A;  5KE2 A;  3OYF A;  1N27 A;  4A4F A;  3LX7 A;  3KUF A;  5D6W A;  5IAY A;  3L2U A;  2RHZ A;  5M9O A;  2RHY A;  1OYX A;  2F5K A;  4II1 A;  3ME9 A;  1WJS A;  2D9T A;  3F70 A;  3OMC A;  2JZ2 A;  2E5Q A;  4Q5W A;  2EFI A;  3OQ5 A;  5J26 A;  2MWO A;  2EQU A;  2RHI A;  2RI3 A;  4A4E A;  4QQ6 A;  3QJ6 A;  3OYA A;  2YRV A;  1OZ3 A;  3PNW C;  2EQJ A;  4C5H A;  3NTK A;  3NTI A;  4UC4 A;  3E9G A;  3FLG A;  2CKK A;  5D6Y A;  2WAC A;  2RJE A;  4FU6 A;  5C0M A;  3L2W A;  4BAC A;  1H3Z A;  3UWN A;  3E9F A;  2DAQ A;  4X34 A;  3OYB A;  2BIV A;  2XDP A;  3LLR A;  5FRM A;  3MET A;  2DIQ A;  3MEU A;  3Q1J A;  2M1H A;  4BD3 A;  2K3X A;  2RJF A;  3PMI A;  3DB4 A;  2RI5 A;  3MEA A;  3S3M A;  2GF7 A;  2IG0 A;  2FHD A;  3MP1 A;  4IKF A;  3O8V A;  4Z02 A;  4IUV A;  4NS5 A;  4OVA A;  4E7I A;  2HQX A;  3OMG A;  4QQG A;  5KE3 A;  4IUT A;  3DB3 A;  2O4X B;  5KCO A;  4C5I A;  2K3Y A;  2EKO A;  2DIG A;  2VYT A;  2R57 A;  2LCC A;  2G3R A;  2L89 A;  2L3R A;  1OI1 A;  3PFS A;  2R58 A;  3BDL A;  3OS2 A;  2GFU A;  1G5V A;  3S3O A;  3OB9 A;  3P8D A;  3OYC A;  2RO0 A;  3ASK A;  4IUR A;  2LDM A;  3GOX A;  4E7L A;  2O4X A;  4B9X A;  3CEY A;  1RI0 A;  5KH6 A;  3L42 A;  3MO8 A;  2LRQ A;  4CRI A;  3OYE A;  3OY9 A;  2QQR A;  2RJD A;  4B9W A;  2BKD N;  4BDZ A;  3MP6 A;  3QBY A;  4N4I A;  2NLU A;  3H8Z A;  1OZ2 A;  4BE1 A;  2B8A A;  2X35 A;  3MEW A;  1KHC A;  4ZTF A;  2M0O A;  2RHX A;  3MEV A;  3FDR A;  3OYM A;  3OYJ A;  4QVZ A;  3L2V A;  2E6N A;  2X4X A;  3OYG A;  4ZTJ A;  3OA6 A;  1WJQ A;  4N4H A;  2R5M A;  3S3N A;  3LH0 A; 
#chains in the Genus database with same CATH topology
 3CXC A;  2KK4 A;  2DNU A;  5DM7 R;  5GAN d;  2M51 A;  2HBP A;  3JCM V;  2M16 A;  4DQ2 A;  4DBR A;  2Y4X A;  1RAH B;  5CIU A;  2EYX A;  1PCX A;  2KYB A;  2DD5 A;  3G6E A;  2DKG A;  5KYX B;  1E6H A;  2XHC A;  3EGU A;  2MIO A;  2DA9 A;  3D7S B;  3GIB A;  3P8H A;  2YDL A;  3CCJ A;  2E1H A;  1HXD A;  4OMQ A;  2E3H A;  1QKW A;  2DL8 A;  1UB4 A;  2EYW A;  2LP5 A;  3L2U A;  5LJ5 h;  3CCM Q;  3REA B;  4FT2 A;  2EQU A;  1TXQ A;  2E5K A;  1BI2 A;  2CP6 A;  2EQI A;  4KGV B;  2JTM A;  4J6X A;  3RNJ A;  2A08 A;  2F1L A;  3V7R A;  2H3J A;  3CBO A;  3CCL A;  1PSF A;  1YCY A;  2V8J A;  3JCM Q;  3CCE T;  2MYS A;  4XU2 A;  2DXC A;  2HZY A;  4HKE A;  1VQM Q;  3S3M A;  1J3T A;  4Z02 A;  2KT8 A;  1VQ6 Q;  1T0J A;  3M4G A;  2XIC A;  3CD6 A;  2EGA A;  2VGN A;  3CMA T;  4C8Q E;  2WSE E;  3GOX A;  2CUD A;  4C8Q C;  2W0Z A;  1RLP C;  3G71 A;  2HD0 A;  4M7A D;  3M4Y A;  2EPD A;  1YHQ T;  2L3Q A;  2F2X A;  3SWN B;  2X4X A;  1XQH A;  3CC4 A;  2DL3 A;  4M7D B;  2LZ6 B;  3SDZ A;  3VV0 A;  1OOT A;  4M77 B;  1VYU A;  1D0Z A;  3CPW P;  2HQH A;  1WGS A;  2NUT A;  4B6M A;  1AHJ B;  4BE2 A;  1KQS S;  4PJL A;  1YCS B;  1W2B A;  2LQ8 A;  2GTO A;  3LH5 A;  4IUP A;  2RQV A;  2K79 A;  4RG2 A;  3JCM d;  3QII A;  1M1K U;  3VUZ A;  4BI4 A;  2DJQ A;  5FRO A;  1WJR A;  5GAM f;  1WI7 A;  4J83 A;  3LGL A;  2K2V A;  3JSC A;  3PT9 A;  4M77 E;  3MJX A;  4M77 C;  1OU8 A;  4E7S A;  4QVD A;  1ZA2 B;  2GTJ A;  3LX7 A;  2FG0 A;  1K73 U;  3A8G B;  1UGQ B;  1WA7 A;  2JNG A;  1QVG S;  4JRK A;  1NYG A;  4A4K A;  2COZ A;  5GMK h;  1UHC A;  3G6E T;  4CI0 C;  1O9S A;  4C0G A;  3RBB B;  5FW9 A;  1IXD A;  1PC0 A;  2KVQ G;  3Q1J A;  1N9S A;  3PIP A;  1KC8 U;  1PRM C;  1LPL A;  2K3X A;  1SG5 A;  2CSI A;  2O31 A;  1NE8 A;  2NUP B;  4NS5 A;  2MI6 A;  5GAO n;  1YJ9 T;  4KGX B;  3DB3 A;  4AFZ C;  1MUZ A;  5KCO A;  4PJO D;  2GCX A;  3CC2 A;  3EHQ A;  2DJZ A;  4OMN A;  3QG1 A;  2LCC A;  1GCP A;  2DXT A;  2L3R A;  3CCL T;  1UEB A;  3A98 A;  5KH6 A;  1UGR B;  2LRQ A;  2RQR A;  4F04 B;  8ATC B;  3TVT A;  1KIK A;  3M54 A;  2J6F A;  2JS2 A;  2L3P A;  1WLP B;  5FLX E;  1D0X A;  2KEA A;  4XTU A;  5HK0 A;  3HRU A;  1MHN