3O8VA

Crystal structure of the tudor domains from fxr1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
119
structure length
102
Chain Sequence
LTVEVRGSNGAFYKGFIKDVHEDSLTVVFENNWQPERQVPFNEVRLPPPPSEGDEVEVYSRPCGWWLAKVRMMKGEFYVIEYYNEIVTFERLRPVNQNKTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of the Tandem Tudor Domains of Fragile X Mental Retardation Related Proteins FXR1 and FXR2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Fragile X mental retardation syndrome-related protein 1
total genus 22
structure length 102
sequence length 119
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05641 Agenet Agenet domain
A PF18336 Tudor_FRX1 Fragile X mental retardation Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3o8vA02
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 3o8vA01
2F5KA 2LTOA 3MEUA 2B8AA 2GF7A 3DB3A 4EDUA 1XNIA 5M9OA 4II1A 3OYNA 5IAYA 3OYAA 2EFIA 3OYLA 3S3OA 3QKJA 5C6SA 1MHNA 2R5AA 2CKKA 2RO0A 3BDLA 4GY5A 4IUUA 2R58A 4QQ6A 4C5EA 1WJRA 1OZ3A 4E7IA 5J26A 3PMIA 2X35A 3DLMA 3UWNA 3FEOA 4IUTA 1G5VA 5C0MA 1OZ2A 5KCOA 1RI0A 3F70A 4RG2A 4BDYA 4PLLA 3Q1JA 3KUFA 3LH0A 3OYBA 2L89A 2NLUA 3CEYA 2LCCA 4CRIA 3OYDA 3L2RA 2DAQA 3OYEA 4IURA 3MP1A 3OB9A 2RHYA 5KE3A 2XDPA 4ZTJA 4A4HA 4C5GA 2RHZA 2GFAA 2E6NA 3LGLA 3PFSA 4QQGA 4E7LA 4N4HA 2BKDN 2O4XA 2RJCA 3ASKA 2XK0A 2L3RA 3ZEHA 4FL6A 2RJEA 3L42A 4BD3A 3OS2A 3L2QA 3L2VA 4E7HA 3OYCA 2M16A 3O8VA 2K3YA 4BE0A 3OYGA 3NTKA 2BIVA 3OYMA 1H3ZA 2EQMA 3OS0A 4FU6A 3L2WA 4QVZA 2E5QA 3META 5FRMA 2R5MA 1OI1A 3OMCA 4BDZA 3MEWA 3OMGA 3LYIA 1OYXA 2LDMA 2X4XA 3LGFA 3E9GA 3ME9A 2EQJA 2RI3A 2D9TA 4IKFA 2L8DA 3NTIA 4BE1A 2DIGA 5FROA 3OA6A 3P8HA 3E9FA 4NS5A 1WJSA 5D6XA 5IN1A 3SD4A 3OYFA 3QBYA 4OVAA 3OYJA 4IUQA 4ZTFA 4A4FA 2X4WA 3OYKA 4E7JA 2GFUA 4PLIA 5D6YA 2P0KA 3P8DA 4X34A 3EAEA 4A4GA 3UT1A 2G3RA 2MWOA 2JTFA 3LLRA 4Z02A 5D6WA 3S3MA 1WJQA 4QW2A 4B9WA 2R57A 2EQKA 2RI5A 3FC3A 3NTHA 4C5HA 4IUVA 2DIQA 3FLGA 4L59A 2RHIA 3L2UA 2YRVA 5KH6A 3S3NA 2MWPA 2HQEA 2EKOA 3DB4A 4N4GA 5KCHA 3MEAA 3MP8A 3LX7A 3C4SA 2FHDA 3MEVA 4LD6A 3OYHA 5FRNA 2BUDA 2RHUA 2O4XB 2RHXA 3S6WA 4BACA 4IUPA 3QJ6A 2JZ2A 2RJFA 2X4YA 4N4IA 2IG0A 3GOXA 2WACA 3QIIA 5CIUA 4C5IA 2K3XA 3FDRA 4HCZA 2VYTA 1SSFA 5J39A 3OY9A 2M1HA 3H6ZA 3OQ5A 2RI2A 2RJDA 2PQWA 4B9XA 3MO8A 3PMTA 2EQUA 2LRQA 4Q5WA 2QQSA 3H8ZA 5KE2A 2QQRA 4BE2A 1N27A 4E7KA 1WGSA 2HQXA 4QQDA 1KHCA 3PNWC 3OS1A 4UC4A 3M9QA 3MP6A 4PL6A 3OYIA 4A4EA 2LVMA 2M0OA
chains in the Genus database with same CATH superfamily
3BDUA 1VQ4T 1YNZA 2HQHA 2RK2A 4HCKA 2ENMA 2GTOA 2OTLQ 2KQWA 4OF1A 4D8KA 2CKKA 1K73C 4M7AF 2X51A 2V1RA 3BE3A 2KYMA 1EZZB 5FWCA 1G5VA 1NEBA 1VQKQ 2FPFA 2L89A 2HSPA 1EIFA 2EJGA 2KEAA 1PKSA 2CH4A 3HP9A 3LGLA 5LJ3j 1MNEA 4M4ZA 4HCCA 1TUCA 3VUZA 2PUOB 3QJYA 1WHJA 1FMWA 5KYUA 1YJWT 5GAOq 2JXBA 1UHCA 2JMAA 1AZGB 4M75E 4QT7A 2MYSA 1IHWA 2E65A 1HSQA 4Z88A 3CCSQ 4MZPA 4M7DG 4P5NA 1VQ5A 2EKHA 4BE1A 1LNXA 3OA6A 2ZPFB 3G71Q 3A8HB 3DKMA 2P84A 2GBQA 4IUQA 4PJJA 3CCLA 2JMCA 3C95A 3LW5E 4OMMA 2L3QA 2P0KA 1UJ0A 2QDYB 1Q86C 1T0HA 4MDXA 5D6WA 1H641 3SFMA 1VQ7A 2KK4A 2ROTA 2KGTA 2XD0A 3JCMQ 4FIBA 3CMEA 4OMPA 4N4IA 2IG0A 4LDVA 2DM1A 3EG0A 3OW2P 2CH4W 4JRIA 1MMAA 2L2PA 2M1HA 3V7SA 3JB9H 5GAN4 2DRMA 1G3SA 1Q81C 2E12A 5KE2A 4BE2A 3RKXA 4M7DE 1OPKA 4UC4A 1GBQA 1GFCA 1D0YA 1AWJA 1IB8A 4C8QA 4M75F 2LTOA 3A8MB 3MEUA 2B8AA 1WHGA 5GMKh 1U5SA 1X69A 2JNGA 3OYLA 1ARKA 4HA8A 2A28A 3JCMV 3VS7A 1VOMA 3HFOA 1BB9A 2D0QB 2PVGB 2DE0X 2E64A 3MPUB 1SPKA 1QLYA 1Y71A 2LT4A 1G2BA 1AVZC 1G83A 5FW9A 1BKBA 1ZUYA 4BD3A 3OS2A 5GAOr 3CPFA 4PKCC 2JS2A 2EBPA 3NTKA 2KBTA 2A7YA 3I56T 4PK4A 4FCYA 2E5QA 1RACB 2KI7A 4R0KA 2C0TA 1MUZA 1FXXA 2Y90A 2A08A 2J6FA 1VQ6A 1ZX6A 1YHQA 2FRYA 4XU3A 2AZSA 2O31A 1PKTA 2HBPA 3I5RA 1ZSZC 4A4FA 4M77C 4LXCA 5LJ3f 3NGPA 3HFNA 3JCMP 2E1HA 4RMOA 2CZ1B 1YITT 3JB9I 1UJYA 1WYXA 1U3OA 4HVWA 4C92F 1M8MA 1RLPC 2XICA 4L59A 3SEMA 1S72A 1HYOA 4RTVA 1K8AR 5KH6A 3A1PA 3G4SA 2LMJA 3NMZC 4JJCA 3HRUA 1MV0B 4BACA 2P4TA 1LVKA 1B07A 3G71A 1LJOA 1QWFA 2RM4A 5J39A 3QZ5B 5CK9A 2LRQA 4FYYB 1QCOA 1AZEA 4RUGA 1UFFA 2EYWA 1J3TA 1ZA1B 4PJMA 1BI1A 3RMSA 1R0BG 2GF7A 3CC4A 4M78C 4PFZA 4ZN1A 3C12A 1Y57A 3CMAA 1M3AA 1IXDA 3CMEQ 1JJ2A 5A0GA 2LC4A 4J6YA 1PG5B 4A4HA 3PFSA 5AT1B 5CQXA 4BY6C 2JOYA 1G3WA 1WHLA 3FIFA 5J3BA 1D0ZA 2YXYA 2QAZA 3VRZA 3OYMA 3M54A 3META 3CCUA 4IIOA 4HVUA 3PIPA 4PJLA 1VQMT 1VQKA 1YCYA 2DLPA 3JCMh 2H8HA 1N6AA 2YUQA 3P8HA 3OYJA 4OVAA 1R0CB 4OGEA 8ATCB 2CP0A 3CCUQ 1GXIE 2LJ0A 1G3YA 2V8IA 4ANJA 1VQ8T 3CD6Q 2JTFA 2CT4A 1M1GA 3QG1A 2DXUA 4AT1B 2AHJB 3VUBA 2DEQA 1VQ9T 1U1TA 2YRVA 2F1LA 2EGEA 2HQEA 4KULA 3CBOA 1AHJB 4XTUA 3CCSA 4C92E 1UGVA 2CYZB 2OTLT 5IXFA 1VQ5Q 2QEXT 4HXJA 1RAIB 2O4XB 3QJ6A 2VKNA 1VIFA 1N8RR 1RUWA 3JRZA 1JXMA 2L3PA 4B6MA 2DK3A 3OQ5A 1OPLA 3VS5A 3GF5A 1M2VA 3A5ZB 1M90C 5GANh 3TQ7P 3L1AA 4II1A 4F17A 1M3BA 4M75A 1JQQA 4PNOA 1M9SA 1Z9QA 2JT4A 1WXTA 2GQIA 4E7IA 2F5TX 1MMDA 2X35A 3KXTA 2QGFB 2PVDB 1D0XA 1K9AA 2ZPEB 1KC8C 1WIEA 1Y7XA 4ZTJA 4EMGA 1KSWA 1QP2A 2RJCA 2BE7D 4JLIA 5I11A 4M78D 1SF9A 5I2MA 3RUXA 1N8RU 2K57A 2EQIA 1SRLA 2QQBA 2I2LA 4RTXA 4IIMA 2RMOA 1OX9A 2X4XA 4PJOC 2RI3A 1H3HA 3I55A 4E7SA 2COZA 3NTIA 6AT1B 1WJSA 4M7AC 3CCVT 2HSEB 2A0FB 2AT1B 3V7RA 4F7UF 4J9FA 3UA6A 4A4GA 1VQNQ 3VS0A 5GAMh 3OYYA 2LP5A 4PJNA 4QW2A 2R57A 1BI2A 1WFWA 4IUVA 1FWZA 4CC3A 3LWIA 2DX1A 4F16A 4C8QD 2YWWA 2QXFA 2GGRA 3ZL7C 3J7AF 4Z8AA 3S6WA 1Q7YR 4XTVA 2SEMA 2DETA 3FJ5A 2DPPB 1SSFA 2JVVA 4BB7A 1WQ7A 2FVUA 2XKOC 2QQRA 4OB3B 2FB7A 1WHKA 3EGUA 3M9QA 3VS2A 1ZBXA 2OJ2A 3OYIA 4A4EA 2LVMA 1JRIA 3G6ET 3HSBA 2CT3A 4GBQA 1Q82U 2FYKA 2D8JA 2COWA 2PUKB 2IIMA 1ZSGA 2YHTA 3S3OA 3QPHA 5GAOn 1KQSA 3PMIA 2GTJA 2DZ9A 4PJOG 2DD4A 1HK9A 1OZ2A 1KG1A 1C6VX 3JCMW 1K4US 1G3TA 3E2UA 2NLUA 2ZPGB 2DAQA 2M02A 2XDPA 2LQNA 4E7LA 1K73R 1SSHA 4EPCA 3BY7A 3R6OA 2XK0A 4Y28E 5EC7A 2VXEA 3CCRQ 2YRCA 2NYSA 2RJEA 3L2QA 3C0CA 5LJ5e 1X75C 1A0NB 1PM3A 5HCKA 2DYIA 2MIOA 1VQ8A 5GANg 1VA7A 2OTJQ 1BIAA 2EGCA 3CCVA 2RH2A 1NPPA 3LH5A 1BYMA 4M75C 4RCCA 2HKNA 4DBQA 1IZ6A 4LDYA 2CP6A 1NJIR 4PLIA 2FRWA 5LJ3h 1O9SA 4ELYC 1ZQ1A 1P92A 5CO7A 1K8AC 4EMKC 3DLLA 1YJ9A 2EQKA 2RI5A 1YJNA 5LJ5d 2VGMA 1N9SA 1NYFA 1X6GA 1UGQB 1TXQA 5I2SA 1QW1A 3CC7T 3CCMQ 5A0LA 3I55T 4M77B 1W2BP 2KXCA 1TTHB 4M77G 1ZA2B 2VYTA 2JN0A 4AMCA 1R8OB 3CD6A 2LNVA 1I0CA 1EX4A 1I8FA 3MP6A 2A37A 5GMKe 3EFOA 1VQPQ 5GMKl 1VQ9Q 2MMPA 4J9GA 2K79A 2FZGB 1K0XA 2F2WA 1PRMC 1MHNA 3C94A 2RO0A 4C5EA 2O9VA 2EJFA 1VQLA 2EIFA 4JRQA 3ULRB 5CKDA 3FEOA 3X24B 2HL5C 3F70A 2LQKA 2FEIA 2QEXA 1TS9A 3CBPA 4CC2A 1WI7A 4X1VA 5GANd 1K9MU 2XIDA 1RADB 1VUBA 1JO8A 2O4XA 4WTOB 4PJOD 2KRNA 2QEXQ 4J8OA 4OP0A 3TVTA 4JPBW 4CI0C 2KAFA 2QASA 