3O90A

High resolution crystal structures of streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into catalytic mechanism and inhibition by aldehydes
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
189
structure length
187
Chain Sequence
TKALISIDYTEDFVADSGKLTAGAPAQAISDAISKVTRLAFERGDYIFFTIDAHEDCFHPESKLFPPHNLIGTSGRNLYGDLGIFYQEHGSDSRVFWMDKRHYSAFSGTDLDIRLRERRVSTVILTGVLTDICVLHTAIDAYNLGYDIEIVKPAVASIWPENHQFALGHFKNTLGAKLVDENLNELF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into the catalytic mechanism and inhibition by aldehydes .
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Hydrolase
molecule keywords nicotinamidase
total genus 66
structure length 187
sequence length 189
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00857 Isochorismatase Isochorismatase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.850 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Isochorismatase-like 3o90A00
1IM5A 3TG2A 3O91A 3R2JA 3S2SA 2H0RA 3KL2A 3EEFA 3UAOA 3O90A 2FQ1A 1NF8A 3V8EA 1NF9A 4L07A 2A67A 3TB4A 2WT9A 1YACA 3O94A 3O92A 1ILWA 1YZVA 4H17A 3OQPA 1X9GA 3MCWA 3LQYA 4WH0A 3O93A 3HB7A 1NBAA 3R77A 3PL1A 1J2RA 3HU5A 3OT4A 4L08A 3IRVA 1XN4A 2B34A 3TXYA 2WTAA 4WGFA
chains in the Genus database with same CATH superfamily
3SYRA 1O95D 3ZPXA 3OMLA 3AI2A 3O31A 4P5DA 2ORED 1VBFA 4P22A 1Z6TA 2I1WA 4QDZA 1W4CA 3MWJA 1NSYA 4G0PA 3SX2A 4D82A 4F86A 1Y5NA 4TV8B 3VDXA 3W5DA 1E32A 1WD5A 4Q15A 3TI9A 3AB8A 3OCXA 4CKWB 2DT5A 4WFJA 2PAFA 3QUCA 5DNYB 4N8EA 1ZNXA 3NV9A 4WBNF 2BHTA 2R11A 2GK3A 6LDHA 5BN1A 4LRXA 1A8HA 1A82A 1TO6A 2PUGA 3HDGA 1L5FA 4G07A 3PUJA 3WSWA 2I8CA 1PTJC 3DMYA 3GEEA 4EFNA 3EIUA 5L7TA 1NLMA 2X1LA 3HVIA 4LWQA 5EQJB 3GFGA 2CJYA 4BGDA 4ZV9A 1NNEA 1N9ZA 1PX2A 5FLKA 3PXGA 3F5SA 3JQQA 2X3UA 5DGIA 2C7PA 1DKOA 2J67A 3D9QX 2V7BA 3OZIA 10MHA 3NTRA 1OXBB 3VHXB 2PL1A 2BIFA 3AUSA 1OI4A 3MTIA 3VC2A 2ZSKA 4RDIA 2IZ1A 4ZAGA 4BE4A 5TARA 1Q50A 4Q7EA 3FY4A 1U7ZA 2ZG6A 3FB4A 4LK2A 2LRHA 3GWZA 5FP0A 3ZNQA 1YKGA 1GFWA 4DDHA 4MKXA 2XIJA 2VWHA 3KXDA 5J9FA 1N2CB 3I2KA 5ALKA 3RQIA 4O4IA 1RD4A 2VJPA 4LZJA 1I1HA 2QTWB 3ON5A 2D5AA 4KDFA 2Z4TA 5KTOA 2QYTA 4ZYUA 1JEAA 3K5IA 5JCJA 4IV0A 3EX7C 1U99A 1Z25A 1M73E 4HQRA 4A0FA 1D5WA 2ZKIA 2X0FA 1M8JA 2FZVA 3LBFA 4B6GA 3OE4A 4QPPA 5JJLA 1BEEA 1G55A 2EF0A 5FTLA 5JI3E 1T5DX 3TOZA 4COOA 3JD4A 4UDXX 1SU8A 3CUWA 3LCJA 3LECA 2W8ZA 1T9GS 2C92A 3SJBA 4BTLA 5CEEA 2ZRFA 3PCTA 2HREA 4K2AA 3S2UA 1FVXA 2OCPA 4F4HA 1AXGA 3L0CA 3FIUA 2QF7A 3AUJB 1T2VA 1XF1A 1J22A 1NQAO 2O2GA 1GAXA 1MLDA 3EG9B 3N2IA 3ZE6A 1AF7A 1UXJA 3HM2A 2CVZA 1E1CA 1Z0JA 1V35A 3OM0A 2I4MA 4OHXA 3HK2A 2R86A 4C0SA 3KVOA 3P45A 2J4CA 3A7DA 3JZFA 2CLDX 4X62B 1Z56C 3OPNA 4FMCF 2P41A 2RKOA 4AY3A 5K3SA 3TQTA 4EHFA 1W0JD 4MS1A 1QP7A 2QUBA 1TKCA 2I29A 3B6KA 4LZPA 5JDCA 1I5OA 3C8UA 1H5QA 1E7SA 2J87A 3CPHA 1NONA 1CUZA 4UXJA 1N34B 2KMLA 2H1CA 3A6LA 3IB3A 1E9SA 1PNVA 3LGXA 1V37A 2BEWB 2DPHA 3BERA 1M5RA 5AI4A 5E8JA 4YAWA 4DXAA 1YDFA 3LQKA 3BTVA 1SUPA 4JLPA 4ZO6A 3L6EA 2NUBA 4MI6A 1MAUA 4JUAA 3FFAA 2ZI9A 4QNMA 7REQB 2OUKA 5IDVA 2DHQA 2CJPA 3SQDA 2XXAA 5HJ5A 2XECA 1SUBA 1E3JA 3L84A 1IOZA 3W79A 3OBIA 4ENQA 3WIBA 3EODA 2HXSA 4ASUA 1CYDA 3PR3A 3S1LA 3WLQA 1REQA 2NTVA 3HXPA 1TQ8A 4ITUA 5LKRA 4V0QA 5BSFA 4XGNA 5TJHA 2WJWA 5HBGA 4DSAA 2NPOA 4B73A 4J8PA 1U94A 4M9CA 4RSRA 2IEZA 3OI7A 3B6IA 1C0EA 1EK5A 4TQGA 1ZN9A 2XMPA 3RVNA 3GIDA 3ZU5A 1RABA 3I0NA 2G28A 3FYCA 3U7FB 3V8VA 2WQ7A 1U63A 2YMPA 4H59A 1U7WA 5CX1B 2OM6A 4UEWA 4DLBA 1QOPB 4B2IA 5LP6C 2WHXA 3ZD8A 5B2EA 3LP6A 1WCV1 4DM3A 4BZWA 3A9VA 3AKDA 2VXOA 2W90A 3IO5A 1GQRA 1NBMD 2ZB3A 4GOND 4J9VA 3G88A 2IV2X 2C2WA 1IDOA 4GBED 1CLEA 3DLAA 1MZPA 3R6WA 3JZIA 3NM4A 4OA8A 4RU1A 3UPUA 4WNYA 