A;  1CSK A;  2FEI A;  2KNB B;  2DEU A;  2QQA A;  5GAO m;  1I0C A;  3OS1 A;  4KUL A;  2HKQ B;  4C92 D;  5LJ3 h;  3QKJ A;  2B86 A;  3JCM c;  1UFF A;  1VQO A;  1T3S A;  2QTV A;  1PD1 A;  2LT1 A;  2IIM A;  2RJC A;  5LJ3 d;  2HL5 C;  3OYH A;  1YIT Q;  1YJW Q;  1IHV A;  2LX7 A;  2QQS A;  3ZEH A;  3M56 A;  3HP9 A;  4M7A A;  3CD6 Q;  2YHT A;  3NMZ C;  2EJ9 A;  3PE0 A;  4OP0 A;  3U23 A;  5CKF A;  3OYF A;  4R0K A;  1N27 A;  1AWW A;  1N8R C;  3EFO B;  5HY6 A;  1QP3 A;  2KE9 A;  4C92 G;  1K0X A;  1M90 R;  3H0H A;  4E6R A;  4BI8 B;  2CYZ B;  1WIE A;  2LJ1 A;  4Y91 A;  2M9U A;  3L2W A;  4BAC A;  4M7D E;  3CCU A;  4MZP A;  3OYB A;  4J7I A;  3I56 Q;  1AWO A;  1S1N A;  1V29 B;  5GMK i;  5DLQ E;  2D6F A;  1JXO A;  1W2B S;  4M77 F;  1IGQ A;  1KSW A;  1K9M R;  1KC8 R;  5HK3 A;  1R0B G;  2ZPF B;  2M02 A;  4NL3 A;  1AEY A;  2QA4 Q;  3G4S A;  1I4K 1;  4LDY A;  1OPK A;  2ZAE A;  4LN2 A;  1BKB A;  2CDT A;  4LUD A;  2QAZ A;  1CKA A;  5KYY B;  3CEY A;  5DLO A;  2K7A A;  1K8A U;  1G3T A;  2RJD A;  2RB6 A;  1F1B B;  4M77 G;  1KHC A;  1YJN Q;  3VS6 A;  4X9C A;  2J05 A;  2SRC A;  1WHM A;  1TS9 A;  1TU0 B;  2KBT A;  2GGR A;  4PLL A;  2VXF A;  3EAE A;  4KH1 B;  1NPP A;  3PGG A;  2E6Z A;  1BYM A;  2DIL A;  3OS5 A;  2DER A;  1Y7X A;  2ZGW A;  4PFZ A;  2P0P A;  2DZ9 A;  2NYS A;  4CC2 A;  2LMJ A;  4EDU A;  3HHT B;  1WFW A;  4KH0 B;  3NGP A;  2EIF A;  1YIT A;  3VYG A;  4AFU C;  3JCM X;  3SD4 A;  2LCS A;  1YBY A;  2K4Y A;  4M78 B;  1C6V X;  3X20 B;  1HSQ A;  3CCV T;  4FL6 A;  2LC4 A;  2CT4 A;  2BZX A;  3UA6 A;  1Z9Z A;  3OW2 S;  3ME9 A;  1WJS A;  3R6O A;  4OMP A;  2XD0 A;  2QDL A;  1VQO T;  2RNA A;  2EQJ A;  1LNX A;  2CZ0 B;  1H64 1;  1SRM A;  1G83 A;  3QJY A;  3H9N A;  4R56 A;  2XDP A;  4C8Q B;  4M78 C;  1V1C A;  4BY6 B;  4M7A G;  1M1K C;  3PMI A;  1RAA B;  2O01 E;  2DL7 A;  1WZO A;  4IUV A;  3M58 A;  1ZSZ B;  3RDV A;  1TOV A;  3OB9 A;  3EGD B;  2RO0 A;  3CCR A;  4AG2 C;  5HKC A;  3PIO A;  3JB9 D;  4B9X A;  1OPL A;  2EVR A;  2L0A A;  1VQ4 Q;  3WVE B;  4B9W A;  3N5B B;  3AT1 B;  4ME7 A;  4M4Z A;  4M75 C;  2J7I A;  2XI9 A;  2G6F X;  2KYM A;  4C92 B;  1MGQ A;  4ZTF A;  1H3H A;  4WCI A;  2D0Q B;  2ZZD A;  3BW1 A;  1VQM T;  4FYW B;  4C8Q D;  1H3Z A;  5KYW A;  4C8Q A;  1ZSZ C;  3BY7 A;  1Y0M A;  4C5G A;  2GFA A;  3M9Q A;  1IRX A;  3HRT A;  4XAX B;  3UA7 A;  5L23 A;  1KQ2 A;  2DXB A;  1AT1 B;  4XU0 A;  1VA7 A;  3UT1 A;  1UG1 A;  2F5T X;  3KFV A;  1N9R A;  1UJ0 A;  4AMC A;  1MNE A;  1WYX A;  2YUP A;  4E7K A;  2DLP A;  2NUT B;  2WSF E;  3LGF A;  4WF2 A;  1SSH A;  4PJO A;  1GCQ A;  3VJP A;  4J5Y A;  4C92 A;  5IAY A;  3OW2 A;  1VQ7 A;  4II1 A;  2RD1 A;  3NFC A;  5FU6 C;  3EFR A;  4M78 D;  1NPR A;  2EJF A;  2EAY A;  2EFI A;  2RI3 A;  5FU7 C;  2DTH A;  2DTO A;  2KY9 A;  4ZNX A;  3L1A A;  2CKK A;  2V26 A;  5C0M A;  4FU6 A;  3CXC P;  2FL7 A;  3EG1 A;  1M3B A;  2P0Q A;  1ZUK A;  2YRD A;  4PJM A;  2YWW A;  1WQ7 A;  2DIQ A;  2DMO A;  5KYU B;  1TWB A;  2F2V A;  4RTY A;  5AYF A;  1Q86 U;  5GAO r;  1VOM A;  4IKF A;  1K9M C;  3OMG A;  3CMA Q;  4MZT A;  5FU6 B;  4VUB A;  3H0F A;  2DK3 A;  1D0Y A;  2RQU A;  1OI1 A;  4AT1 B;  2K5I A;  1N5Z A;  3SB2 A;  3ASK A;  4E7L A;  1WHK A;  1QCF A;  1K8A R;  3HL8 A;  1I81 A;  2CH4 A;  1VQP Q;  3WVD B;  4M78 F;  1V76 A;  4BE1 A;  1Q82 U;  2BTT A;  3VKI A;  2E4H A;  1FWZ A;  3FDR A;  4E2F B;  5CCA A;  3L2R A;  1G3S A;  2DVE A;  4M78 A;  1BIB A;  3L2Q A;  2VUB A;  3GLX A;  2EYQ A;  3V8J A;  3OYD A;  4XQ3 A;  3M0T A;  1IB8 A;  1K1Z A;  2LX9 A;  5FRN A;  1ZQ1 A;  3J81 E;  2E12 A;  2DL4 A;  1JU5 C;  1QMC A;  4L59 A;  3SWN A;  1U3O A;  2BUD A;  4N4G A;  4GBQ A;  4IUU A;  2F2W A;  4HCZ A;  2Z0W A;  2DTI A;  2KAF A;  1XNI A;  3G4S Q;  2V1R A;  3INZ A;  1G3Y A;  3QWY A;  2FO0 A;  4PK4 A;  1RAC B;  2OAU A;  