3O8VA

Crystal structure of the tudor domains from fxr1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
102
Chain Sequence
b'LTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPSEGDEVEVYSRPCGWWLAKVRMMKGEFYVIEYYNEIVTFERLRPVNQNKTVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fragile X mental retardation syndrome-related protein 1
molecule tags Protein binding
source organism Homo sapiens
publication title Structural Studies of the Tandem Tudor Domains of Fragile X Mental Retardation Related Proteins FXR1 and FXR2.
pubmed doi rcsb
total genus 22
structure length 102
sequence length 119
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3o8vA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3o8vA01
2DIQA 3L2QA 3MEUA 5IN1A 3LGFA 4CRIA 4E7LA 2E5QA 2R5MA 4LD6A 4B9XA 3GOXA 1SSFA 3OYAA 4QVZA 2JZ2A 5FRNA 3FEOA 4IURA 4QQGA 3P8HA 2RHYA 3P8DA 2FHDA 5KE2A 4PL6A 2R58A 4UC4A 4BDYA 2L3RA 4BACA 2DAQA 3OYEA 5D6WA 3OYBA 2RJEA 4B9WA 5J39A 4N4HA 4A4HA 3QJ6A 3OYMA 4C5HA 1G5VA 2GF7A 5C6SA 4OVAA 1OZ3A 3S3MA 1KHCA 3S6WA 2DIGA 3L2VA 1WGSA 3META 4IUVA 2X35A 4E7JA 4FL6A 2L89A 3C4SA 5CIUA 1WJRA 2X4YA 2LTOA 2EQMA 2BIVA 3OYNA 3DB4A 4BE0A 3ZEHA 3OS0A 4ZTJA 4FU6A 4RG2A 1MHNA 2LDMA 2RJFA 3OA6A 4X34A 2EKOA 2RI2A 3S3NA 4C5IA 3OYCA 3EAEA 4N4IA 4PLIA 2R5AA 2B8AA 2HQXA 3FLGA 3LLRA 4A4FA 2RI3A 5KH6A 3OQ5A 3S3OA 2WACA 4L59A 1RI0A 3QBYA 2EQKA 3OYGA 2GFUA 1OYXA 3CEYA 3OS2A 3E9GA 3O8VA 3MEVA 3LH0A 2F5KA 2QQRA 3LGLA 2QQSA 3H8ZA 4QW2A 5M9OA 5C0MA 3PMIA 3UWNA 3MEAA 3OY9A 2X4WA 1N27A 3ME9A 4GY5A 4IUTA 3OYJA 2EQJA 4C5EA 2RO0A 3PFSA 3L2WA 4A4GA 2JTFA 2K3YA 3DLMA 3BDLA 3MO8A 2X4XA 3OMGA 5KCHA 2O4XB 1OZ2A 3NTIA 4A4EA 5IAYA 2RHZA 2VYTA 2RI5A 3OYLA 3OYIA 3OYHA 2G3RA 2M16A 2R57A 3MEWA 3M9QA 1OI1A 3OB9A 3OYKA 4IKFA 2IG0A 2K3XA 2LCCA 2GFAA 2RJCA 4HCZA 5D6YA 2BKDN 3PMTA 4EDUA 3KUFA 3NTKA 3OYDA 3L2RA 5KCOA 2P0KA 3OYFA 4QQDA 3MP8A 2RJDA 3MP6A 5D6XA 3L42A 2BUDA 2M0OA 5FRMA 4E7HA 2HQEA 3SD4A 2L8DA 5J26A 1H3ZA 2O4XA 2E6NA 2RHIA 4IUUA 4N4GA 2NLUA 2MWPA 3OS1A 2M1HA 2EQUA 3OMCA 4E7KA 3F70A 4Z02A 2XK0A 4II1A 3QIIA 3E9FA 4E7IA 3Q1JA 3DB3A 3L2UA 4NS5A 4BE2A 2RHXA 2YRVA 5KE3A 3NTHA 4PLLA 2LVMA 2PQWA 2D9TA 2MWOA 3FDRA 3QKJA 4Q5WA 1WJQA 2RHUA 5FROA 4C5GA 1WJSA 4BDZA 3H6ZA 2XDPA 4BE1A 3FC3A 3LYIA 3MP1A 3ASKA 4IUPA 4BD3A 3PNWC 2LRQA 4QQ6A 4ZTFA 2CKKA 3UT1A 3LX7A 2EFIA 4IUQA 1XNIA
chains in the Genus database with same CATH superfamily
1SEMA 2EWNA 3GBQA 1JQQA 3VS6A 1FYNA 1RAFB 2QG9B 5FRNA 5FWCA 3CC2Q 3MHXA 2DEQA 2DBMA 3OSSC 4AG2C 2OTJA 4M77D 1EIFA 3G71Q 4FM4B 4PFPA 1U8RA 2PZ1A 3I5RA 3RUXA 1CSKA 5I11A 4IUVA 3DKMA 2QGFB 4CC7A 2C0TA 3FIFA 2RK1A 1RL2A 1G8XA 5GAMf 1X01A 5KYWA 1QQJA 1Q81U 2C0IA 2JM8A 4KGZB 5KH6A 2E3HA 2M9UA 5HK0A 2K5FA 1D0YA 4L59A 4DBFA 5GANj 2JXBA 1LOJA 1D0XA 5CCAA 2FG0A 1M9SA 3CC2T 3ZBDA 3LH0A 2DRKA 1GCPA 3CD6Q 5GAN5 5HKCA 4OB2B 3JCMc 1YWPA 4QW2A 2DZCA 3M58A 4LE9A 2FVUA 1QVFS 2HSPA 4D8KA 2X4WA 4C8QB 3CPFA 2JW4A 1NYGA 3A8HB 4JLGA 1AWWA 3CMEA 1GCQA 3E2UA 2O88A 1GL5A 1K1ZA 1XJWB 3CCVQ 2RI5A 3EG9B 4M4ZA 2AK5A 2O31A 3MKDA 5D6YA 1UEBA 1KC8C 3NTKA 3EGXA 2RJDA 3VS7A 1SKUB 2JMCA 1ZBJA 1AD5A 1V29B 3H0IA 1K76A 5DY9A 2E65A 1VQMA 4IUUA 2M1HA 1VQNT 2DXTA 4O6JA 4XQ3A 3QIIA 5CR2A 2NUPB 3QHSA 4ESRA 1M1FA 2DNUA 3THKA 4C5GA 2XDPA 2KRMA 1N5ZA 5FU7C 3MP1A 1YNZA 2HMAA 1UDLA 3DLLA 1I0CA 4ZTFA 4E7LA 1RACB 2PVOB 5CKDA 2L3SA 3G6ET 2K9GA 4F17A 5GJWB 2DAQA 4KGXB 5LJ3j 4VUBA 1MV3A 3UDCA 4JJNK 3RDVA 2DD5A 4OVAA 2KMTA 3TSZA 3GP8A 1OU9A 5GMKh 3C4SA 2L3PA 2GCXA 2LQNA 3EHRA 3ZEHA 3OS0A 4J9BA 2EIFA 2XDDA 1SHGA 2HNIA 2J6KA 3G4SA 3CXCA 2R5AA 1YJWT 3JV3A 1H8KA 5EG2A 4M77C 2COWA 1PNJA 1YJWA 5LJ3h 3HFOA 1G2BA 2QQRA 3CCMA 3CCUQ 2L3QA 4BY6C 1MMAA 3QZ9B 4DBRA 1E7OA 4O5VA 2VWFA 2RO0A 2H3JA 3TSWA 4XTVA 2D1XA 2DM1A 2RHZA 3JCMf 3HRTA 1WXTA 3OB9A 2KE9A 2YHTA 2OX7A 2J05A 4FYYB 4BUGA 5LJ5f 3MP8A 1MNEA 2LJ3A 3RR6A 4E7HA 2PTKA 3OW2S 2DERA 3A5ZB 1G83A 1VQ7Q 2KYMA 1W70A 9ATCB 1QVGS 4BE2A 4J9FA 3NTHA 1TUCA 2MWOA 4F7UF 3J81E 1VA7A 5CKHA 4QVZA 2JZ2A 3A8MB 4BDYA 3VRZA 1MNDA 3X26B 2BZYA 2EYQA 1AWJA 4KULA 2GQVA 4J6XA 3S6WA 2DETA 5LJ5g 2O01E 1M2VB 4RTYA 1ZSZA 3FJ5A 5I2MA 2DVEA 3OYNA 2QI2A 2GTJA 3A1PA 4KUDK 4XU0A 5GANg 3CXCP 1K9MR 3CMAT 2RI2A 3X28B 2YUPA 4WF2A 3OW2A 2P4TA 2RI3A 1KK7A 4F7UG 2AT1B 2E10A 2Y4XA 1W2BP 2EQKA 1Q82U 2K2MA 3O8VA 2CP3A 3GLXA 3JCMb 1K73C 2XHCA 8ATCB 1FMWA 2KR3A 1M27C 2IPOB 3G1JA 1SF9A 5LJ3d 1N9RA 1Q7YC 2D6FA 1ZUUA 2L5QA 3OYIA 2NWMA 3JCMW 1N8RU 3H0HA 4JJCA 4XTYA 1UG1A 5LJ5j 5A2QE 3NPFA 4MMKA 3M0RA 1JB0E 2BE7D 2LT4A 2VKNA 1BB9A 2D8JA 4M78D 2EBPA 1QCOA 4RTTA 4EMKB 3C12A 2CP2A 2KDSA 1EFNA 1WYXA 4D8DA 2CDTA 1ARKA 3CCUA 4E7IA 2DX1A 5L23A 3I55Q 3RMQA 4BE1A 4GBQA 1MMGA 4BD3A 5LJ5h 4OMQA 3LX7A 1ZSZB 4LXCA 3MEUA 2KK4A 1R0CB 1D3BB 3JRZA 1IHWA 4C92G 4E47A 2QQAA 3M5AA 1WDXA 3P8HA 1U1TA 4J9EA 4N0AC 1YHQQ 3E19A 2RJEA 4M77F 1PSFA 1OU8A 4JS5A 4OMPA 4C8QE 1VQ4T 4LNPA 1VQ7T 2CH4W 2Y90A 1GBQA 3QWXX 3NGPA 1V76A 4XTWA 4D6WA 4DEYA 1WFWA 1WIEA 1OX8A 2DYIA 4M75E 4IIMA 3GPLA 1WHGA 3VYHB 1AT1B 3OS2A 2I2LA 1S1NA 1X27A 3X24B 1M4ZA 2C06A 3L1AA 3WXMB 1NG2A 1N27A 2MAMA 4PJOB 2VXEA 2MMPA 4A4GA 1I81A 2IVWA 2RQWA 2ED1A 3VS5A 1HJDA 2E12A 2DFUA 4YTLA 2VYTA 2F5TX 1VQ5A 1GRIA 1NEGA 5J3BA 4JJBA 5CQYA 2FB7A 3QWYA 3M4GA 5GANh 3T9NA 2K5IA 1KQSA 4OMOA 5GJVB 2L8DA 3BW1A 3RNJA 1H641 1QP2A 1KC8R 4NOYA 1G3TA 5DLOA 3CCRQ 2KROA 2ZPIB 1KQ2A 3TREA 4E7KA 3CCEQ 3JSCA 4PLLA 1VQ7A 2PQWA 2GQIA 2COYA 3PE0A 4M7DE 4HXJA 2JM9A 3ASKA 4FSXA 4MDWA 1VIEA 2ATCB 1KSWA 3OBWA 3UT1A 1Y96A 5AYFA 1QVFP 4PJOE 4LD6A 1BCMA 1IO6A 4OP0A 2QGGA 4KRTA 3M0PA 3EG3A 3PVQA 3ULRB 2L3RA 5D6WA 1AWOA 5J39A 1UHCA 4JPBW 5GAN8 2DTHA 2BTTA 4FYXB 1IGUA 5CK9A 1G5VA 2GF7A 2KXCA 1WQ7A 2AKLA 4OB3B 4PNOA 2PUKB 1AZEA 4F14A 4RG2A 5IXBA 4ATOA 4JRKA 2DL5A 2KGTA 2ZPEB 1YIJA 2KY9A 2BE9B 1TH7A 4FSSA 4N4IA 1GCQC 1X6OA 2AZSA 2J6FA 2A3LA 1ZBXA 2YDLA 2KQWA 4QVDA 4C0FA 3E9GA 2C0OA 2COZA 1AOJA 3RKWA 1JJ2P 3LWHA 3EFRA 4Z89A 1YI2T 2LQWA 4Y28E 3PFSA 5GMKe 3CD6T 1T0HA 1M1KU 2QYZA 4ZGDB 2JTFA 1BI3A 4HKEA 1K8AR 5A0GA 1VQ9Q 2IG0A 2GFAA 4HCZA 4PJOF 2JS0A 1W2BS 4M75B 3OYFA 4C8QA 2LQ8A 3C0CA 5FRMA 2FZCB 2K5LA 1VIFA 3CCMT 1E6GA 2QEXQ 2QA4A 2JUFA 1B3QA 1NYFA 2KSSA 2NLUA 1AVZC 2EJGA 1BI2A 1ABOA 2MI6A 3C94A 1ZLMA 1KIKA 4F04B 4Q5WA 1CKBA 3G4ST 1YJWQ 4HVVA 1YP5A 3BDLA 3V8LA 2DIQA 1NJIC 1F1BB 1VQOT 5IHNA 3SWNC 3OYAA 4OMFB 2RHYA 4J8OA 1U5SA 1QCNA 1JEGA 2CZ0B 1UE9A 3QZ5B 4M77E 2FRWA 1NM7A 1KHCA 3U23A 3L2VA 4RTXA 5CIUA 1KJWA 1FMKA 4M78B 1Q86U 5LL6S 3SDZA 4FT2A 4NL3A 4HCBA 1VQ4A 2B8AA 3LLRA 4RTZA 2L0AA 1T0JA 4ELZC 3EH2A 1M90R 2X9HA 1UECA 1DJ7B 4ZGEB 4M7AF 2LCSA 3I55T 1RUWA 2KEAA 3CC4T 2MIOA 2FO0A 2FZGB 2ROTA 1WNLA 1UGRB 