1CNEA 1ZM7A 2A88A 1JB1A 2ZRGA 1GPMA 3GHYA 5AQEA 3QBVA 4BTVA 5K6AA 3VH3A 3A1UA 4GG1A 1Z8NA 2BHSA 2OSVA 4XYMA 3PUZA 1JPJA 2C5GA 5BNWA 1P75A 1O3YA 4GQIA 4BYMA 4CHGA 8ATCA 2FDCA 1NXVA 1VFNA 3M5DA 2XDQB 4QUIA 4HDNB 5ERXA 3CZQA 2CYCA 3MAAC 2VP2A 1JHOA 2GWHA 3E53A 4IGKA 3AL3A 1MRNA 3LKDA 4JBNA 3I6MA 2WSMA 3RC8A 3P4XA 1Q0UA 5AHRA 2ZDGA 2XWJI 2YIJA 2V9ZA 1J42A 4HX2A 3J80A 1R9GA 3RVJA 4B46A 5J4KA 1ZM2A 2QYHA 3HFGA 1Q0TA 2ZRPA 3KOZA 4S1NA 1U04A 4ZMBA 3FJYA 1M2JA 5DM0A 3JYNA 3RFVA 5L4SA 2PJUA 3VSDA 1DELA 2W6OA 3B78A 2QRUA 3EOZA 3IQFA 2B0JA 4IXMA 1B6RA 5C8DA 2XJ4A 3OP4A 2WVGA 3KUKA 4RV5A 3ZZTA 1WXHA 4BPRA 1OC2A 2R1TB 5EJAA 1A3CA 2CMDA 2P11A 4F1JA 1UKZA 3IAFA 4MWOA 4OBXA 3IBFA 3IKVA 3WBFA 3ZLUA 1USGA 2I4IA 4AMYA 3Q3JB 4XWGA 1RM0A 1Z12A 2A30A 5EPEA 3ODPA 3ORYA 2G71A 4EZEA 3DZFA 1DAKA 3MTEA 3DDOA 3WLFA 4QT4A 2VBIA 2GEJA 2VH5R 1D4FA 1YA8A 3KJHA 3S2FA 4W7IA 4HKTA 3ZDAA 4ECEA 4UMEA 4WVLA 5HRCA 1DWQA 2V8OA 4E33A 1MJ5A 1H94A 1UDCA 2J4FA 3H99A 3IFSA 4AKIA 1JDBC 2P40A 4A5OA 1OBVA 1R12A 4I1RA 5EUQB 1UUFA 2CFOA 4LXXA 3N76A 2HJHA 1VBNA 2K6GA 3ZWWA 3AM1A 4JSTA 3OFJA 4RY9A 1VIDA 2VHUA 1U7HA 3IOCA 4EGFA 4NL4H 3I1IA 4IQGA 3QVSA 3OQIB 2HJRA 4QLOA 4TQAA 2B98A 5IJZA 1O97D 2QG6A 5C8XA 1GCGA 2I4RA 3OQIA 3E7PA 5C8YF 1F5SA 1LFDB 4MMXB 3F6PA 1KYQA 5ESRA 1D6NA 1U98A 2FVYA 2JKYA 1Q1AA 3T5BA 2C5EA 1BOOA 3WZ2A 4S04A 1OH5A 4M8IA 3PE6A 3QX3A 3QMWA 1FUYB 3DEAA 5IJAA 4GZMA 3FSGD 3GFVA 5CM8B 3GLGB 1WHTA 2JFUA 2PZJA 5I4CA 3SVLA 1GL7A 4FFBB 3GLGA 1TDJA 1D1TA 1LPOA 4JN6B 1MNQA 1M8FA 3EA5A 5JPCA 1GEGA 3U26A 3JVIA 1VMAA 4FZ3A 4RTJA 5E7MA 1TKBA 4LBYA 4W8HA 1U31A 1UXGA 4JDUA 1ENPA 1Y8ZA 2WZDA 3W0LB 4BLPA 2PGLA 3NGLA 1N0IA 1QIHA 4Q9AA 3UUFA 3X1DA 1KC3A 5EWJB 4OQNA 3EZYA 2GWRA 4B40A 2IKQA 5C81A 3P9KA 3FLMA 2P9EA 1V1MB 2XR1A 1PV2A 3KSRA 3QOFA 2VAMA 4FGJA 1FMLA 1NOKA 1QUFA 3JQFC 3KQYA 3OJCA 4H35A 5FPSA 3HPRA 4OAQA 3UH1A 2D5LA 3FD8A 2PVSA 4OMCA 4DDMA 1VPWA 1ACLA 2ZAMA 4Y2GA 5HCNA 1W4AA 5C51B 1NFRA 1BWRA 3MJHA 4Z9YA 3OPYI 1XE3A 2POCA 3H0CA 4K9PA 4RSGA 3BBPA 1TKAA 2R6GA 3O91A 4DNXA 4ZYZA 2O8EA 4YI3A 2SNIE 4ZV4A 1XDWA 2Q29A 5FX2A 2V5UA 2H29A 2IA5A 4PFKA 4C0JA 2E5LB 3RC7A 3U4QB 4JT4A 4Q18A 3M49A 4HLCA 4P84A 1HDXA 2BPOA 2CFTA 4WDQA 4BMOB 2QTHA 3BJIC 5G41A 2ZYUX 1M2VA 1V39A 2BN4A 2C4NA 2VRWA 3OX2A 1N2SA 4WX2B 3OEWA 1B8PA 2I9PA 4IIUA 3BVPA 4U2FA 1N2HA 2E4WA 1FRZA 2Y9MB 5D87A 1DU4A 5M29A 1Q22A 4BYGA 4MNTA 1KK0A 2D4AA 1TX4B 2QAIA 4V0LA 2WUDA 1UDWA 4J1TC 4MYRA 4R51A 5DT9A 1R16A 4AM8A 4BLSA 4EAAA 1SC1A 2OG1A 3HCBA 4PZZA 3RAJA 3M9LA 3NYRA 4DIDA 3TLJA 2NYUA 1VCOA 2LD4A 3TMKA 1Y8RA 4XUEA 5DTIA 2RK6A 3F5QA 4HNQA 3MTQA 2A1TS 1GQQA 1TW3A 4V0RA 4EKYA 1GYQA 4RF3A 1BN7A 2FW1A 3FNIA 2BUCA 5F7ZA 1P80A 1E3DA 5FTWA 2XHZA 1ZDMA 2QN7A 2YBDA 5IANA 3CY6A 3GEGA 3U7HB 3RFXA 3RLIA 4KZKA 1B23P 1DEHA 3LWNA 2QTMA 1YZ3A 2PT6A 4KSBA 4W5HA 4CQMA 3PPXA 4ZOQI 3IRVA 2D7JA 2BZ1A 1AKVA 4UFOA 3D7RA 3I9V6 2RGEA 2IZ0A 2JLWA 1CY6A 1K2WA 1TT5B 2X5OA 3MFQA 2PH7A 3ICWA 1OFIA 4X54A 4ND6A 2J3KA 3SU8A 3SY8A 4FNAA 1E8MA 1JDSA 1NYRA 2C3MA 2P9YA 3R4VA 3BIFA 5B1DA 1D1SA 3OA0A 1YVUA 4I9UA 1OC4A 3IAM1 4JMPA 2ZUDA 3GRPA 4NFYA 4IOKA 1D7OA 2QUZA 3ZWKA 3ABQB 4HVTA 3TKYA 4AF7A 3PPYA 4YFVA 4A6XA 1L5MA 2OBXA 4HI0E 3QFSA 1N36B 4O4JA 4DADA 8OHMA 2VPQA 4XM1A 3TIGA 3TEJA 5A5EA 1SVKA 3DZHA 1NULA 2ZJ4A 4R01A 1QB8A 1UWLA 3ZV5A 1T0BA 3NH6A 4GDMA 3F78A 3PXBA 4L7QA 4BMVA 4IX9A 3T52A 4YUAA 3FUUA 2A1TR 3KVYA 1PQUA 4LFAB 1CUYA 1KC1A 4ON9A 5DNVA 5DYGA 3WL3A 4RH1A 4NE7A 1S2GA 1YCDA 4FQ8A 4GP7A 4Y1GA 2HWYA 2PQ2A 3QPDA 1EPUA 1T0PA 1CJMA 2OO5C 1PWHA 2FRXA 3INNA 2AJTA 4RELA 2BFFA 4B2YA 4MR7B 5ILOA 2I0FA 2OMEA 1N6NA 1YR9A 4Z4GA 1NJ5A 3VA7A 2P7HA 4KIGA 1KVUA 1E3SA 5EMKA 1LBQA 2O2YA 2OD9A 3K0HA 2AFVA 1F7UA 1G3RA 1G59A 4RXMA 