3QDR B;  3E19 A;  4M7D G;  4A4G A;  5KE2 A;  1PD0 A;  5I21 A;  2QEX A;  2AKK A;  2F5K A;  3VS0 A;  4Q5W A;  1QP2 A;  1M9S A;  1M90 C;  1HD3 A;  2CH4 W;  2CT3 A;  4UC4 A;  2MPX C;  2JTE A;  4M7A E;  5CKE A;  2CP5 A;  1W4S A;  4A53 A;  2JMC A;  2M1H A;  4J8O A;  1OEB A;  5GAM d;  2KRO A;  3MEA A;  5GAN 6;  4M75 A;  3JB9 I;  3CBM A;  4MMK A;  3O8V A;  1PNJ A;  4JRP A;  2DRM A;  2DX1 A;  2JN0 A;  2ROL A;  4C5I A;  2ESW A;  2DIG A;  4RCB A;  1PHT A;  2DBK A;  3RES A;  5LJ5 d;  2CP7 A;  2OTJ A;  1G5V A;  4LNP A;  2LDM A;  2O4X A;  1KD1 U;  1Q81 C;  2D0N A;  1UGP B;  4M75 D;  2FPE A;  4D6W A;  4C0D B;  2FB7 A;  4HCK A;  3CCU T;  4O5V A;  3SEM A;  1QKX A;  1ZBX A;  4JZ3 A;  1B3Q A;  3UF4 A;  1ZHI A;  1OUL A;  4EMK B;  3EFS A;  3M0R A;  4LUE A;  5CO7 A;  1BK2 A;  4N4H A;  2R5M A;  3M59 A;  1YWP A;  2C0T A;  1GCQ C;  2CGH A;  1OX8 A;  2A36 A;  2R5A A;  3CC4 Q;  1NJI C;  1AWX A;  2PVD B;  1Q86 C;  2KXD A;  3G4S T;  1M3C A;  2JTF A;  2BZY A;  2PVO B;  4HVU A;  3TSW A;  1AZE A;  1M1G A;  3H6Z A;  3A8L B;  4RTW A;  2DZC A;  2X4J A;  2DET A;  4PL6 A;  4HVW A;  4PJO E;  4KT0 E;  1LCK A;  1GFC A;  1WHH A;  3E2U A;  2EW3 A;  2LNH B;  3CCQ A;  1X2K A;  4LD9 K;  1NLP C;  1NEG A;  4EMK A;  4PJN A;  3KXT A;  3M0S A;  3M0P A;  2QQ9 A;  4DEY A;  2XDB A;  3I56 T;  3QZ9 B;  1AD5 A;  4C5H A;  2DD4 A;  1JEG A;  1B34 B;  5LJ3 f;  3NTI A;  1VQK A;  2WAC A;  1K73 R;  3RKX A;  1D1C A;  1M2O A;  2YLB A;  3MEU A;  4J9E A;  5GAN 4;  2JW4 A;  5GAO p;  3DB4 A;  3CCM A;  4ATO A;  1IHW A;  2RA2 A;  4OVA A;  3JCM W;  4XTZ A;  5GAO l;  3BE3 A;  1UHF A;  2RH2 A;  1UGS B;  3NPF A;  1MND A;  4M7A F;  3CCV A;  2XMF A;  2A0F B;  4F14 A;  4BB7 A;  4JJC A;  2A7Y A;  1X2Q A;  4CRI A;  3FB9 A;  5CKH A;  4DOW A;  2NLU A;  5L8R E;  1NYF A;  2CP3 A;  3CCE Q;  4ANJ A;  5GAM g;  2ZPH B;  3E1S A;  3GBQ A;  5IHN A;  3EGD A;  3OA6 A;  4DOV A;  3LH0 A;  4OB3 B;  1GBR A;  5CAI A;  1VQ8 A;  2X4W A;  2XK0 A;  4Z8A A;  4BI3 A;  5GMK l;  1O75 A;  2ZPB B;  2Y4Y A;  1YIJ T;  4ZGE B;  1X01 A;  4WTO B;  4OML A;  3JAM E;  1VQ5 Q;  2MK5 A;  2FRW A;  4OB1 B;  5IN1 A;  4C5E A;  5GAN 3;  2C0O A;  3V8L A;  4EPC A;  3CCV Q;  1VQ4 T;  5GAN g;  2RQW A;  1KJW A;  1VQ9 Q;  3FEO A;  4BUG A;  3CMA A;  1I1J A;  3CBP A;  4XTV A;  4AFS C;  3VU3 C;  1EX4 A;  2VB6 A;  4A4F A;  2RHZ A;  1OYX A;  3THK A;  2PZ1 A;  2DRK A;  1Q82 C;  4PJO B;  3V7S A;  3FLG A;  2LNV A;  2EBP A;  1VIE A;  5LJ3 j;  4QT7 A;  3UWN A;  4N0A C;  2J6K A;  2A28 A;  1R77 A;  1GRI A;  2BE9 B;  4XTX A;  3JB9 G;  5GJW B;  2GNC A;  2NUZ A;  1ABQ A;  1I07 A;  4JLI A;  4FW1 A;  4RTZ A;  2GF7 A;  1ZLM A;  2OTJ Q;  1TH7 A;  3MP1 A;  1LJO A;  2X9H A;  5ECA A;  5IH2 A;  2OX7 A;  2IPO B;  1IRE B;  1ABO A;  2RPN A;  1PWT A;  2V8I A;  3OSS C;  4PJO C;  3ZBD A;  3PVL A;  4DA4 A;  1VQ9 A;  2FYK A;  5A0L A;  3CME Q;  3FJP A;  5CKB A;  3QXE B;  2HKN A;  4FT4 A;  5LJ5 f;  1RI0 A;  2HL3 A;  4QKU A;  1BCO A;  1G2B A;  2KT1 A;  1JJ2 A;  4V2S A;  2BKD N;  4BDZ A;  1U8R A;  2OTL Q;  4M75 E;  2M0O A;  3G1J A;  3CCQ Q;  4ZTJ A;  2JVV A;  1HK9 A;  4E7Z A;  3O5Z A;  5C6S A;  4M7A C;  1SSF A;  3HFO A;  2MWP A;  2VGM A;  1N6A A;  4FM4 B;  4QW2 A;  4JRI A;  1M30 A;  3C4S A;  4ORZ A;  3X28 B;  4AFQ C;  1SEM A;  2KXC A;  4PLI A;  4ELY C;  1GXI E;  1UUE A;  2FZG B;  2K3B A;  2EQM A;  2HMA A;  2HSE B;  1FX7 A;  3CCJ T;  3EG0 A;  3JB9 F;  3WXM B;  1BBZ A;  1VQ5 A;  5GMK m;  4FSX A;  4JS5 A;  1G8X A;  1SRL A;  3URG A;  2VAS A;  4FIB A;  2ZPG B;  3X25 B;  4HXJ A;  1MV3 A;  2JZ2 A;  3AHU A;  3A8M B;  3R6N A;  3CCS A;  4RTU A;  4QQ6 A;  5GAM e;  1Q95 G;  2YRV A;  1OZ3 A;  5D6Y A;  3CCR Q;  2OTJ T;  2FVU A;  2DO3 A;  1KFZ A;  1UE9 A;  2DXU A;  3VS3 A;  3H41 A;  2AT1 B;  4F7U E;  2E41 A;  5IXF A;  2CZ6 B;  1ACM B;  1WXU A;  