2EW3A 1K73R 4KUIA 3CBMA 4XU2A 3BY7A 2YXYA 4M7DC 2AZVA 3NHNA 2LNVA 1N6AA 3PT9A 4OGEA 3CCJQ 2VUBA 3L42A 5GMKm 5FLXE 1BYMA 2P0QA 3M55A 4XU3A 1M2OA 1RAAB 2DXBA 1Y0MA 1OPKA 1R8OB 2YT6A 3OMCA 3TU4K 4C92B 4CC3A 1K9MU 3I9QA 3Q1JA 3DB3A 2LVMA 1K0SA 1YITQ 3G6EQ 3QXEB 3H6ZA 3VV0A 3LYIA 2EGEA 1GBRA 1VQ6T 1WHHA 3BE3A 2CKKA 4M7DD 5GAOr 5CKEA 4J9DA 1RI9A 1W1FA 4PJOD 4AFUC 1VQLT 3A98A 4KBMB 4HA8A 1N9SA 2VB6A 4PL6A 3CMEQ 1RAIB 4HVWA 2GTOA 1RAEB 1YFNA 4A4HA 5GAN4 4CC4B 2QEXA 2QA4Q 3CQTA 1UTIA 2YLBA 1WGSA 1ABQA 3G71T 2LTOA 2BIVA 3DB4A 2PU9B 4M78A 4X34A 2CUBA 4V2SA 2CGHA 2H8HA 5HCKA 4C92E 2CYZB 1QVGP 2DKGA 3CCSA 5GAN3 2HDAA 2F1LA 1BK2A 4C8QF 4OGCA 3MEVA 4R0KA 4J9HA 4RCBA 4RTVA 4RG8A 1QWEA 3TEEA 1I8FA 2NUPA 1RAGB 4JJDA 3JCMh 2QXFA 1TU0B 2QDYB 3EG2A 5GAN6 1YCSB 2VGNA 4JDSA 1YJ9A 1OI1A 1UB4A 2XICA 4M7DG 2ZPBB 4C0DC 3GNGA 4MZTA 2XDBA 2SEMA 4Z88A 1WXBA 1N8RC 1YHQT 3QDRB 1JJ2S 4AFZC 1M90U 3CCQQ 4N4GA 4M7AE 4II1A 3VRYA 1W6XA 1QKWA 3HKSA 2YRVA 4J9CA 5KE3A 2CZ7B 5CAIA 3PIOA 1VQLQ 4JRQA 3RKYA 1OPLA 1QWFA 1WJSA 1Q82C 2QQBA 4F16A 3CMAA 5KYYA 1NZ9A 4IUQA 4M78C 5KYYB 2RQRA 1YJ9T 3L2QA 1B34B 4C8QD 1UGQB 2RF0A 4XTXA 4QQGA 5FWBA 1YIJQ 4EMKC 3CCEA 2A0FB 2VGMA 3I56Q 1KQ1A 2YUOA 3CCJT 4LN2A 1NE8A 1UJYA 1OOTA 2FL7A 1D1BA 4C92F 2EYYA 4HCKA 2J06A 1JU5C 3L2ZA 3CCVT 1CKAA 3S3NA 3CBOA 2KT8A 3JB9I 1M1GA 1ZQ1A 2KI7A 1KQSP 3V7CA 2X3WD 5DM7R 2ZPHB 4A63B 1B7TA 3OQ5A 4M7AG 5HY6A 1OYXA 1NBEB 2EGAA 1WZOA 2F5KA 3LGLA 4PJJA 2QQSA 2XD0A 1G3WA 1O9SA 5GAOp 2AKKA 1VQNQ 5L8RE 2EQJA 3J80E 5KYUB 1WPYA 2Y4YA 2RQTA 3M9QA 1G3SA 3UATA 2RJCA 2W10A 3CCQT 2A37A 1M3BA 3JCMd 4RTWA 2L2PA 5KCOA 1D1AA 4JUVA 2K3BA 4LDYA 1K8AC 3CCSQ 1PCXA 1H3ZA 3RBBB 1ZA1B 1GXIE 1UGVA 1K9AA 4M78E 3SHWA 1OEBA 3M0SA 3OS1A 2ZAEA 3CCJA 2EQUA 4AFQC 3F70A 3A8GB 3L2UA 3I5SA 4NS5A 3HPWA 2OI3A 4DA4A 4J83A 1TOVA 5I21A 3QKJA 1WJQA 2NUTA 3CCRT 5GANd 4EIKA 4Y91A 2FPFA 4QQ6A 4PFOA 5GAN2 2EFIA 1UFFA 3QSUA 3O5ZA 1RADB 4GLKA 1Y7XA 4QKUA 2DK3A 4M77B 4OF1A 4E2FB 4RUGA 3JB9D 1ZSGA 1HYOA 2CT4A 1QP3A 1UJ0A 4E7JA 3CCLT 5FU6C 3OYYA 1C0MA 1I5OB 4FU6A 1Y71A 2PUOB 4KGVB 2FPDA 1YBYA 2EYZA 3EFOB 2WSCE 3EHQA 3NMZC 1K9MC 3PVLA 1YCYA 1JBMA 1XQHA 1SSHA 2YLCA 5CVIA 2NYSA 3JCMX 1ZSZC 3UWNA 3WVDB 4CC2A 4HCCA 3CBPA 5LJ3e 4JLIA 1P92A 1M3AA 4JS4A 4A4EA 5I2SA 4ZN1A 1YN8A 3OYLA 1RABB 3CPWA 2M16A 3MEWA 3PIPA 1AZGB 3JAME 2RN8A 5GAMg 1NJIR 2K4YA 1W4SA 3QJYA 4Z8AA 2DXUA 4M7DF 2VXFA 3G71A 3UA6A 1K0XA 3SB2A 2ABLA 1VQKT 3EH1A 3G7ZA 1PD1A 2JVVA 1YWOA 3VS0A 5D7UA 3QYHB 1MGQA 2EPDA 2D9TA 3FDRA 1VQPQ 4M7AC 3M57A 1X2KA 3EGDA 1W2BA 5LJ5e 1Q86C 1OV3A 3KFVA 3URGA 1M90C 1YITT 4JZ3A 2NUZA 3P8DA 4QVCA 2XKOC 4XK8E 2F2XA 1B34A 5CKBA 1VQ6Q 3EGXB 4AMCA 1U3OA 1M1KR 1IXDA 1Q95G 2DXCA 1M5Q1 1LPLA 5IT9E 5IHIA 5IH2A 3META 2DA9A 3VUZA 3X25B 3CCVA 1E6HA 2CP6A 5GAOm 1MHNA 3RERA 3OW2P 5FU7B 1M2VA 3EAEA 5GANe 1UUEA 1M8MA 2CUDA 2D8HA 1IRXA 1D09B 4J6YA 1TTHB 1BKBA 1RI0A 1BI1A 2HAXA 2EKHA 2QTVA 3QDFA 3LW5E 2HKQB 2P84A 4OMMA 1TXQA 3CC2A 2OAWA 5C0MA 3MEAA 2VV5A 4XTUA 2MOXA 5CO7A 3L2WA 5KYWB 1SRMA 2O4XB 1QLYA 2CSIA 1BIAA 3REAB 3M53A 1BCOA 4DOVA 2V1RA 4PJMA 1VQLA 4PJNA 4DOWA 1EZZB 1C1AA 1EX4A 3MP6A 4LDWA 5D6XA 2M0OA 4BI8B 3JCMJ 1M3CA 3V7RA 1VQ4Q 1QCFA 1X6BA 2EJFA 3VS4A 2M02A 3CD6A 3GF5A 1I5LA 4C92D 4M75G 2CP5A 2DYBA 2DJQA 4BDZA 3VKIA 3CPWS 2HL5C 4IUPA 1VQ5T 5IN1A 3JB9J 1S72Q 2LMJA 4LDVA 4RKUE 1VQPT 1FXXA 1TUDA 4ORZA 5ECAA 1NJIU 3AT1B 3TCJA 2ESWA 4B9WA 2LZ6B 2E1HA 5GANf 1XOVA 1Y07A 2ZZDA 1VQMQ 3SEMA 3EG1A 1ZHIA 4M75D 3GNFB 2WSEE 2DL3A 1JXOA 2HBPA 4ZTJA 2KRSA 1TG0A 1YJNT 2EKOA 1Q81R 4JRIA 4PLIA 4DBHA 3VYGA 2V26A 4M7DA 5IHKA 3RESA 2LC4A 3A8LB 1ZX6A 1UHFA 4FW1A 1N8RR 2JS2A 3CPWP 4PJOA 1VQ8Q 5M9OA 4LUDA 3CC7T 2V8IA 5GAMd 1T3LA 2HSEB 1JJ2A 1BU1A 3KXTA 1ZA2B 1I07A 2O9VA 1SHFA 2DO3A 3SFMA 1OZ2A 3NTIA 4X9CA 1YI2A 1Q82R 1H3HA 3HL8A 3OYHA 2G3RA 2K7AA 4JRPA 1OULA 1PKTA 2NUTB 2RMOA 3KUFA 4J7IA 4PK4A 3L2RA 3J7AF 1YIJT 2JTEA 2P0KA 4QQDA 3GIBA 4PJOG 4PFZA 1SRLA 2A28A 3KBGA 2DZ9A 5KYXB 4QT7A 2LX9A 3CMET 2RHIA 2QASA 2ENMA 1M8VA 4J7FA 4BI4A 1GFDA 2WSFE 2DL7A 4L6V5 5FW9A 4M77G 4J6WA 2RHUA 2XMFA 3SWNA 1VQOQ 2JTMA 2V8KA 1LCKA 2KVQG 5KYNA 3CC4A 2Z0WA 2KBTA 2RNAA 4A4FA 4N0AA 3M0TA 1PM3A 3LGFA 2E5QA 2R5MA 1SSFA 2HQHA 3M0QA 1FWZA 1AEYA 1KD1C 2MK5A 4NL2A 2EJ9A 3MJXA 4ZGJB 2DVJA 4F7UB 4AT1B 4LDXA 5KYUA 4J9GA 3M4YA 3S3MA 5IXFA 1VQ9T 4DBQA 2X35A 3E1SA 3INZA 1KHIA 2E70A 1YHQA 1X2QA 2RQVA 1PSEA 2GGRA 2MCNA 2D0NA 3FJPA 2JN0A 1VQMT 2HL3A 2JJ9A 3FRNA 3M54A 3JCMP 2LJ1A 1I1JA 2DILA 2WACA 3TQ7P 4EMHA 3CCLQ 1YJ9Q 4HT8A 2HEQA 3CCUT 3VJPA 1K4US 2GFUA 1WHKA 2DD4A 1BI0A 2ZPGB 3H8ZA 2LCLA 2RD1A 3VU3C 1LNXA 2EYWA 2RPNA 3OY9A 3ME9A 2VVKA 4X1VA 2FRYA 3H9NA 5GAOn 3OMGA 1AWXA 2O9SA 3MCAB 2DPPB 5GMKl 3CCST 3OYKA 3TVTA 4F7UE 2LCCA 3ZFJA 1MMNA 2KAFA 2DJZA 3REBB 2QEXT 1R77A 2A08A 3C95A 3M0UA 4A4KA 3FB9A 1OQKA 4KT0E 4FIBA 1K73U 3G6EA 4DQ2A 1WHLA 1X43A 1QVPA 1TSFA 1B07A 1VYUA 2EGCA 2I0NA 2DMOA 2PNIA 2EQIA 5GAMe 2DTIA 2AIRB 3VS1A 5FROA 3VS3A 4E7SA 1S72T 1D1CA 5A0LA 2HZYA 2M51A 3V8JA 3PTAA 3PNWC 4AFSC 1NLPC 2X4JA 2ZCFB 1J3TA 3HTRA 3QYGB 4B9XA 1NLOC 2FHDA 2OTLQ 4FYVB 3JB9H 3OYEA 2MPXC 1Y57A 1VQKQ 1MMDA 1VOMA 2DLPA 3HRSA 2ZPFB 4FL6A 2X4YA 5GMKi 3I56T 3EGDB 4R55A 2DF6A 5GAOq 2CS7A 1TS9A 4ME7A 4C5IA 2HQXA 3FLGA 4HVUA 1U1SA 2CREA 1RLQC 3HP9A 2CSQA 2LX7A 1PKSA 3CC4Q 3QO3A 3V8KA 3WVEB 3CC7Q 2OAUA 4E6RA 3SWNB 2ROLA 1PHTA 3PMIA 3VS2A 2DEUA 5LJ3f 2CP0A 4GY5A 3CC7A 3UPUA 3LWIA 4M7AB 2X51A 1OX9A 3N5BB 4C8QC 5IAYA 5EC7A 3OS5A 2JT4A 2YRDA 5KYXA 2R57A 1NEBA 1VQ6A 2F69A 1WLPB 1Q86R 3OYDA 2XI9A 3PMTA 3CCMQ 2QAZA 1U06A 3HSBA 4MDXA 1GFCA 2BUDA 3V7SA 4TVRA 2F2VA 1KD1U 3EFSA 4ZN3A 2RM4A 2FZKB 1M1KC 2K6DA 3G4SQ 4Y92A 4WCIA 2H3EB 4RTUA 1RAHB 2YRCA 3EFOA 1SPKA 5LJ5d 1IHVA 2YUQA 2DBKA 2KT1A 2LRQA 2FYKA 4IIOA 3S3OA 2RB6A 2CZ6B 2CH4A 1K8AU 3MPUB 2E41A 3HRUA 4J5YA 2R58A 1BIBA 4M77A 4BACA 3OYBA 4FCYA 1UGPB 5CKFA 3QJ6A 1ZUYA 1PC0A 3EG0A 4C0ZA 5C6SA 3JCMQ 2XIDA 2YWWA 2DIGA 1WHMA 2L89A 1RLPC 4BE0A 4C92C 1Q7YU 3OA6A 3JCMg 1X69A 1HK9A 4M7AA 3P8BB 8AT1B 1QVGA 2QQ9A 1YITA 1TUGB 4BI3A 5AT1B 2B86A 4JZ4A 1ZUKA 4C0GA 1X75C 4XAXB 2KRNA 4R56A 1O75A 3VUBA 2BZ8A 3R6OA 1QMCA 2E64A 2KNBB 2KXDA 5GAMh 3JB9G 1QKXA 1VQKA 2OJ2A 1BBZA 5HK3A 1MV0B 3PGGA 2DTOA 2EAYA 2K3YA 1KC8U 3CMAQ 5I22A 2IIMA 1PD0A 2K2VA 1PRLC 2P4RA 1ACMB 1WQWA 2K3XA 3I35A 3QPHA 2GBQA 4MZPA 1PG5B 3I56A 3H0FA 5J26A 2YSQA 2O4XA 2E6NA 2A7YA 3M59A 3HFNA 5GAMj 3LH5A 2E3IA 2QA4T 1IB8A 1FX7A 2K79A 4L5GA 1VUBA 1IZ6A 1R0BG 1KFZA 2XK0A 3E9FA 2KYBA 2MF2A 4M75A 2RHXA 2ED0A 5GMKj 1Q81C 4WTOB 4B6MA 2CT3A 2E4HA 4Z02A 2OTJQ 1G3YA 4CRIA 1XTDA 4KH0B 1VQ9A 4EPCA 2PVGB 2JMAA 5GAN7 4M78G 4IURA 1KG1A 2SRCA 4UC4A 4MZMA 1VQ5Q 2QDLA 3ZL7C 5GAOl 