1PWXA 4ZVOA 1JSLA 3JQ9C 4LJKA 4Z9AA 1VIYA 2Q5IA 2XNHA 2X4GA 3OIYA 4GR9A 4HFMA 2DZDA 4R7ZA 4X1OA 5BVHB 3FTPA 2YWFA 3RSGA 5I6DA 3A9TA 1W29A 2RG1A 4G4JA 2O8BB 1T3ZA 2BEWA 4MPRA 3RYFB 3PFWO 2P9HA 3OJWA 3V4OA 3W9YA 5EUBA 4ZYVA 5FLYA 4U9HS 2UXBB 1FYEA 5KVVA 3ZXUB 4AZTA 3ANSA 3H5VA 4PV7A 4OQFA 2WVHA 4AP6A 4INPA 2ASVA 3VU3A 4AURA 1FW8A 1VHQA 1OZGA 1Y6ZA 3D64A 3INYA 1Z3IX 2X22A 3JASA 2H8GA 4H27A 4ILKA 2FFJA 4C4XA 4DA7A 4YRZA 1O9GA 2VCHA 1AOXA 4MROA 3IMCA 4RCZA 2H59A 1LJLA 2BFAA 3AF6A 3IE2A 4MV4A 4RD3A 4EA8A 4AYTA 4URXR 3GU3A 3EZ7A 3K0BA 1HE2A 5JMWA 5T3UA 1CLUA 3RRBA 5TEWA 3SMVA 4B7UA 1DDIA 2QAGA 4YN3A 3UC5A 4B71A 3F67A 1U02A 1I51A 2Y1KA 4ARUA 4IJUA 2VDMB 2K7ZA 4HWRA 4ZO7A 1QE5A 1R3DA 1DRKA 4MVJG 3B13B 3DPUA 2EP8A 1M2NA 5FTMA 1IPHA 3B1ZA 2AR9A 1R00A 3KS9A 1W4ZA 3ZY4A 1K7CA 1TJ4A 3DBRA 3E6AA 5C31A 1JIIA 2K4MA 4B3TB 4R8RA 3MWLA 5AKZA 5HXAA 2R5NA 4JL8A 1FDTA 3VPCA 5L3SA 2MSLA 2C61A 2Y0DA 4OIMA 4C4TA 4EP1A 2BH2A 3IH5A 3R6LA 1HT3A 1RFLA 3D7LA 5DLPA 3R3YA 5DISB 1S5PA 3R77A 1FJHA 1KJNA 1GGHA 3AHDA 4BX0A 1L4KA 2XXBA 1N5KA 1FFDA 1LB1B 2QI9C 5C5EA 2MJLA 2XITA 5HOQA 2AZ4A 2FUNB 2NUTA 2BELA 2G5CA 1PQPA 3SZ3A 4HYYA 4WRRA 4YCJA 5HMMA 3QVXA 5JDIC 4JAVC 2ZIVB 1Q1EA 4M0DA 3ROFA 1DFGA 1QHFA 1SUSA 4AULA 4BJ1A 4ENRA 1T4DA 1X7GA 2VJAA 1ORVA 1FDSA 4B83A 7ABPA 4DJAA 4Q7MB 2IK8A 2FP4B 5DN9A 3CRVA 5IKOA 3O8RA 3CURA 2EFJA 3O4JA 5ITZB 1JKJB 3DPIA 1YKFA 3DZDA 3TIXB 2QTVB 3DFZA 3SJAA 3L7JA 2C7OA 4FOOA 1Z5WA 2M9MA 3BFXA 2AKEA 3PFBA 4JU8A 1C9KA 2AUMA 1JYSA 2A0UA 2NZJA 1KQGA 3LUPA 1KO4A 1RAAA 3A25A 1O96B 5TF4A 1R0CA 5CEFA 1YDGA 2V6BA 3PLRA 5A0TA 2OM2A 3C5HA 1ZBDA 1JG7A 2UYGA 4YJFB 4EJ2A 3SBOA 3QJ5A 1CF4A 1G7SA 4B7XA 1OF1A 3T15A 3KZMA 2BDTA 5HS6A 3UOAB 3LCVB 3LOPA 4J4BA 3GFOA 2XA1A 5F76A 2DTDA 1NW5A 1CF9A 1RWXA 2HIMA 3SJ7A 1IU9A 3T7AA 4C4SA 4TN5A 1LPPA 1OCEA 3C5CA 3GEDA 4EB3A 2PR2A 1JR3D 4UPVA 3LRXA 3IIJA 3ZJTA 3VX3A 5REQA 3AZQA 4K6GA 2BEVA 1EFDN 3BXXA 2PU5A 3FZQA 2Q1TA 4H6VA 5E1BA 4DG8A 2SKCA 5CB4B 2IEIA 4YCNA 2ZAYA 2YJZA 1FTNA 3B1YA 4EFLA 2IVZA 3GLIE 1R2QA 1E61A 5AP9A 2OL4A 2ZYDA 1N5IA 5FPQA 2LIPA 1JSXA 1N6IA 3BE5A 2FZKA 2QAJA 3DTYA 4Z2YA 4PN3A 1W0JA 1ZN2A 2ZUBA 4IQFA 1ICEA 1D04A 1L7BA 1OJ7A 2B4KA 1KXZA 2WJZB 1FDVA 4RFVA 4ROTA 2JIOA 2WHQA 4MH0R 4F6RB 2VC2B 1WOYA 4HB3A 1U5AA 4RW0A 1Q14A 1VA4A 1ZMTA 2EKPA 3EZLA 3QK7A 4LZAA 4MIOA 1ESNA 2P9ZA 3O73A 4JCOA 4KOEC 3RUFA 1UMCA 1USIA 5IK2A 1E0SA 2XUFA 2J1LA 4QYTA 2AOVA 2W22A 5HFJA 4C0LA 4EHKA 4LCJA 4H7EA 5F7XA 5T6BA 3ORRA 3W3AA 4R5MA 3IOYA 2A0KA 1LWNA 3TXYA 2C4TA 4RD4A 5KNBH 3LDUA 5EHXA 4G84A 4HMPA 3BQ9A 1IJBA 1J2YA 2EV9A 3ITEA 4IIXA 3T4PA 4E1AA 4B3SB 1L4YA 2ZRAA 5DX1A 3B2NA 1SHUX 3DTVB 1I33A 1F0KA 4TUYA 4L0CA 5KSWB 4NCKA 4CV3A 1C14A 3EWAA 1E7YA 5CDFE 1QG2A 1V1MA 1Y1SA 1KYWA 5HJ2A 1YDMA 3R7FA 4B76A 4HEA1 3ZH2A 4XPZA 2XDAA 3K9FC 2HA5A 4XCVA 5IC6A 1LBTA 1IZ9A 1FNCA 1C2TA 2ROQA 5LB2A 1CUXA 3OM8A 4BP8A 3B51X 3W7VA 2IUYA 2O7NA 5FOXA 3RE1A 1OGIA 2D0IA 1NIJA 3DHYA 1TAQA 3UO8B 3ED5A 2BDUA 5H4GA 4ZMRA 4NBNA 5REQB 4D45A 1BG6A 2WJIA 1KHHA 3VC7A 2IOFA 1I7PA 1SGWA 5FR1A 4BWFB 1F8XA 1ZIDA 1PYGA 2ODWA 2ET6A 1WHTB 3CEJA 3MLBA 2OP1A 1SZDA 4JOCA 1YD7A 4PZCA 5JSYA 2A0FA 3ZZMA 1C30B 1U4SA 4LJRA 2LV8A 1Q1NA 4QUGA 3JAKA 4OH7A 1WW8A 3QYJA 5G3ZA 4DLWA 1ZL2A 2NTNA 2WWVD 4IPTA 3CYFA 2ZZKA 1K2VN 5JAOA 1ECPA 4UVDA 6Q21A 4Q4HB 4C07A 1SVSA 3T41A 1SVIA 1GD1O 1TQ2A 3BMQA 3R3JA 2F7SA 1SD2A 4PLZA 2FFQA 3LT2A 1YIDA 4JS0A 4YGYA 3A4TA 2FUEA 1YHZA 3QQPA 4Q9LA 2GBIA 1VZ3A 2ZT8A 2DFNA 5IVHA 2ERYA 5AO9A 2QBYB 1IG0A 1EG2A 2E4XA 4B75A 2V5VA 2KS6A 5KTYA 5DCLA 3OO1A 1QH1B 1HG0A 1RNLA 1TLFA 2PCLA 1MXHA 5IWAB 2C82A 2VDUE 4ZAXA 4YAEA 2CXOA 3BRCA 3OWOA 1WDLA 1PEYA 4A5SA 3KKMA 1VL1A 3ICPA 5EIHA 3CVXA 1BMFD 2R00C 3LOUA 4O1HA 3PB3A 