4M7DD 1CSKA 2ED0A 2K3YA 1UHFA 5GAN6 4AFSC 2EQMA 2CP5A 3RESA 5GANf 3X25B 3OMCA 4CC4B 1X43A 5AYFA 1GCQA 5GAMj 3EGDB 1KC8R 1D1AA 3SWNB 3X26B 1SHFA 2XDBA 2DL3A 4E7JA 1ZUKA 3THKA 4QKUA 3HTRA 3EG9B 2MWOA 2PVOB 2M9UA 8AT1B 1PNJA 1K76A 4RTUA 4YTLA 4BUGA 2OTLA 1IRXA 4E7ZA 1NE8A 3OSVA 2EKOA 4N4GA 3VV0A 2KT8A 4M75D 2EWNA 1GBRA 4XTXA 3CCVQ 1EFNA 1Q95G 1RAHB 5GMKi 3R6NA 2CZ6B 4B9XA 3PMTA 1QVGP 4ME7A 3PNWC 3TREA 1OV3A 1ZHIA 4JJDA 4C0ZA 1OQKA 1KD1C 1QVPA 3RERA 2EYXA 4LDUA 2J7IA 1YWOA 2BTTA 4IUUA 2OAWA 1Q81U 2R58A 5GANj 4JDSA 3M58A 5KCOA 1NEGA 5A0DA 3HKSA 4OB0B 1I07A 4IURA 3MP1A 2BE9B 5CKEA 2M51A 2DEUA 2BKDN 2HBWA 4HVVA 2IVWA 2V8JA 3ZFJA 2MK5A 1HXDA 1ACMB 2BIVA 2ESWA 3JCMb 1MMGA 2NUPB 2GQVA 2KSSA 1M4ZA 4OB1B 4DQ2A 3OMGA 1AWXA 1VYTA 4KH0B 2E6ZA 2EJ9A 1B34A 3CC4T 1D3BA 5FROA 3NFCA 3ER0A 3QZ9B 5D6XA 2KY9A 3GPLA 1VQ5T 3EGDA 3QXEB 2QG9B 2LX9A 1M27C 3EG2A 1TOVA 2X4WA 1KC8U 1Y96B 3I9QA 3RMQA 5GMKj 2ECZA 3EGXB 4ZGDB 3CCET 1X6BA 1N5ZA 5FU7B 1YITA 2HMAA 2X3XD 1JXOA 3QSUA 3CD6T 1YCSB 3CCST 5IHIA 2AK5A 2MAMA 5GAN2 3DB4A 1MMNA 2VUBA 4KRTA 3EHQA 4LDWA 4AFUC 7AT1B 2W10A 2JZ2A 2LCSA 1M90R 1CKBA 2QQAA 4OMLA 3OW2S 3O5ZA 3CC2T 1M2VB 4KGZB 5HK3A 1K73U 3I55Q 1T3SA 3PE0A 2QGGA 2C06A 4J9IA 1V76A 5CVIA 3NHNA 2M0OA 2RQVA 3I5SA 2DXBA 3RBBB 3CCUT 3GLXA 1FYNA 1U06A 5L8RE 2CZ7B 5J26A 2PZ1A 4RG2A 2C0OA 1JBMA 3L2RA 2CP7A 1GCPA 2E6NA 1YWPA 3J80E 2L3RA 2L3SA 3L2VA 3RKWA 4C0DB 2K9GA 4D6WA 4C8QE 3OYGA 4ZN3A 2OX7A 3L2WA 3EG1A 2DL5A 1MNDA 4J7FA 1I5OB 2L5QA 1SG5A 3LYIA 4N0AC 2EQJA 2KDSA 4M77F 2QA4Q 4MZTA 3CC2A 1JU5C 1Y0MA 3CPWS 3SD4A 4PJOF 2NUTB 1T3LA 4C8QC 3VU3C 5HY6A 2AKKA 4DA4A 1UGPB 2GFUA 5D6YA 3EAEA 2P0PA 3SWNC 3UT1A 3JCMX 4O6JA 2G6FX 4PFPA 2HNIA 1IGQA 2DXCA 4M78B 3H0HA 2O2OA 3FLGA 1JJ2P 3CCLT 1VQ4Q 2FG0A 5IH2A 1W4SA 3MP8A 3EHRA 2FZCB 4AG1C 2RHUA 3CCQT 2XMFA 5LL6S 4FSXA 4C5IA 1IREB 1TSFA 2Z0WA 1LCKA 4Q5WA 1R77A 2KE9A 4E7KA 4JRPA 1AWWA 4XU0A 1JB0E 5GJVB 3QYGB 3DB3A 1XNIA 1E6GA 2PNIA 1B3QA 4M7DA 2MF2A 1PHTA 3EG9A 2E10A 3RIRA 1YN8A 4ORZA 1UUEA 3EFSA 1YHQQ 2YUOA 3GP8A 1U8RA 4BDYA 4PJOB 2JM8A 5IXBA 1M3CA 1DJ7B 3A8OB 3T9NA 5KE3A 3M5AA 4C8QG 4AG2C 1N8RC 1YI2T 4RKUE 1SRMA 2RQRA 2J6OA 3PGGA 4VUBA 4PJOE 3CCQQ 2EYQA 4C92B 4FL6A 3VS3A 4JS5A 1WXUA 3CCJQ 4M78E 3A8LB 4J6XA 2DVJA 3JAME 5GAOp 3OS0A 4FU6A 1RI9A 3TSZA 3MEWA 2FO0A 4JLGA 2QTXA 2CZ0B 2MI6A 4EMKB 2DIGA 3CC7Q 1B34B 3QUIA 4M7DC 3OYFA 2CGHA 5CCAA 2EVRA 2DTHA 1K0SA 1X6OA 1PSFA 4M78G 4MDWA 3CMET 4PFOA 4A63B 4EMHA 2YT6A 4AFZC 3M0UA 1WX6A 1YJ9T 2AIRB 4PJOA 2K7AA 4KGXB 1YBYA 3CXCA 4LD6A 3OYHA 1VQ7T 3M4GA 4J5YA 5GAMd 2JTEA 3QIIA 2K3XA 2IPOB 4OMFB 2RI2A 1MV3A 1ZBJA 3OSSC 2QQSA 2NUPA 1YITQ 1N27A 3WVEB 1TWBA 1Q7YU 2P4RA 1ZLMA 1YJWQ 4M7AB 2DXTA 1W70A 5LJ3g 1FMKA 4OMQA 5GAOm 4M78F 5C6SA 3M0PA 3OYDA 4M77E 1ZUUA 4QVDA 4IUTA 3JB9G 1Q82R 1X27A 1Q86U 4PLLA 3Q1JA 2ZPBB 4KGVB 4XTZA 5IHNA 3OB9A 4F7UE 1QKWA 1LPLA 3CPWP 3QO3A 2RB6A 2YUNA 5LJ5h 3G6EQ 3JCMd 2K5FA 1QVGS 4OMOA 3OYCA 1NYGA 1QWEA 1RAAB 2CP2A 1QVFA 2W0ZA 1WLPB 5FWBA 5LJ3e 5GAN5 3VRYA 3GBQA 3LGFA 3E9GA 3J81E 3CCMT 2L8DA 1ZSZB 5KYXA 4KBMB 3PTAA 1WA7A 2ZGWA 4NS5A 5GAMe 2NWMA 4D8DA 2VASA 1M1KU 3VYHB 1XTDA 1K8AU 3CC7A 4X34A 4F04B 2LQWA 3PT9A 1M30A 2F2VA 5KYYB 3JCMe 1Q86R 2ZPHB 3OBYA 1AD5A 3HL8A 3CCEQ 1C1AA 2MCNA 3INZA 4C0GA 1XQHA 2ZZDA 4Y91A 2DJZA 2AZVA 5CQYA 2QA4A 2O01E 4KH1B 4M75G 5LJ3d 4ATOA 4OMNA 3E1SA 4JZ4A 1VQLQ 3A8GB 2F69A 2WACA 5GAN3 4JJBA 3FDRA 4HCZA 2X3WD 1S72T 2RJDA 3CC4Q 2D6FA 4DOVA 1IO6A 5KYWA 2K2VA 2L0AA 4LDXA 1OULA 4JRKA 5FU6B 1OU8A 2LJ3A 2E4HA 3G71T 3V8KA 2HZYA 2J05A 2E3HA 3QKJA 2COYA 2HD0A 4GY5A 2FZKB 4X9CA 3WXMB 2FL7A 2DJQA 3A98A 3HPWA 4M75B 3DLMA 2PTKA 1LOJA 1UGRB 1GFDA 2KNBB 1VIEA 2DO3A 1PSEA 1WDXA 3OYBA 3CXCS 3M59A 3CCRT 3OYEA 3I56A 3MHXA 4QQGA 4J9EA 1X01A 2DNUA 2HEQA 3ASKA 2MOXA 3CMAQ 3ZEHA 3CQTA 2DA9A 1JEGA 2YLCA 2RPNA 3L42A 1TUGB 3O8VA 4M7AD 1K9MR 2MPXC 4C8QF 2VVKA 1H3ZA 1QKXA 3G6EA 5DLQE 4A54A 3V7CA 3H0FA 2VB6A 1YHQT 3V8LA 3EFOB 2RK1A 1T0JA 1BCMA 1BCOA 2DYBA 2CSIA 5D7UA 4IKFA 1KFZA 2VV5A 3GNFB 1KIKA 5IN1A 2CS7A 2DKGA 1QCNA 2CSQA 3EFRA 2EPDA 4ZTFA 4RTWA 5ECAA 2KMTA 3EGXA 5GJWB 5FU7C 2D8HA 4J9CA 1ABQA 2K3BA 1PC0A 5IHKA 3VS6A 5LJ5g 3NTHA 1KD1U 2VC8A 3L2UA 2OTJT 4GLMA 4X9DA 1QVGA 4M77D 1CKAA 3N5BB 3CMAT 4LUEA 3SHWA 4RTYA 3M4YA 2KXDA 4C92D 1VQOQ 3UDCA 5I21A 4FT2A 3UPUA 3KBGA 1NM7A 2DFUA 1UDLA 1RABB 2QI2A 3QWXX 3MJXA 4EMKA 1NPRA 2DL7A 3H8ZA 2ABLA 3UF4A 1WGSA 1KHCA 4XQ3A 1AT1B 4FW2A 4LUDA 4PL6A 1H92A 1IHVA 2E70A 3RKYA 1U1SA 3M57A 4C92G 4J9HA 2JS0A 3P8BB 2WSEE 2Y4YA 4CC7A 1YIJT 1JJ2S 2DTOA 4M7DF 3GNGA 1YI2A 3X20B 3UA7A 1YIJQ 4FT4A 4CRIA 1AOJA 1Q81R 3UATA 4C5GA 2GNCA 2LJ1A 3I35A 2YRDA 1NBEB 4N4HA 2FPEA 1YJWA 2X9HA 3TEEA 3GIBA 4JJNK 5HKCA 1HD3A 3JB9J 3EG3A 4F14A 1N9RA 2R5MA 1VQ6T 2LDMA 3CCJT 4M7AG 2D9TA 4XU2A 1YP5A 2ATCB 1TG0A 1BU1A 2LNHB 2LX7A 4J6WA 3OYKA 2EGAA 3LLRA 3G4ST 1VQ9A 5LJ5f 2JW4A 3QWYA 9ATCB 2DRKA 1WXBA 1RAFB 1M5Q1 2CREA 1S72Q 1KD1R 4J7IA 5KCHA 3SB2A 2KT1A 3QDFA 3SDZA 4FW1A 2HAXA 2RHXA 2KR3A 4XTWA 1YJNT 4IUPA 5CAIA 4XAXB 3JSCA 4FM4B 1V29B 2BZ8A 3JCMJ 3H6ZA 4XK8E 3JB9F 3CXCP 4M7AE 2HQXA 1AEYA 4V2SA 2DZCA 1M1KC 3VS4A 1QQJA 2F5KA 3ZBDA 2M0YA 2WSCE 1YFNA 4C0DC 3CCLQ 2DTIA 1RLQC 2VGNA 5GANe 4MMKA 5KYYA 3BDLA 3G4SQ 1VQOT 2QYZA 1NLPC 3RNJA 2KROA 2H3EB 2A3LA 5C0MA 1OX8A 3H41A 4F7UB 3KUFA 3M0SA 5I22A 1D1CA 2RHZA 1SKUB 1M8VA 3JV3A 2XHCA 3BW1A 1PWTA 1VQ8Q 1UECA 2CUDA 1IGUA 4ZGJB 2YLBA 2KRMA 3M0TA 3RDVA 2M16A 1VQPT 2ZCFB 1GCQC 2RN8A 3PVLA 1RAGB 5LJ5j 4BY6B 4BI4A 1BI0A 4HKEA 4BI3A 5FLXE 1UE9A 4C0FA 1I81A 1W6XA 3V8JA 4ESRA 4E2FB 1OOTA 4ZGEB 1KQSP 4FYXB 1VYUA 5EG2A 4OB2B 3SWNA 1B7TA 2QK0A 1O75A 3LWHA 2YDLA 2G3RA 3JB9D 1WJQA 1UB4A 3QYHB 3QDRB 3U23A 1RL2A 2E5KA 3JCMf 1NJIU 3AT1B 2MWPA 5KYUB 5GAMf 1MGQA 1XOVA 1KHIA 2FHDA 3VJPA 2J06A 3CCJA 2XU8A 2RJFA 2HDAA 3PVQA 4LNPA 5A2QE 4NL3A 3M53A 3OY9A 4LE9A 1M2OA 4JS4A 2K4YA 2EQUA 2HKQB 2ED1A 2DMOA 2CP3A 1VQNA 4XTYA 3FB9A 3CPWA 1Q82C 4MZMA 5CKHA 2ZAEA 1HJDA 1M1KR 2QQ9A 2RQWA 5IAYA 3OYAA 4DBFA 4M7AA 4JUVA 1ABOA 2EFIA 4HT8A 1WJRA 1OZ3A 2CDTA 4N0AA 3UWNA 4E6RA 3M55A 4F7UG 3CC2Q 5DY9A 4ELZC 3HHTB 4WF2A 1YIJA 4K11A 3REBB 2RHYA 2O88A 2C0IA 2SRCA 1VQMQ 4BI8B 2VXFA 4Y92A 2DF6A 3X28B 3TU4K 4BE0A 3PIOA 1VQ4A 4QVZA 1YI2Q 1D3BB 1BI3A 5L23A 2DBKA 1OI1A 1W2BA 4A53A 1QP3A 3BFMA 3HRSA 4C8QB 2HCKA 2VWFA 3I56Q 2DERA 3E19A 4R56A 3QBYA 1I1JA 1WNLA 1X2KA 2GCXA 2PU9B 2H3JA 2JJ9A 2V1QA 5HK0A 2YUPA 2BZXA 4B9WA 2Y4XA 1KK7A 3M0RA 3FC3A 4JZ3A 1NLOC 5GAOl 3JCMg 2HL3A 1D1BA 2RQTA 1E6HA 3S3NA 1NG2A 1F1BB 4HT9A 2RNAA 2ROLA 1I5LA 2OTJA 1UEBA 4FYVB 1RAEB 4RG8A 5CKFA 3TCJA 2E3IA 1QVFS 1G8XA 2V8KA 1WZOA 1XJWB 2P0QA 1OU9A 3OS1A 3H9NA 3MKDA 2AKLA 3M56A 2WSFE 5CIUA 4HCBA 1FX7A 