2DL4A 1IREB 1KD1R 4OMNA 2CZ1B 2MYSA 1HXDA 3RMSA 2YUNA 1H92A 4RMOA 2LDMA 2RJFA 1WHJA 1WA7A 3CCRA 1I4K1 4PJOC 2FEIA 1WI7A 2FPEA 2AHJB 2QK0A 4P5NA 4ZNXA 5A0DA 3CEYA 4BB7A 1VQPA 1VQOA 2LNHB 4E7ZA 1FMVA 3OYJA 4CI0C 2HCKA 3RKXA 3CCET 4XU1A 4K11A 3DLMA 3IQLA 1Z9QA 3UF4A 3UA7A 2P0PA 4FYWB 1JRIA 4XTZA 3BFMA 5CQXA 1MUZA 4F7UA 1QVFA 2BKDN 4EDUA 1PRMC 2W0ZA 7AT1B 2E5KA 3ER0A 2A36A 2DRMA 2HQEA 2J7IA 2RA2A 1Y96B 1S72A 2DE0X 1JXMA 2MWPA 1KQSS 1NPRA 2OTJT 4FW2A 2ECZA 2JNGA 4HT9A 3CCLA 1VQNA 4DEXA 1M30A 4ANJA 4A54A 2RK2A 4J9IA 4MMLA 1HD3A 1XNIA 4PKCC 4X9DA 3GOXA 1V1CA 1PWTA 2HBWA 3FEOA 5KE2A 4AG1C 1YI2Q 4M7AD 2QTXA 1SG5A 4LD9K 1C6VX 2XG8D 2HD0A 2E6ZA 2GNCA 4N4HA 1VQ8T 3NFCA 4OB1B 3OYMA 4C5HA 1QW1A 3QUIA 4M75C 3AHUA 4GLMA 3EGUA 1OZ3A 1WX6A 2EVRA 2EYXA 1WXUA 3JCMe 1VQ8A 4M75F 1WJRA 1LVKA 2O2OA 2EQMA 6AT1B 5FU6B 2X3XD 2ZGWA 1IGQA 1TWBA 1JO8A 3QG1A 3OYCA 1D0ZA 4OB0B 4C92A 2LP5A 2VASA 2OTLT 3QBYA 3I55A 3RIRA 2G6FX 3OYGA 2CP7A 3JB9F 3OBYA 3CCQA 4LDUA 2F2WA 2LT1A 2XU8A 1AHJB 2M0YA 4M7DB 1Q7YR 5DLQE 1X6GA 3EG9A 4IUTA 1VYTA 3R6NA 1A0NB 2BZXA 4C5EA 2HKNA 2DL8A 4C0DB 2JOYA 4LUEA 3MO8A 2X4XA 3OSVA 5KCHA 1YJNA 2OTLA 4FT4A 4BY6B 4IKFA 2PVDB 1LJOA 2VC8A 4OMLA 3X20B 4C8QG 2LQKA 1YJNQ 3JCMV 1D3BA 4PJLA 2RQUA 3SD4A 2V8JA 4KH1B 2RH2A 4ELYC 4EMKA 3BDUA 1HSQA 3A8OB 2K57A 2J6OA 1VYVA 4RCCA 3D7SB 2V1QA 4A53A 1UGSB 5LJ3g 3M56A 1T3SA 4EMGA 3HHTB 1Z9ZA 3FC3A 1NPPA 4M78F 2D0QB 3CXCS 3H41A 2LJ0A
chains in the Genus database with same CATH topology
2ZCFB 4PJOE 2EWNA 3QYGB 4LD6A 4B9XA 3QSUA 4OP0A 5FRNA 2FHDA 1Y7XA 4GLKA 3MHXA 2DEQA 3JB9H 2DK3A 2L3RA 4M77B 3OYEA 3OSSC 5D6WA 5J39A 4OF1A 2OTJA 4M77D 1EIFA 5GAN8 2DTHA 4FM4B 1U8RA 5CK9A 1G5VA 2GF7A 3JB9D 3RUXA 1WQ7A 3HRSA 4OB3B 4PNOA 1QP3A 4IUVA 2PUKB 2ZPFB 3DKMA 4E7JA 4FL6A 3CCLT 3FIFA 2X4YA 5FU6C 3OYYA 5GMKi 3I56T 2RK1A 4FU6A 1RL2A 1Y71A 2PUOB 4RG2A 5GAMf 4R55A 1X01A 5GAOq 4ATOA 2CS7A 4JRKA 4ME7A 2ZPEB 1YIJA 2KY9A 4C5IA 1TH7A 1YBYA 4N4IA 1Q81U 1X6OA 2WSCE 2HQXA 3FLGA 5KH6A 1U1SA 2A3LA 2M9UA 3HP9A 1ZBXA 5HK0A 2K5FA 4L59A 5GANj 3QO3A 3V8KA 1K9MC 2KQWA 3WVEB 1LOJA 5CCAA 4QVDA 1YCYA 2OAUA 4C0FA 1M9SA 3E9GA 1JBMA 1XQHA 3ZBDA 3CC2T 3LH0A 3SWNB 5HKCA 5GAN5 4OB2B 3JCMc 4QW2A 2YLCA 5CVIA 2DZCA 3RKWA 3M58A 3PMIA 2FVUA 3JCMX 3LWHA 3UWNA 1QVFS 3EFRA 5LJ3f 3WVDB 2X4WA 4C8QB 3CPFA 4GY5A 3CC7A 1YI2T 3UPUA 3A8HB 4Y28E 3PFSA 5GMKe 3CD6T 1M1KU 3LWIA 4M7AB 4ZGDB 4HCCA 2JTFA 4JLGA 1BI3A 3CBPA 5LJ3e 4JLIA 3CMEA 3N5BB 1P92A 4HKEA 4A4EA 4C8QC 4ZN1A 5I2SA 5IAYA 4JS4A 2RI5A 3OYLA 3OS5A 3CPWA 2M16A 2R57A 3MEWA 3PIPA 5A0GA 1VQ6A 2F69A 2IG0A 3JAME 2GFAA 4HCZA 5D6YA 4PJOF 5GAMg 1UEBA 2XI9A 3NTKA 3PMTA 3OYDA 2K4YA 1W2BS 1KC8C 4M75B 1W4SA 4C8QA 3OYFA 3HSBA 2LQ8A 4MDXA 2RJDA 3QJYA 5FRMA 2BUDA 3V7SA 2DXUA 4M7DF 2VXFA 1V29B 4TVRA 3G71A 2K5LA 1KD1U 1VIFA 3EFSA 4ZN3A 3CCMT 2RM4A 5DY9A 2E65A 1M1KC 2QA4A 1VQMA 2JUFA 3SB2A 4IUUA 2NLUA 2KSSA 2M1HA 1VQKT 1VQNT 3G7ZA 2DXTA 2JVVA 4O6JA 4XQ3A 2EJGA 3QIIA 5CR2A 1BI2A 2MI6A 3QYHB 1MGQA 3QHSA 3C94A 5LJ5d 1M1FA 2D9TA 3FDRA 4Q5WA 4C5GA 3G4ST 4M7AC 2XDPA 3M57A 5FU7C 3MP1A 2LRQA 2FYKA 3DLLA 4ZTFA 1W2BA 3BDLA 3S3OA 3V8LA 2DIQA 5LJ5e 1Q86C 2RB6A 2CZ6B 4E7LA 1NJIC 1K8AU 1VQOT 2PVOB 3URGA 3SWNC 5CKDA 3OYAA 1M90C 4OMFB 1YITT 2E41A 2RHYA 3HRUA 3P8DA 4J5YA 3G6ET 4J8OA 4QVCA 2R58A 1BIBA 2XKOC 4XK8E 4M77A 1B34A 2DAQA 5CKBA 5LJ3j 2CZ0B 3OYBA 4BACA 1UGPB 4VUBA 5CKFA 3QJ6A 3UDCA 3QZ5B 4JJNK 2DD5A 4C0ZA 2DXCA 5C6SA 4OVAA 1M5Q1 4M77E 3JCMQ 2KMTA 2XIDA 5IT9E 1KHCA 3GP8A 2DIGA 3L2VA 3META 5GMKh 3VUZA 3X25B 2L89A 3C4SA 5CIUA 3CCVA 2GCXA 4M78B 3ZEHA 5GAOm 3OS0A 4BE0A 1Q86U 5LL6S 3SDZA 4C92C 4FT2A 1MHNA 2EIFA 3JCMg 2XDDA 3OA6A 1Q7YU 3RERA 2HNIA 1HK9A 4NL3A 4HCBA 1VQ4A 3P8BB 4M7AA 5FU7B 1QVGA 2QQ9A 1YITA 3G4SA 3EAEA 5GANe 2R5AA 3CXCA 2B8AA 1YJWT 3LLRA 4BI3A 5EG2A 4J6YA 4ELZC 4C0GA 4M77C 1BKBA 1RI0A 1X75C 4XAXB 1BI1A 2HAXA 4R56A 3LW5E 1YJWA 1O75A 5LJ3h 3HFOA 1DJ7B 3VUBA 3CC2A 2QQRA 4ZGEB 3CCMA 4M7AF 3R6OA 5C0MA 4BY6C 3I55T 3QZ9B 2E64A 3MEAA 5GAMh 3CC4T 2VV5A 4O5VA 4XTUA 3JB9G 5CO7A 1VQKA 2RO0A 5HK3A 1WNLA 3PGGA 3L2WA 1UGRB 2DTOA 2H3JA 2EAYA 2K3YA 4XTVA 1KC8U 4KUIA 2O4XB 3CBMA 2RHZA 3JCMf 2K2VA 4XU2A 3BY7A 1BIAA 3HRTA 3OB9A 1WQWA 4M7DC 2K3XA 3M53A 3QPHA 2LNVA 2YHTA 4DOVA 1N6AA 3PT9A 1VQLA 4OGEA 4MZPA 4BUGA 4DOWA 5LJ5f 3MP8A 2VUBA 3MP6A 5D6XA 4LDWA 3L42A 2M0OA 4BI8B 3JCMJ 3I56A 4E7HA 3OW2S 3A5ZB 3V7RA 5GMKm 5J26A 5FLXE 1BYMA 2EJFA 2P0QA 3M55A 2O4XA 4XU3A 2E6NA 2DXBA 2A7YA 3M59A 3HFNA 5GAMj 2QA4T 3CD6A 1FX7A 3GF5A 4L5GA 1VUBA 1IZ6A 1R8OB 3OMCA 3TU4K 1I5LA 4C92B 2XK0A 1QVGS 3E9FA 1K9MU 3Q1JA 2MF2A 3DB3A 4C92D 4M75G 4BE2A 4M75A 2RHXA 3NTHA 5GMKj 2LVMA 2MWOA 4BDZA 3VKIA 3QXEB 3H6ZA 3CPWS 4F7UF 3VV0A 1Q81C 3LYIA 4IUPA 3J81E 1VQ6T 2CKKA 4Z02A 4M7DD 1VQ5T 5GAOr 1G3YA 5CKEA 5IN1A 4CRIA 1XTDA 3JB9J 1VQ9A 5CKHA 4LDVA 4RKUE 4EPCA 2PVGB 4QVZA 2JZ2A 4M78G 4IURA 5GAN7 1VQPT 1VQLT 4PJOD 1FXXA 3A8MB 4KBMB 1KG1A 4HA8A 1N9SA 1NJIU 4PL6A 4UC4A 4MZMA 4BDYA 3TCJA 4B9WA 2E1HA 3X26B 4A4HA 5GAOl 5GANf 1XOVA 1Y07A 2ZZDA 2EYQA 5GAN4 1IREB 4KULA 2QEXA 2GQVA 4J6XA 3S6WA 2CZ1B 2YLBA 1WGSA 5LJ5g 1ZHIA 2O01E 4M75D 3GNFB 1HXDA 2WSEE 5I2MA 2DVEA 2LTOA 3OYNA 2BIVA 2HBPA 2QI2A 3DB4A 3RMSA 3G71T 4ZTJA 4KUDK 4RMOA 2LDMA 2PU9B 2RJFA 4XU0A 5GANg 3CMAT 4M78A 4X34A 2EKOA 1YJNT 4V2SA 2RI2A 4JRIA 3X28B 4WF2A 2CGHA 3CCRA 4PLIA 3OW2A 1I4K1 2P4TA 4PJOC 2RI3A 4C92E 2CYZB 3VYGA 2DKGA 4F7UG 3CCSA 5GAN3 2AHJB 4M7DA 4P5NA 2E10A 2Y4XA 3RESA 2LC4A 2EQKA 3A8LB 1Q82U 4C8QF 5A0DA 3CEYA 3O8VA 4OGCA 3MEVA 4RCBA 4BB7A 4PJOA 4RG8A 1VQPA 3GLXA 3JCMb 5M9OA 1VQOA 1K73C 3CC7T 2XHCA 2V8IA 5GAMd 3TEEA 1I8FA 3OYJA 4CI0C 1JJ2A 3KXTA 3RKXA 3CCET 3JCMh 4XU1A 2QXFA 2QDYB 2DO3A 3DLMA 3SFMA 5GAN6 1Q7YC 1N9RA 5LJ3d 2D6FA 1OZ2A 2VGNA 3NTIA 4X9CA 2L5QA 4JDSA 3OYIA 3JCMW 1YI2A 1YJ9A 1N8RU 3HL8A 2P0PA 3OYHA 2G3RA 4JRPA 1JRIA 4XTZA 1OI1A 3BFMA 1UB4A 2XICA 4M7DG 4XTYA 5CQXA 5LJ5j 5A2QE 2ZPBB 4F7UA 4C0DC 1QVFA 2BKDN 4EDUA 4MMKA 3KUFA 4J7IA 3L2RA 3J7AF 1JB0E 2LT4A 3GNGA 4MZTA 1YIJT 2P0KA 4QQDA 2XDBA 4M78D 4PJOG 3GIBA 3ER0A 3KBGA 1N8RC 1YHQT 2DZ9A 3QDRB 2HQEA 2RA2A 1JJ2S 1Y96B 2LX9A 3CMET 4EMKB 3C12A 1S72A 2RHIA 2KDSA 1M90U 4N4GA 2MWPA 1KQSS 1NPRA 4M7AE 3CCUA 2OTJT 4II1A 4E7IA 4J7FA 2JNGA 4HT9A 4BI4A 1M8VA 3HKSA 2WSFE 2YRVA 3CCLA 5KE3A 2CZ7B 4L6V5 5CAIA 1VQNA 3PIOA 3RMQA 4M77G 4J6WA 3RKYA 2RHUA 4JRQA 1WJSA 3SWNA 4BE1A 2JTMA 4A54A 1Q82C 2QQBA 2RK2A 2V8KA 4MMLA 4BD3A 3CMAA 1NZ9A 5LJ5h 2KVQG 3LX7A 3CC4A 4IUQA 4M78C 1XNIA 4A4FA 4PKCC 4N0AA 1YJ9T 3L2QA 3MEUA 3LGFA 1B34B 2E5QA 2KK4A 2R5MA 4X9DA 3GOXA 1SSFA 1D3BB 4C8QD 3JRZA 4C92G 4E47A 1FWZA 1UGQB 2QQAA 3FEOA 3M5AA 4QQGA 4XTXA 3P8HA 3UT1A 5KE2A 4EMKC 1KD1C 4M7AD 1U1TA 