4RLQA 2G1AA 4P33A 4E1VA 1NUTA 2GUGA 5CNMA 3EEYA 4XIFA 1QFZA 1RRVA 5FFFA 2HH9A 1L5WA 2AGVA 3L82B 2Y66A 4IUDS 3VR6A 4C7OB 5B12A 1NXSA 3OLZA 5AM4A 4X1IA 4YS6A 1QGDA 3HGTA 4BV9A 3NT2A 3K9GA 1XJCA 3M6LA 4AKTA 4ID9A 2HMTA 3JQ9A 2XODA 3E7DA 2GAIA 3NNDA 3DAYA 1ZD1A 2PGDA 1TAUA 3L7LA 3SF8A 2ZGVA 1UEJA 3IT2A 1Z08A 3E9EA 1KMCA 4J0DA 3R0ZA 1ADBA 3QWAA 4BCCA 1LTKA 1YJAA 4KQCA 5HVNA 5ADUS 3S4YA 1VSQA 4ZRDA 4RZUA 5IC4A 1ULHA 2J0UA 1X7WB 2VJDA 1AT1A 3HDQA 4AWXA 2BWJA 2GD2A 1C0KA 1MEEA 2ZVDA 3C97A 3D8TA 1JAZA 4KPGA 4LTNA 4CT4B 2Q9UA 6REQA 1ILEA 1RWBA 4N5MA 3TM5A 3G2JA 4OYRA 1SMKA 2WWTA 1DX6A 2HWWA 3N07A 4FDTA 5K4AA 1BE6A 3MJCA 1KVQA 1DZIA 2Q2NA 2ZXFA 2EKLA 2IUTA 1SG0A 3T3NA 1NWHA 4TROA 2WMYA 4IRXA 1L7XA 3AFOA 4IF4A 4M9ZA 3N2GA 2OBYA 3STHA 1UIMA 1JFSA 2NIPA 2FMTA 3QLTA 1BVYF 2XGGA 2GEUA 1C1DB 1FA9A 2PYIA 4CM6A 3HJCA 4MPPA 4PTLA 4BWVA 1DIBA 1MO6A 2FKNA 1RWOA 2QT1A 4S1VA 3QBJA 3P2OA 3RIGA 3OZDA 1IXKA 3BRWA 3ZNNA 2RSLA 2WBLC 3KPYA 3TCXB 2D13A 2D1YA 3NUGA 4M0KA 4YUWA 1ZQ1A 3HU3A 4XVRA 3FCAA 2MSDB 3K0CC 4NBWA 4DSZA 1GGJA 2J0VA 5JFGA 1IZYA 5F5LA 1O0CA 4K0KB 1WMEA 3N8KA 3QVGB 3FH0A 1CZOA 4JU9A 2J5KA 3ROXA 1UPAA 4JYCA 1SHLA 3W6ZA 1FDUA 4R71A 1Q0PA 4NJEA 1M1YA 4JP5A 4M49A 4YMTA 2ODNA 4KAFA 1DX9A 1TLTA 1W0KD 3U39A 3LPNA 2EX1A 2IS4A 3STUA 4I6EA 1XQ6A 3CH4B 3R4CA 1HPLA 1Q20A 1TZJA 1XU9A 4MLPA 2A5LA 4YACA 4ZP1A 1SOAA 3TW6A 5K3BA 3HDJA 2OXTA 5M5BA 3QYPA 5CLQA 1Z33A 1TC2A 1J2EA 1TF5A 1AUQA 1JDZA 2GHTA 3DQQA 4HNGA 4L3OA 4MP8A 5EXTA 1HTBA 2DY1A 3THRA 4EPYA 3L4JA 4URHA 3QEBZ 2P4UA 2A0XA 5TQ0A 1L5ZA 5IAJA 4C87A 1M34E 3M70A 4UU7A 4ZQBA 4JASB 3HMKA 1E9AA 4XR4A 4Y2UA 1T9ZA 1ZISA 3VU0A 1IUNA 4G0UA 4JR2A 2HDWA 4OJNA 4TTAA 5B55A 2B8EA 1IBSA 2BJVA 2PYDA 1CJVC 1HETA 3RWBA 5E9WA 3MWEB 1ZJWA 1N6HA 3QJYA 4R9NA 3QPVA 1VG0B 4WOPA 1KJWA 2PUTA 4X61A 3RTGA 3OSZA 3FHLA 3HC7A 1IUKA 1AQNA 3VJRA 1DT3A 2H52A 4B9EA 5JO9A 1XQXA 2VKQA 4IIGA 2O23A 3DOHA 2Q1UA 3VAZA 3BJRA 5A1TA 2AMLA 1M2FA 5CBPA 1UJ6A 1ZHHA 2PLAA 5I48A 5LA6B 4IYRA 4NZ9A 1VKOA 3OC6A 3BK7A 4OL9A 3V5NA 2WYVA 3OC0A 3ZDQA 4ZCLA 4CMKA 1ACJA 5TVKA 1SKQA 4Z9BA 1TGYA 1TCAA 5SZIA 8MHTA 3DV0A 4F21A 4H3KB 2FW0A 5JG7A 4IV5A 1VCHA 3RIXA 2OD2A 2RGYA 4S1OA 3KJEA 2O6HA 4P98A 1VJRA 1ENYA 4L1KA 5KCMA 4EG8A 1CR1A 1B41A 3E7WA 5B3JC 5BNZA 3EW9A 4FWIB 5EE9A 1AF4A 4Y0AA 1XVAA 3AF4A 3ZHQA 3PQ6A 4GFDA 5B6JA 5EIEA 2OUIA 1SXQA 1O8BA 2Q6KA 5CFNA 4PY2A 3V97A 5BY2A 2Q8QA 3LRPA 1GUDA 2FPKA 1LVUA 3ECCA 2RI6A 3NIBA 1VLLA 4IGEA 1Z82A 3S40A 3WLAA 3WGVA 2O7SA 1ZIOA 4IVPA 1MABB 3UOWA 9GPBA 3BULA 1GTSA 1PZNA 2ZBRA 3EE6A 1YJ5A 4Q6BA 2G9UA 2LP4Y 2XAUA 4RA6A 4JODA 1IZ0A 4DA9A 3E3MA 3Q12A 2ZANA 4GZ5A 1K6XA 2HRBA 2QIPA 1J8QA 1XLTC 4QRIA 2E9SA 3FNEA 2X8JA 4K6MA 5E1DA 3G49A 2AOUB 2RHGB 4WY5A 3SJUA 3BFPA 3CR7A 1KGSA 1LC3A 1Z6AA 1KAQA 1POWA 3HB1A 3PNLA 2QNIA 2I6GA 4MUYA 4AXBA 3GY0A 4MUMA 1GYRA 4HUQA 4XWOA 2MOKA 2J3EA 3QV2A 1EDEA 4R8LA 1PUIA 4RHUA 5L8VA 3JALA 2X2EA 3O0TA 3O8LA 2D1TA 1P8JA 3Q7IA 1F2TA 3H8SA 5K51A 1UPXA 4V0KA 4FYYA 2XT9A 4CT0A 2JLRA 5DTRA 2NSYA 3RODA 1E3IA 2EFDB 4FDUA 4KN5A 4Y8VA 1A8PA 3VR4A 1WSAA 3FVQA 4ZI3A 3DBLA 1OH7A 1P9NA 3GPIA 1U0TA 2J07A 4BECA 4AY6A 4ZZ3A 1AB5A 1WMSA 1K5HA 3ZTYA 5EJ9A 3GOHA 1KTVA 1A2KC 1OHHA 3KTOA 2QR2A 2CL6X 4CF6A 3DUFB 4OXKA 4TS1A 3UHPA 2IQIA 1UBJS 5CD1A 1PSZA 2NU7A 3SKVA 3DV2A 3FUXA 4OQ4A 2CFCA 2CXQA 2DPLA 3IBGA 3UHJA 3HA3A 5LLTA 5I7EA 4ZANA 2GLTA 3FDJA 1T35A 2AXEA 3UHAA 1SCNE 1P1KA 1DAIA 1KDTA 5LBUA 4KQHA 1C1DA 5KYGA 2ZPAA 1NTRA 3CNOA 4JUBA 1ISRA 3H2HA 1C9YA 3CNQS 3FVWA 4C29A 1EP9A 5BWOA 4E32A 4YXWD 1KSHA 2A3RA 2F1RA 4DYHA 1UBEA 1RE0A 2HQBA 1P6UA 2V6MA 3L0SA 4EEXA 5BMVA 5LWHA 1J1ZA 5GAJA 4OU4A 1OKKA 1YC5A 5A5FA 3ZWMA 1KOJA 1UODA 4DBVO 4MYSA 5IG2A 4DKJA 4LFBB 4YPFA 5EZ5A 4C7BA 4CM5A 