1BBZA 4M7DB 4ZNXA 5KYWB 2FPDA 5M9OA 2XI9A 3OYNA 1WQWA 1VQKT 4KT0E 3QHSA 4QQ6A 1Q7YC 2CUBA 4L5GA 5GAN7 2JUFA 2QA4T 1K9MC 1UGSB 2KVQG 3CEYA 3CCEA 4C92A 4F7UA 5GAMg 4EIKA 2DILA 2KRSA 1QMCA 4LD9K 4KUIA 1Y07A 1C0MA 3REAB 2RF0A 2V26A 2F2XA 5IT9E 2EYYA 2DBMA 2RA2A 4OGCA 4O5VA 4BDZA 1OYXA 2DL4A 2JM9A 4MMLA 2K5LA 2E41A 4J83A 2JTMA 3EH1A 4DEXA 4LN2A 4NL2A 1GRIA 2LT1A 3VS1A 1KJWA 4Z02A 5DLOA 3S3MA 2DVEA 1WHMA 3OS5A 2D0NA 1YJNQ 1GL5A 1FMVA 3URGA 3MEAA 4DOWA 3LX7A 4RTZA 2KYBA 5FRNA 2BUDA 1BIBA 4RTTA 3TSWA 3CCMA 5CKBA 1W2BS 2X4YA 2EW3A 3M0QA 5FU6C 3GOXA 1NJIC 3H0IA 2XG8D 2YSQA 5KYNA 2PQWA 3HRTA 1VQNT 2XDDA 1S1NA 4QVCA 4C92C 4QQDA 1Z9ZA 2BZYA 4RCBA 1M90U 2O9SA 2NUTA 1YJ9Q 1ZSZA 5KYXB 2K6DA 4EDUA 5CR2A 1TU0B 5GAN8 4J9BA 1E7OA 2R5AA 1KQ1A 4M78A 1D09B 1PD1A 1VQ6Q 2DL8A 2EAYA 2EYZA 1RI0A 2RD1A 4XU1A 1V1CA 2ZPIB 3CCQA 1NZ9A 3LH0A 4TVRA 2LCCA 3OBWA 1KQ2A 4R55A 1H8KA 3JCMc 2LZ6B 1SEMA 2GFAA 1VYVA 4M77A 4AFQC 4DEYA 1VQPA 2K5IA 1PCXA 2QDLA 3MCAB 3VYGA 4E7HA 3NPFA 3EH2A 3D7SB 2I0NA 2RQUA 4FYWB 1PD0A 1K1ZA 3CBMA 3L2ZA 5FRMA 2LCLA 4J9DA 1TH7A 3ME9A 1TUDA 3VKIA 4L6V5 5GMKm 2LQ8A 4A4KA 1WPYA 4DBRA 4FSSA 1VQOA 3E9FA 4E47A 1W1FA 1Y96A 1I4K1 1VQ7Q 2X4JA 1M1FA 1SHGA 3CCRA 1BK2A 1VQMA 2B86A 2D1XA 3P8DA 2A36A 1QCFA 3IQLA 5DM7R 1QVFP 1UG1A 4GLKA 3FJPA 4C5HA 1OEBA 2DIQA 2J6KA 2RHIA 4Z89A 2NUZA 2QTVA 1VQLT 2DD5A 3C4SA 3MEVA 2OAUA 3OW2A 3KFVA 1X2QA 2OI3A 3G7ZA 1WHHA 4NOYA 3WVDB 3G1JA 2K2MA 3RR6A 1AWOA 3FRNA 1KQSS 3MO8A 1UTIA 4KUDK 3AHUA 1PRLC 4WCIA 4DBHA
chains in the Genus database with same CATH topology
3BDUA 1VQ4T 2F5KA 1JB0E 2RK2A 2WSCE 4XU0A 3QYGB 3ZBDA 1Q82U 2FYKA 2PUKB 3DB3A 1XNIA 4C0DC 4M7DA 2DTIA 2MF2A 2E10A 2KQWA 2VGNA 3RIRA 5GANe 4MMKA 4OF1A 2CKKA 2YHTA 3BDLA 3QPHA 5GAOn 3S3OA 1VQOT 1K73C 4M7AF 1KQSA 3PMIA 3EFSA 2DZ9A 4PJOG 2A3LA 2DD4A 1G5VA 1HK9A 1OZ2A 5C0MA 1KG1A 3GP8A 1U8RA 3JCMW 4BDYA 4F7UB 3KUFA 4PJOB 2L89A 1G3TA 2NLUA 1DJ7B 2ZPGB 1EIFA 2DAQA 2EJGA 3A8OB 3T9NA 5KE3A 2XDPA 3M5AA 4C8QG 2RHZA 3HP9A 3LGLA 1N8RC 4E7LA 1YI2T 4RKUE 5LJ3j 3PGGA 4VUBA 3BY7A 3R6OA 2XK0A 4Y28E 4EPCA 2XHCA 3BW1A 4PJOE 1M8VA 2EYQA 2VXEA 4C92B 4HCCA 4FL6A 2RJEA 3VUZA 3L2QA 2PUOB 3QJYA 1X75C 4ZGJB 2YLBA 5LJ5e 4JS5A 2M16A 1YJWT 1VQPT 5GAOq 2ZCFB 4M78E 3A8LB 4J6XA 5LJ5j 4BY6B 3JAME 4BI4A 5GAOp 4FU6A 4M75E 3OS0A 1BI0A 1VQ8A 4HKEA 5GANg 2E65A 3MEWA 4JLGA 2QTXA 4MZPA 4BI3A 1BIAA 4P5NA 2MI6A 2CZ0B 5FLXE 4M7DG 3CCVA 4C0FA 2RH2A 4EMKB 1I81A 1VQ5A 4BE1A 2DIGA 1NPPA 1LNXA 3V8JA 3OA6A 1B34B 2ZPFB 1BYMA 3A8HB 3QUIA 3DKMA 4M75C 4RCCA 2CGHA 4ZGEB 5CCAA 3OYFA 4IUQA 4M7DC 3CCLA 1IZ6A 3C95A 4LDYA 5EG2A 2DTHA 3LW5E 4OB2B 3SWNA 4PLIA 1X6OA 1O75A 2P0KA 2QDYB 1Q86C 3LWHA 1PSFA 2G3RA 1O9SA 5LJ3h 4ELYC 1ZQ1A 4M78G 4MDWA 3JB9D 1P92A 5D6WA 1H641 1WJQA 3SFMA 3CMET 4MDXA 1UB4A 1VQ7A 5CO7A 1K8AC 3QYHB 4EMKC 3DLLA 1YJ9A 2EQKA 2RI5A 4EMHA 1YJNA 5LJ5d 2VGMA 3QDRB 1N9SA 1RL2A 3JCMf 1NJIU 1YJ9T 4PJOA 1UGQB 2KK4A 1YBYA 2MWPA 5I2SA 3CXCA 2XD0A 1QW1A 1MGQA 1XOVA 5GAMf 3CC7T 4LD6A 1KHIA 2FHDA 3VJPA 5A0LA 3JCMQ 3OYHA 3I55T 4M77B 1VQ7T 3M4GA 4FIBA 3CCJA 3CMEA 2XU8A 2RJFA 4J5YA 4N4IA 5GAMd 2IG0A 4LDVA 5A2QE 4NL3A 3QIIA 4M77G 2K3XA 2VYTA 2JN0A 3M53A 4JRIA 2M1HA 4OMFB 1R8OB 3V7SA 3OY9A 2RI2A 5GAN4 3CD6A 3JB9H 4JS4A 2K4YA 2EQUA 1G3SA 3OSSC 2QQSA 2LNVA 1Q81C 2E12A 5KE2A 4BE2A 1N27A 3RKXA 3WVEB 4M7DE 1I8FA 4UC4A 3MP6A 1Q7YU 1VQNA 4XTYA 3FB9A 5GMKe 3CPWA 4M7AB 1Q82C 5GMKl 2DXTA 4C8QA 2MMPA 4MZMA 4M75F 2LTOA 3A8MB 3MEUA 5CKHA 2B8AA 5LJ3g 5GAOm 5GMKh 2QQ9A 5IAYA 3OYAA 4M7AA 3HSBA 4JUVA 2JNGA 4M78F 2EFIA 3OYLA 5C6SA 4HA8A 1MHNA 3C94A 3OYDA 2RO0A 4C5EA 4HT8A 3JCMV 2EJFA 1WJRA 1OZ3A 4M77E 1VQLA 2EIFA 4JRQA 4N0AA 5CKDA 3HFOA 3UWNA 2D0QB 3FEOA 3M55A 4IUTA 3X24B 4F7UG 4QVDA 3JB9G 2PVGB 1Q86U 3F70A 2QEXA 2E64A 2LQKA 4PLLA 3Q1JA 2ZPBB 5DY9A 4ELZC 3HHTB 3CBPA 4WF2A 1Y71A 4XTZA 1YIJA 5GANd 1K9MU 3OB9A 2RHYA 2LT4A 4F7UE 2XIDA 1VUBA 2O4XA 1BKBA 4PJOD 3QO3A 2RB6A 5LJ5h 4J8OA 4OP0A 3JCMd 4BI8B 2K5FA 2VXFA 1QVGS 4BD3A 4CI0C 3OS2A 5GAOr 2KAFA 3OYCA 3CPFA 4M7DD 4PKCC 3X28B 3TU4K 2K3YA 4BE0A 3NTKA 3PIOA 2A7YA 5GAN6 1QVFA 3I56T 2EQMA 1VQ4A 4QVZA 3RESA 2E5QA 1D3BB 1BI3A 5GANf 3X25B 1W2BA 1OI1A 3OMCA 5LJ3e 4A53A 1QP3A 5GAN5 3BFMA 5AYFA 3LGFA 3E9GA 1FXXA 2Y90A 3J81E 3CCMT 3HRSA 4C8QB 5GAMj 2L8DA 1VQ6A 1YHQA 4KBMB 3PTAA 4XU3A 3E19A 2ZGWA 4R56A 4NS5A 2HBPA 3QBYA 3SWNB 5GAMe 3X26B 1M1KU 1WNLA 2GCXA 3VYHB 4M77C 4A4FA 2XDBA 5LJ3f 3HFNA 4E7JA 3JCMP 1XTDA 2E1HA 2PU9B 2H3JA 2CZ1B 4RMOA 3CC7A 4X34A 3JB9I 1YITT 1K8AU 2MWOA 2PVOB 3PT9A 2M9UA 4C92F 5HK0A 4B9WA 3JCMe 2Y4XA 2ZPHB 2XICA 3FC3A 3OBYA 4YTLA 4L59A 3JCMg 5GAOl 1S72A 4BUGA 2OTLA 3HL8A 3INZA 4C0GA 5KH6A 3S3NA 1NE8A 3OSVA 2EKOA 1XQHA 2ZZDA 3G4SA 1I5LA 4HT9A 4N4GA 3VV0A 4Y91A 2OTJA 1UEBA 2DJZA 3HRUA 2EWNA 4M75D 5CQYA 2QA4A 2O01E 4M75G 4XTXA 5LJ3d 4ATOA 4BACA 2P4TA 4RG8A 3E1SA 3A8GB 2F69A 1LJOA 2WACA 5CKFA 3TCJA 5GMKi 5GAN3 3G71A 3FDRA 4HCZA 2RM4A 5J39A 3QZ5B 1S72T 5CK9A 1QVFS 2RJDA 2CZ6B 4B9XA 2V8KA 2D6FA 3PMTA 2LRQA 4DOVA 2P0QA 4ME7A 2K2VA 3OS1A 3PNWC 4LDXA 3TREA 4HCBA 3M56A 5CIUA 2WSFE 1FX7A 1ZHIA 4M7DB 1BI1A 4JRKA 5FU6B 3RMSA 4C0ZA 2GF7A 3CC4A 5M9OA 1KD1C 2XI9A 3G71T 3OYNA 1QVPA 3RERA 1WQWA 4LDUA 4M78C 3V8KA 4KT0E 1VQKT 3QKJA 3QHSA 2HD0A 4GY5A 4IUUA 4QQ6A 1Q81U 2R58A 5GANj 4ZN1A 4JDSA 4X9CA 3WXMB 2FL7A 3HPWA 4M75B 3C12A 3DLMA 3M58A 1Q7YC 1LOJA 1UGRB 5KCOA 3CMAA 4L5GA 5GAN7 5A0DA 1VIEA 2DO3A 3HKSA 1PSEA 2JUFA 2QA4T 1K9MC 1JJ2A 3OYBA 1UGSB 2KVQG 4OB0B 3CXCS 3CEYA 3M59A 3CCRT 5A0GA 3OYEA 4IURA 3MP1A 2LC4A 4J6YA 3I56A 3CCEA 5CKEA 4A4HA 4C92A 4F7UA 3MHXA 3PFSA 4QQGA 5GAMg 4LD9K 1X01A 2BKDN 3ASKA 5CQXA 4BY6C 4KUIA 3ZEHA 1Y07A 2YLCA 2JOYA 3L42A 1G3WA 5IT9E 3O8VA 4M7AD 3FIFA 5J3BA 2IVWA 2V8JA 2RA2A 4C8QF 4OGCA 3ZFJA 1HXDA 2BIVA 3OYMA 1H3ZA 3JCMb 3M54A 3G6EA 2GQVA 5DLQE 2KSSA 4A54A 1M4ZA 3META 3V7CA 4O5VA 3CCUA 4OB1B 4BDZA 1YHQT 4DQ2A 3OMGA 3PIPA 3V8LA 1OYXA 2RK1A 1VQMT 1VQKA 2E6ZA 2EJ9A 1B34A 3CC4T 1YCYA 4MMLA 1D3BA 2K5LA 4IKFA 3JCMh 2E41A 5FROA 1N6AA 2VV5A 3GNFB 3ER0A 3NFCA 3QZ9B 3P8HA 4J83A 5D6XA 2CS7A 2JTMA 2DKGA 2KY9A 4OVAA 5IN1A 3OYJA 4OGEA 3GPLA 3EFRA 1VQ5T 1GXIE 4ZTFA 3QXEB 2LX9A 1G3YA 2V8IA 2X4WA 1KC8U 2KMTA 5FU7C 1Y96B 1VQ8T 4NL2A 3RMQA 5GMKj 2LT1A 2JTFA 4Z02A 5DLOA 4ZGDB 3S3MA 3CCET 2DVEA 1M1GA 5FU7B 1YITA 3QG1A 2DXUA 3OS5A 3NTHA 2AHJB 5LJ5g 3VUBA 1KD1U 2DEQA 3QSUA 3CD6T 2VC8A 3CCST 3L2UA 2OTJT 1VQ9T 1U1TA 4X9DA 4M77D 1QVGA 3N5BB 3CMAT 2YRVA 3URGA 2MAMA 5GAN2 2HQEA 4KULA 3M4YA 3DB4A 3CBOA 1AHJB 4XTUA 4C92D 4C92E 3UDCA 2CYZB 3MEAA 3CCSA 4DOWA 2OTLT 3LX7A 2VUBA 5I21A 4FT2A 3UPUA 2BUDA 1BIBA 4LDWA 3KBGA 2QEXT 2O4XB 5FRNA 3CCMA 5CKBA 3QJ6A 2JZ2A 1W2BS 2X4YA 1VIFA 5FU6C 3GOXA 3JRZA 2QI2A 2QQAA 3OW2S 