3CCEA 2QTXA 4LD9K 2XG8D 2HD0A 4N0AC 2E6ZA 2VGMA 3E19A 2RJEA 4M77F 2EJ9A 4NL2A 1KQ1A 4N4HA 1PSFA 1VQ8T 3NFCA 4OB1B 3OYMA 3CCJT 4ZGJB 4JS5A 4C5HA 4F7UB 1QW1A 3QUIA 4M75C 3AHUA 4LDXA 1OZ3A 3M4YA 4C8QE 3S3MA 1VQ4T 1VQ9T 1VQ7T 2X35A 1NE8A 3JCMe 1VQ8A 1WJRA 2Y90A 1KHIA 3E1SA 2EQMA 3INZA 4M75F 2E70A 2FL7A 1YHQA 4C92F 1PSEA 5FU6B 3L2ZA 2ZGWA 4XTWA 3CCVT 3FJPA 3S3NA 3CBOA 2JN0A 3QG1A 3OYCA 1VQMT 4D6WA 1M1GA 1ZQ1A 3JB9I 3V7CA 5DM7R 2ZPHB 3FRNA 3M54A 3OQ5A 4OB0B 3JCMP 4C92A 4M75E 4M7AG 2WACA 4EMHA 3GPLA 5HY6A 4HT8A 3CCUT 2OTLT 3QBYA 3I55A 3RIRA 3VYHB 3VJPA 3OYGA 2GFUA 1OYXA 3OS2A 3JB9F 2I2LA 2DD4A 3X24B 1M4ZA 3OBYA 2C06A 3CCQA 1BI0A 2F5KA 4LDUA 2LT1A 2XU8A 2QQSA 2ZPGB 3L1AA 3LGLA 1AHJB 3H8ZA 3WXMB 4M7DB 2LCLA 2RD1A 3VU3C 1LNXA 2XD0A 1G3WA 5DLQE 1O9SA 5GAOp 3OY9A 1N27A 2MAMA 3ME9A 4IUTA 5L8RE 4PJOB 2EQJA 2VXEA 4C5EA 3J80E 2MMPA 4A4GA 5GAOn 1I81A 4C0DB 2IVWA 2JOYA 3MO8A 2X4XA 3OMGA 2E12A 1WPYA 3OSVA 5KCHA 1YJNA 2Y4YA 3MCAB 4YTLA 2VYTA 2DPPB 4FT4A 2OTLA 2F5TX 1VQ5A 5GMKl 3CCST 5J3BA 3M9QA 4BY6B 3OYKA 4F7UE 4IKFA 1G3SA 5CQYA 2FB7A 2PVDB 2LCCA 3ZFJA 2KAFA 2RJCA 2DJZA 1LJOA 2VC8A 3CCQT 2QEXT 3M4GA 3X20B 5GANh 3JCMd 5KCOA 3C95A 4C8QG 3T9NA 4JUVA 2LQKA 4A4KA 2K5IA 3FB9A 1D3BA 4LDYA 3JCMV 1K8AC 1KQSA 4KT0E 3SD4A 2L8DA 1H3ZA 3BW1A 2V8JA 4FIBA 2RH2A 1GXIE 1H641 1QP2A 4ELYC 4DQ2A 4EMKA 4NOYA 4M78E 3G6EA 1K73U 1G3TA 5DLOA 1QVPA 3BDUA 3OS1A 2ZPIB 3A8OB 3CCJA 1KQ2A 2EQUA 3TREA 2K57A 4E7KA 3F70A 3A8GB 4RCCA 5GAMe 3L2UA 4NS5A 3HPWA 2DTIA 4DA4A 3JSCA 4PLLA 4J83A 4A53A 1VQ7A 1UGSB 2PQWA 3M56A 4EMGA 5FROA 3HHTB 3QKJA 5I21A 5LJ3g 1WJQA 3CCRT 5GANd 1S72T 4M7DE 5A0LA 1NPPA 3FC3A 3V8JA 4M78F 3ASKA 2D0QB 4Y91A 3PTAA 3PNWC 4FSXA 1VIEA 4MDWA 4QQ6A 5GAN2 3CXCS 2X4JA 3OBWA 2EFIA 1Y96A 5AYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DIQ A;  3L2Q A;  3MEU A;  5IN1 A;  3LGF A;  4CRI A;  4E7L A;  2E5Q A;  2R5M A;  4LD6 A;  4B9X A;  3GOX A;  1SSF A;  3OYA A;  4QVZ A;  2JZ2 A;  5FRN A;  3FEO A;  4IUR A;  4QQG A;  3P8H A;  2RHY A;  3P8D A;  2FHD A;  5KE2 A;  4PL6 A;  2R58 A;  4UC4 A;  4BDY A;  2L3R A;  4BAC A;  2DAQ A;  3OYE A;  5D6W A;  3OYB A;  2RJE A;  4B9W A;  5J39 A;  4N4H A;  4A4H A;  3QJ6 A;  3OYM A;  4C5H A;  1G5V A;  2GF7 A;  5C6S A;  4OVA A;  1OZ3 A;  3S3M A;  1KHC A;  3S6W A;  2DIG A;  3L2V A;  1WGS A;  3MET A;  4IUV A;  2X35 A;  4E7J A;  4FL6 A;  2L89 A;  3C4S A;  5CIU A;  1WJR A;  2X4Y A;  2LTO A;  2EQM A;  2BIV A;  3OYN A;  3DB4 A;  4BE0 A;  3ZEH A;  3OS0 A;  4ZTJ A;  4FU6 A;  4RG2 A;  1MHN A;  2LDM A;  2RJF A;  3OA6 A;  4X34 A;  2EKO A;  2RI2 A;  3S3N A;  4C5I A;  3OYC A;  3EAE A;  4N4I A;  4PLI A;  2R5A A;  2B8A A;  2HQX A;  3FLG A;  3LLR A;  4A4F A;  2RI3 A;  5KH6 A;  3OQ5 A;  3S3O A;  2WAC A;  4L59 A;  1RI0 A;  3QBY A;  2EQK A;  3OYG A;  2GFU A;  1OYX A;  3CEY A;  3OS2 A;  3E9G A;  3O8V A;  3MEV A;  3LH0 A;  2F5K A;  2QQR A;  3LGL A;  2QQS A;  3H8Z A;  4QW2 A;  5M9O A;  5C0M A;  3PMI A;  3UWN A;  3MEA A;  3OY9 A;  2X4W A;  1N27 A;  3ME9 A;  4GY5 A;  4IUT A;  3OYJ A;  2EQJ A;  4C5E A;  2RO0 A;  3PFS A;  3L2W A;  4A4G A;  2JTF A;  2K3Y A;  3DLM A;  3BDL A;  3MO8 A;  2X4X A;  3OMG A;  5KCH A;  2O4X B;  1OZ2 A;  3NTI A;  4A4E A;  5IAY A;  2RHZ A;  2VYT A;  2RI5 A;  3OYL A;  3OYI A;  3OYH A;  2G3R A;  2M16 A;  2R57 A;  3MEW A;  3M9Q A;  1OI1 A;  3OB9 A;  3OYK A;  4IKF A;  2IG0 A;  2K3X A;  2LCC A;  2GFA A;  2RJC A;  4HCZ A;  5D6Y A;  2BKD N;  3PMT A;  4EDU A;  3KUF A;  3NTK A;  3OYD A;  3L2R A;  5KCO A;  2P0K A;  3OYF A;  4QQD A;  3MP8 A;  2RJD A;  3MP6 A;  5D6X A;  3L42 A;  2BUD A;  2M0O A;  5FRM A;  4E7H A;  2HQE A;  3SD4 A;  2L8D A;  5J26 A;  1H3Z A;  2O4X A;  2E6N A;  2RHI A;  4IUU A;  4N4G A;  2NLU A;  2MWP A;  3OS1 A;  2M1H A;  2EQU A;  3OMC A;  4E7K A;  3F70 A;  4Z02 A;  2XK0 A;  4II1 A;  3QII A;  3E9F A;  4E7I A;  3Q1J A;  3DB3 A;  3L2U A;  4NS5 A;  4BE2 A;  2RHX A;  2YRV A;  5KE3 A;  3NTH A;  4PLL A;  2LVM A;  2PQW A;  2D9T A;  2MWO A;  3FDR A;  3QKJ A;  4Q5W A;  1WJQ A;  2RHU A;  5FRO A;  4C5G A;  1WJS A;  4BDZ A;  3H6Z A;  2XDP A;  4BE1 A;  3FC3 A;  3LYI A;  3MP1 A;  3ASK A;  4IUP A;  4BD3 A;  3PNW C;  2LRQ A;  4QQ6 A;  4ZTF A;  2CKK A;  3UT1 A;  3LX7 A;  2EFI A;  4IUQ A;  1XNI A; 
#chains in the Genus database with same CATH topology
 1SEM A;  2EWN A;  3GBQ A;  1JQQ A;  3VS6 A;  1FYN A;  1RAF B;  2QG9 B;  5FRN A;  5FWC A;  3CC2 Q;  3MHX A;  2DEQ A;  2DBM A;  3OSS C;  4AG2 C;  2OTJ A;  4M77 D;  1EIF A;  3G71 Q;  4FM4 B;  4PFP A;  1U8R A;  2PZ1 A;  3I5R A;  3RUX A;  1CSK A;  5I11 A;  4IUV A;  3DKM A;  2QGF B;  4CC7 A;  2C0T A;  3FIF A;  2RK1 A;  1RL2 A;  1G8X A;  5GAM f;  1X01 A;  5KYW A;  1QQJ A;  1Q81 U;  2C0I A;  2JM8 A;  4KGZ B;  5KH6 A;  2E3H A;  2M9U A;  5HK0 A;  2K5F A;  1D0Y A;  4L59 A;  4DBF A;  5GAN j;  2JXB A;  1LOJ A;  1D0X A;  5CCA A;  2FG0 A;  1M9S A;  3CC2 T;  3ZBD A;  3LH0 A;  2DRK A;  1GCP A;  3CD6 Q;  5GAN 5;  5HKC A;  4OB2 B;  3JCM c;  1YWP A;  4QW2 A;  2DZC A;  3M58 A;  4LE9 A;  2FVU A;  1QVF S;  2HSP A;  4D8K A;  2X4W A;  4C8Q B;  3CPF A;  2JW4 A;  1NYG A;  3A8H B;  4JLG A;  1AWW A;  3CME A;  1GCQ A;  3E2U A;  2O88 A;  1GL5 A;  1K1Z A;  1XJW B;  3CCV Q;  2RI5 A;  3EG9 B;  4M4Z A;  2AK5 A;  2O31 A;  3MKD A;  5D6Y A;  1UEB A;  1KC8 C;  3NTK A;  3EGX A;  2RJD A;  3VS7 A;  1SKU B;  2JMC A;  1ZBJ A;  1AD5 A;  1V29 B;  3H0I A;  1K76 A;  5DY9 A;  2E65 A;  1VQM A;  4IUU A;  2M1H A;  1VQN T;  2DXT A;  4O6J A;  4XQ3 A;  3QII A;  5CR2 A;  2NUP B;  3QHS A;  4ESR A;  1M1F A;  2DNU A;  3THK A;  4C5G A;  2XDP A;  2KRM A;  1N5Z A;  5FU7 C;  3MP1 A;  1YNZ A;  2HMA A;  1UDL A;  3DLL A;  1I0C A;  4ZTF A;  4E7L A;  1RAC B;  2PVO B;  5CKD A;  2L3S A;  3G6E T;  2K9G A;  4F17 A;  5GJW B;  2DAQ A;  4KGX B;  5LJ3 j;  4VUB A;  1MV3 A;  3UDC A;  4JJN K;  3RDV A;  2DD5 A;  4OVA A;  2KMT A;  3TSZ A;  3GP8 A;  1OU9 A;  5GMK h;  3C4S A;  2L3P A;  2GCX A;  2LQN A;  3EHR A;  3ZEH A;  3OS0 A;  4J9B A;  2EIF A;  2XDD A;  1SHG A;  2HNI A;  2J6K A;  3G4S A;  3CXC A;  2R5A A;  1YJW T;  3JV3 A;  1H8K A;  5EG2 A;  4M77 C;  2COW A;  1PNJ A;  1YJW A;  5LJ3 h;  3HFO A;  1G2B A;  2QQR A;  3CCM A;  3CCU Q;  2L3Q A;  4BY6 C;  1MMA A;  3QZ9 B;  4DBR A;  1E7O A;  4O5V A;  2VWF A;  2RO0 A;  2H3J A;  3TSW A;  4XTV A;  2D1X A;  2DM1 A;  2RHZ A;  3JCM f;  3HRT A;  1WXT A;  3OB9 A;  2KE9 A;  2YHT A;  2OX7 A;  2J05 A;  4FYY B;  4BUG A;  5LJ5 f;  3MP8 A;  1MNE A;  2LJ3 A;  3RR6 A;  4E7H A;  2PTK A;  3OW2 S;  2DER A;  3A5Z B;  1G83 A;  1VQ7 Q;  2KYM A;  1W70 A;  9ATC B;  1QVG S;  4BE2 A;  4J9F A;  3NTH A;  1TUC A;  2MWO A;  4F7U F;  3J81 E;  1VA7 A;  5CKH