4FGWA 3KHUA 2GNOA 5HKKA 1L4NA 3SICE 1E2HA 1C2YA 1PDVA 3GLHA 3QKRB 5HJ7A 5C52B 1IBKB 1A4RA 3M4XA 4QJBA 3RAGA 2Q8PA 1QYXA 2C8LA 5H3LA 3KXPA 3MT9A 2B7LA 3BOSA 5JVDF 2Q3FA 4GVPA 1SD1A 2JVIA 1VHDA 3KKZA 2HV8A 4IG4A 4HXEB 4KP7A 3IIIA 5E3IA 3QITA 3T1TA 3TL6A 1RYYA 1XAJA 2QNBA 2XEDA 3ROGA 5KYVA 3X1MA 2QN8A 3K0SA 3FWNA 4R1TA 3DLCA 4BNIA 4RC9A 4IHQA 1HLFA 3NI2A 1FUEA 3AKZA 4WK2B 2QRLA 4QATA 3R7NA 5FUXA 1GRNA 1U9YA 4BNTA 5JV5A 1IDN1 4IVRA 3JVVA 2BH9A 4PYQA 1GY8A 4DCVA 2ZR9A 1SXPA 3EIEA 4XXHA 2J3LA 3Q8XB 3NVMB 4EITA 4UMDA 1SZPA 3T34A 5BN5A 2YFHA 5BO5A 4DCJA 2DR2A 3V4FA 2FW8A 1VPDA 2OBMA 1H0SA 3EG9A 4HH3C 4HEJA 2GJ4A 4FDAA 1KJJA 4TTIA 4LEIA 2QUAA 1UMDA 1ZPDA 1BXGA 1T1GA 4F7WA 1BEZA 1N6RA 4QUEA 3L8CA 2VZLA 4N39A 3N39C 3LD9A 3WAGA 1XTZA 3MBOA 4J6EA 3UB3A 3FG9A 2OLJA 3CRZA 2DFPA 2QR5A 3EXHB 3M5WA 3UMGA 4M76B 5JNUA 2PUJA 3H1PA 3VKHA 2INGX 4GF5A 4KVZA 4O4HF 1KFJB 1K7XB 2QMYA 4P4LA 2ZI6A 4YDRA 4D0NA 4OXNA 2HEGA 5FBHA 1F4LA 1E59A 1VPTA 4UAJA 2Q6VA 3ROPA 1TCVA 3QBTA 1UQTA 3EQZA 4XD7D 3ZBPA 4AT1A 2BFCB 1A1VA 4TKMA 3ETEA 2QY9A 4PNHA 3KNZA 4O4HA 4CEJB 2ZJ6A 3ABZA 1SK8A 3HACA 3QWHA 5F12A 2QN3A 2QD3A 4YCLA 5ICGA 3IUEA 3JYHA 3CX7A 1E1YA 3VYWA 1PV4A 3ZLVA 2DLDA 1Q12A 2Y1XA 3QVLA 1KJ8A 4YO8A 2W5UA 3BGOS 4XGIA 4QD3A 4OP2A 3K0FB 2G5PA 4LRWA 1N5RA 2J3HA 2XUIA 5LYJF 1DAEA 1IHYA 1T5BA 2FGKA 4JL6A 1NAIA 3PXDA 3QHPA 1J49A 3REOA 4ME6A 3UG7A 4CKBA 4BXOB 1NUUA 2PBFA 2Y92A 3QOWA 3D0OA 1WZ2A 2GA8A 4L50A 4F93B 1EWTA 2W42A 1MIOB 4JY7A 3OWHA 3FYSA 4JSYA 3SAJA 1YZVA 3VKFA 4FCVA 1R10A 4X3PA 4E22A 3TGPA 4ZHQB 1VIVA 1O0SA 4GI2A 2C8KA 1U0HC 2GESA 2ISSD 1LZLA 5EYPA 5IAEA 3WDSA 2ZJ1A 4J3FA 2J08A 3MCTA 3RUIA 1U7TA 2NU9A 5EUCA 2C2ZA 3PEYA 1ZH8A 3CX3A 3PJGA 2GK6A 4G1CA 4DC0A 1GEEA 1XAGA 4YDSA 1A4IA 3OT5A 5I47A 4RQTA 4WE3A 3F2IA 1IWOA 1LQUA 3LUDA 3KWFA 1J0DA 3OHMA 3CIFA 1KI4A 2I6XA 1FP1D 3V4PB 3FWZA 3NM6B 1IY1A 1U1DA 3DYIA 4NMHA 2QZSA 5ECWA 1EWYA 5HIKA 5LVAA 3OAAA 4LWOA 3KQTA 4J29A 4LI3X 2CV2A 1BMDA 2A0WA 2HIGA 1JE1A 2B9VA 1P1IA 4QOGA 4TYWA 1SRQA 3WK6A 3M82A 4G9BA 3WYBA 1TYZA 4MYUA 3ZVNA 4JYBA 1ZINA 1TQHA 2HQOA 5BT8A 3GROA 4QPJC 4HPWA 1ECLA 3KDSE 3FJOA 1ODSA 1WMBA 1O95C 1QB7A 3QW4B 2R6DA 1T4CA 2XUGA 4QOEA 5ER9A 4W4TA 3Q3VA 4ZEXA 2QN1A 1R4NA 2TECE 3UGJA 1LLDA 2G0TA 3IA7A 3KR0A 4HB2A 3RU7A 3R74A 2AOXA 3U31A 3U80A 1M8KA 4LNUA 4N7BA 2YL2A 4F60A 1VRVA 4DG5A 3G6WA 2H1IA 5D6OA 3WLEA 5I7AA 3BHNA 4J0QA 3T3PB 1EJ2A 3VNVA 3MCWA 3TDNA 1N78A 1N3LA 3DM9B 3DSRA 1JZSA 1DAGA 1WMAA 1HFWA 4EVIA 1ZJJA 1RU3A 3I9V1 1NV9A 3ZV3A 5FOSA 4F4UA 3IAAA 4Q3EA 4RPCA 1M8PA 3RS8A 2VXYA 2ZIUB 4OU5A 4YRAA 1GM5A 1M5UA 3IVRA 2O57A 3TTTA 5EYPB 2NO7A 5JDCC 1XRLA 4NH0A 5EVCA 4C5BA 3COPA 2E1PA 2G7MC 2QGNA 3FPKA 3OZRA 4W1RA 5T4HA 3RAPR 4BMXA 2GDZA 3R2JA 1JU4A 3JQBA 5JNVA 1SVMA 2LTAA 1BHQ1 2ZUTA 3NLLA 2X0RA 2AUNA 4HDMB 4KWTA 1HYQA 1G66A 2DX7A 3VKUA 5WRFA 1W75A 3TD2A 2XUHA 4BVLA 2B69A 1G63A 1S3FA 1OIWA 1P7ZA 1E18A 2HSEA 5CGZA 4BMCA 2FSPA 1JU3A 4JQYA 4KPYA 1SURA 4BN4A 3JWIA 1Y1KE 3CWCA 3GLHE 2W9XA 3EY4A 1VPVA 3I73A 3Q0EA 4FOSA 3FWPA 4YVFA 1S2OA 2X9LA 3WADA 1IZ8A 1F38A 5KYNA 1DXYA 1UKCA 2AXNA 4RJ2A 4J2TA 2PRZA 1XNQB 3L43A 1OPRA 2OV8A 1Q84A 4KXNA 2A14A 2PX6A 1H4VB 4PPYA 1UPCA 4P3XA 3VR5H 1GNQA 3NHPA 4RZQA 2G9QA 5DYYA 4F0JA 5I9NA 1F2TB 4ZTZB 1D1QA 1GKIA 3KYDA 4TLDA 4DEXA 4EVRA 1XZBA 3U1BA 2IY8A 1IOLA 3LWBA 3QVKA 1PVVA 4MGEA 4RTNA 2W4IA 5ALEA 4M36A 1TTPB 3UQYS 3T5AA 1OXKB 1LLCA 2VBFA 1FVFA 1XX6A 4P3YA 5A06A 1PNQA 2UZ1B 1I4EB 3H04A 2GN1A 3H8JA 2R9VA 3KKNA 3RT1A 5AW2A 3R7SA 5JDIA 2PRIA 3OFSA 3WLOA 3F97A 3LYUA 3WO1A 1ZCFA 2OENG 5A4IS 3SQMA 1QM5A 4GSYA 3OLCX 4BFVA 3DWFA 2D1RA 3GJ6A 3HCRA 4J4TA 2IOFK 1I2BA 5LQMA 1XEAA 3PTZA 5HILA 4PN7A 3P71T 3LQFA 4L0QA 1HORA 4ZFNA 5ITWA 2MSWA 2NVBA 2OCBA 