3CC2T 1NJIC 2DK3A 2XG8D 3OQ5A 2PQWA 3HRTA 4EMKA 1VQNT 2XDDA 5HK3A 1K73U 1NPRA 3H8ZA 3GF5A 4QVCA 4C92C 1WGSA 4QQDA 1KHCA 4RCBA 3A5ZB 4XQ3A 1M90U 4PL6A 2C06A 2E70A 5CVIA 3RKYA 2M0OA 1M90C 1U1SA 3M57A 4C92G 5GANh 3P8BB 3L1AA 4EDUA 2WSEE 4II1A 2DXBA 2Y4YA 5CR2A 3CCUT 4M75A 1YIJT 1JJ2S 3GLXA 4PNOA 1M9SA 5GAN8 2R5AA 5L8RE 4E7IA 2DTOA 1KQ1A 4M7DF 2CZ7B 2F5TX 3GNGA 4M78A 5J26A 3X20B 1YI2A 2X35A 3KXTA 2EAYA 2RD1A 1RI0A 4RG2A 4XU1A 2ZPIB 3CCQA 1NZ9A 3LH0A 2PVDB 4FT4A 1JBMA 4TVRA 2LCCA 4CRIA 2ZPEB 3L2RA 1KC8C 3OBWA 1KQ2A 4R55A 1Y7XA 4ZTJA 3JCMc 4C5GA 4EMGA 2E6NA 2GFAA 1QP2A 4N4HA 2RJCA 4M77A 4JLIA 1VQPA 1YJWA 3J80E 2L3RA 2K5IA 3TEEA 3L2VA 3MCAB 3RKWA 3VYGA 4C0DB 4E7HA 4D6WA 3GIBA 4M78D 4JJNK 5HKCA 5I2MA 3RUXA 4C8QE 3OYGA 3JB9J 4ZN3A 1N8RU 2K57A 3L2WA 3CBMA 3L2ZA 2QQBA 5FRMA 1N9RA 2R5MA 2I2LA 2L5QA 4J7FA 1VQ6T 2LCLA 3LYIA 2LDMA 2X4XA 4N0AC 3CCJT 1TH7A 3ME9A 4M7AG 2EQJA 2RI3A 2KDSA 3VKIA 2D9TA 3I55A 4M77F 4PJOC 4L6V5 5GMKm 4XU2A 3NTIA 2LQ8A 4A4KA 1WPYA 1VQOA 4MZTA 3CC2A 3E9FA 1WJSA 3SD4A 4E47A 3CPWS 3CCVT 1Y96A 4M7AC 1I4K1 4PJOF 4J6WA 2X4JA 4C8QC 1M1FA 3VU3C 3CCRA 5HY6A 1VQMA 3OYKA 3V7RA 4F7UF 4DA4A 1UGPB 2GFUA 5D6YA 3P8DA 3EAEA 2P0PA 3SWNC 3UT1A 4A4GA 4O6JA 3JCMX 3LLRA 3G4ST 5DM7R 5GAMh 3OYYA 2HNIA 2DXCA 4QW2A 1VQ9A 4GLKA 5LJ5f 4M78B 2R57A 3FJPA 1BI2A 4C5HA 4IUVA 2DIQA 3FLGA 2RHIA 1FWZA 3LWIA 3CCLT 1M5Q1 4C8QD 2QXFA 1W4SA 1VQLT 4J7IA 5KCHA 3SB2A 3MP8A 2DD5A 3C4SA 3MEVA 2OAUA 3SDZA 3OW2A 3J7AF 2HAXA 2RHUA 3CCQT 2RHXA 4XTWA 3G7ZA 3S6WA 1YJNT 4IUPA 5CAIA 4XAXB 3JSCA 4FM4B 5LL6S 4NOYA 3WVDB 4FSXA 4XTVA 4C5IA 1IREB 1V29B 2DPPB 1SSFA 2JVVA 3JCMJ 3H6ZA 3FRNA 4XK8E 1KQSS 3MO8A 4Q5WA 4BB7A 1WQ7A 3JB9F 2FVUA 2XKOC 2QQRA 4OB3B 2FB7A 4KUDK 4E7KA 3AHUA 2HQXA 4M7AE 4JRPA 3M9QA 4V2SA 1ZBXA 2DZCA 4A4EA 2LVMA 3OYIA 1JRIA 3G6ET 1M1KC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5K A;  2LTO A;  3MEU A;  2B8A A;  2GF7 A;  3DB3 A;  4EDU A;  1XNI A;  5M9O A;  4II1 A;  3OYN A;  5IAY A;  3OYA A;  2EFI A;  3OYL A;  3S3O A;  3QKJ A;  5C6S A;  1MHN A;  2R5A A;  2CKK A;  2RO0 A;  3BDL A;  4GY5 A;  4IUU A;  2R58 A;  4QQ6 A;  4C5E A;  1WJR A;  1OZ3 A;  4E7I A;  5J26 A;  3PMI A;  2X35 A;  3DLM A;  3UWN A;  3FEO A;  4IUT A;  1G5V A;  5C0M A;  1OZ2 A;  5KCO A;  1RI0 A;  3F70 A;  4RG2 A;  4BDY A;  4PLL A;  3Q1J A;  3KUF A;  3LH0 A;  3OYB A;  2L89 A;  2NLU A;  3CEY A;  2LCC A;  4CRI A;  3OYD A;  3L2R A;  2DAQ A;  3OYE A;  4IUR A;  3MP1 A;  3OB9 A;  2RHY A;  5KE3 A;  2XDP A;  4ZTJ A;  4A4H A;  4C5G A;  2RHZ A;  2GFA A;  2E6N A;  3LGL A;  3PFS A;  4QQG A;  4E7L A;  4N4H A;  2BKD N;  2O4X A;  2RJC A;  3ASK A;  2XK0 A;  2L3R A;  3ZEH A;  4FL6 A;  2RJE A;  3L42 A;  4BD3 A;  3OS2 A;  3L2Q A;  3L2V A;  4E7H A;  3OYC A;  2M16 A;  3O8V A;  2K3Y A;  4BE0 A;  3OYG A;  3NTK A;  2BIV A;  3OYM A;  1H3Z A;  2EQM A;  3OS0 A;  4FU6 A;  3L2W A;  4QVZ A;  2E5Q A;  3MET A;  5FRM A;  2R5M A;  1OI1 A;  3OMC A;  4BDZ A;  3MEW A;  3OMG A;  3LYI A;  1OYX A;  2LDM A;  2X4X A;  3LGF A;  3E9G A;  3ME9 A;  2EQJ A;  2RI3 A;  2D9T A;  4IKF A;  2L8D A;  3NTI A;  4BE1 A;  2DIG A;  5FRO A;  3OA6 A;  3P8H A;  3E9F A;  4NS5 A;  1WJS A;  5D6X A;  5IN1 A;  3SD4 A;  3OYF A;  3QBY A;  4OVA A;  3OYJ A;  4IUQ A;  4ZTF A;  4A4F A;  2X4W A;  3OYK A;  4E7J A;  2GFU A;  4PLI A;  5D6Y A;  2P0K A;  3P8D A;  4X34 A;  3EAE A;  4A4G A;  3UT1 A;  2G3R A;  2MWO A;  2JTF A;  3LLR A;  4Z02 A;  5D6W A;  3S3M A;  1WJQ A;  4QW2 A;  4B9W A;  2R57 A;  2EQK A;  2RI5 A;  3FC3 A;  3NTH A;  4C5H A;  4IUV A;  2DIQ A;  3FLG A;  4L59 A;  2RHI A;  3L2U A;  2YRV A;  5KH6 A;  3S3N A;  2MWP A;  2HQE A;  2EKO A;  3DB4 A;  4N4G A;  5KCH A;  3MEA A;  3MP8 A;  3LX7 A;  3C4S A;  2FHD A;  3MEV A;  4LD6 A;  3OYH A;  5FRN A;  2BUD A;  2RHU A;  2O4X B;  2RHX A;  3S6W A;  4BAC A;  4IUP A;  3QJ6 A;  2JZ2 A;  2RJF A;  2X4Y A;  4N4I A;  2IG0 A;  3GOX A;  2WAC A;  3QII A;  5CIU A;  4C5I A;  2K3X A;  3FDR A;  4HCZ A;  2VYT A;  1SSF A;  5J39 A;  3OY9 A;  2M1H A;  3H6Z A;  3OQ5 A;  2RI2 A;  2RJD A;  2PQW A;  4B9X A;  3MO8 A;  3PMT A;  2EQU A;  2LRQ A;  4Q5W A;  2QQS A;  3H8Z A;  5KE2 A;  2QQR A;  4BE2 A;  1N27 A;  4E7K A;  1WGS A;  2HQX A;  4QQD A;  1KHC A;  3PNW C;  3OS1 A;  4UC4 A;  3M9Q A;  3MP6 A;  4PL6 A;  3OYI A;  4A4E A;  2LVM A;  2M0O A; 
#chains in the Genus database with same CATH topology
 3BDU A;  1VQ4 T;  1YNZ A;  2HQH A;  2RK2 A;  4HCK A;  2ENM A;  2GTO A;  2OTL Q;  2KQW A;  4OF1 A;  4D8K A;  2CKK A;  1K73 C;  4M7A F;  2X51 A;  2V1R A;  3BE3 A;  2KYM A;  1EZZ B;  5FWC A;  1G5V A;  1NEB A;  1VQK Q;  2FPF A;  2L89 A;  2HSP A;  1EIF A;  2EJG A;  2KEA A;  1PKS A;  2CH4 A;  3HP9 A;  3LGL A;  5LJ3 j;  1MNE A;  4M4Z A;  4HCC A;  1TUC A;  3VUZ A;  2PUO B;  3QJY A;  1WHJ A;  1FMW A;  5KYU A;  1YJW T;  5GAO q;  2JXB A;  1UHC A;  2JMA A;  1AZG B;  4M75 E;  4QT7 A;  2MYS A;  1IHW A;  2E65 A;  1HSQ A;  4Z88 A;  3CCS Q;  4MZP A;  4M7D G;  4P5N A;  1VQ5 A;  2EKH A;  4BE1 A;  1LNX A;  3OA6 A;  2ZPF B;  3G71 Q;  3A8H B;  3DKM A;  2P84 A;  2GBQ A;  4IUQ A;  4PJJ A;  3CCL A;  2JMC A;  3C95 A;  3LW5 E;  4OMM A;  2L3Q A;  2P0K A;  1UJ0 A;  2QDY B;  1Q86 C;  1T0H A;  4MDX A;  5D6W A;  1H64 1;  3SFM A;  1VQ7 A;  2KK4 A;  2ROT A;  2KGT A;  2XD0 A;  3JCM Q;  4FIB A;  3CME A;  4OMP A;  4N4I A;  2IG0 A;  4LDV A;  2DM1 A;  3EG0 A;  3OW2 P;  2CH4 W;  4JRI A;  1MMA A;  2L2P A;  2M1H A;  3V7S A;  3JB9 H;  5GAN 4;  2DRM A;  1G3S A;  1Q81 C;  2E12 A;  5KE2 A;  4BE2 A;  3RKX A;  4M7D E;  1OPK A;  4UC4 A;  1GBQ A;  1GFC A;  1D0Y A;  1AWJ A;  1IB8 A;  4C8Q A;  4M75 F;  2LTO A;  3A8M B;  3MEU A;  2B8A A;  1WHG A;  5GMK h;  1U5S A;  1X69 A;  2JNG A;  3OYL A;  1ARK A;  4HA8 A;  2A28 A;  3JCM V;  3VS7 A;  1VOM A;  3HFO A;  1BB9 A;  2D0Q B;  2PVG B;  2DE0 X;  2E64 A;  3MPU B;  1SPK A;  1QLY A;  1Y71 A;  2LT4 A;  1G2B A;  1AVZ C;  1G83 A;  5FW9 A;  1BKB A;  1ZUY A;  4BD3 A;  3OS2 A;  5GAO r;  3CPF A;  4PKC C;  2JS2 A;  2EBP A;  3NTK A;  2KBT A;  2A7Y A;  3I56 T;  4PK4 A;  4FCY A;  2E5Q A;  1RAC B;  2KI7 A;  4R0K A;  2C0T A;  1MUZ A;  1FXX A;  2Y90 A;  2A08 A;  2J6F A;  1VQ6 A;  1ZX6 A;  1YHQ A;  2FRY A;  4XU3 A;  2AZS A;  2O31 A;  1PKT A;  2HBP A;  3I5R A;  1ZSZ C;  4A4F A;  4M77 C;  4LXC A;  5LJ3 f;  3NGP A;  3HFN A;  3JCM P;  2E1H A;  4RMO A;  2CZ1 B;  1YIT T;  3JB9 I;  1UJY A;  1WYX A;  1U3O A;  4HVW A;  4C92 F;  1M8M A;  1RLP C;  2XIC A;  4L59 A;  3SEM A;  1S72 A;  1HYO A;  4RTV A;  1K8A R;  5KH6 A;  3A1P A;  3G4S A;  2LMJ A;  3NMZ C;  4JJC A;  3HRU A;  1MV0 B;  4BAC A;  2P4T A;  1LVK A;  1B07 A;  3G71 A;  1LJO A;  1QWF A;  2RM4 A;  5J39 A;  3QZ5 B;  5CK9 A;  2LRQ A;  