A;  4QVZ A;  2JZ2 A;  3A8M B;  4BDY A;  3VRZ A;  1MND A;  3X26 B;  2BZY A;  2EYQ A;  1AWJ A;  4KUL A;  2GQV A;  4J6X A;  3S6W A;  2DET A;  5LJ5 g;  2O01 E;  1M2V B;  4RTY A;  1ZSZ A;  3FJ5 A;  5I2M A;  2DVE A;  3OYN A;  2QI2 A;  2GTJ A;  3A1P A;  4KUD K;  4XU0 A;  5GAN g;  3CXC P;  1K9M R;  3CMA T;  2RI2 A;  3X28 B;  2YUP A;  4WF2 A;  3OW2 A;  2P4T A;  2RI3 A;  1KK7 A;  4F7U G;  2AT1 B;  2E10 A;  2Y4X A;  1W2B P;  2EQK A;  1Q82 U;  2K2M A;  3O8V A;  2CP3 A;  3GLX A;  3JCM b;  1K73 C;  2XHC A;  8ATC B;  1FMW A;  2KR3 A;  1M27 C;  2IPO B;  3G1J A;  1SF9 A;  5LJ3 d;  1N9R A;  1Q7Y C;  2D6F A;  1ZUU A;  2L5Q A;  3OYI A;  2NWM A;  3JCM W;  1N8R U;  3H0H A;  4JJC A;  4XTY A;  1UG1 A;  5LJ5 j;  5A2Q E;  3NPF A;  4MMK A;  3M0R A;  1JB0 E;  2BE7 D;  2LT4 A;  2VKN A;  1BB9 A;  2D8J A;  4M78 D;  2EBP A;  1QCO A;  4RTT A;  4EMK B;  3C12 A;  2CP2 A;  2KDS A;  1EFN A;  1WYX A;  4D8D A;  2CDT A;  1ARK A;  3CCU A;  4E7I A;  2DX1 A;  5L23 A;  3I55 Q;  3RMQ A;  4BE1 A;  4GBQ A;  1MMG A;  4BD3 A;  5LJ5 h;  4OMQ A;  3LX7 A;  1ZSZ B;  4LXC A;  3MEU A;  2KK4 A;  1R0C B;  1D3B B;  3JRZ A;  1IHW A;  4C92 G;  4E47 A;  2QQA A;  3M5A A;  1WDX A;  3P8H A;  1U1T A;  4J9E A;  4N0A C;  1YHQ Q;  3E19 A;  2RJE A;  4M77 F;  1PSF A;  1OU8 A;  4JS5 A;  4OMP A;  4C8Q E;  1VQ4 T;  4LNP A;  1VQ7 T;  2CH4 W;  2Y90 A;  1GBQ A;  3QWX X;  3NGP A;  1V76 A;  4XTW A;  4D6W A;  4DEY A;  1WFW A;  1WIE A;  1OX8 A;  2DYI A;  4M75 E;  4IIM A;  3GPL A;  1WHG A;  3VYH B;  1AT1 B;  3OS2 A;  2I2L A;  1S1N A;  1X27 A;  3X24 B;  1M4Z A;  2C06 A;  3L1A A;  3WXM B;  1NG2 A;  1N27 A;  2MAM A;  4PJO B;  2VXE A;  2MMP A;  4A4G A;  1I81 A;  2IVW A;  2RQW A;  2ED1 A;  3VS5 A;  1HJD A;  2E12 A;  2DFU A;  4YTL A;  2VYT A;  2F5T X;  1VQ5 A;  1GRI A;  1NEG A;  5J3B A;  4JJB A;  5CQY A;  2FB7 A;  3QWY A;  3M4G A;  5GAN h;  3T9N A;  2K5I A;  1KQS A;  4OMO A;  5GJV B;  2L8D A;  3BW1 A;  3RNJ A;  1H64 1;  1QP2 A;  1KC8 R;  4NOY A;  1G3T A;  5DLO A;  3CCR Q;  2KRO A;  2ZPI B;  1KQ2 A;  3TRE A;  4E7K A;  3CCE Q;  3JSC A;  4PLL A;  1VQ7 A;  2PQW A;  2GQI A;  2COY A;  3PE0 A;  4M7D E;  4HXJ A;  2JM9 A;  3ASK A;  4FSX A;  4MDW A;  1VIE A;  2ATC B;  1KSW A;  3OBW A;  3UT1 A;  1Y96 A;  5AYF A;  1QVF P;  4PJO E;  4LD6 A;  1BCM A;  1IO6 A;  4OP0 A;  2QGG A;  4KRT A;  3M0P A;  3EG3 A;  3PVQ A;  3ULR B;  2L3R A;  5D6W A;  1AWO A;  5J39 A;  1UHC A;  4JPB W;  5GAN 8;  2DTH A;  2BTT A;  4FYX B;  1IGU A;  5CK9 A;  1G5V A;  2GF7 A;  2KXC A;  1WQ7 A;  2AKL A;  4OB3 B;  4PNO A;  2PUK B;  1AZE A;  4F14 A;  4RG2 A;  5IXB A;  4ATO A;  4JRK A;  2DL5 A;  2KGT A;  2ZPE B;  1YIJ A;  2KY9 A;  2BE9 B;  1TH7 A;  4FSS A;  4N4I A;  1GCQ C;  1X6O A;  2AZS A;  2J6F A;  2A3L A;  1ZBX A;  2YDL A;  2KQW A;  4QVD A;  4C0F A;  3E9G A;  2C0O A;  2COZ A;  1AOJ A;  3RKW A;  1JJ2 P;  3LWH A;  3EFR A;  4Z89 A;  1YI2 T;  2LQW A;  4Y28 E;  3PFS A;  5GMK e;  3CD6 T;  1T0H A;  1M1K U;  2QYZ A;  4ZGD B;  2JTF A;  1BI3 A;  4HKE A;  1K8A R;  5A0G A;  1VQ9 Q;  2IG0 A;  2GFA A;  4HCZ A;  4PJO F;  2JS0 A;  1W2B S;  4M75 B;  3OYF A;  4C8Q A;  2LQ8 A;  3C0C A;  5FRM A;  2FZC B;  2K5L A;  1VIF A;  3CCM T;  1E6G A;  2QEX Q;  2QA4 A;  2JUF A;  1B3Q A;  1NYF A;  2KSS A;  2NLU A;  1AVZ C;  2EJG A;  1BI2 A;  1ABO A;  2MI6 A;  3C94 A;  1ZLM A;  1KIK A;  4F04 B;  4Q5W A;  1CKB A;  3G4S T;  1YJW Q;  4HVV A;  1YP5 A;  3BDL A;  3V8L A;  2DIQ A;  1NJI C;  1F1B B;  1VQO T;  5IHN A;  3SWN C;  3OYA A;  4OMF B;  2RHY A;  4J8O A;  1U5S A;  1QCN A;  1JEG A;  2CZ0 B;  1UE9 A;  3QZ5 B;  4M77 E;  2FRW A;  1NM7 A;  1KHC A;  3U23 A;  3L2V A;  4RTX A;  5CIU A;  1KJW A;  1FMK A;  4M78 B;  1Q86 U;  5LL6 S;  3SDZ A;  4FT2 A;  4NL3 A;  4HCB A;  1VQ4 A;  2B8A A;  3LLR A;  4RTZ A;  2L0A A;  1T0J A;  4ELZ C;  3EH2 A;  1M90 R;  2X9H A;  1UEC A;  1DJ7 B;  4ZGE B;  4M7A F;  2LCS A;  3I55 T;  1RUW A;  2KEA A;  3CC4 T;  2MIO A;  2FO0 A;  2FZG B;  2ROT A;  1WNL A;  1UGR B;  2EW3 A;  1K73 R;  4KUI A;  3CBM A;  4XU2 A;  3BY7 A;  2YXY A;  4M7D C;  2AZV A;  3NHN A;  2LNV A;  1N6A A;  3PT9 A;  4OGE A;  3CCJ Q;  2VUB A;  3L42 A;  5GMK m;  5FLX E;  1BYM A;  2P0Q A;  3M55 A;  4XU3 A;  1M2O A;  1RAA B;  2DXB A;  1Y0M A;  1OPK A;  1R8O B;  2YT6 A;  3OMC A;  3TU4 K;  4C92 B;  4CC3 A;  1K9M U;  3I9Q A;  3Q1J A;  3DB3 A;  2LVM A;  1K0S A;  1YIT Q;  3G6E Q;  3QXE B;  3H6Z A;  3VV0 A;  3LYI A;  2EGE A;  1GBR A;  1VQ6 T;  1WHH A;  3BE3 A;  2CKK A;  4M7D D;  5GAO r;  5CKE A;  4J9D A;  1RI9 A;  1W1F A;  4PJO D;  4AFU C;  1VQL T;  3A98 A;  4KBM B;  4HA8 A;  1N9S A;  2VB6 A;  4PL6 A;  3CME Q;  1RAI B;  4HVW A;  2GTO A;  1RAE B;  1YFN A;  4A4H A;  5GAN 4;  4CC4 B;  2QEX A;  2QA4 Q;  3CQT A;  1UTI A;  2YLB A;  1WGS A;  1ABQ A;  3G71 T;  2LTO A;  2BIV A;  3DB4 A;  2PU9 B;  4M78 A;  4X34 A;  2CUB A;  4V2S A;  2CGH A;  2H8H A;  5HCK A;  4C92 E;  2CYZ B;  1QVG P;  2DKG A;  3CCS A;  5GAN 3;  2HDA A;  2F1L A;  1BK2 A;  4C8Q F;  4OGC A;  3MEV A;  4R0K A;  4J9H A;  4RCB A;  4RTV A;  4RG8 A;  1QWE A;  3TEE A;  1I8F A;  2NUP A;  1RAG B;  4JJD A;  3JCM h;  2QXF A;  1TU0 B;  2QDY B;  3EG2 A;  5GAN 6;  1YCS B;  2VGN A;  4JDS A;  1YJ9 A;  1OI1 A;  1UB4 A;  2XIC A;  4M7D G;  2ZPB B;  4C0D C;  3GNG A;  4MZT A;  2XDB A;  2SEM A;  4Z88 A;  1WXB A;  1N8R C;  1YHQ T;  3QDR B;  1JJ2 S;  4AFZ C;  1M90 U;  3CCQ Q;  4N4G A;  4M7A E;  4II1 A;  3VRY A;  1W6X A;  1QKW A;  3HKS A;  2YRV A;  4J9C A;  5KE3 A;  2CZ7 B;  5CAI A;  3PIO A;  1VQL Q;  4JRQ A;  3RKY A;  1OPL A;  1QWF A;  1WJS A;  1Q82 C;  2QQB A;  4F16 A;  3CMA A;  5KYY A;  1NZ9 A;  4IUQ A;  4M78 C;  5KYY B;  2RQR A;  1YJ9 T;  3L2Q A;  1B34 B;  4C8Q D;  1UGQ B;  2RF0 A;  4XTX A;  4QQG A;  5FWB A;  1YIJ Q;  4EMK C;  3CCE A;  2A0F B;  2VGM A;  3I56 Q;  1KQ1 A;  2YUO A;  3CCJ T;  4LN2 A;  1NE8 A;  1UJY A;  1OOT A;  2FL7 A;  1D1B A;  4C92 F;  2EYY A;  4HCK A;  2J06 A;  1JU5 C;  3L2Z A;  3CCV T;  1CKA A;  3S3N A;  3CBO A;  2KT8 A;  3JB9 I;  1M1G A;  1ZQ1 A;  2KI7 A;  1KQS P;  3V7C A;  2X3W D;  5DM7 R;  2ZPH B;  4A63 B;  1B7T A;  3OQ5 A;  4M7A G;  5HY6 A;  1OYX A;  1NBE B;  2EGA A;  1WZO A;  2F5K A;  3LGL A;  4PJJ A;  2QQS A;  2XD0 A;  1G3W A;  1O9S A;  5GAO p;  2AKK A;  1VQN Q;  5L8R E;  2EQJ A;  3J80 E;  5KYU B;  1WPY A;  2Y4Y A;  2RQT A;  3M9Q A;  1G3S A;  3UAT A;  2RJC A;  2W10 A;  3CCQ T;  2A37 A;  1M3B A;  3JCM d;  4RTW A;  2L2P A;  5KCO A;  1D1A A;  4JUV A;  2K3B A;  4LDY A;  1K8A C;  3CCS Q;  1PCX A;  1H3Z A;  3RBB B;  1ZA1 B;  1GXI E;  1UGV A;  1K9A A;  4M78 E;  3SHW A;  1OEB A;  3M0S A;  3OS1 A;  2ZAE A;  3CCJ A;  2EQU A;  4AFQ C;  3F70 A;  3A8G B;  3L2U A;  