4LDAA 4E88A 3RSOA 1U9IA 4KLAA 2F90A 4MV8A 3USCS 3TOVA 1RHMA 4TWZA 4A23A 1WVIA 1DO2A 2C54A 3QE3A 3GCDA 3EBOA 5E4JA 3HJAA 3FFBA 4TLBA 3OIVA 5DTQA 1KDPA 2AG6A 1L4EA 1I7NA 1IBMB 1MKYA 2QG9A 3GCXA 2JCGA 3HUUA 3QU2A 5BN3A 3LC7O 4HCJA 3LYLA 3BA6A 4LYEA 3KPVA 3P9NA 3PHJA 3TYXA 1T91A 5EP2A 1H4TA 3WWEA 4ONEA 3HADA 2X1VA 4R8MA 1G5QA 1XMPA 5T8KC 3IAM6 3MJFA 1T2FA 4XASA 3T0FA 3W2HA 5H59A 5EFZA 2B99A 4KYVA 3KZXA 5BQPA 4Z3DA 2XMRA 2I65A 1B6TA 3ZBUA 1NXPA 2VP3A 1MGOA 1GV1A 2OHXA 3LS2A 3WGLA 4E13A 3TZKA 4YAIA 5IDWA 2H2DA 3LX8A 3UH0A 2ID8A 2GJSA 1CZHA 5KYUA 1IVNA 1QRUA 3ANNA 2J6CA 3G2LA 3HZRA 2Z6QA 5A4FS 1K4YA 4E31A 1AMOA 3J7AC 2D5CA 2VAWA 3OTHA 1KVSA 2RKBA 3NP7A 3IVAA 1JRLA 1F51E 4N1AA 1JFFA 3LCRA 2GAFA 4BNUA 4D8XA 1ZH0A 2IY9A 2PO7A 2Q46A 3F9RA 4RKYA 3CN9A 1PJTA 3N0XA 3VTKA 4BB6A 3FYUB 1JVBA 3BHMA 2ZWVA 1UPTA 1Y8QA 2XVXA 5CRIA 1RJ9B 2HCBA 4YRBA 2HRRA 2BGIA 3RU2A 3WGYA 1NW9B 3C87A 3OPMA 4JA0A 1NN1A 1LK7A 4CVNA 3WQSB 4OKNA 4BVBA 5EVJA 5E0OA 3PGLA 4ZJZA 4B32A 5LSAA 1BA2A 1EGMB 1P2SA 2R65A 1LS6A 3L0PA 1I0LA 2O8VA 4NENB 3UVEA 1TTTA 1JAHA 3JX9A 3SGLA 5F2NA 1X8XA 5IAOA 3D5EA 4L4UA 2VP4A 4GMKA 2C0CA 4KIJA 3GCZA 4DJTA 4PRLA 5BOVA 1E69A 5AJWA 3MTBA 1DKUA 1ZUNB 3OM9A 4GXRA 1UBUS 1VHWA 1AB6A 3D4PA 4M0FA 4MV9A 4PS1A 3ME5A 3O26A 4MUJA 4BE9A 5C7YA 1CZRA 1LC0A 3RGWS 2JFHA 2HYDA 1TYDE 2O3JA 1SA0B 2Q7DA 2RCNA 2VPXA 3CIOA 3DB2A 4TRJA 5I45A 1RIIA 2OB1A 2YQ4A 2WKRA 3PWTA 2RHJA 3I58A 4MGIR 2OHFA 3AUUA 1PU2A 3L7OA 1G3UA 1YBVA 1KI9A 1CJKC 1VMDA 2NT3A 1DV2A 4OQDA 1Z34A 5JW6A 1FNDA 2GCOA 3KRTA 4CTMA 3E58A 4C14A 4M53A 3MPOA 4WLOA 4B5KA 4QTYA 2WIAA 3KQKA 3X1KA 1RM3A 2H5LA 2VDWA 2ZXEA 3GJ8A 2WJHA 4IUCS 4GGOA 3BCUA 3QXGA 4TMXA 5K3CA 4C7JA 2O59A 4JXJA 2P3LA 4L16A 1DQSA 2JGJA 2XKJE 3UJDA 1U2QA 2I8LA 2C96A 3CEAA 1CIPA 1URPA 4L72A 4BZZA 1CQIB 1L6IA 5P8WA 2X41A 4LQCA 1KJ9A 2FSVC 3BWEA 3K6KA 1EBBA 2WWIA 3NTVA 4IAOA 3WNVA 4B4KA 2JLXA 2R00A 3SYNA 5K2OA 4CL3A 3T94A 4OSPA 2GM4A 4N6NA 4NKRA 4WWHA 1J9EA 3OLWA 3IUSA 1OBCA 1F5NA 3S2EA 3TN7A 4QT0A 3E7XA 2HSZA 2ZYHA 4H1UA 4JHXA 5DI3A 5KYUB 5LPNA 1N8NA 2B4TO 5DXJA 2EGHA 4P31A 4UAUA 3KL4A 3AYZB 2QVCA 2I4NA 3D7MA 1PI3A 3D5QA 3PR1A 4KSCA 4M60A 3KOUA 3UJ3X 1YWGO 2MYPA 2IHVA 5DULA 5JR3A 2GLXA 5A5VA 1XTSA 2Y77A 1W6RA 1MAHA 4ZVTA 1GZ6A 1XALA 3WY9A 1N0WA 3ANLA 3KT3A 3QKRA 2DHDA 3GVCA 1GZUA 4JLWA 5TS3A 5FUWA 1CUIA 4ALMA 4H1WA 1HOTA 4O08A 4JI7B 2ORYA 3P5BA 1ZU4A 3D6NB 2DTEA 1N5JA 2JFGA 2P2NA 2FKAA 2HO4A 4IP0A 4XB6B 3ZNPA 2UUCB 3O4HA 1HDGO 4C2TA 2XYHA 1T2CA 1Y34E 5GMOA 1BD3A 1OX5A 3WYFA 4N7RA 1WHSA 4BN5A 2PH5A 2IS2A 4NU6A 2VNKA 2GUWA 2JGAA 3SVZA 2AVDA 2AEFA 2B1IA 5I7RA 1NA5A 3SG0A 1L1EA 3ZS9A 1BMQA 1VSVA 1JDVA 3P19A 3K20A 1HI9A 3G0GA 3HSYA 3NFRA 3DOCA 2I4LA 1D9XA 4ND1A 4X85A 5J2UF 2VZ9A 2EFGA 5SV2A 1J00A 4K9KA 2D54A 4EO4A 3AOEC 4DMMA 3LXXA 1NVAA 5EIWA 3ZDCA 3STTA 3SI7A 1VB3A 1PNTA 3DEZA 2IFTA 4B87A 1LEHA 3SQWA 3R0QA 4MV7A 1K89A 3G2MA 4M7RA 3N2NA 1UBTS 3P0IA 4O4LB 4U00A 1J20A 4JA2A 4YCMA 3OLQA 5LZ8A 1OX4A 1TZCA 3N6VA 4MGYR 5FJJA 3EEIA 3R7LA 2GPSA 3B2QA 5F33A 2C0QA 3WB9A 3D59A 3CH6A 2WVAA 2A2ZA 3E3OA 4YRNA 4FM9A 4CL2A 5A0VA 2Q49A 1TPYA 2WYUA 4RJKA 3EVFA 2QQGA 3EYWA 1G38A 2C4WA 2D0DA 1SBNE 3BXZA 3RFTA 5F51A 3SM9A 4BTEA 1WW2A 2GPTA 3F7TA 3TMAA 1EBFA 1Z0ZA 2AN5A 4FYHA 1JQ3A 2X0NA 4GM0A 2F00A 4KEAA 4DM7A 1MB4A 3IOMA 2XA9A 4Y2YA 4YRDA 2VJCA 1K27A 4TSFD 3O2QB 5E4YA 3UK6A 2XQJA 4GWGA 4ESOA 2AB0A 1S9DA 4YB8A 4N9WA 3BQMB 5ARDA 2A35A 4LXTA 1QUEA 3A6JA 1XXHA 3PDCA 4JYAB 4IRUB 5CH5A 2EEPA 3F6CA 3B52X 3RG8A 1OJLA 3R44A 1CR4A 2X13A 1CZNA 1Y9AA 5JQGB 1VLQA 2E82A 2G9RA 2BVNA 5AJVB 4X93A 1II9A 1D6MA 3DPSA 4BUCA 2R4TA 4OUDB 5I7WA 3K3PA 2X1HA 1QX3A 2ISCA 3MSXA 1SHJA 2B21A 2ZITA 3DQZA 4YRTA 2I1QA 2YXNA 3NFYA 3PGMA 3GIWA 3ENVA 3KAKA 