2MMP A;  5GMK e;  2FPD A;  2JMA A;  4J9I A;  4OMO A;  4FW2 A;  4E7I A;  2HQX A;  3CPW A;  2O4X B;  3TCJ A;  2KRS A;  2LJ3 A;  1UJY A;  4FYY B;  2QEX T;  3OYC A;  4IUR A;  3QO3 A;  2XDD A;  2NWM A;  1Q7Y R;  2IVW A;  2RQT A;  4L6V 5;  2QXF A;  3EH1 A;  3PVQ A;  2I2L A;  3DLL A;  1PSE A;  3CPW S;  3RIR A;  3GPL A;  3V8K A;  3HRS A;  1YFN A;  1YHQ A;  4E47 A;  3G7Z A;  4FYV B;  3X26 B;  3S3N A;  1JO8 A;  4FCY A;  2ROT A;  1H8K A;  4Y28 E;  2PUO B;  4C0Z A;  4HA8 A;  4PJO F;  1ZSZ A;  1WHG A;  1M1F A;  2YUQ A;  2O88 A;  1SPK A;  2YUO A;  2JS0 A;  5LJ3 e;  2QQB A;  3CCJ Q;  4Z88 A;  2E10 A;  4PKC C;  3LYI A;  5A2Q E;  4ESR A;  4KUI A;  1U06 A;  4OGC A;  3UDC A;  3CME A;  4M77 A;  4RCC A;  2DVJ A;  4N0A A;  1AWJ A;  1C0M A;  4HVV A;  3JCM f;  1FMW A;  3LW5 E;  5KYW B;  2XKO C;  1SHF A;  2KRM A;  4ELZ C;  4CC4 B;  1DJ7 B;  5GJV B;  1TSF A;  2RHI A;  3BDU A;  3UPU A;  2MOX A;  1WHJ A;  3G71 Q;  4LDU A;  1M2V B;  1T3L A;  2RJE A;  2VVK A;  2H3E B;  1SKU B;  2CS7 A;  2ED1 A;  2KSS A;  6AT1 B;  2C0I A;  2K57 A;  2WSC E;  3MET A;  3RMS A;  4MDX A;  5J3B A;  1HJD A;  4BD3 A;  4HT8 A;  3NHN A;  1VQL T;  3VRY A;  1VQN T;  2YXY A;  1RL2 A;  1QVP A;  4M7D D;  2QEX Q;  1YI2 Q;  3DKM A;  1YJ9 A;  2JM8 A;  1G3W A;  2VYT A;  3HTR A;  1VUB A;  2O2O A;  1VQO Q;  4C0F A;  3CCU Q;  3EG9 B;  1N8R R;  1D1A A;  4F7U G;  1W1F A;  4PFP A;  3REB B;  2JM9 A;  3OY9 A;  2NUP A;  3VS5 A;  1P92 A;  2LQN A;  3SWN C;  2DM1 A;  1NZ9 A;  2B8A A;  1XJW B;  5KYU A;  2RHX A;  2QI2 A;  4DEX A;  2E70 A;  3OYG A;  3FIF A;  1PRL C;  5DY9 A;  1QVG P;  4FYX B;  3FC3 A;  4CC3 A;  1WDX A;  3OS0 A;  2D8J A;  8AT1 B;  2LTO A;  2QK0 A;  3CCM T;  2O9S A;  2HEQ A;  2ZPI B;  4GLM A;  1YJN A;  4LDV A;  4ZGJ B;  3CCE A;  1NEB A;  1K73 C;  2X4Y A;  4IIM A;  1OQK A;  2RI2 A;  1CKB A;  3DLM A;  2OAW A;  4Z89 A;  4J9D A;  4NL2 A;  2E64 A;  5CVI A;  5D6X A;  2RHU A;  2HNI A;  2D8H A;  1M2V A;  4QVC A;  4CC7 A;  3P8B B;  3M0Q A;  2DYI A;  1OV3 A;  2PNI A;  2VXE A;  1ZBJ A;  2VWF A;  4A63 B;  3JCM g;  4JPB W;  1WNL A;  3FJ5 A;  2H8H A;  4ZN3 A;  3KUF A;  1K4U S;  3G71 T;  3CPF A;  5M9O A;  2ZPE B;  3GNG A;  3F70 A;  1YIJ Q;  2BE7 D;  3C12 A;  5AT1 B;  1VQM A;  2OI3 A;  2AK5 A;  3OBW A;  4A4E A;  3QYH B;  1IZ6 A;  3A1P A;  1Y96 B;  3RKY A;  2A3L A;  4XK8 E;  1LOJ A;  4M75 G;  3I55 A;  1KHI A;  3QWX X;  4M7D C;  3EG9 A;  5IT9 E;  1VQK Q;  3E9F A;  4X34 A;  3LLR A;  4JLG A;  3CC7 T;  1MV0 B;  3I9Q A;  4GLK A;  1YI2 T;  1W2B P;  4RMO A;  1X6G A;  2CUB A;  2SEM A;  1M8V A;  1X6B A;  4XU3 A;  3VYH B;  1E6G A;  5LJ3 g;  4BY6 C;  3TSZ A;  3M0U A;  2XID A;  4HCB A;  1S72 Q;  3S3O A;  3GNF B;  1WXB A;  2CZ1 B;  1Q81 U;  3IQL A;  2XG8 D;  4O6J A;  1QVF A;  5KYX A;  1OZ2 A;  1M8M A;  1ZSG A;  1ZUU A;  2KR3 A;  1WPY A;  1VYT A;  3QDF A;  3V7C A;  2RF0 A;  4F7U A;  3CCS Q;  4M75 B;  1RLQ C;  4C92 C;  1FMK A;  4RTV A;  2COY A;  4OF1 A;  2CSQ A;  2L8D A;  1VQ5 T;  4BDY A;  3JCM h;  5CK9 A;  2KQW A;  5GAN 7;  5GAN h;  1BI3 A;  5CQX A;  1VQ9 T;  4LDW A;  2CRE A;  4XTW A;  1VQP T;  4OMM A;  4F17 A;  2CZ7 B;  1JQQ A;  2HQE A;  3OYN A;  1K9A A;  2LQW A;  3RUX A;  2E3I A;  2GQI A;  1S72 A;  5GAN e;  4M77 D;  2AZS A;  1YNZ A;  4KUD K;  2LVM A;  4E7H A;  3M5A A;  3CCQ T;  3T9N A;  3I5S A;  4DBQ A;  1YJ9 Q;  1JJ2 P;  1WX6 A;  3HKS A;  1QW1 A;  1RAD B;  3UAT A;  3I56 A;  3VS4 A;  1NBE B;  1PKT A;  3VRZ A;  1KK7 A;  3QSU A;  1VQK T;  3QJ6 A;  3OYA A;  2QGG A;  1NG2 A;  1RAI B;  3NTK A;  1ARK A;  4RTT A;  2J06 A;  1QVF P;  3JV3 A;  1M90 U;  4M78 E;  4X9D A;  3SFM A;  2J6O A;  1WHL A;  2VV5 A;  3GF5 A;  4JDS A;  1Q7Y C;  1M3A A;  3ZL7 C;  1K0S A;  4JZ4 A;  2EYZ A;  2PVG B;  4D8K A;  4QQG A;  2KI7 A;  2EKO A;  1KQ1 A;  1X75 C;  1Z9Q A;  2DYB A;  4M78 G;  3CXC S;  5LJ5 