3I5S A;  4NS5 A;  3HPW A;  2OI3 A;  4DA4 A;  4J83 A;  1TOV A;  5I21 A;  3QKJ A;  1WJQ A;  2NUT A;  3CCR T;  5GAN d;  4EIK A;  4Y91 A;  2FPF A;  4QQ6 A;  4PFO A;  5GAN 2;  2EFI A;  1UFF A;  3QSU A;  3O5Z A;  1RAD B;  4GLK A;  1Y7X A;  4QKU A;  2DK3 A;  4M77 B;  4OF1 A;  4E2F B;  4RUG A;  3JB9 D;  1ZSG A;  1HYO A;  2CT4 A;  1QP3 A;  1UJ0 A;  4E7J A;  3CCL T;  5FU6 C;  3OYY A;  1C0M A;  1I5O B;  4FU6 A;  1Y71 A;  2PUO B;  4KGV B;  2FPD A;  1YBY A;  2EYZ A;  3EFO B;  2WSC E;  3EHQ A;  3NMZ C;  1K9M C;  3PVL A;  1YCY A;  1JBM A;  1XQH A;  1SSH A;  2YLC A;  5CVI A;  2NYS A;  3JCM X;  1ZSZ C;  3UWN A;  3WVD B;  4CC2 A;  4HCC A;  3CBP A;  5LJ3 e;  4JLI A;  1P92 A;  1M3A A;  4JS4 A;  4A4E A;  5I2S A;  4ZN1 A;  1YN8 A;  3OYL A;  1RAB B;  3CPW A;  2M16 A;  3MEW A;  3PIP A;  1AZG B;  3JAM E;  2RN8 A;  5GAM g;  1NJI R;  2K4Y A;  1W4S A;  3QJY A;  4Z8A A;  2DXU A;  4M7D F;  2VXF A;  3G71 A;  3UA6 A;  1K0X A;  3SB2 A;  2ABL A;  1VQK T;  3EH1 A;  3G7Z A;  1PD1 A;  2JVV A;  1YWO A;  3VS0 A;  5D7U A;  3QYH B;  1MGQ A;  2EPD A;  2D9T A;  3FDR A;  1VQP Q;  4M7A C;  3M57 A;  1X2K A;  3EGD A;  1W2B A;  5LJ5 e;  1Q86 C;  1OV3 A;  3KFV A;  3URG A;  1M90 C;  1YIT T;  4JZ3 A;  2NUZ A;  3P8D A;  4QVC A;  2XKO C;  4XK8 E;  2F2X A;  1B34 A;  5CKB A;  1VQ6 Q;  3EGX B;  4AMC A;  1U3O A;  1M1K R;  1IXD A;  1Q95 G;  2DXC A;  1M5Q 1;  1LPL A;  5IT9 E;  5IHI A;  5IH2 A;  3MET A;  2DA9 A;  3VUZ A;  3X25 B;  3CCV A;  1E6H A;  2CP6 A;  5GAO m;  1MHN A;  3RER A;  3OW2 P;  5FU7 B;  1M2V A;  3EAE A;  5GAN e;  1UUE A;  1M8M A;  2CUD A;  2D8H A;  1IRX A;  1D09 B;  4J6Y A;  1TTH B;  1BKB A;  1RI0 A;  1BI1 A;  2HAX A;  2EKH A;  2QTV A;  3QDF A;  3LW5 E;  2HKQ B;  2P84 A;  4OMM A;  1TXQ A;  3CC2 A;  2OAW A;  5C0M A;  3MEA A;  2VV5 A;  4XTU A;  2MOX A;  5CO7 A;  3L2W A;  5KYW B;  1SRM A;  2O4X B;  1QLY A;  2CSI A;  1BIA A;  3REA B;  3M53 A;  1BCO A;  4DOV A;  2V1R A;  4PJM A;  1VQL A;  4PJN A;  4DOW A;  1EZZ B;  1C1A A;  1EX4 A;  3MP6 A;  4LDW A;  5D6X A;  2M0O A;  4BI8 B;  3JCM J;  1M3C A;  3V7R A;  1VQ4 Q;  1QCF A;  1X6B A;  2EJF A;  3VS4 A;  2M02 A;  3CD6 A;  3GF5 A;  1I5L A;  4C92 D;  4M75 G;  2CP5 A;  2DYB A;  2DJQ A;  4BDZ A;  3VKI A;  3CPW S;  2HL5 C;  4IUP A;  1VQ5 T;  5IN1 A;  3JB9 J;  1S72 Q;  2LMJ A;  4LDV A;  4RKU E;  1VQP T;  1FXX A;  1TUD A;  4ORZ A;  5ECA A;  1NJI U;  3AT1 B;  3TCJ A;  2ESW A;  4B9W A;  2LZ6 B;  2E1H A;  5GAN f;  1XOV A;  1Y07 A;  2ZZD A;  1VQM Q;  3SEM A;  3EG1 A;  1ZHI A;  4M75 D;  3GNF B;  2WSE E;  2DL3 A;  1JXO A;  2HBP A;  4ZTJ A;  2KRS A;  1TG0 A;  1YJN T;  2EKO A;  1Q81 R;  4JRI A;  4PLI A;  4DBH A;  3VYG A;  2V26 A;  4M7D A;  5IHK A;  3RES A;  2LC4 A;  3A8L B;  1ZX6 A;  1UHF A;  4FW1 A;  1N8R R;  2JS2 A;  3CPW P;  4PJO A;  1VQ8 Q;  5M9O A;  4LUD A;  3CC7 T;  2V8I A;  5GAM d;  1T3L A;  2HSE B;  1JJ2 A;  1BU1 A;  3KXT A;  1ZA2 B;  1I07 A;  2O9V A;  1SHF A;  2DO3 A;  3SFM A;  1OZ2 A;  3NTI A;  4X9C A;  1YI2 A;  1Q82 R;  1H3H A;  3HL8 A;  3OYH A;  2G3R A;  2K7A A;  4JRP A;  1OUL A;  1PKT A;  2NUT B;  2RMO A;  3KUF A;  4J7I A;  4PK4 A;  3L2R A;  3J7A F;  1YIJ T;  2JTE A;  2P0K A;  4QQD A;  3GIB A;  4PJO G;  4PFZ A;  1SRL A;  2A28 A;  3KBG A;  2DZ9 A;  5KYX B;  4QT7 A;  2LX9 A;  3CME T;  2RHI A;  2QAS A;  2ENM A;  1M8V A;  4J7F A;  4BI4 A;  1GFD A;  2WSF E;  2DL7 A;  4L6V 5;  5FW9 A;  4M77 G;  4J6W A;  2RHU A;  2XMF A;  3SWN A;  1VQO Q;  2JTM A;  2V8K A;  1LCK A;  2KVQ G;  5KYN A;  3CC4 A;  2Z0W A;  2KBT A;  2RNA A;  4A4F A;  4N0A A;  3M0T A;  1PM3 A;  3LGF A;  2E5Q A;  2R5M A;  1SSF A;  2HQH A;  3M0Q A;  1FWZ A;  1AEY A;  1KD1 C;  2MK5 A;  4NL2 A;  2EJ9 A;  3MJX A;  4ZGJ B;  2DVJ A;  4F7U B;  4AT1 B;  4LDX A;  5KYU A;  4J9G A;  3M4Y A;  3S3M A;  5IXF A;  1VQ9 T;  4DBQ A;  2X35 A;  3E1S A;  3INZ A;  1KHI A;  2E70 A;  1YHQ A;  1X2Q A;  2RQV A;  1PSE A;  2GGR A;  2MCN A;  2D0N A;  3FJP A;  2JN0 A;  1VQM T;  2HL3 A;  2JJ9 A;  3FRN A;  3M54 A;  3JCM P;  2LJ1 A;  1I1J A;  2DIL A;  2WAC A;  3TQ7 P;  4EMH A;  3CCL Q;  1YJ9 Q;  4HT8 A;  2HEQ A;  3CCU T;  3VJP A;  1K4U S;  2GFU A;  1WHK A;  2DD4 A;  1BI0 A;  2ZPG B;  3H8Z A;  2LCL A;  2RD1 A;  3VU3 C;  1LNX A;  2EYW A;  2RPN A;  3OY9 A;  3ME9 A;  2VVK A;  4X1V A;  2FRY A;  3H9N A;  5GAO n;  3OMG A;  1AWX A;  2O9S A;  3MCA B;  2DPP B;  5GMK l;  3CCS T;  3OYK A;  3TVT A;  4F7U E;  2LCC A;  3ZFJ A;  1MMN A;  2KAF A;  2DJZ A;  3REB B;  2QEX T;  1R77 A;  2A08 A;  3C95 A;  3M0U A;  4A4K A;  3FB9 A;  1OQK A;  4KT0 E;  4FIB A;  1K73 U;  3G6E A;  4DQ2 A;  1WHL A;  1X43 A;  1QVP A;  1TSF A;  1B07 A;  1VYU A;  2EGC A;  2I0N A;  2DMO A;  2PNI A;  2EQI A;  5GAM e;  2DTI A;  2AIR B;  3VS1 A;  5FRO A;  3VS3 A;  4E7S A;  1S72 T;  1D1C A;  5A0L A;  2HZY A;  2M51 A;  3V8J A;  3PTA A;  3PNW C;  4AFS C;  1NLP C;  2X4J A;  2ZCF B;  1J3T A;  3HTR A;  3QYG B;  4B9X A;  1NLO C;  2FHD A;  2OTL Q;  4FYV B;  3JB9 H;  3OYE A;  2MPX C;  1Y57 A;  1VQK Q;  1MMD A;  1VOM A;  2DLP A;  3HRS A;  2ZPF B;  4FL6 A;  2X4Y A;  5GMK i;  3I56 T;  3EGD B;  4R55 A;  2DF6 A;  5GAO q;  2CS7 A;  1TS9 A;  4ME7 A;  4C5I A;  2HQX A;  3FLG A;  4HVU A;  1U1S A;  2CRE A;  1RLQ C;  3HP9 A;  2CSQ A;  2LX7 A;  1PKS A;  3CC4 Q;  3QO3 A;  3V8K A;  3WVE B;  3CC7 Q;  2OAU A;  4E6R A;  3SWN B;  2ROL A;  1PHT A;  3PMI A;  3VS2 A;  2DEU A;  5LJ3 f;  2CP0 A;  4GY5 A;  3CC7 A;  3UPU A;  3LWI A;  4M7A B;  2X51 A;  1OX9 A;  3N5B B;  4C8Q C;  5IAY A;  5EC7 A;  3OS5 A;  2JT4 A;  2YRD A;  5KYX A;  2R57 A;  1NEB A;  1VQ6 A;  2F69 A;  1WLP B;  1Q86 R;  3OYD A;  2XI9 A;  3PMT A;  3CCM Q;  2QAZ A;  1U06 A;  3HSB A;  4MDX A;  1GFC A;  2BUD A;  3V7S A;  4TVR A;  2F2V A;  1KD1 U;  3EFS A;  4ZN3 A;  2RM4 A;  2FZK B;  1M1K C;  2K6D A;  3G4S Q;  4Y92 A;  4WCI A;  2H3E B;  4RTU A;  1RAH B;  2YRC A;  3EFO A;  1SPK A;  5LJ5 d;  1IHV A;  2YUQ A;  2DBK A;  2KT1 A;  2LRQ A;  2FYK A;  4IIO A;  3S3O A;  2RB6 A;  2CZ6 B;  2CH4 A;  1K8A U;  3MPU B;  2E41 A;  3HRU A;  4J5Y A;  2R58 A;  1BIB A;  4M77 A;  4BAC A;  3OYB A;  4FCY A;  1UGP B;  5CKF A;  3QJ6 A;  1ZUY A;  1PC0 A;  3EG0 A;  4C0Z A;  5C6S A;  3JCM Q;  2XID A;  2YWW A;  2DIG A;  1WHM A;  2L89 A;  1RLP C;  4BE0 A;  4C92 C;  1Q7Y U;  3OA6 A;  3JCM g;  1X69 A;  1HK9 A;  4M7A A;  3P8B B;  8AT1 B;  1QVG A;  2QQ9 A;  1YIT A;  1TUG B;  4BI3 A;  5AT1 B;  2B86 A;  4JZ4 A;  1ZUK A;  4C0G A;  1X75 C;  4XAX B;  2KRN A;  4R56 A;  1O75 A;  3VUB A;  2BZ8 A;  3R6O A;  1QMC A;  2E64 A;  2KNB B;  2KXD A;  5GAM h;  3JB9 G;  1QKX A;  1VQK A;  2OJ2 A;  1BBZ A;  5HK3 A;  1MV0 B;  3PGG A;  2DTO A;  2EAY A;  2K3Y A;  1KC8 U;  3CMA Q;  