3OIDA 5AVWA 2YQ5A 2WEKA 2X1MA 5THQA 1CWUA 4R68A 5MGBA 3CR3C 5IUNC 3KOWA 4OTZA 2EYQA 5CDFA 3CLKA 2B4RO 3H18A 3W5UA 3WMGA 3MRSA 3PRKE 5JALA 4G0ZA 4KDEA 3V4LA 2BD0A 3MM4A 2RAPA 2ZWAA 3EQ7A 1BD4A 2DPGA 1ZSVA 2CVHA 1L4HA 3K4HA 4EHHA 4IMJB 3BMNA 1NVWQ 1ORWA 1JDUA 3QXCA 4DZZA 2HYIC 1CJUC 1QS0B 3O8DA 1HT0A 3EAFA 2UV8A 1FP6A 3WI7A 3CLRC 4ZGGA 4KV9A 3NEYA 2Q5HA 4IZOA 4E46A 1S2MA 4OA5A 4MVJI 1QOQB 3TZQA 1BROA 1V8BA 5FLEX 1DAOA 3I0ZA 4BU1A 5HSGA 2O8DA 3ZJUA 2VHTA 4HSGA 5CJ2A 2SECE 3MJEA 3H97A 3UF0A 3M5PA 1H8HA 3ESQA 1K66A 2BGJA 1NTOA 3FGZA 3D4NA 1SCQA 3P0JA 5K03A 1DTEA 2CHVA 3CJTA 1LJ8A 2JJ2A 3GVXA 3TZBA 4MLDA 5KUTA 3DO8A 3N87A 1UZAA 1RMTA 2QDXA 3T7EA 3CLSD 1KO5A 1KNXA 5JMTA 3M1LA 5I5GA 1UMBB 2IPXA 3L8HA 1B00A 1HH4A 4HGNA 2BONA 1AV6A 2XF8A 4AS1A 2FPWA 3PX7A 1E79A 1ZI6A 2FN3A 2C00A 1MW8X 1Z5GA 5HBRA 3R5JA 1R0BA 4FYJA 1H23A 1RYEA 3HGQA 4CMJA 2IE8A 3HWX1 2EZTA 2HFKA 1MD9A 3Q98A 3TZ6A 2VQEB 4O2AF 2QLFA 3CSUA 4G4SO 3TGWA 1OZFA 3N7UA 4D43A 1DG3A 4QGAA 4KMSA 4F12A 3BA1A 4FU0A 5LMUB 4C20A 3PX3A 3PUXA 3ZN2A 2AE1A 3DBHA 3LGSA 2CHFA 3K2BA 4GP9A 2P9FA 3BMOA 3TSCA 4CF7A 5KJCA 3CF4G 4L9RA 3D8HA 1KZ6A 1V7CA 4RETA 2M6LA 4JVOA 5J4YA 1W48A 1E8NA 4JLOA 3LUCA 1U7XA 4TGLA 4TQUS 3N05A 1AURA 4MIEA 4XVQA 3KCNA 4QAJA 3NOQA 2DQYA 3OE5A 3CZCA 4MA5A 2AFHB 2RGXA 4WZAE 4IY1A 1VBKA 2AXQA 4WKCA 3M3DA 4YJGB 3ZWAA 6CHYA 2XGJA 2HIAA 2YHBA 1RACA 1U5BB 4MUNA 4P6VF 2HDHA 1AH2A 3FFTA 4Q3AA 5I7SA 1E1CB 2OHOA 3EVTA 1DOHA 4IXDA 4L8VA 4RA6B 1FFXB 2ZRDA 3K9NA 4H6XA 1MQ9A 1Y4DE 2O6LA 1YRLA 1DWUA 4IL5A 3E03A 4DT1B 3GYBA 5HQTA 1CUWA 1XEWX 2PFSA 2QK4A 2ZI7A 3QNMA 3IPXA 3IAHA 3IQIX 3M81A 1FMTA 2FWAA 4KO8A 3HA2A 3AMVA 1C7JA 1RI3A 5D3MA 3M6WA 1F6DA 1NDUA 2O9JA 3AEYA 1FYFA 1RLMA 5LYJA 1AKWA 3L05A 2AC7A 2OECA 4WCFC 3VDMA 2XDQA 3OZVA 1KBOA 3A70A 4I99A 2XB8A 1J70A 2X2OA 3SKXA 5HKOA 3E1SA 2QROA 2ZB7A 4G65A 1HNXB 5TY0A 3SX0A 1UMDB 1KE1A 1I94B 1TYAE 4M9RA 3DDZX 4R5HA 4Q4JB 1RRKA 1FRVA 4RMGA 1JBKA 5CNKA 5FR2A 4A82A 4DRXB 2BTQB 4L5JA 5L3VA 5G4KA 2Y4OA 5M34A 1GL3A 2GAJA 2OO5A 3MD9A 4OF4A 4YRLA 1JTVA 5AMXA 4ZZ2A 1UT6A 3SXUB 3B82A 3R24A 4S05A 2FFBA 4OJYA 1V2HE 2CXPA 2XMGA 3L0IB 1ZA1A 1LFAA 3M6VA 4GX0A 3FZEA 4HEQA 1GWNA 1FQOA 4WKGA 5AUQA 3UJNA 2I91A 3GVHA 4B84A 4L5BA 4PLYA 1WB5A 2AMVA 1WU8A 1O08A 3I9KA 1WE2A 3K6JA 3A1SA 3I64A 4OHWA 4YAUA 1B3BA 1V5GA 4UE3S 3M6AA 3JXEA 3Q8MA 1E20A 2P6NA 4XSVA 3PRYA 4PZAA 5SYNA 5LJLA 4M9QA 1BH6A 1NVMB 4ACBA 3V80A 4EJFA 5K8IA 4YDHB 5FWDA 3TE6A 3RV4A 3NKLA 1BFUA 4HN2A 1UFKA 1ZWKA 3PQCA 3WO0A 5HIMA 1PIWA 5DXAA 3KKPA 4DJFC 3BGWA 3ESRA 4UBIA 1ZIXA 4WCVA 1ZI9A 1JHRA 1REQB 2WMOB 2VTBA 1SU7A 4RMIA 5HFNA 1X38A 4LHYA 5FOVA 3P0EA 3QEJA 1OLSB 4RV9A 5C32A 3RH0A 1C4OA 1JIUA 2FOXA 2ZR7A 1XC7A 2UXCB 1V0JA 2HQSA 1HTWA 3ZNOA 1O54A 1U3GA 3MMPA 4NU0A 4X8LA 1K0FA 4N9QA 1N4DA 1EM8B 3I42A 4G1VA 3C5WP 5BV0A 3R9XB 4R05A 3TXAA 2XRMA 3DV9A 3ZVLA 2A92A 4D3YA 3IQXA 3QNWA 5DEIA 2GFIA 4ISCA 1K0UA 3RTAA 5LMNB 2PGXA 4ZARA 1MH9A 1X94A 4UM8B 3OU6A 2GCIA 1PFVA 3P9RA 5JBNA 2E4ZA 5I7OA 1XAIA 4Q3OA 1IUOA 5C37A 2IH4A 1ZESA 1I2ZA 2P9BA 3QPUA 4XX0B 3UWMA 4FILA 2BHRA 4HNUA 3CXRA 4OHUA 3U61B 4LYDA 4U2KA 3F47A 4WINA 1J9GA 3HM9A 1CY8A 3AO0B 1S7GA 2P9GA 1G8GA 1NBME 2PA3A 3Q2OA 1RXYA 2E5FA 3VDQA 3SLGA 4E5UA 1U28C 1G2QA 2NAPA 4ROSA 2WF7A 5FFMA 8LDHA 3CVWA 4PC3A 1T3GA 3FVVA 5KOJB 1LS1A 5DBIA 1W47A 2E2WA 2FFAA 2OXCA 2ZBEA 3HY6A 3W6PA 4NAVA 5C8VA 1KPHA 1SQ0A 5K3FB 2BKXA 3MUOA 2PGAA 5CTAA 3QVOA 1DFIA 1M83A 3EOAI 3HZHA 2O2SA 3BE6A 3BMCB 3I6BA 1Q0RA 2BM9A 1HTTA 1OXTA 3QBDA 3AR8A 5BRJA 1RJEA 1RWVA 4DCOA 4E09A 5EY5B 4HX9A 2FMIA 8ADHA 1N2IA 4FYKA 4TLLB 1E8DA 1Y82A 2W37A 1ZHOA 1QO0D 3BTOA 1LBHA 4FHDA 3M8KA 4L8FA 3WIUA 9LDTA 4M8LA 4YI5A 1O03A 3LLUA 2NXNA 2YC4C 3C2QA 1ZUWA 4LN1A 1T3LA 