e;  3P8D A;  2OTL T;  1R0C B;  2V8K A;  1B34 A;  4FSS A;  3OYE A;  3LWH A;  2DEQ A;  1YJW T;  1Q81 R;  2RM4 A;  2HSP A;  3CCS T;  1I5O B;  1QCN A;  3OBY A;  4LE9 A;  1SF9 A;  3H0I A;  2JUF A;  1TUC A;  2P4R A;  1VQ8 T;  4QVZ A;  1EFN A;  1PG5 B;  3OW2 P;  5IXB A;  1D1B A;  1YP5 A;  2AHJ B;  5KCH A;  4ZN1 A;  2MCN A;  5EG2 A;  4LD6 A;  2K6D A;  5CQY A;  1KQS P;  2PTK A;  3RMQ A;  1WQW A;  1Y07 A;  2W10 A;  4EMH A;  3X24 B;  2DPP B;  1QVG A;  1M1K R;  1YN8 A;  2RK2 A;  4JJB A;  5GAM j;  2FPF A;  4OB0 B;  3VS1 A;  1H92 A;  1FXX A;  1BI1 A;  2QTX A;  3C95 A;  4QQD A;  1M5Q 1;  1YWO A;  1FMV A;  2QGF B;  3J80 E;  2QA4 T;  1VQ6 A;  5D6W A;  2E65 A;  4MZM A;  5I2M A;  2EGC A;  4MDW A;  4EMG A;  5HCK A;  2D9T A;  2O9V A;  1BU1 A;  1VQN A;  1BIA A;  1MMA A;  2AIR B;  5I22 A;  4EMK C;  4XU1 A;  4OGE A;  3PNW C;  1KQS A;  4Y92 A;  2PUK B;  4OB2 B;  3L2Z A;  2ENM A;  2FZC B;  2AZV A;  1PKS A;  5FRM A;  2BIV A;  1BI0 A;  4J9F A;  1XTD A;  4KBM B;  1EIF A;  3EH2 A;  1UGV A;  2RK1 A;  1VIF A;  4IUT A;  5EC7 A;  4EIK A;  1JBM A;  2K3Y A;  3JCM b;  1X43 A;  2L89 A;  5FWB A;  2R58 A;  2HAX A;  3TRE A;  5LJ5 j;  1PM3 A;  3RR6 A;  3CC2 T;  2ABL A;  5IHI A;  3HSB A;  2QQR A;  4LXC A;  1NJI R;  1ZA1 B;  2KMT A;  2MF2 A;  4HT9 A;  1SHG A;  5CKD A;  1QVF S;  3ULR B;  3I55 Q;  4LDX A;  3OYM A;  2KDS A;  2GBQ A;  4J6W A;  5A0D A;  1VQN Q;  1YHQ Q;  1MMD A;  1KG1 A;  2C06 A;  1VQ7 Q;  1VQL A;  2DBM A;  5IHK A;  3MP8 A;  2X51 A;  2LQK A;  3OYI A;  5KYN A;  2PQW A;  5D7U A;  4RKU E;  2FRY A;  3BFM A;  3PMT A;  3NTH A;  2EQK A;  4JUV A;  1QWE A;  1BCM A;  1U5S A;  4C8Q G;  3HPW A;  3JB9 H;  4J9C A;  1GFD A;  4DBF A;  4IUQ A;  4J9H A;  4D8D A;  2K9G A;  1YI2 A;  3TQ7 P;  1Y96 A;  4RG8 A;  5FU7 B;  3M55 A;  3EHR A;  2Y90 A;  3OQ5 A;  1RAE B;  1K76 A;  3MPU B;  1NM7 A;  4C92 E;  3GP8 A;  2PU9 B;  2YLC A;  4JRQ A;  2ZCF B;  3QZ5 B;  5LJ5 g;  1VYV A;  4TVR A;  1YIJ A;  3SHW A;  3C94 A;  1X27 A;  3TU4 K;  1C1A A;  4F16 A;  5CR2 A;  2GQV A;  1OU9 A;  2YRC A;  2QA4 A;  4P5N A;  2RI5 A;  1I5L A;  2IG0 A;  3JRZ A;  1MMG A;  1IO6 A;  1EZZ B;  5KE3 A;  2I0N A;  1QCO A;  3CC2 Q;  1JJ2 S;  2BZ8 A;  1D09 B;  1Q86 R;  3BDL A;  2GFU A;  1D3B B;  2LT4 A;  1X6O A;  2XU8 A;  3A8H B;  3I55 T;  2JJ9 A;  4K11 A;  2QDY B;  1U1T A;  1Q7Y U;  1M27 C;  3QBY A;  4IIO A;  4N4I A;  1RAG B;  3VS2 A;  1VQ7 T;  5GAN j;  1ZX6 A;  2COW A;  2E6N A;  3L2V A;  4PJO G;  1WJQ A;  3TEE A;  4A4H A;  5GAN 2;  4BE0 A;  4X1V A;  3I35 A;  1B7T A;  4R55 A;  5J39 A;  2DE0 X;  4RTX A;  3QHS A;  2EYY A;  3G6E Q;  2DF6 A;  2KGT A;  2L5Q A;  2ED0 A;  3JCM P;  3A8O B;  4F7U B;  2K5L A;  2P0K A;  3PTA A;  1K8A C;  3CME T;  3OYK A;  1QWF A;  4KRT A;  4AG1 C;  2LJ0 A;  5I11 A;  1T0H A;  1TUD A;  2JT4 A;  4XTY A;  9ATC B;  1YIT T;  4KGZ B;  3JCM e;  1E7O A;  1OX9 A;  4J6Y A;  2LCL A;  1M4Z A;  3RKW A;  2K5F A;  2FZK B;  1RAF B;  2HCK A;  3OMC A;  3QPH A;  2E5Q A;  1ZUY A;  2EGE A;  3CC7 Q;  1WXT A;  1LVK A;  3CCL Q;  5GAN 5;  3E9G A;  3ZFJ A;  3EGX B;  1UEC A;  2VC8 A;  1NLO C;  1KD1 C;  1Y71 A;  2HBW A;  2DAQ A;  2YSQ A;  4PFO A;  3J7A F;  3MHX A;  1RUW A;  1VQP A;  1S72 T;  1JB0 E;  1BB9 A;  4JJD A;  2FHD A;  1UTI A;  3EG2 A;  3QYG B;  2X3W D;  3LWI A;  2R57 A;  2V1Q A;  2G3R A;  2YUN A;  3PFS A;  4C0D C;  1Y57 A;  2QYZ A;  2QAS A;  1TTH B;  2P4T A;  3L42 A;  3MO8 A;  2L3S A;  3CCR T;  2DFU A;  4NOY A;  2X35 A;  3CD6 T;  2VKN A;  1NJI U;  1X69 A;  2CP0 A;  3OSV A;  4YTL A;  1KD1 R;  2YT6 A;  1JRI A;  5GAN 8;  3MP6 A;  4M75 F;  4DBH A;  3OYY A;  1YJN T;  5GMK j;  1KC8 C;  4M7A B;  4ZGD B;  2EWN A;  4A54 A;  2D1X A;  1GBQ A;  2DL5 A;  4E7J A;  3KBG A;  3VUB A;  4GY5 A;  3ER0 A;  2OTL A;  1AOJ A;  1VQ4 A;  1AZG B;  3I5R A;  3EFO A;  1YJW A;  3OYL A;  2P84 A;  