5I22 A;  2IIM A;  1PD0 A;  2K2V A;  1PRL C;  2P4R A;  1ACM B;  1WQW A;  2K3X A;  3I35 A;  3QPH A;  2GBQ A;  4MZP A;  1PG5 B;  3I56 A;  3H0F A;  5J26 A;  2YSQ A;  2O4X A;  2E6N A;  2A7Y A;  3M59 A;  3HFN A;  5GAM j;  3LH5 A;  2E3I A;  2QA4 T;  1IB8 A;  1FX7 A;  2K79 A;  4L5G A;  1VUB A;  1IZ6 A;  1R0B G;  1KFZ A;  2XK0 A;  3E9F A;  2KYB A;  2MF2 A;  4M75 A;  2RHX A;  2ED0 A;  5GMK j;  1Q81 C;  4WTO B;  4B6M A;  2CT3 A;  2E4H A;  4Z02 A;  2OTJ Q;  1G3Y A;  4CRI A;  1XTD A;  4KH0 B;  1VQ9 A;  4EPC A;  2PVG B;  2JMA A;  5GAN 7;  4M78 G;  4IUR A;  1KG1 A;  2SRC A;  4UC4 A;  4MZM A;  1VQ5 Q;  2QDL A;  3ZL7 C;  5GAO l;  2DL4 A;  1IRE B;  1KD1 R;  4OMN A;  2CZ1 B;  2MYS A;  1HXD A;  3RMS A;  2YUN A;  1H92 A;  4RMO A;  2LDM A;  2RJF A;  1WHJ A;  1WA7 A;  3CCR A;  1I4K 1;  4PJO C;  2FEI A;  1WI7 A;  2FPE A;  2AHJ B;  2QK0 A;  4P5N A;  4ZNX A;  5A0D A;  3CEY A;  4BB7 A;  1VQP A;  1VQO A;  2LNH B;  4E7Z A;  1FMV A;  3OYJ A;  4CI0 C;  2HCK A;  3RKX A;  3CCE T;  4XU1 A;  4K11 A;  3DLM A;  3IQL A;  1Z9Q A;  3UF4 A;  3UA7 A;  2P0P A;  4FYW B;  1JRI A;  4XTZ A;  3BFM A;  5CQX A;  1MUZ A;  4F7U A;  1QVF A;  2BKD N;  4EDU A;  1PRM C;  2W0Z A;  7AT1 B;  2E5K A;  3ER0 A;  2A36 A;  2DRM A;  2HQE A;  2J7I A;  2RA2 A;  1Y96 B;  1S72 A;  2DE0 X;  1JXM A;  2MWP A;  1KQS S;  1NPR A;  2OTJ T;  4FW2 A;  2ECZ A;  2JNG A;  4HT9 A;  3CCL A;  1VQN A;  4DEX A;  1M30 A;  4ANJ A;  4A54 A;  2RK2 A;  4J9I A;  4MML A;  1HD3 A;  1XNI A;  4PKC C;  4X9D A;  3GOX A;  1V1C A;  1PWT A;  2HBW A;  3FEO A;  5KE2 A;  4AG1 C;  1YI2 Q;  4M7A D;  2QTX A;  1SG5 A;  4LD9 K;  1C6V X;  2XG8 D;  2HD0 A;  2E6Z A;  2GNC A;  4N4H A;  1VQ8 T;  3NFC A;  4OB1 B;  3OYM A;  4C5H A;  1QW1 A;  3QUI A;  4M75 C;  3AHU A;  4GLM A;  3EGU A;  1OZ3 A;  1WX6 A;  2EVR A;  2EYX A;  1WXU A;  3JCM e;  1VQ8 A;  4M75 F;  1WJR A;  1LVK A;  2O2O A;  2EQM A;  6AT1 B;  5FU6 B;  2X3X D;  2ZGW A;  1IGQ A;  1TWB A;  1JO8 A;  3QG1 A;  3OYC A;  1D0Z A;  4OB0 B;  4C92 A;  2LP5 A;  2VAS A;  2OTL T;  3QBY A;  3I55 A;  3RIR A;  2G6F X;  3OYG A;  2CP7 A;  3JB9 F;  3OBY A;  3CCQ A;  4LDU A;  2F2W A;  2LT1 A;  2XU8 A;  1AHJ B;  2M0Y A;  4M7D B;  1Q7Y R;  5DLQ E;  1X6G A;  3EG9 A;  4IUT A;  1VYT A;  3R6N A;  1A0N B;  2BZX A;  4C5E A;  2HKN A;  2DL8 A;  4C0D B;  2JOY A;  4LUE A;  3MO8 A;  2X4X A;  3OSV A;  5KCH A;  1YJN A;  2OTL A;  4FT4 A;  4BY6 B;  4IKF A;  2PVD B;  1LJO A;  2VC8 A;  4OML A;  3X20 B;  4C8Q G;  2LQK A;  1YJN Q;  3JCM V;  1D3B A;  4PJL A;  2RQU A;  3SD4 A;  2V8J A;  4KH1 B;  2RH2 A;  4ELY C;  4EMK A;  3BDU A;  1HSQ A;  3A8O B;  2K57 A;  2J6O A;  1VYV A;  4RCC A;  3D7S B;  2V1Q A;  4A53 A;  1UGS B;  5LJ3 g;  3M56 A;  1T3S A;  4EMG A;  3HHT B;  1Z9Z A;  3FC3 A;  1NPP A;  4M78 F;  2D0Q B;  3CXC S;  3H41 A;  2LJ0 A; 
#chains in the Genus database with same CATH homology
 2ZCF B;  4PJO E;  2EWN A;  3QYG B;  4LD6 A;  4B9X A;  3QSU A;  4OP0 A;  5FRN A;  2FHD A;  1Y7X A;  4GLK A;  3MHX A;  2DEQ A;  3JB9 H;  2DK3 A;  2L3R A;  4M77 B;  3OYE A;  3OSS C;  5D6W A;  5J39 A;  4OF1 A;  2OTJ A;  4M77 D;  1EIF A;  5GAN 8;  2DTH A;  4FM4 B;  1U8R A;  5CK9 A;  1G5V A;  2GF7 A;  3JB9 D;  3RUX A;  1WQ7 A;  3HRS A;  4OB3 B;  4PNO A;  1QP3 A;  4IUV A;  2PUK B;  2ZPF B;  3DKM A;  4E7J A;  4FL6 A;  3CCL T;  3FIF A;  2X4Y A;  5FU6 C;  3OYY A;  5GMK i;  3I56 T;  2RK1 A;  4FU6 A;  1RL2 A;  1Y71 A;  2PUO B;  4RG2 A;  5GAM f;  4R55 A;  1X01 A;  5GAO q;  4ATO A;  2CS7 A;  4JRK A;  4ME7 A;  2ZPE B;  1YIJ A;  2KY9 A;  4C5I A;  1TH7 A;  1YBY A;  4N4I A;  1Q81 U;  1X6O A;  2WSC E;  2HQX A;  3FLG A;  5KH6 A;  1U1S A;  2A3L A;  2M9U A;  3HP9 A;  1ZBX A;  5HK0 A;  2K5F A;  4L59 A;  5GAN j;  3QO3 A;  3V8K A;  1K9M C;  2KQW A;  3WVE B;  1LOJ A;  5CCA A;  4QVD A;  1YCY A;  2OAU A;  4C0F A;  1M9S A;  3E9G A;  1JBM A;  1XQH A;  3ZBD A;  3CC2 T;  3LH0 A;  3SWN B;  5HKC A;  5GAN 5;  4OB2 B;  3JCM c;  4QW2 A;  2YLC A;  5CVI A;  2DZC A;  3RKW A;  3M58 A;  3PMI A;  2FVU A;  3JCM X;  3LWH A;  3UWN A;  1QVF S;  3EFR A;  5LJ3 f;  3WVD B;  2X4W A;  4C8Q B;  3CPF A;  4GY5 A;  3CC7 A;  1YI2 T;  3UPU A;  3A8H B;  4Y28 E;  3PFS A;  5GMK e;  3CD6 T;  1M1K U;  3LWI A;  4M7A B;  4ZGD B;  4HCC A;  2JTF A;  4JLG A;  1BI3 A;  3CBP A;  5LJ3 e;  4JLI A;  3CME A;  3N5B B;  1P92 A;  4HKE A;  4A4E A;  4C8Q C;  4ZN1 A;  5I2S A;  5IAY A;  4JS4 A;  2RI5 A;  3OYL A;  3OS5 A;  3CPW A;  2M16 A;  2R57 A;  3MEW A;  3PIP A;  5A0G A;  1VQ6 A;  2F69 A;  2IG0 A;  3JAM E;  2GFA A;  4HCZ A;  5D6Y A;  4PJO F;  5GAM g;  1UEB A;  2XI9 A;  3NTK A;  3PMT A;  3OYD A;  2K4Y A;  1W2B S;  1KC8 C;  4M75 B;  1W4S A;  4C8Q A;  3OYF A;  3HSB A;  2LQ8 A;  4MDX A;  2RJD A;  3QJY A;  5FRM A;  2BUD A;  3V7S A;  2DXU A;  4M7D F;  2VXF A;  1V29 B;  4TVR A;  3G71 A;  2K5L A;  1KD1 U;  1VIF A;  3EFS A;  4ZN3 A;  3CCM T;  2RM4 A;  5DY9 A;  2E65 A;  1M1K C;  2QA4 A;  1VQM A;  2JUF A;  3SB2 A;  4IUU A;  2NLU A;  2KSS A;  2M1H A;  1VQK T;  1VQN T;  3G7Z A;  2DXT A;  2JVV A;  4O6J A;  4XQ3 A;  2EJG A;  3QII A;  5CR2 A;  1BI2 A;  2MI6 A;  3QYH B;  1MGQ A;  3QHS A;  3C94 A;  5LJ5 d;  1M1F A;  2D9T A;  3FDR A;  4Q5W A;  4C5G A;  3G4S T;  4M7A C;  2XDP A;  3M57 A;  5FU7 C;  3MP1 A;  2LRQ A;  2FYK A;  3DLL A;  4ZTF A;  1W2B A;  3BDL A;  3S3O A;  3V8L A;  2DIQ A;  5LJ5 e;  1Q86 C;  2RB6 A;  2CZ6 B;  4E7L A;  1NJI C;  1K8A U;  1VQO T;  2PVO B;  3URG A;  3SWN C;  5CKD A;  3OYA A;  1M90 C;  4OMF B;  1YIT T;  2E41 A;  2RHY A;  3HRU A;  3P8D A;  4J5Y A;  3G6E T;  4J8O A;  4QVC A;  2R58 A;  1BIB A;  2XKO C;  4XK8 E;  4M77 A;  1B34 A;  2DAQ A;  5CKB A;  5LJ3 j;  2CZ0 B;  3OYB A;  4BAC A;  1UGP B;  4VUB A;  5CKF A;  3QJ6 A;  3UDC A;  3QZ5 B;  4JJN K;  2DD5 A;  4C0Z A;  2DXC A;  5C6S A;  4OVA A;  1M5Q 1;  4M77 E;  3JCM Q;  2KMT A;  2XID A;  5IT9 E;  1KHC A;  3GP8 A;  2DIG A;  3L2V A;  3MET A;  5GMK h;  3VUZ A;  3X25 B;  2L89 A;  3C4S A;  5CIU A;  3CCV A;  2GCX A;  4M78 B;  3ZEH A;  5GAO m;  3OS0 A;  4BE0 A;  1Q86 U;  5LL6 S;  3SDZ A;  4C92 C;  4FT2 A;  1MHN A;  2EIF A;  3JCM g;  2XDD A;  3OA6 A;  1Q7Y U;  3RER A;  2HNI A;  1HK9 A;  4NL3 A;  4HCB A;  1VQ4 A;  3P8B B;  4M7A A;  5FU7 B;  1QVG A;  2QQ9 A;  1YIT A;  3G4S A;  3EAE A;  5GAN e;  2R5A A;  3CXC A;  2B8A A;  1YJW T;  3LLR A;  4BI3 A;  5EG2 A;  4J6Y A;  4ELZ C;  4C0G A;  4M77 C;  1BKB A;  1RI0 A;  1X75 C;  4XAX B;  1BI1 A;  2HAX A;  4R56 A;  3LW5 E;  1YJW A;  1O75 A;  5LJ3 h;  3HFO A;  1DJ7 B;  3VUB A;  3CC2 A;  2QQR A;  4ZGE B;  3CCM A;  4M7A F;  3R6O A;  5C0M A;  4BY6 C;  3I55 T;  3QZ9 B;  2E64 A;  3MEA A;  5GAM h;  3CC4 T;  2VV5 A;  4O5V A;  4XTU A;  3JB9 