4FYY B;  1QCO A;  1AZE A;  4RUG A;  1UFF A;  2EYW A;  1J3T A;  1ZA1 B;  4PJM A;  1BI1 A;  3RMS A;  1R0B G;  2GF7 A;  3CC4 A;  4M78 C;  4PFZ A;  4ZN1 A;  3C12 A;  1Y57 A;  3CMA A;  1M3A A;  1IXD A;  3CME Q;  1JJ2 A;  5A0G A;  2LC4 A;  4J6Y A;  1PG5 B;  4A4H A;  3PFS A;  5AT1 B;  5CQX A;  4BY6 C;  2JOY A;  1G3W A;  1WHL A;  3FIF A;  5J3B A;  1D0Z A;  2YXY A;  2QAZ A;  3VRZ A;  3OYM A;  3M54 A;  3MET A;  3CCU A;  4IIO A;  4HVU A;  3PIP A;  4PJL A;  1VQM T;  1VQK A;  1YCY A;  2DLP A;  3JCM h;  2H8H A;  1N6A A;  2YUQ A;  3P8H A;  3OYJ A;  4OVA A;  1R0C B;  4OGE A;  8ATC B;  2CP0 A;  3CCU Q;  1GXI E;  2LJ0 A;  1G3Y A;  2V8I A;  4ANJ A;  1VQ8 T;  3CD6 Q;  2JTF A;  2CT4 A;  1M1G A;  3QG1 A;  2DXU A;  4AT1 B;  2AHJ B;  3VUB A;  2DEQ A;  1VQ9 T;  1U1T A;  2YRV A;  2F1L A;  2EGE A;  2HQE A;  4KUL A;  3CBO A;  1AHJ B;  4XTU A;  3CCS A;  4C92 E;  1UGV A;  2CYZ B;  2OTL T;  5IXF A;  1VQ5 Q;  2QEX T;  4HXJ A;  1RAI B;  2O4X B;  3QJ6 A;  2VKN A;  1VIF A;  1N8R R;  1RUW A;  3JRZ A;  1JXM A;  2L3P A;  4B6M A;  2DK3 A;  3OQ5 A;  1OPL A;  3VS5 A;  3GF5 A;  1M2V A;  3A5Z B;  1M90 C;  5GAN h;  3TQ7 P;  3L1A A;  4II1 A;  4F17 A;  1M3B A;  4M75 A;  1JQQ A;  4PNO A;  1M9S A;  1Z9Q A;  2JT4 A;  1WXT A;  2GQI A;  4E7I A;  2F5T X;  1MMD A;  2X35 A;  3KXT A;  2QGF B;  2PVD B;  1D0X A;  1K9A A;  2ZPE B;  1KC8 C;  1WIE A;  1Y7X A;  4ZTJ A;  4EMG A;  1KSW A;  1QP2 A;  2RJC A;  2BE7 D;  4JLI A;  5I11 A;  4M78 D;  1SF9 A;  5I2M A;  3RUX A;  1N8R U;  2K57 A;  2EQI A;  1SRL A;  2QQB A;  2I2L A;  4RTX A;  4IIM A;  2RMO A;  1OX9 A;  2X4X A;  4PJO C;  2RI3 A;  1H3H A;  3I55 A;  4E7S A;  2COZ A;  3NTI A;  6AT1 B;  1WJS A;  4M7A C;  3CCV T;  2HSE B;  2A0F B;  2AT1 B;  3V7R A;  4F7U F;  4J9F A;  3UA6 A;  4A4G A;  1VQN Q;  3VS0 A;  5GAM h;  3OYY A;  2LP5 A;  4PJN A;  4QW2 A;  2R57 A;  1BI2 A;  1WFW A;  4IUV A;  1FWZ A;  4CC3 A;  3LWI A;  2DX1 A;  4F16 A;  4C8Q D;  2YWW A;  2QXF A;  2GGR A;  3ZL7 C;  3J7A F;  4Z8A A;  3S6W A;  1Q7Y R;  4XTV A;  2SEM A;  2DET A;  3FJ5 A;  2DPP B;  1SSF A;  2JVV A;  4BB7 A;  1WQ7 A;  2FVU A;  2XKO C;  2QQR A;  4OB3 B;  2FB7 A;  1WHK A;  3EGU A;  3M9Q A;  3VS2 A;  1ZBX A;  2OJ2 A;  3OYI A;  4A4E A;  2LVM A;  1JRI A;  3G6E T;  3HSB A;  2CT3 A;  4GBQ A;  1Q82 U;  2FYK A;  2D8J A;  2COW A;  2PUK B;  2IIM A;  1ZSG A;  2YHT A;  3S3O A;  3QPH A;  5GAO n;  1KQS A;  3PMI A;  2GTJ A;  2DZ9 A;  4PJO G;  2DD4 A;  1HK9 A;  1OZ2 A;  1KG1 A;  1C6V X;  3JCM W;  1K4U S;  1G3T A;  3E2U A;  2NLU A;  2ZPG B;  2DAQ A;  2M02 A;  2XDP A;  2LQN A;  4E7L A;  1K73 R;  1SSH A;  4EPC A;  3BY7 A;  3R6O A;  2XK0 A;  4Y28 E;  5EC7 A;  2VXE A;  3CCR Q;  2YRC A;  2NYS A;  2RJE A;  3L2Q A;  3C0C A;  5LJ5 e;  1X75 C;  1A0N B;  1PM3 A;  5HCK A;  2DYI A;  2MIO A;  1VQ8 A;  5GAN g;  1VA7 A;  2OTJ Q;  1BIA A;  2EGC A;  3CCV A;  2RH2 A;  1NPP A;  3LH5 A;  1BYM A;  4M75 C;  4RCC A;  2HKN A;  4DBQ A;  1IZ6 A;  4LDY A;  2CP6 A;  1NJI R;  4PLI A;  2FRW A;  5LJ3 h;  1O9S A;  4ELY C;  1ZQ1 A;  1P92 A;  5CO7 A;  1K8A C;  4EMK C;  3DLL A;  1YJ9 A;  2EQK A;  2RI5 A;  1YJN A;  5LJ5 d;  2VGM A;  1N9S A;  1NYF A;  1X6G A;  1UGQ B;  1TXQ A;  5I2S A;  1QW1 A;  3CC7 T;  3CCM Q;  5A0L A;  3I55 T;  4M77 B;  1W2B P;  2KXC A;  1TTH B;  4M77 G;  1ZA2 B;  2VYT A;  2JN0 A;  4AMC A;  1R8O B;  3CD6 A;  2LNV A;  1I0C A;  1EX4 A;  1I8F A;  3MP6 A;  2A37 A;  5GMK e;  3EFO A;  1VQP Q;  5GMK l;  1VQ9 Q;  2MMP A;  4J9G A;  2K79 A;  2FZG B;  1K0X A;  2F2W A;  1PRM C;  1MHN A;  3C94 A;  2RO0 A;  4C5E A;  2O9V A;  2EJF A;  1VQL A;  2EIF A;  4JRQ A;  3ULR B;  5CKD A;  3FEO A;  3X24 B;  2HL5 C;  3F70 A;  2LQK A;  2FEI A;  2QEX A;  1TS9 A;  3CBP A;  4CC2 A;  1WI7 A;  4X1V A;  5GAN d;  1K9M U;  2XID A;  1RAD B;  1VUB A;  1JO8 A;  2O4X A;  4WTO B;  4PJO D;  2KRN A;  2QEX Q;  4J8O A;  4OP0 A;  3TVT A;  4JPB W;  4CI0 C;  2KAF A;  2QAS A;  4M7D D;  1CSK A;  2ED0 A;  2K3Y A;  1UHF A;  5GAN 6;  4AFS C;  2EQM A;  2CP5 A;  3RES A;  5GAN f;  3X25 B;  3OMC A;  4CC4 B;  1X43 A;  5AYF A;  1GCQ A;  5GAM j;  3EGD B;  1KC8 R;  1D1A A;  3SWN B;  3X26 B;  1SHF A;  2XDB A;  2DL3 A;  4E7J A;  1ZUK A;  3THK A;  4QKU A;  3HTR A;  3EG9 B;  2MWO A;  2PVO B;  2M9U A;  8AT1 B;  1PNJ A;  1K76 A;  4RTU A;  4YTL A;  4BUG A;  2OTL A;  1IRX A;  4E7Z A;  1NE8 A;  3OSV A;  2EKO A;  4N4G A;  3VV0 A;  2KT8 A;  4M75 D;  2EWN A;  1GBR A;  4XTX A;  3CCV Q;  1EFN A;  1Q95 G;  1RAH B;  5GMK i;  3R6N A;  2CZ6 B;  4B9X A;  3PMT A;  1QVG P;  4ME7 A;  3PNW C;  3TRE A;  1OV3 A;  1ZHI A;  4JJD A;  4C0Z A;  1OQK A;  1KD1 C;  1QVP A;  3RER A;  2EYX A;  4LDU A;  2J7I A;  1YWO A;  2BTT A;  4IUU A;  2OAW A;  1Q81 U;  2R58 A;  5GAN j;  4JDS A;  3M58 A;  5KCO A;  1NEG A;  5A0D A;  3HKS A;  4OB0 B;  1I07 A;  4IUR A;  3MP1 A;  2BE9 B;  5CKE A;  2M51 A;  2DEU A;  2BKD N;  2HBW A;  4HVV A;  2IVW A;  2V8J A;  3ZFJ A;  2MK5 A;  1HXD A;  1ACM B;  2BIV A;  2ESW A;  3JCM b;  1MMG A;  2NUP B;  2GQV A;  2KSS A;  1M4Z A;  4OB1 B;  4DQ2 A;  3OMG A;  1AWX A;  1VYT A;  4KH0 B;  2E6Z A;  2EJ9 A;  1B34 A;  3CC4 T;  1D3B A;  5FRO A;  3NFC A;  3ER0 A;  3QZ9 B;  5D6X A;  2KY9 A;  3GPL A;  1VQ5 T;  3EGD A;  3QXE B;  2QG9 B;  2LX9 A;  1M27 C;  3EG2 A;  1TOV A;  2X4W A;  1KC8 U;  1Y96 B;  3I9Q A;  3RMQ A;  5GMK j;  2ECZ A;  3EGX B;  4ZGD B;  3CCE T;  1X6B A;  1N5Z A;  5FU7 B;  1YIT A;  2HMA A;  2X3X D;  1JXO A;  3QSU A;  3CD6 T;  1YCS B;  3CCS T;  5IHI A;  2AK5 A;  2MAM A;  5GAN 2;  3DB4 A;  1MMN A;  2VUB A;  4KRT A;  3EHQ A;  4LDW A;  4AFU C;  7AT1 B;  2W10 A;  2JZ2 A;  2LCS A;  1M90 R;  1CKB A;  2QQA A;  4OML A;  3OW2 S;  3O5Z A;  3CC2 T;  1M2V B;  4KGZ B;  5HK3 A;  1K73 U;  3I55 Q;  1T3S A;  3PE0 A;  2QGG A;  2C06 A;  4J9I A;  1V76 A;  5CVI A;  3NHN A;  2M0O A;  2RQV A;  3I5S A;  2DXB A;  3RBB B;  3CCU T;  3GLX A;  1FYN A;  1U06 A;  5L8R E;  2CZ7 B;  5J26 A;  2PZ1 A;  4RG2 A;  2C0O A;  1JBM A;  3L2R A;  2CP7 A;  1GCP A;  2E6N A;  1YWP A;  3J80 E;  2L3R A;  2L3S A;  3L2V A;  3RKW A;  4C0D B;  2K9G A;  4D6W A;  4C8Q E;  3OYG A;  4ZN3 A;  2OX7 A;  3L2W A;  3EG1 A;  2DL5 A;  1MND A;  4J7F A;  1I5O B;  2L5Q A;  1SG5 A;  3LYI A;  4N0A C;  2EQJ A;  2KDS A;  4M77 F;  2QA4 Q;  4MZT A;  3CC2 A;  1JU5 C;  1Y0M A;  3CPW S;  3SD4 A;  4PJO F;  2NUT B;  1T3L A;  4C8Q C;  3VU3 C;  5HY6 A;  2AKK A;  4DA4 A;  1UGP B;  2GFU A;  5D6Y A;  3EAE A;  2P0P A;  3SWN C;  3UT1 A;  3JCM X;  4O6J A;  2G6F X;  4PFP A;  2HNI A;  1IGQ A;  2DXC A;  4M78 B;  3H0H A;  2O2O A;  3FLG A;  1JJ2 P;  3CCL T;  1VQ4 Q;  2FG0 A;  5IH2 A;  1W4S A;  3MP8 A;  3EHR A;  2FZC B;  4AG1 C;  2RHU A;  3CCQ T;  2XMF A;  5LL6 S;  4FSX