3EGX A;  4MML A;  5I2S A;  2EKH A;  3A5Z B;  2ATC B;  4M7D A;  3S6W A;  1VQ8 Q;  1R8O B;  1RAB B;  2F69 A;  4J7F A;  5FWC A;  2A37 A;  1HYO A;  4JJN K;  1I8F A;  1MMN A;  2JXB A;  2MAM A;  2CP2 A;  2RHY A;  2OJ2 A;  4HCC A;  4M7D F;  5J26 A;  2MWO A;  3MKD A;  5GAM h;  4L5G A;  3CQT A;  1W70 A;  3CC7 A;  2RMO A;  1D3B A;  1JXM A;  4PJJ A;  1TUG B;  3MCA B;  4C8Q F;  2ECZ A;  4JS4 A;  1W6X A;  1XOV A;  3FRN A;  3JB9 J;  1TG0 A;  2L2P A;  2RJF A;  3JCM J;  7AT1 B;  2M0Y A;  5LL6 S;  3VS7 A;  1QQJ A;  1K9M U;  2X3X D;  3C0C A;  1A0N B;  3M57 A;  1AVZ C;  3CC4 T;  1UDL A;  4F7U F;  1RI9 A;  2KRN A;  1QLY A;  1B07 A;  4J9G A;  2RN8 A;  3OS2 A;  1VQ6 T;  3RER A;  1U1S A;  2AKL A;  3EG3 A;  3HFN A;  1FYN A;  5A0G A;  3QUI A;  1N8R U;  4OMF B;  1Q82 R;  4C92 F;  3H8Z A;  2JOY A;  1GL5 A;  3MEW A;  5GAO q;  5KYY A;  3MEV A;  2QG9 B;  2HDA A;  3OYJ A;  4J9B A;  2EJG A;  3M53 A;  1IGU A;  2K2M A;  4RUG A;  5GAN f;  1VQL Q;  4PNO A; 
#chains in the Genus database with same CATH homology
 3CXC A;  4C8Q A;  5C6S A;  2KK4 A;  3BY7 A;  4M7A C;  1SSF A;  3HFO A;  4C5G A;  2MWP A;  2VGM A;  5DM7 R;  1N6A A;  2AHJ B;  2GFA A;  4FM4 B;  5GAN d;  5KCH A;  3M9Q A;  4QW2 A;  3HRT A;  4JRI A;  4ZN1 A;  2HBP A;  4XAX B;  5EG2 A;  3JCM V;  4LD6 A;  2M16 A;  4DQ2 A;  5CQY A;  1KQ2 A;  3C4S A;  3RMQ A;  1WQW A;  1Y07 A;  2DXB A;  4EMH A;  4XU0 A;  3X28 B;  3X24 B;  2DPP B;  2Y4X A;  3UT1 A;  2F5T X;  5CIU A;  1QVG A;  4PLI A;  2DD5 A;  4ELY C;  1GXI E;  3G6E A;  1N9R A;  2DKG A;  2RK2 A;  2XHC A;  5GAM j;  2EQM A;  4OB0 B;  3CCJ T;  1FX7 A;  3GIB A;  3P8H A;  4E7K A;  3JB9 F;  3WXM B;  1VQ5 A;  3CCJ A;  2WSF E;  3LGF A;  5GMK m;  2E1H A;  4WF2 A;  1FXX A;  4FSX A;  1HXD A;  4JS5 A;  4PJO A;  1BI1 A;  3VJP A;  2QTX A;  3C95 A;  3URG A;  4QQD A;  1M5Q 1;  4FIB A;  4J5Y A;  2ZPG B;  3J80 E;  1UB4 A;  4C92 A;  2QA4 T;  3X25 B;  1VQ6 A;  5D6W A;  5IAY A;  3L2U A;  3OW2 A;  2E65 A;  1VQ7 A;  4MZM A;  5LJ5 h;  5I2M A;  4EMG A;  4II1 A;  4MDW A;  2RD1 A;  3NFC A;  2D9T A;  5FU6 C;  3EFR A;  1BIA A;  2JZ2 A;  1NPR A;  4M78 D;  2EJF A;  3A8M B;  1VQN A;  2EAY A;  2EFI A;  3AHU A;  4FT2 A;  2RI3 A;  2EQU A;  4EMK C;  3CCS A;  4QQ6 A;  5FU7 C;  1BI2 A;  4XU1 A;  5GAM e;  2DTH A;  4OGE A;  2DTO A;  2YRV A;  1OZ3 A;  3PNW C;  2JTM A;  2KY9 A;  4J6X A;  3L1A A;  1KQS A;  2PUK B;  4OB2 B;  2CKK A;  3L2Z A;  5D6Y A;  5C0M A;  4FU6 A;  2FL7 A;  2OTJ T;  3V7R A;  2P0Q A;  2H3J A;  3CBO A;  2FVU A;  5FRM A;  2BIV A;  2DO3 A;  3CCL A;  1BI0 A;  1PSF A;  1YCY A;  2DXU A;  1WQ7 A;  2DIQ A;  2V8J A;  3JCM Q;  3CCE T;  4XU2 A;  1XTD A;  2DXC A;  1EIF A;  4KBM B;  4F7U E;  4HKE A;  2E41 A;  5AYF A;  2CZ6 B;  3S3M A;  1Q86 U;  5GAO r;  2MMP A;  5GMK e;  2RK1 A;  1VIF A;  4IKF A;  4Z02 A;  4E7I A;  1K9M C;  2HQX A;  3OMG A;  4IUT A;  3CPW A;  4MZT A;  2O4X B;  5FU6 B;  3TCJ A;  1JBM A;  2K3Y A;  4VUB A;  3JCM b;  2DK3 A;  3M4G A;  2L89 A;  2XIC A;  1OI1 A;  2R58 A;  3CD6 A;  2K5I A;  2HAX A;  3TRE A;  2QEX T;  5LJ5 j;  3SB2 A;  2VGN A;  3OYC A;  3CC2 T;  3ASK A;  2WSE E;  4IUR A;  4C8Q E;  3GOX A;  4E7L A;  3QO3 A;  3HL8 A;  1I81 A;  4C8Q C;  2XDD A;  3WVD B;  3G71 A;  2HD0 A;  3HSB A;  2IVW A;  4L6V 5;  4M7A D;  4M78 F;  2QXF A;  2QQR A;  3M4Y A;  2I2L A;  3DLL A;  1PSE A;  3CPW S;  2KMT A;  3RIR A;  3GPL A;  2MF2 A;  1YHQ T;  4BE1 A;  1Q82 U;  3VKI A;  4HT9 A;  3V8K A;  1FWZ A;  5CKD A;  1QVF S;  4LDX A;  3HRS A;  1YHQ A;  3FDR A;  3OYM A;  4E47 A;  3SWN B;  2X4X A;  5CCA A;  1XQH A;  2KDS A;  3G7Z A;  3CC4 A;  3X26 B;  3L2R A;  3S3N A;  1G3S A;  2DVE A;  4J6W A;  4M7D B;  5A0D A;  4M78 A;  1BIB A;  3L2Q A;  1KG1 A;  2VUB A;  3GLX A;  3SDZ A;  3VV0 A;  2C06 A;  4Y28 E;  2EYQ A;  2PUO B;  4M77 B;  3V8J A;  4C0Z A;  3OYD A;  