G;  5CO7 A;  1VQK A;  2RO0 A;  5HK3 A;  1WNL A;  3PGG A;  3L2W A;  1UGR B;  2DTO A;  2H3J A;  2EAY A;  2K3Y A;  4XTV A;  1KC8 U;  4KUI A;  2O4X B;  3CBM A;  2RHZ A;  3JCM f;  2K2V A;  4XU2 A;  3BY7 A;  1BIA A;  3HRT A;  3OB9 A;  1WQW A;  4M7D C;  2K3X A;  3M53 A;  3QPH A;  2LNV A;  2YHT A;  4DOV A;  1N6A A;  3PT9 A;  1VQL A;  4OGE A;  4MZP A;  4BUG A;  4DOW A;  5LJ5 f;  3MP8 A;  2VUB A;  3MP6 A;  5D6X A;  4LDW A;  3L42 A;  2M0O A;  4BI8 B;  3JCM J;  3I56 A;  4E7H A;  3OW2 S;  3A5Z B;  3V7R A;  5GMK m;  5J26 A;  5FLX E;  1BYM A;  2EJF A;  2P0Q A;  3M55 A;  2O4X A;  4XU3 A;  2E6N A;  2DXB A;  2A7Y A;  3M59 A;  3HFN A;  5GAM j;  2QA4 T;  3CD6 A;  1FX7 A;  3GF5 A;  4L5G A;  1VUB A;  1IZ6 A;  1R8O B;  3OMC A;  3TU4 K;  1I5L A;  4C92 B;  2XK0 A;  1QVG S;  3E9F A;  1K9M U;  3Q1J A;  2MF2 A;  3DB3 A;  4C92 D;  4M75 G;  4BE2 A;  4M75 A;  2RHX A;  3NTH A;  5GMK j;  2LVM A;  2MWO A;  4BDZ A;  3VKI A;  3QXE B;  3H6Z A;  3CPW S;  4F7U F;  3VV0 A;  1Q81 C;  3LYI A;  4IUP A;  3J81 E;  1VQ6 T;  2CKK A;  4Z02 A;  4M7D D;  1VQ5 T;  5GAO r;  1G3Y A;  5CKE A;  5IN1 A;  4CRI A;  1XTD A;  3JB9 J;  1VQ9 A;  5CKH A;  4LDV A;  4RKU E;  4EPC A;  2PVG B;  4QVZ A;  2JZ2 A;  4M78 G;  4IUR A;  5GAN 7;  1VQP T;  1VQL T;  4PJO D;  1FXX A;  3A8M B;  4KBM B;  1KG1 A;  4HA8 A;  1N9S A;  1NJI U;  4PL6 A;  4UC4 A;  4MZM A;  4BDY A;  3TCJ A;  4B9W A;  2E1H A;  3X26 B;  4A4H A;  5GAO l;  5GAN f;  1XOV A;  1Y07 A;  2ZZD A;  2EYQ A;  5GAN 4;  1IRE B;  4KUL A;  2QEX A;  2GQV A;  4J6X A;  3S6W A;  2CZ1 B;  2YLB A;  1WGS A;  5LJ5 g;  1ZHI A;  2O01 E;  4M75 D;  3GNF B;  1HXD A;  2WSE E;  5I2M A;  2DVE A;  2LTO A;  3OYN A;  2BIV A;  2HBP A;  2QI2 A;  3DB4 A;  3RMS A;  3G71 T;  4ZTJ A;  4KUD K;  4RMO A;  2LDM A;  2PU9 B;  2RJF A;  4XU0 A;  5GAN g;  3CMA T;  4M78 A;  4X34 A;  2EKO A;  1YJN T;  4V2S A;  2RI2 A;  4JRI A;  3X28 B;  4WF2 A;  2CGH A;  3CCR A;  4PLI A;  3OW2 A;  1I4K 1;  2P4T A;  4PJO C;  2RI3 A;  4C92 E;  2CYZ B;  3VYG A;  2DKG A;  4F7U G;  3CCS A;  5GAN 3;  2AHJ B;  4M7D A;  4P5N A;  2E10 A;  2Y4X A;  3RES A;  2LC4 A;  2EQK A;  3A8L B;  1Q82 U;  4C8Q F;  5A0D A;  3CEY A;  3O8V A;  4OGC A;  3MEV A;  4RCB A;  4BB7 A;  4PJO A;  4RG8 A;  1VQP A;  3GLX A;  3JCM b;  5M9O A;  1VQO A;  1K73 C;  3CC7 T;  2XHC A;  2V8I A;  5GAM d;  3TEE A;  1I8F A;  3OYJ A;  4CI0 C;  1JJ2 A;  3KXT A;  3RKX A;  3CCE T;  3JCM h;  4XU1 A;  2QXF A;  2QDY B;  2DO3 A;  3DLM A;  3SFM A;  5GAN 6;  1Q7Y C;  1N9R A;  5LJ3 d;  2D6F A;  1OZ2 A;  2VGN A;  3NTI A;  4X9C A;  2L5Q A;  4JDS A;  3OYI A;  3JCM W;  1YI2 A;  1YJ9 A;  1N8R U;  3HL8 A;  2P0P A;  3OYH A;  2G3R A;  4JRP A;  1JRI A;  4XTZ A;  1OI1 A;  3BFM A;  1UB4 A;  2XIC A;  4M7D G;  4XTY A;  5CQX A;  5LJ5 j;  5A2Q E;  2ZPB B;  4F7U A;  4C0D C;  1QVF A;  2BKD N;  4EDU A;  4MMK A;  3KUF A;  4J7I A;  3L2R A;  3J7A F;  1JB0 E;  2LT4 A;  3GNG A;  4MZT A;  1YIJ T;  2P0K A;  4QQD A;  2XDB A;  4M78 D;  4PJO G;  3GIB A;  3ER0 A;  3KBG A;  1N8R C;  1YHQ T;  2DZ9 A;  3QDR B;  2HQE A;  2RA2 A;  1JJ2 S;  1Y96 B;  2LX9 A;  3CME T;  4EMK B;  3C12 A;  1S72 A;  2RHI A;  2KDS A;  1M90 U;  4N4G A;  2MWP A;  1KQS S;  1NPR A;  4M7A E;  3CCU A;  2OTJ T;  4II1 A;  4E7I A;  4J7F A;  2JNG A;  4HT9 A;  4BI4 A;  1M8V A;  3HKS A;  2WSF E;  2YRV A;  3CCL A;  5KE3 A;  2CZ7 B;  4L6V 5;  5CAI A;  1VQN A;  3PIO A;  3RMQ A;  4M77 G;  4J6W A;  3RKY A;  2RHU A;  4JRQ A;  1WJS A;  3SWN A;  4BE1 A;  2JTM A;  4A54 A;  1Q82 C;  2QQB A;  2RK2 A;  2V8K A;  4MML A;  4BD3 A;  3CMA A;  1NZ9 A;  5LJ5 h;  2KVQ G;  3LX7 A;  3CC4 A;  4IUQ A;  4M78 C;  1XNI A;  4A4F A;  4PKC C;  4N0A A;  1YJ9 T;  3L2Q A;  3MEU A;  3LGF A;  1B34 B;  2E5Q A;  2KK4 A;  2R5M A;  4X9D A;  3GOX A;  1SSF A;  1D3B B;  4C8Q D;  3JRZ A;  4C92 G;  4E47 A;  1FWZ A;  1UGQ B;  2QQA A;  3FEO A;  3M5A A;  4QQG A;  4XTX A;  3P8H A;  3UT1 A;  5KE2 A;  4EMK C;  1KD1 C;  4M7A D;  1U1T A;  3CCE A;  2QTX A;  4LD9 K;  2XG8 D;  2HD0 A;  4N0A C;  2E6Z A;  2VGM A;  3E19 A;  2RJE A;  4M77 F;  2EJ9 A;  4NL2 A;  1KQ1 A;  4N4H A;  1PSF A;  1VQ8 T;  3NFC A;  4OB1 B;  3OYM A;  3CCJ T;  4ZGJ B;  4JS5 A;  4C5H A;  4F7U B;  1QW1 A;  3QUI A;  4M75 C;  3AHU A;  4LDX A;  1OZ3 A;  3M4Y A;  4C8Q E;  3S3M A;  1VQ4 T;  1VQ9 T;  1VQ7 T;  2X35 A;  1NE8 A;  3JCM e;  1VQ8 A;  1WJR A;  2Y90 A;  1KHI A;  3E1S A;  2EQM A;  3INZ A;  4M75 F;  2E70 A;  2FL7 A;  1YHQ A;  4C92 F;  1PSE A;  5FU6 B;  3L2Z A;  2ZGW A;  4XTW A;  3CCV T;  3FJP A;  3S3N A;  3CBO A;  2JN0 A;  3QG1 A;  3OYC A;  1VQM T;  4D6W A;  1M1G A;  1ZQ1 A;  3JB9 I;  3V7C A;  5DM7 R;  2ZPH B;  3FRN A;  3M54 A;  3OQ5 A;  4OB0 B;  3JCM P;  4C92 A;  4M75 E;  4M7A G;  2WAC A;  4EMH A;  3GPL A;  5HY6 A;  4HT8 A;  3CCU T;  2OTL T;  3QBY A;  3I55 A;  3RIR A;  3VYH B;  3VJP A;  3OYG A;  2GFU A;  1OYX A;  3OS2 A;  3JB9 F;  2I2L A;  2DD4 A;  3X24 B;  1M4Z A;  3OBY A;  2C06 A;  3CCQ A;  1BI0 A;  2F5K A;  4LDU A;  2LT1 A;  2XU8 A;  2QQS A;  2ZPG B;  3L1A A;  3LGL A;  1AHJ B;  3H8Z A;  3WXM B;  4M7D B;  2LCL A;  2RD1 A;  3VU3 C;  1LNX A;  2XD0 A;  1G3W A;  5DLQ E;  1O9S A;  5GAO p;  3OY9 A;  1N27 A;  2MAM A;  3ME9 A;  4IUT A;  5L8R E;  4PJO B;  2EQJ A;  2VXE A;  4C5E A;  3J80 E;  2MMP A;  4A4G A;  5GAO n;  1I81 A;  4C0D B;  2IVW A;  2JOY A;  3MO8 A;  2X4X A;  3OMG A;  2E12 A;  1WPY A;  3OSV A;  5KCH A;  1YJN A;  2Y4Y A;  3MCA B;  4YTL A;  2VYT A;  2DPP B;  4FT4 A;  2OTL A;  2F5T X;  1VQ5 A;  5GMK l;  3CCS T;  5J3B A;  3M9Q A;  4BY6 B;  3OYK A;  4F7U E;  4IKF A;  1G3S A;  5CQY A;  2FB7 A;  2PVD B;  2LCC A;  3ZFJ A;  2KAF A;  2RJC A;  2DJZ A;  1LJO A;  2VC8 A;  3CCQ T;  2QEX T;  3M4G A;  3X20 B;  5GAN h;  3JCM d;  5KCO A;  3C95 A;  4C8Q G;  3T9N A;  4JUV A;  2LQK A;  4A4K A;  2K5I A;  3FB9 A;  1D3B A;  4LDY A;  3JCM V;  1K8A C;  1KQS A;  4KT0 E;  3SD4 A;  2L8D A;  1H3Z A;  3BW1 A;  2V8J A;  4FIB A;  2RH2 A;  1GXI E;  1H64 1;  1QP2 A;  4ELY C;  4DQ2 A;  4EMK A;  4NOY A;  4M78 E;  3G6E A;  1K73 U;  1G3T A;  5DLO A;  1QVP A;  3BDU A;  3OS1 A;  2ZPI B;  3A8O B;  3CCJ A;  1KQ2 A;  2EQU A;  3TRE A;  2K57 A;  4E7K A;  3F70 A;  3A8G B;  4RCC A;  5GAM e;  3L2U A;  4NS5 A;  3HPW A;  2DTI A;  4DA4 A;  3JSC A;  4PLL A;  4J83 A;  4A53 A;  1VQ7 A;  1UGS B;  2PQW A;  3M56 A;  4EMG A;  5FRO A;  3HHT B;  3QKJ A;  5I21 A;  5LJ3 g;  1WJQ A;  3CCR T;  5GAN d;  1S72 T;  4M7D E;  5A0L A;  1NPP A;  3FC3 A;  3V8J A;  4M78 F;  3ASK A;  2D0Q B;  4Y91 A;  3PTA A;  3PNW C;  4FSX A;  1VIE A;  4MDW A;  4QQ6 A;  5GAN 2;  3CXC S;  2X4J A;  3OBW A;  2EFI A;  1Y96 A;  5AYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...