A;  4C5I A;  1IRE B;  1TSF A;  2Z0W A;  1LCK A;  4Q5W A;  1R77 A;  2KE9 A;  4E7K A;  4JRP A;  1AWW A;  4XU0 A;  1JB0 E;  5GJV B;  3QYG B;  3DB3 A;  1XNI A;  1E6G A;  2PNI A;  1B3Q A;  4M7D A;  2MF2 A;  1PHT A;  3EG9 A;  2E10 A;  3RIR A;  1YN8 A;  4ORZ A;  1UUE A;  3EFS A;  1YHQ Q;  2YUO A;  3GP8 A;  1U8R A;  4BDY A;  4PJO B;  2JM8 A;  5IXB A;  1M3C A;  1DJ7 B;  3A8O B;  3T9N A;  5KE3 A;  3M5A A;  4C8Q G;  4AG2 C;  1N8R C;  1YI2 T;  4RKU E;  1SRM A;  2RQR A;  2J6O A;  3PGG A;  4VUB A;  4PJO E;  3CCQ Q;  2EYQ A;  4C92 B;  4FL6 A;  3VS3 A;  4JS5 A;  1WXU A;  3CCJ Q;  4M78 E;  3A8L B;  4J6X A;  2DVJ A;  3JAM E;  5GAO p;  3OS0 A;  4FU6 A;  1RI9 A;  3TSZ A;  3MEW A;  2FO0 A;  4JLG A;  2QTX A;  2CZ0 B;  2MI6 A;  4EMK B;  2DIG A;  3CC7 Q;  1B34 B;  3QUI A;  4M7D C;  3OYF A;  2CGH A;  5CCA A;  2EVR A;  2DTH A;  1K0S A;  1X6O A;  1PSF A;  4M78 G;  4MDW A;  3CME T;  4PFO A;  4A63 B;  4EMH A;  2YT6 A;  4AFZ C;  3M0U A;  1WX6 A;  1YJ9 T;  2AIR B;  4PJO A;  2K7A A;  4KGX B;  1YBY A;  3CXC A;  4LD6 A;  3OYH A;  1VQ7 T;  3M4G A;  4J5Y A;  5GAM d;  2JTE A;  3QII A;  2K3X A;  2IPO B;  4OMF B;  2RI2 A;  1MV3 A;  1ZBJ A;  3OSS C;  2QQS A;  2NUP A;  1YIT Q;  1N27 A;  3WVE B;  1TWB A;  1Q7Y U;  2P4R A;  1ZLM A;  1YJW Q;  4M7A B;  2DXT A;  1W70 A;  5LJ3 g;  1FMK A;  4OMQ A;  5GAO m;  4M78 F;  5C6S A;  3M0P A;  3OYD A;  4M77 E;  1ZUU A;  4QVD A;  4IUT A;  3JB9 G;  1Q82 R;  1X27 A;  1Q86 U;  4PLL A;  3Q1J A;  2ZPB B;  4KGV B;  4XTZ A;  5IHN A;  3OB9 A;  4F7U E;  1QKW A;  1LPL A;  3CPW P;  3QO3 A;  2RB6 A;  2YUN A;  5LJ5 h;  3G6E Q;  3JCM d;  2K5F A;  1QVG S;  4OMO A;  3OYC A;  1NYG A;  1QWE A;  1RAA B;  2CP2 A;  1QVF A;  2W0Z A;  1WLP B;  5FWB A;  5LJ3 e;  5GAN 5;  3VRY A;  3GBQ A;  3LGF A;  3E9G A;  3J81 E;  3CCM T;  2L8D A;  1ZSZ B;  5KYX A;  4KBM B;  3PTA A;  1WA7 A;  2ZGW A;  4NS5 A;  5GAM e;  2NWM A;  4D8D A;  2VAS A;  1M1K U;  3VYH B;  1XTD A;  1K8A U;  3CC7 A;  4X34 A;  4F04 B;  2LQW A;  3PT9 A;  1M30 A;  2F2V A;  5KYY B;  3JCM e;  1Q86 R;  2ZPH B;  3OBY A;  1AD5 A;  3HL8 A;  3CCE Q;  1C1A A;  2MCN A;  3INZ A;  4C0G A;  1XQH A;  2ZZD A;  4Y91 A;  2DJZ A;  2AZV A;  5CQY A;  2QA4 A;  2O01 E;  4KH1 B;  4M75 G;  5LJ3 d;  4ATO A;  4OMN A;  3E1S A;  4JZ4 A;  1VQL Q;  3A8G B;  2F69 A;  2WAC A;  5GAN 3;  4JJB A;  3FDR A;  4HCZ A;  2X3W D;  1S72 T;  2RJD A;  3CC4 Q;  2D6F A;  4DOV A;  1IO6 A;  5KYW A;  2K2V A;  2L0A A;  4LDX A;  1OUL A;  4JRK A;  5FU6 B;  1OU8 A;  2LJ3 A;  2E4H A;  3G71 T;  3V8K A;  2HZY A;  2J05 A;  2E3H A;  3QKJ A;  2COY A;  2HD0 A;  4GY5 A;  2FZK B;  4X9C A;  3WXM B;  2FL7 A;  2DJQ A;  3A98 A;  3HPW A;  4M75 B;  3DLM A;  2PTK A;  1LOJ A;  1UGR B;  1GFD A;  2KNB B;  1VIE A;  2DO3 A;  1PSE A;  1WDX A;  3OYB A;  3CXC S;  3M59 A;  3CCR T;  3OYE A;  3I56 A;  3MHX A;  4QQG A;  4J9E A;  1X01 A;  2DNU A;  2HEQ A;  3ASK A;  2MOX A;  3CMA Q;  3ZEH A;  3CQT A;  2DA9 A;  1JEG A;  2YLC A;  2RPN A;  3L42 A;  1TUG B;  3O8V A;  4M7A D;  1K9M R;  2MPX C;  4C8Q F;  2VVK A;  1H3Z A;  1QKX A;  3G6E A;  5DLQ E;  4A54 A;  3V7C A;  3H0F A;  2VB6 A;  1YHQ T;  3V8L A;  3EFO B;  2RK1 A;  1T0J A;  1BCM A;  1BCO A;  2DYB A;  2CSI A;  5D7U A;  4IKF A;  1KFZ A;  2VV5 A;  3GNF B;  1KIK A;  5IN1 A;  2CS7 A;  2DKG A;  1QCN A;  2CSQ A;  3EFR A;  2EPD A;  4ZTF A;  4RTW A;  5ECA A;  2KMT A;  3EGX A;  5GJW B;  5FU7 C;  2D8H A;  4J9C A;  1ABQ A;  2K3B A;  1PC0 A;  5IHK A;  3VS6 A;  5LJ5 g;  3NTH A;  1KD1 U;  2VC8 A;  3L2U A;  2OTJ T;  4GLM A;  4X9D A;  1QVG A;  4M77 D;  1CKA A;  3N5B B;  3CMA T;  4LUE A;  3SHW A;  4RTY A;  3M4Y A;  2KXD A;  4C92 D;  1VQO Q;  3UDC A;  5I21 A;  4FT2 A;  3UPU A;  3KBG A;  1NM7 A;  2DFU A;  1UDL A;  1RAB B;  2QI2 A;  3QWX X;  3MJX A;  4EMK A;  1NPR A;  2DL7 A;  3H8Z A;  2ABL A;  3UF4 A;  1WGS A;  1KHC A;  4XQ3 A;  1AT1 B;  4FW2 A;  4LUD A;  4PL6 A;  1H92 A;  1IHV A;  2E70 A;  3RKY A;  1U1S A;  3M57 A;  4C92 G;  4J9H A;  2JS0 A;  3P8B B;  2WSE E;  2Y4Y A;  4CC7 A;  1YIJ T;  1JJ2 S;  2DTO A;  4M7D F;  3GNG A;  1YI2 A;  3X20 B;  3UA7 A;  1YIJ Q;  4FT4 A;  4CRI A;  1AOJ A;  1Q81 R;  3UAT A;  4C5G A;  2GNC A;  2LJ1 A;  3I35 A;  2YRD A;  1NBE B;  4N4H A;  2FPE A;  1YJW A;  2X9H A;  3TEE A;  3GIB A;  4JJN K;  5HKC A;  1HD3 A;  3JB9 J;  3EG3 A;  4F14 A;  1N9R A;  2R5M A;  1VQ6 T;  2LDM A;  3CCJ T;  4M7A G;  2D9T A;  4XU2 A;  1YP5 A;  2ATC B;  1TG0 A;  1BU1 A;  2LNH B;  2LX7 A;  4J6W A;  3OYK A;  2EGA A;  3LLR A;  3G4S T;  1VQ9 A;  5LJ5 f;  2JW4 A;  3QWY A;  9ATC B;  2DRK A;  1WXB A;  1RAF B;  1M5Q 1;  2CRE A;  1S72 Q;  1KD1 R;  4J7I A;  5KCH A;  3SB2 A;  2KT1 A;  3QDF A;  3SDZ A;  4FW1 A;  2HAX A;  2RHX A;  2KR3 A;  4XTW A;  1YJN T;  4IUP A;  5CAI A;  4XAX B;  3JSC A;  4FM4 B;  1V29 B;  2BZ8 A;  3JCM J;  3H6Z A;  4XK8 E;  3JB9 F;  3CXC P;  4M7A E;  2HQX A;  1AEY A;  4V2S A;  2DZC A;  1M1K C;  3VS4 A;  1QQJ A;  2F5K A;  3ZBD A;  2M0Y A;  2WSC E;  1YFN A;  4C0D C;  3CCL Q;  2DTI A;  1RLQ C;  2VGN A;  5GAN e;  4MMK A;  5KYY A;  3BDL A;  3G4S Q;  1VQO T;  2QYZ A;  1NLP C;  3RNJ A;  2KRO A;  2H3E B;  2A3L A;  5C0M A;  1OX8 A;  3H41 A;  4F7U B;  3KUF A;  3M0S A;  5I22 A;  1D1C A;  2RHZ A;  1SKU B;  1M8V A;  3JV3 A;  2XHC A;  3BW1 A;  1PWT A;  1VQ8 Q;  1UEC A;  2CUD A;  1IGU A;  4ZGJ B;  2YLB A;  2KRM A;  3M0T A;  3RDV A;  2M16 A;  1VQP T;  2ZCF B;  1GCQ C;  2RN8 A;  3PVL A;  1RAG B;  5LJ5 j;  4BY6 B;  4BI4 A;  1BI0 A;  4HKE A;  4BI3 A;  5FLX E;  1UE9 A;  4C0F A;  1I81 A;  1W6X A;  3V8J A;  4ESR A;  4E2F B;  1OOT A;  4ZGE B;  1KQS P;  4FYX B;  1VYU A;  5EG2 A;  4OB2 B;  3SWN A;  1B7T A;  2QK0 A;  1O75 A;  3LWH A;  2YDL A;  2G3R A;  3JB9 D;  1WJQ A;  1UB4 A;  3QYH B;  3QDR B;  3U23 A;  1RL2 A;  2E5K A;  3JCM f;  1NJI U;  3AT1 B;  2MWP A;  5KYU B;  5GAM f;  1MGQ A;  1XOV A;  1KHI A;  2FHD A;  3VJP A;  2J06 A;  3CCJ A;  2XU8 A;  2RJF A;  2HDA A;  3PVQ A;  4LNP A;  5A2Q E;  4NL3 A;  3M53 A;  3OY9 A;  4LE9 A;  1M2O A;  4JS4 A;  2K4Y A;  2EQU A;  2HKQ B;  2ED1 A;  2DMO A;  2CP3 A;  1VQN A;  4XTY A;  3FB9 A;  3CPW A;  1Q82 C;  4MZM A;  5CKH A;  2ZAE A;  1HJD A;  1M1K R;  2QQ9 A;  2RQW A;  5IAY A;  3OYA A;  4DBF A;  4M7A A;  4JUV A;  1ABO A;  2EFI A;  4HT8 A;  1WJR A;  1OZ3 A;  2CDT A;  4N0A A;  3UWN A;  4E6R A;  3M55 A;  4F7U G;  3CC2 Q;  5DY9 A;  4ELZ C;  3HHT B;  4WF2 A;  1YIJ A;  4K11 A;  3REB B;  2RHY A;  2O88 A;  2C0I A;  2SRC A;  1VQM Q;  4BI8 B;  2VXF A;  4Y92 A;  2DF6 A;  3X28 B;  3TU4 K;  4BE0 A;  3PIO A;  1VQ4 A;  4QVZ A;  1YI2 Q;  1D3B B;  1BI3 A;  5L23 A;  2DBK A;  1OI1 A;  1W2B A;  4A53 A;  1QP3 A;  3BFM A;  3HRS A;  4C8Q B;  2HCK A;  2VWF A;  