4XQ3 A;  1VQL A;  4HA8 A;  4PJO F;  1M1F A;  1WGS A;  3MP8 A;  1AHJ B;  2LX9 A;  4BE2 A;  1KQS S;  5FRN A;  1ZQ1 A;  3J81 E;  2E12 A;  5LJ3 e;  2QQB A;  2LQK A;  4L59 A;  3SWN A;  3OYI A;  2BUD A;  2PQW A;  1W2B A;  2LQ8 A;  4N4G A;  2E10 A;  4IUU A;  4RKU E;  4IUP A;  3BFM A;  3LYI A;  4PKC C;  3PMT A;  4HCZ A;  5A2Q E;  3NTH A;  2DTI A;  2EQK A;  4KUI A;  2KAF A;  4OGC A;  3I55 A;  4JUV A;  1XNI A;  3UDC A;  3CME A;  3JCM d;  4RG2 A;  4C8Q G;  4M77 A;  3QII A;  1M1K U;  4RCC A;  3HPW A;  3VUZ A;  4BI4 A;  3INZ A;  1G3Y A;  5FRO A;  4N0A A;  3JB9 H;  1WJR A;  5GAM f;  4J83 A;  3LGL A;  2K2V A;  3JSC A;  2OAU A;  3PT9 A;  3JCM f;  3QDR B;  4M77 E;  3E19 A;  4M7D G;  3LW5 E;  4A4G A;  4IUQ A;  5KE2 A;  4M77 C;  4QVD A;  5I21 A;  1YI2 A;  2XKO C;  2QEX A;  3LX7 A;  1Y96 A;  4ELZ C;  4RG8 A;  1K73 U;  3A8G B;  5FU7 B;  1UGQ B;  2F5K A;  3M55 A;  2JNG A;  1QVG S;  1DJ7 B;  4Q5W A;  1QP2 A;  2Y90 A;  3OQ5 A;  4JRK A;  4A4K A;  1M9S A;  2RHI A;  5GMK h;  4C92 E;  1M90 C;  3BDU A;  3GP8 A;  2PU9 B;  3G6E T;  2YLC A;  4JRQ A;  3UPU A;  2ZCF B;  4LDU A;  1O9S A;  4C0G A;  4CI0 C;  4UC4 A;  3QZ5 B;  5LJ5 g;  2RJE A;  4TVR A;  1YIJ A;  2CS7 A;  3C94 A;  4M7A E;  1H3Z A;  2KSS A;  3TU4 K;  5CKE A;  2K57 A;  2WSC E;  1W4S A;  2KVQ G;  3MET A;  3Q1J A;  3RMS A;  1N9S A;  4A53 A;  2GQV A;  5J3B A;  2M1H A;  4J8O A;  5CR2 A;  5GAM d;  3PIP A;  4BD3 A;  1KC8 U;  2K3X A;  4HT8 A;  2QA4 A;  4P5N A;  2RI5 A;  3MEA A;  4M75 A;  5GAN 6;  3JB9 I;  1I5L A;  2IG0 A;  1VQL T;  1NE8 A;  3JRZ A;  1VQN T;  3CBM A;  1RL2 A;  4MMK A;  1QVP A;  1HK9 A;  3O8V A;  4M7D D;  4NS5 A;  2MI6 A;  5GAO n;  1YJ9 T;  5KE3 A;  4JRP A;  3DB3 A;  3DKM A;  5KCO A;  2JN0 A;  1YJ9 A;  1JJ2 S;  2GCX A;  3CC2 A;  4PJO D;  2DJZ A;  4C5I A;  1G3W A;  2DIG A;  2VYT A;  4RCB A;  3QG1 A;  2LCC A;  2DXT A;  1VUB A;  2L3R A;  3RES A;  3BDL A;  5LJ5 d;  2OTJ A;  2GFU A;  1D3B B;  4C0F A;  1G5V A;  2LT4 A;  2LDM A;  1X6O A;  2O4X A;  1KD1 U;  4F7U G;  2XU8 A;  1Q81 C;  3A8H B;  3CCL T;  3I55 T;  1UEB A;  1UGP B;  4M75 D;  4D6W A;  5KH6 A;  1UGR B;  2LRQ A;  4C0D B;  3OY9 A;  2FB7 A;  2QDY B;  1U1T A;  1Q7Y U;  3CCU T;  1P92 A;  4O5V A;  3QBY A;  4N4I A;  3M54 A;  3SWN C;  1NZ9 A;  1ZBX A;  2B8A A;  1VQ7 T;  2RHX A;  5GAN j;  1ZHI A;  2QI2 A;  2E70 A;  4EMK B;  5FLX E;  3EFS A;  2E6N A;  3L2V A;  3OYG A;  4PJO G;  3CMA T;  5CO7 A;  1WJQ A;  4N4H A;  2R5M A;  3FIF A;  3M59 A;  5DY9 A;  3FC3 A;  3TEE A;  4XTU A;  4A4H A;  5HK0 A;  3OS0 A;  5GAN 2;  4BE0 A;  2CGH A;  3HRU A;  2LTO A;  1MHN A;  4R55 A;  2R5A A;  3CCM T;  5J39 A;  2QQA A;  1NJI C;  5GAO m;  2PVD B;  2ZPI B;  1Q86 C;  1YJN A;  3OS1 A;  4LDV A;  4KUL A;  3QHS A;  4ZGJ B;  3CCE A;  2X4Y A;  1K73 C;  2L5Q A;  3G4S T;  3JCM P;  2JTF A;  2PVO B;  3A8O B;  2K5L A;  5LJ3 h;  2RI2 A;  2P0K A;  4C92 D;  4F7U B;  3QKJ A;  3PTA A;  1M1G A;  3JCM c;  3OYK A;  3CME T;  1VQO A;  3H6Z A;  3DLM A;  2RJC A;  2LT1 A;  5LJ3 d;  3OYH A;  3A8L B;  4NL2 A;  2DZC A;  2E64 A;  5CVI A;  2X4J A;  5D6X A;  2RHU A;  2HNI A;  4PL6 A;  2QQS A;  3ZEH A;  3M56 A;  4QVC A;  3HP9 A;  4PJO E;  4KT0 E;  3P8B B;  4M7A A;  2YHT A;  4XTY A;  2EJ9 A;  1YIT T;  4OP0 A;  3JCM e;  2VXE A;  4J6Y A;  5CKF A;  3OYF A;  1N27 A;  2LCL A;  3JCM g;  1WNL A;  1M4Z A;  4ZN3 A;  3RKW A;  3KUF A;  3CCQ A;  2K5F A;  3G71 T;  3CPF A;  5M9O A;  1N8R C;  4LD9 K;  5HY6 A;  4EMK A;  1QP3 A;  2ZPE B;  4C92 G;  3OMC A;  3GNG A;  3QPH A;  3F70 A;  3KXT A;  2E5Q A;  3C12 A;  1VQM A;  2QQ9 A;  2XDB A;  3OBW A;  4A4E A;  4BI8 B;  3QYH B;  1IZ6 A;  3I56 T;  3QZ9 B;  1Y96 B;  2A3L A;  3RKY A;  4XK8 E;  1LOJ A;  2CYZ B;  1B34 B;  2DD4 A;  4M75 G;  5LJ3 f;  3NTI A;  4C5H A;  3E9G A;  4Y91 A;  3ZFJ A;  1KHI A;  5GAN 5;  1VQK A;  4M7D C;  