3I56 Q;  2DER A;  3E19 A;  4R56 A;  3QBY A;  1I1J A;  1WNL A;  1X2K A;  2GCX A;  2PU9 B;  2H3J A;  2JJ9 A;  2V1Q A;  5HK0 A;  2YUP A;  2BZX A;  4B9W A;  2Y4X A;  1KK7 A;  3M0R A;  3FC3 A;  4JZ3 A;  1NLO C;  5GAO l;  3JCM g;  2HL3 A;  1D1B A;  2RQT A;  1E6H A;  3S3N A;  1NG2 A;  1F1B B;  4HT9 A;  2RNA A;  2ROL A;  1I5L A;  2OTJ A;  1UEB A;  4FYV B;  1RAE B;  4RG8 A;  5CKF A;  3TCJ A;  2E3I A;  1QVF S;  1G8X A;  2V8K A;  1WZO A;  1XJW B;  2P0Q A;  1OU9 A;  3OS1 A;  3H9N A;  3MKD A;  2AKL A;  3M56 A;  2WSF E;  5CIU A;  4HCB A;  1FX7 A;  1BBZ A;  4M7D B;  4ZNX A;  5KYW B;  2FPD A;  5M9O A;  2XI9 A;  3OYN A;  1WQW A;  1VQK T;  4KT0 E;  3QHS A;  4QQ6 A;  1Q7Y C;  2CUB A;  4L5G A;  5GAN 7;  2JUF A;  2QA4 T;  1K9M C;  1UGS B;  2KVQ G;  3CEY A;  3CCE A;  4C92 A;  4F7U A;  5GAM g;  4EIK A;  2DIL A;  2KRS A;  1QMC A;  4LD9 K;  4KUI A;  1Y07 A;  1C0M A;  3REA B;  2RF0 A;  2V26 A;  2F2X A;  5IT9 E;  2EYY A;  2DBM A;  2RA2 A;  4OGC A;  4O5V A;  4BDZ A;  1OYX A;  2DL4 A;  2JM9 A;  4MML A;  2K5L A;  2E41 A;  4J83 A;  2JTM A;  3EH1 A;  4DEX A;  4LN2 A;  4NL2 A;  1GRI A;  2LT1 A;  3VS1 A;  1KJW A;  4Z02 A;  5DLO A;  3S3M A;  2DVE A;  1WHM A;  3OS5 A;  2D0N A;  1YJN Q;  1GL5 A;  1FMV A;  3URG A;  3MEA A;  4DOW A;  3LX7 A;  4RTZ A;  2KYB A;  5FRN A;  2BUD A;  1BIB A;  4RTT A;  3TSW A;  3CCM A;  5CKB A;  1W2B S;  2X4Y A;  2EW3 A;  3M0Q A;  5FU6 C;  3GOX A;  1NJI C;  3H0I A;  2XG8 D;  2YSQ A;  5KYN A;  2PQW A;  3HRT A;  1VQN T;  2XDD A;  1S1N A;  4QVC A;  4C92 C;  4QQD A;  1Z9Z A;  2BZY A;  4RCB A;  1M90 U;  2O9S A;  2NUT A;  1YJ9 Q;  1ZSZ A;  5KYX B;  2K6D A;  4EDU A;  5CR2 A;  1TU0 B;  5GAN 8;  4J9B A;  1E7O A;  2R5A A;  1KQ1 A;  4M78 A;  1D09 B;  1PD1 A;  1VQ6 Q;  2DL8 A;  2EAY A;  2EYZ A;  1RI0 A;  2RD1 A;  4XU1 A;  1V1C A;  2ZPI B;  3CCQ A;  1NZ9 A;  3LH0 A;  4TVR A;  2LCC A;  3OBW A;  1KQ2 A;  4R55 A;  1H8K A;  3JCM c;  2LZ6 B;  1SEM A;  2GFA A;  1VYV A;  4M77 A;  4AFQ C;  4DEY A;  1VQP A;  2K5I A;  1PCX A;  2QDL A;  3MCA B;  3VYG A;  4E7H A;  3NPF A;  3EH2 A;  3D7S B;  2I0N A;  2RQU A;  4FYW B;  1PD0 A;  1K1Z A;  3CBM A;  3L2Z A;  5FRM A;  2LCL A;  4J9D A;  1TH7 A;  3ME9 A;  1TUD A;  3VKI A;  4L6V 5;  5GMK m;  2LQ8 A;  4A4K A;  1WPY A;  4DBR A;  4FSS A;  1VQO A;  3E9F A;  4E47 A;  1W1F A;  1Y96 A;  1I4K 1;  1VQ7 Q;  2X4J A;  1M1F A;  1SHG A;  3CCR A;  1BK2 A;  1VQM A;  2B86 A;  2D1X A;  3P8D A;  2A36 A;  1QCF A;  3IQL A;  5DM7 R;  1QVF P;  1UG1 A;  4GLK A;  3FJP A;  4C5H A;  1OEB A;  2DIQ A;  2J6K A;  2RHI A;  4Z89 A;  2NUZ A;  2QTV A;  1VQL T;  2DD5 A;  3C4S A;  3MEV A;  2OAU A;  3OW2 A;  3KFV A;  1X2Q A;  2OI3 A;  3G7Z A;  1WHH A;  4NOY A;  3WVD B;  3G1J A;  2K2M A;  3RR6 A;  1AWO A;  3FRN A;  1KQS S;  3MO8 A;  1UTI A;  4KUD K;  3AHU A;  1PRL C;  4WCI A;  4DBH A; 
#chains in the Genus database with same CATH homology
 3BDU A;  1VQ4 T;  2F5K A;  1JB0 E;  2RK2 A;  2WSC E;  4XU0 A;  3QYG B;  3ZBD A;  1Q82 U;  2FYK A;  2PUK B;  3DB3 A;  1XNI A;  4C0D C;  4M7D A;  2DTI A;  2MF2 A;  2E10 A;  2KQW A;  2VGN A;  3RIR A;  5GAN e;  4MMK A;  4OF1 A;  2CKK A;  2YHT A;  3BDL A;  3QPH A;  5GAO n;  3S3O A;  1VQO T;  1K73 C;  4M7A F;  1KQS A;  3PMI A;  3EFS A;  2DZ9 A;  4PJO G;  2A3L A;  2DD4 A;  1G5V A;  1HK9 A;  1OZ2 A;  5C0M A;  1KG1 A;  3GP8 A;  1U8R A;  3JCM W;  4BDY A;  4F7U B;  3KUF A;  4PJO B;  2L89 A;  1G3T A;  2NLU A;  1DJ7 B;  2ZPG B;  1EIF A;  2DAQ A;  2EJG A;  3A8O B;  3T9N A;  5KE3 A;  2XDP A;  3M5A A;  4C8Q G;  2RHZ A;  3HP9 A;  3LGL A;  1N8R C;  4E7L A;  1YI2 T;  4RKU E;  5LJ3 j;  3PGG A;  4VUB A;  3BY7 A;  3R6O A;  2XK0 A;  4Y28 E;  4EPC A;  2XHC A;  3BW1 A;  4PJO E;  1M8V A;  2EYQ A;  2VXE A;  4C92 B;  4HCC A;  4FL6 A;  2RJE A;  3VUZ A;  3L2Q A;  2PUO B;  3QJY A;  1X75 C;  4ZGJ B;  2YLB A;  5LJ5 e;  4JS5 A;  2M16 A;  1YJW T;  1VQP T;  5GAO q;  2ZCF B;  4M78 E;  3A8L B;  4J6X A;  5LJ5 j;  4BY6 B;  3JAM E;  4BI4 A;  5GAO p;  4FU6 A;  4M75 E;  3OS0 A;  1BI0 A;  1VQ8 A;  4HKE A;  5GAN g;  2E65 A;  3MEW A;  4JLG A;  2QTX A;  4MZP A;  4BI3 A;  1BIA A;  4P5N A;  2MI6 A;  2CZ0 B;  5FLX E;  4M7D G;  3CCV A;  4C0F A;  2RH2 A;  4EMK B;  1I81 A;  1VQ5 A;  4BE1 A;  2DIG A;  1NPP A;  1LNX A;  3V8J A;  3OA6 A;  1B34 B;  2ZPF B;  1BYM A;  3A8H B;  3QUI A;  3DKM A;  4M75 C;  4RCC A;  2CGH A;  4ZGE B;  5CCA A;  3OYF A;  4IUQ A;  4M7D C;  3CCL A;  1IZ6 A;  3C95 A;  4LDY A;  5EG2 A;  2DTH A;  3LW5 E;  4OB2 B;  3SWN A;  4PLI A;  1X6O A;  1O75 A;  2P0K A;  2QDY B;  1Q86 C;  3LWH A;  1PSF A;  2G3R A;  1O9S A;  5LJ3 h;  4ELY C;  1ZQ1 A;  4M78 G;  4MDW A;  3JB9 D;  1P92 A;  5D6W A;  1H64 1;  1WJQ A;  3SFM A;  3CME T;  4MDX A;  1UB4 A;  1VQ7 A;  5CO7 A;  1K8A C;  3QYH B;  4EMK C;  3DLL A;  1YJ9 A;  2EQK A;  2RI5 A;  4EMH A;  1YJN A;  5LJ5 d;  2VGM A;  3QDR B;  1N9S A;  1RL2 A;  3JCM f;  1NJI U;  1YJ9 T;  4PJO A;  1UGQ B;  2KK4 A;  1YBY A;  2MWP A;  5I2S A;  3CXC A;  2XD0 A;  1QW1 A;  1MGQ A;  1XOV A;  5GAM f;  3CC7 T;  4LD6 A;  1KHI A;  2FHD A;  3VJP A;  5A0L A;  3JCM Q;  3OYH A;  3I55 T;  4M77 B;  1VQ7 T;  3M4G A;  4FIB A;  3CCJ A;  3CME A;  2XU8 A;  2RJF A;  4J5Y A;  4N4I A;  5GAM d;  2IG0 A;  4LDV A;  5A2Q E;  4NL3 A;  3QII A;  4M77 G;  2K3X A;  2VYT A;  2JN0 A;  3M53 A;  4JRI A;  2M1H A;  4OMF B;  1R8O B;  3V7S A;  3OY9 A;  2RI2 A;  5GAN 4;  3CD6 A;  3JB9 H;  4JS4 A;  2K4Y A;  2EQU A;  1G3S A;  3OSS C;  2QQS A;  2LNV A;  1Q81 C;  2E12 A;  5KE2 A;  4BE2 A;  1N27 A;  3RKX A;  3WVE B;  4M7D E;  1I8F A;  4UC4 A;  3MP6 A;  1Q7Y U;  1VQN A;  4XTY A;  3FB9 A;  5GMK e;  3CPW A;  4M7A B;  1Q82 C;  5GMK l;  2DXT A;  4C8Q A;  2MMP A;  4MZM A;  4M75 F;  2LTO A;  3A8M B;  3MEU A;  5CKH A;  2B8A A;  5LJ3 g;  5GAO m;  5GMK h;  2QQ9 A;  5IAY A;  3OYA A;  4M7A A;  3HSB A;  4JUV A;  2JNG A;  4M78 F;  2EFI A;  3OYL A;  5C6S A;  4HA8 A;  1MHN A;  3C94 A;  3OYD A;  2RO0 A;  4C5E A;  4HT8 A;  3JCM V;  2EJF A;  1WJR A;  1OZ3 A;  4M77 E;  1VQL A;  2EIF A;  4JRQ A;  4N0A A;  5CKD A;  3HFO A;  3UWN A;  2D0Q B;  3FEO A;  3M55 A;  4IUT A;  3X24 B;  4F7U G;  4QVD A;  3JB9 G;  2PVG B;  1Q86 U;  3F70 A;  2QEX A;  2E64 A;  2LQK A;  4PLL A;  3Q1J A;  2ZPB B;  5DY9 A;  4ELZ C;  3HHT B;  3CBP A;  4WF2 A;  1Y71 A;  4XTZ A;  1YIJ A;  5GAN d;  1K9M U;  3OB9 A;  2RHY A;  2LT4 A;  4F7U E;  2XID A;  1VUB A;  2O4X A;  1BKB A;  4PJO D;  3QO3 A;  2RB6 A;  5LJ5 h;  4J8O A;  4OP0 A;  3JCM d;  4BI8 B;  2K5F A;  2VXF A;  1QVG S;  4BD3 A;  4CI0 C;  3OS2 A;  5GAO r;  2KAF A;  3OYC A;  3CPF A;  4M7D D;  4PKC C;  3X28 B;  3TU4 K;  2K3Y A;  4BE0 A;  3NTK A;  3PIO A;  2A7Y A;  5GAN 6;  1QVF A;  3I56 T;  2EQM