2M9U A;  2WAC A;  3L2W A;  4BAC A;  2VC8 A;  5IT9 E;  4M7D E;  3CCU A;  4MZP A;  3RKX A;  1KD1 C;  1Y71 A;  3E9F A;  2DAQ A;  4J7I A;  4X34 A;  3LLR A;  2YLB A;  4JLG A;  3OYB A;  3CC7 T;  3MEU A;  4GLK A;  3J7A F;  1V29 B;  5GMK i;  1YI2 T;  3MHX A;  5GAN 4;  5DLQ E;  4RMO A;  1VQP A;  5GAO p;  1S72 T;  2D6F A;  1W2B S;  4M77 F;  1M8V A;  3DB4 A;  1JB0 E;  4XU3 A;  3VYH B;  3CCM A;  5HK3 A;  5LJ3 g;  4ATO A;  2ZPF B;  2FHD A;  4BY6 C;  2XID A;  4NL3 A;  4HCB A;  2RA2 A;  4OVA A;  3JCM W;  4XTZ A;  5GAO l;  3QYG B;  4MDX A;  3LWI A;  3G4S A;  1I4K 1;  2RH2 A;  4LDY A;  1UGS B;  4M7A F;  3CCV A;  2R57 A;  2G3R A;  1BKB A;  3PFS A;  4C0D C;  3S3O A;  3GNF B;  4BB7 A;  2CZ1 B;  2A7Y A;  1Q81 U;  3CEY A;  5DLO A;  2P4T A;  3L42 A;  3MO8 A;  4CRI A;  2XG8 D;  4O6J A;  1QVF A;  1K8A U;  1G3T A;  3FB9 A;  3CCR T;  2RJD A;  5CKH A;  4DOW A;  2RB6 A;  2NLU A;  1OZ2 A;  4NOY A;  5L8R E;  4M77 G;  2X35 A;  3CD6 T;  1KHC A;  1NJI U;  3OSV A;  1WPY A;  5GAM g;  4YTL A;  4X9C A;  2ZPH B;  3V7C A;  4F7U A;  3E1S A;  1JRI A;  4M75 B;  5GAN 8;  4C92 C;  3OA6 A;  4DOV A;  3MP6 A;  3LH0 A;  4M75 F;  4OB3 B;  4PLL A;  2VXF A;  3EAE A;  5CAI A;  4OF1 A;  1VQ8 A;  2L8D A;  1NPP A;  2X4W A;  3OYY A;  2XK0 A;  3PGG A;  5GMK j;  1YJN T;  1KC8 C;  4BI3 A;  1VQ5 T;  5GMK l;  1O75 A;  2ZPB B;  2E6Z A;  2Y4Y A;  4BDY A;  1BYM A;  1YIJ T;  3OS5 A;  4M7A B;  4ZGD B;  2EWN A;  3JCM h;  4A54 A;  5CK9 A;  2KQW A;  4ZGE B;  1Y7X A;  5GAN h;  5GAN 7;  4E7J A;  1X01 A;  2ZGW A;  1BI3 A;  3KBG A;  2P0P A;  3VUB A;  2DZ9 A;  3JAM E;  4GY5 A;  3ER0 A;  5CQX A;  1VQ9 T;  2OTL A;  4LDW A;  4XTW A;  1VQP T;  4EDU A;  4OB1 B;  5IN1 A;  4C5E A;  5GAN 3;  1VQ4 A;  3V8L A;  3HHT B;  2CZ7 B;  2HQE A;  4EPC A;  3OYN A;  2EIF A;  3OYL A;  1VQ4 T;  1YJW A;  1YIT A;  5GAN g;  3RUX A;  3VYG A;  3JCM X;  1S72 A;  4MML A;  5I2S A;  3FEO A;  4BUG A;  3CMA A;  5GAN e;  3A5Z B;  4M77 D;  4M7D A;  3SD4 A;  1YBY A;  2K4Y A;  4M78 B;  3S6W A;  3CBP A;  4KUD K;  2LVM A;  4E7H A;  3M5A A;  1R8O B;  2F69 A;  4J7F A;  4XTV A;  3T9N A;  3X20 B;  3CCQ T;  4FL6 A;  2LC4 A;  3CCV T;  3VU3 C;  4JJN K;  3HKS A;  1I8F A;  1QW1 A;  4A4F A;  2MAM A;  2RHZ A;  3I56 A;  2RHY A;  1OYX A;  3OW2 S;  3ME9 A;  1WJS A;  4HCC A;  3R6O A;  3QSU A;  4M7D F;  2XD0 A;  1VQO T;  5J26 A;  1VQK T;  2MWO A;  5GAM h;  1Q82 C;  4L5G A;  3QJ6 A;  3OYA A;  2EQJ A;  3CC7 A;  4PJO B;  3NTK A;  1LNX A;  2CZ0 B;  1D3B A;  3FLG A;  3V7S A;  1H64 1;  2LNV A;  3QJY A;  3MCA B;  1VIE A;  4C8Q F;  5LJ3 j;  4JS4 A;  3UWN A;  1M90 U;  4M78 E;  4N0A C;  4X9D A;  3SFM A;  2XDP A;  4R56 A;  3JB9 G;  4XTX A;  4C8Q B;  1XOV A;  2VV5 A;  3FRN A;  4M78 C;  3JB9 J;  3GF5 A;  4JDS A;  4BY6 B;  4M7A G;  4JLI A;  2RJF A;  1M1K C;  3PMI A;  3JCM J;  2GF7 A;  1Q7Y C;  2O01 E;  5LL6 S;  1TH7 A;  3MP1 A;  4IUV A;  2PVG B;  1K8A C;  1K9M U;  1LJO A;  4QQG A;  3M57 A;  3M58 A;  3CC4 T;  4F7U F;  1IRE B;  2EKO A;  1KQ1 A;  1X75 C;  4M78 G;  3CXC S;  2V8I A;  3OSS C;  3OS2 A;  4PJO C;  1VQ6 T;  5LJ5 e;  3OB9 A;  3P8D A;  3ZBD A;  4DA4 A;  1VQ9 A;  2FYK A;  2RO0 A;  5A0L A;  3CCR A;  1U1S A;  2OTL T;  3RER A;  2V8K A;  3FJP A;  5HKC A;  3PIO A;  5CKB A;  3JB9 D;  3HFN A;  3QXE B;  4B9X A;  4FT4 A;  5LJ5 f;  1B34 A;  1RI0 A;  5A0G A;  3QUI A;  1N8R U;  3OYE A;  3LWH A;  2DEQ A;  1YJW T;  4OMF B;  2RM4 A;  3WVE B;  3CCS T;  1JJ2 A;  3OBY A;  4B9W A;  4C92 F;  4V2S A;  2BKD N;  3N5B B;  4ME7 A;  4BDZ A;  1U8R A;  3H8Z A;  4M75 C;  2JOY A;  2XI9 A;  4C92 B;  3MEW A;  5GAO q;  1MGQ A;  4M75 E;  2M0O A;  2JUF A;  3MEV A;  4ZTF A;  2D0Q B;  1VQ8 T;  2ZZD A;  3BW1 A;  4QVZ A;  3OYJ A;  2EJG A;  1VQM T;  3M53 A;  4ZTJ A;  4C8Q D;  5GAN f;  2JVV A;  4PNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...