A;  1VQ4 A;  4QVZ A;  3RES A;  2E5Q A;  1D3B B;  1BI3 A;  5GAN f;  3X25 B;  1W2B A;  1OI1 A;  3OMC A;  5LJ3 e;  4A53 A;  1QP3 A;  5GAN 5;  3BFM A;  5AYF A;  3LGF A;  3E9G A;  1FXX A;  2Y90 A;  3J81 E;  3CCM T;  3HRS A;  4C8Q B;  5GAM j;  2L8D A;  1VQ6 A;  1YHQ A;  4KBM B;  3PTA A;  4XU3 A;  3E19 A;  2ZGW A;  4R56 A;  4NS5 A;  2HBP A;  3QBY A;  3SWN B;  5GAM e;  3X26 B;  1M1K U;  1WNL A;  2GCX A;  3VYH B;  4M77 C;  4A4F A;  2XDB A;  5LJ3 f;  3HFN A;  4E7J A;  3JCM P;  1XTD A;  2E1H A;  2PU9 B;  2H3J A;  2CZ1 B;  4RMO A;  3CC7 A;  4X34 A;  3JB9 I;  1YIT T;  1K8A U;  2MWO A;  2PVO B;  3PT9 A;  2M9U A;  4C92 F;  5HK0 A;  4B9W A;  3JCM e;  2Y4X A;  2ZPH B;  2XIC A;  3FC3 A;  3OBY A;  4YTL A;  4L59 A;  3JCM g;  5GAO l;  1S72 A;  4BUG A;  2OTL A;  3HL8 A;  3INZ A;  4C0G A;  5KH6 A;  3S3N A;  1NE8 A;  3OSV A;  2EKO A;  1XQH A;  2ZZD A;  3G4S A;  1I5L A;  4HT9 A;  4N4G A;  3VV0 A;  4Y91 A;  2OTJ A;  1UEB A;  2DJZ A;  3HRU A;  2EWN A;  4M75 D;  5CQY A;  2QA4 A;  2O01 E;  4M75 G;  4XTX A;  5LJ3 d;  4ATO A;  4BAC A;  2P4T A;  4RG8 A;  3E1S A;  3A8G B;  2F69 A;  1LJO A;  2WAC A;  5CKF A;  3TCJ A;  5GMK i;  5GAN 3;  3G71 A;  3FDR A;  4HCZ A;  2RM4 A;  5J39 A;  3QZ5 B;  1S72 T;  5CK9 A;  1QVF S;  2RJD A;  2CZ6 B;  4B9X A;  2V8K A;  2D6F A;  3PMT A;  2LRQ A;  4DOV A;  2P0Q A;  4ME7 A;  2K2V A;  3OS1 A;  3PNW C;  4LDX A;  3TRE A;  4HCB A;  3M56 A;  5CIU A;  2WSF E;  1FX7 A;  1ZHI A;  4M7D B;  1BI1 A;  4JRK A;  5FU6 B;  3RMS A;  4C0Z A;  2GF7 A;  3CC4 A;  5M9O A;  1KD1 C;  2XI9 A;  3G71 T;  3OYN A;  1QVP A;  3RER A;  1WQW A;  4LDU A;  4M78 C;  3V8K A;  4KT0 E;  1VQK T;  3QKJ A;  3QHS A;  2HD0 A;  4GY5 A;  4IUU A;  4QQ6 A;  1Q81 U;  2R58 A;  5GAN j;  4ZN1 A;  4JDS A;  4X9C A;  3WXM B;  2FL7 A;  3HPW A;  4M75 B;  3C12 A;  3DLM A;  3M58 A;  1Q7Y C;  1LOJ A;  1UGR B;  5KCO A;  3CMA A;  4L5G A;  5GAN 7;  5A0D A;  1VIE A;  2DO3 A;  3HKS A;  1PSE A;  2JUF A;  2QA4 T;  1K9M C;  1JJ2 A;  3OYB A;  1UGS B;  2KVQ G;  4OB0 B;  3CXC S;  3CEY A;  3M59 A;  3CCR T;  5A0G A;  3OYE A;  4IUR A;  3MP1 A;  2LC4 A;  4J6Y A;  3I56 A;  3CCE A;  5CKE A;  4A4H A;  4C92 A;  4F7U A;  3MHX A;  3PFS A;  4QQG A;  5GAM g;  4LD9 K;  1X01 A;  2BKD N;  3ASK A;  5CQX A;  4BY6 C;  4KUI A;  3ZEH A;  1Y07 A;  2YLC A;  2JOY A;  3L42 A;  1G3W A;  5IT9 E;  3O8V A;  4M7A D;  3FIF A;  5J3B A;  2IVW A;  2V8J A;  2RA2 A;  4C8Q F;  4OGC A;  3ZFJ A;  1HXD A;  2BIV A;  3OYM A;  1H3Z A;  3JCM b;  3M54 A;  3G6E A;  2GQV A;  5DLQ E;  2KSS A;  4A54 A;  1M4Z A;  3MET A;  3V7C A;  4O5V A;  3CCU A;  4OB1 B;  4BDZ A;  1YHQ T;  4DQ2 A;  3OMG A;  3PIP A;  3V8L A;  1OYX A;  2RK1 A;  1VQM T;  1VQK A;  2E6Z A;  2EJ9 A;  1B34 A;  3CC4 T;  1YCY A;  4MML A;  1D3B A;  2K5L A;  4IKF A;  3JCM h;  2E41 A;  5FRO A;  1N6A A;  2VV5 A;  3GNF B;  3ER0 A;  3NFC A;  3QZ9 B;  3P8H A;  4J83 A;  5D6X A;  2CS7 A;  2JTM A;  2DKG A;  2KY9 A;  4OVA A;  5IN1 A;  3OYJ A;  4OGE A;  3GPL A;  3EFR A;  1VQ5 T;  1GXI E;  4ZTF A;  3QXE B;  2LX9 A;  1G3Y A;  2V8I A;  2X4W A;  1KC8 U;  2KMT A;  5FU7 C;  1Y96 B;  1VQ8 T;  4NL2 A;  3RMQ A;  5GMK j;  2LT1 A;  2JTF A;  4Z02 A;  5DLO A;  4ZGD B;  3S3M A;  3CCE T;  2DVE A;  1M1G A;  5FU7 B;  1YIT A;  3QG1 A;  2DXU A;  3OS5 A;  3NTH A;  2AHJ B;  5LJ5 g;  3VUB A;  1KD1 U;  2DEQ A;  3QSU A;  3CD6 T;  2VC8 A;  3CCS T;  3L2U A;  2OTJ T;  1VQ9 T;  1U1T A;  4X9D A;  4M77 D;  1QVG A;  3N5B B;  3CMA T;  2YRV A;  3URG A;  2MAM A;  5GAN 2;  2HQE A;  4KUL A;  3M4Y A;  3DB4 A;  3CBO A;  1AHJ B;  4XTU A;  4C92 D;  4C92 E;  3UDC A;  2CYZ B;  3MEA A;  3CCS A;  4DOW A;  2OTL T;  3LX7 A;  2VUB A;  5I21 A;  4FT2 A;  3UPU A;  2BUD A;  1BIB A;  4LDW A;  3KBG A;  2QEX T;  2O4X B;  5FRN A;  3CCM A;  5CKB A;  3QJ6 A;  2JZ2 A;  1W2B S;  2X4Y A;  1VIF A;  5FU6 C;  3GOX A;  3JRZ A;  2QI2 A;  2QQA A;  3OW2 S;  3CC2 T;  1NJI C;  2DK3 A;  2XG8 D;  3OQ5 A;  2PQW A;  3HRT A;  4EMK A;  1VQN T;  2XDD A;  5HK3 A;  1K73 U;  1NPR A;  3H8Z A;  3GF5 A;  4QVC A;  4C92 C;  1WGS A;  4QQD A;  1KHC A;  4RCB A;  3A5Z B;  4XQ3 A;  1M90 U;  4PL6 A;  2C06 A;  2E70 A;  5CVI A;  3RKY A;  2M0O A;  1M90 C;  1U1S A;  3M57 A;  4C92 G;  5GAN h;  3P8B B;  3L1A A;  4EDU A;  2WSE E;  4II1 A;  2DXB A;  2Y4Y A;  5CR2 A;  3CCU T;  4M75 A;  1YIJ T;  1JJ2 S;  3GLX A;  4PNO A;  1M9S A;  5GAN 8;  2R5A A;  5L8R E;  4E7I A;  2DTO A;  1KQ1 A;  4M7D F;  2CZ7 B;  2F5T X;  3GNG A;  4M78 A;  5J26 A;  3X20 B;  1YI2 A;  2X35 A;  3KXT A;  2EAY A;  2RD1 A;  1RI0 A;  4RG2 A;  4XU1 A;  2ZPI B;  3CCQ A;  1NZ9 A;  3LH0 A;  2PVD B;  4FT4 A;  1JBM A;  4TVR A;  2LCC A;  4CRI A;  2ZPE B;  3L2R A;  1KC8 C;  3OBW A;  1KQ2 A;  4R55 A;  1Y7X A;  4ZTJ A;  3JCM c;  4C5G A;  4EMG A;  2E6N A;  2GFA A;  1QP2 A;  4N4H A;  2RJC A;  4M77 A;  4JLI A;  1VQP A;  1YJW A;  3J80 E;  2L3R A;  2K5I A;  3TEE A;  3L2V A;  3MCA B;  3RKW A;  3VYG A;  4C0D B;  4E7H A;  4D6W A;  3GIB A;  4M78 D;  4JJN K;  5HKC A;  5I2M A;  3RUX A;  4C8Q E;  3OYG A;  3JB9 J;  4ZN3 A;  1N8R U;  2K57 A;  3L2W A;  3CBM A;  3L2Z A;  2QQB A;  5FRM A;  1N9R A;  2R5M A;  2I2L A;  2L5Q A;  4J7F A;  1VQ6 T;  2LCL A;  3LYI A;  2LDM A;  2X4X A;  4N0A C;  3CCJ T;  1TH7 A;  3ME9 A;  4M7A G;  2EQJ A;  2RI3 A;  2KDS A;  3VKI A;  2D9T A;  3I55 A;  4M77 F;  4PJO C;  4L6V 5;  5GMK m;  4XU2 A;  3NTI A;  2LQ8 A;  4A4K A;  1WPY A;  1VQO A;  4MZT A;  3CC2 A;  3E9F A;  1WJS A;  3SD4 A;  4E47 A;  3CPW S;  3CCV T;  1Y96 A;  4M7A C;  1I4K 1;  4PJO F;  4J6W A;  2X4J A;  4C8Q C;  1M1F A;  3VU3 C;  3CCR A;  5HY6 A;  1VQM A;  3OYK A;  3V7R A;  4F7U F;  4DA4 A;  1UGP B;  2GFU A;  5D6Y A;  3P8D A;  3EAE A;  2P0P A;  3SWN C;  3UT1 A;  4A4G A;  4O6J A;  3JCM X;  3LLR A;  3G4S T;  5DM7 R;  5GAM h;  3OYY A;  2HNI A;  2DXC A;  4QW2 A;  1VQ9 A;  4GLK A;  5LJ5 f;  4M78 B;  2R57 A;  3FJP A;  1BI2 A;  4C5H A;  4IUV A;  2DIQ A;  3FLG A;  2RHI A;  1FWZ A;  3LWI A;  3CCL T;  1M5Q 1;  4C8Q D;  2QXF A;  1W4S A;  1VQL T;  4J7I A;  5KCH A;  3SB2 A;  3MP8 A;  2DD5 A;  3C4S A;  3MEV A;  2OAU A;  3SDZ A;  3OW2 A;  3J7A F;  2HAX A;  2RHU A;  3CCQ T;  2RHX A;  4XTW A;  3G7Z A;  3S6W A;  1YJN T;  4IUP A;  5CAI A;  4XAX B;  3JSC A;  4FM4 B;  5LL6 S;  4NOY A;  3WVD B;  4FSX A;  4XTV A;  4C5I A;  1IRE B;  1V29 B;  2DPP B;  1SSF A;  2JVV A;  3JCM J;  3H6Z A;  3FRN A;  4XK8 E;  1KQS S;  3MO8 A;  4Q5W A;  4BB7 A;  1WQ7 A;  3JB9 F;  2FVU A;  2XKO C;  2QQR A;  4OB3 B;  2FB7 A;  4KUD K;  4E7K A;  3AHU A;  2HQX A;  4M7A E;  4JRP A;  3M9Q A;  4V2S A;  1ZBX A;  2DZC A;  4A4E A;  2LVM A;  3OYI A;  1JRI A;  3G6E T;  1M1K C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...