1QQ7A 3QKSB 3COSA 1DO0A 1NP3A 1Y3CE 1M1UA 3L8ZA 4P3NA 2ID4A 4MVYA 4XB2A 4W1SA 1ZNWA 1GPKA 1IN8A 1AMUA 3FNRA 1JEJA 2P2CA 3M9XA 2Y68A 1Z17A 5IFKA 3FHOA 4FW9A 4KRGA 3VU9B 2Q5CA 2CXNA 3BDVA 1XVTA 2C0PA 1G8MA 1PVOA 2H1VA 2ZSUA 2E7ZA 4JH0A 2R97A 1UKVY 4N8SA 4NQZA 4TZKA 1NFQA 4A2QA 3RKRA 1EFUA 4E30A 3S1SA 3IX7A 2O0JA 5BYAA 4FLFA 5A5DA 3WRYC 4C04A 3H87A 4LKOA 2ZSFA 3DMNA 5AW6A 3S8MA 4JJZA 1FOEB 2VF4X 1WAMA 4REOA 5IVDA 3WGQA 2EIXA 1FFYA 1I4OA 4CIXA 2MHCA 1T8RA 2IIVA 2VHZA 4QJIA 4RENA 1BDIA 3RS7A 2YJ6A 3N75A 3QHAA 2RBGA 4YP7A 4IXTA 1I0ZA 3U7RA 4BY9E 1UBFA 4RORA 3UJ7A 3A14A 3MCVA 1ELOA 5INTA 5H70A 1X2EA 2P9TA 3JAWA 1XMSA 3HA7A 1U0EA 1ADGA 3ANXA 4G0XA 3HVUA 3HKDB 1KO1A 4PE5B 2QVXX 4WZ6A 5DWVA 3S55A 3ER8A 1JKJA 2JH8A 4GMDA 2DHCA 1BW9B 3R1IA 3NDBB 4ZOLF 2VBGA 3AVVA 2CHGA 4R9UC 2XUAA 3G5TA 2PRSA 3EPJA 1QQAA 1EZ1A 1R1DA 2KI5A 4EI9A 4WK0B 4DV0B 2Y6UA 1W44A 2IVFA 1XQVA 3BMCA 4GP6A 4IJMA 1XR3A 1HRKA 1BCSA 3EEFA 1TAHA 1DTWB 3N7TA 5ALWA 3PIRA 2BMFA 2NUTB 5B2ZA 4XTCS 4EYQA 1ILWA 5IDQA 3JQGB 2P2GA 4OJQA 3I23A 4ZALA 3FNBA 1W0CA 4Z86A 1DWPA 3NONA 1C5KA 2DE0X 2IIQA 2FQYA 4B6OA 3A3NA 4O2LA 1PHRA 3RYHA 5IASA 1M2OB 4IIJB 1XA3A 5AW5A 3WBJA 2FXIA 3I09A 1G16A 3AF0A 3OM1A 1HDYA 3EG5A 5J58A 5DTJA 3D7KA 3MRVA 4EOGA 1POXA 1TMYA 4OK5A 2ZIAA 3DTVA 3HDVA 4FN4A 4H15A 4B3DA 2XADA 4C21A 2UKDA 4K26A 4UMVA 2IYXA 4PHHA 1U8TA 2LBPA 2XTZA 4FCTA 1Z6QA 4ZRMA 2V4MA 3OZCA 4TVOA 1W76A 1HL7A 1X8LA 2VDRB 3PHCA 5AR1A 4CFZA 4HWGA 3VNRA 3ADBA 3M89A 2XE7A 1UAYA 1OQAA 3CUTA 2GH1A 3CLRD 3KYIB 5G4LA 5KNDD 1DAFA 4WEOA 1SH7A 1J0BA 2IXFA 2O3SA 4EG7A 3LTNC 3AC0A 2DWCA 3HXTA 1JJAA 1JR3A 3B1KA 4X92A 4ABTA 1CNMA 4TTTS 1V41E 1U2RA 4FYXA 3S2GA 2GZAA 3MTGA 3DVQX 1EVIA 1UPBA 4HTFA 3OU7A 5JFOA 5LLDA 1P18A 3UPDA 2NZVG 1YS1X 2EBFX 2QX4A 4FP9A 3HEAA 1CUGA 4LOIA 2CNWA 4KQ2A 4L6IA 1RHRA 5B1YA 5I4KA 2XRYA 3VYTB 5L51A 1YOVA 2JIMA 2J32A 5E1OA 2A78A 3L6RA 2W43A 1X70A 3E5HA 5T41A 3HYNA 4ND2A 2OBLA 1TEXA 4FMBB 1S8OA 4F5WA 3H4VA 4MS3A 4FMCB 1PDOA 1RXEA 4QDXA 1IBLB 3RAFC 2FF7A 4M2LA 1SU6A 3HKCB 2ZRIA 4F6RA 2RH4A 3I45A 1OOEA 3C6QA 3HVKA 2H5IA 3ZHUA 1IULA 1YDEA 1Q1GA 1KJYA 4NNPA 3NWJA 2GPJA 1COWD 1T2AA 1R66A 1PQYA 2UYOA 1FZQA 4KPFC 3U3KA 5J1SB 2QGFA 1UZLA 3F49S 3GA5A 3ICCA 3R5XA 2GPBA 3AP1A 1GVNB 2AV6A 2VYND 2FSFA 3DZ8A 1SG6A 3KJQA 4HJXA 4PSDA 4U8GA 1T8TA 5GONF 2J3QA 1X8JA 3OEHD 1RAEA 2DUJA 2A86A 4OQYA 5GV7A 4XEUA 1E1QA 5T7BA 3T6KA 2QZZA 3QTBA 3WAJA 1T8YA 2FRDC 2VYFA 4GXQA 4JLVA 3LCMA 1UQUA 4B81A 2Q4OA 2MR5A 5FOWA 2R8RA 3SNKA 5AVUA 2ODPA 2QPAA 4ML3A 5HTKA 2C31A 4JWTA 1A9PA 1T8UA 3AHHA 3B8EA 3G59A 4RVCA 4KOAA 1GYPA 3EFOA 1KE2A 3VTFA 4RGBA 4D6YA 3FNHA 2I87A 3DULA 4LFCB 2FHSA 2ZBVA 4NOLA 3ZQJA 3CUSA 2ZIEA 4M0UA 2CJXA 5KYXB 1K5DA 3ZCQA 2VUTA 4OD0A 4WJLA 1UOEA 1OI3A 3EQ8A 4LOJA 1DRJA 5A05A 3UTDA 1JXMA 2JRCA 3D43A 5KJ1A 4DRZA 1MIOA 1EDDA 2X9GA 4CEHB 4Q9HA 4QULA 2JBAA 2ZUSA 3DZCA 5LOVA 1IJEA 3M7IA 2QMQA 4TVKA 4B3HA 1OLUA 4BLRA 1UJMA 4YV0A 1W1UA 1O7JA 4GSLA 4IOMA 1HT2E 2Q3CA 1XRJA 2V97A 5KVAA 3DE1X 1FJGB 1HYHA 1II8A 1CUJA 3EC2A 3NORA 4V39A 4RPJA 2QVYX 4NNJA 2SKEA 4CMEC 4D3DA 1ZMXA 4JBIA 1P60A 3R7BA 4AO6A 1DG1G 4V24A 1E92A 4Q1FA 2W83A 4J91A 4BKMA 1JKXA 3HCEA 3OFNA 1RAHA 2G76A 4Z4CA 1X9HA 4MGHA 4N03A 1NMXA 1UM9B 3UJAA 3AF5A 3O5AA 4PW0A 3VJMA 4DMFA 4S2EA 2YVAA 1M5TA 2HSDA 4WZAA 1JHAA 1CZKA 2EERA 2PJDA 4HR7A 1RKBA 3GGDA 1SKMA 2AG1A 1E3WB 4LV8B 1K06A 2F8LA 3DTVD 5H82A 5AKYA 5BN4B 1I7SB 3AIIA 3RHFA 2Q5LA 1UXHA 2YY7A 1N5MA 2RJ3A 3GC6A 3JD0A 2WOOA 5K0LA 4Z4IA 2AJLI 1XJWA 2CMFA 2YICA 1I13A 4N01A 1QYIA 3L6BA 3KX2A 1D2EA 2PD6A 1OIVA 2YUTA 4NFHA 2EBHX 5E38A 5GOTA 5K8UA 3F4LA 1ESMA 1JILA 1V5EA 3LL4A 2O8EB 2ZXUA 2I2FA 2WSSA 1F2DA 5HM6A 1CQXA 5JASA 4WKOA 3NIGB 3C6MA 3T4EA 3HYCA 4BFUA 1WZCA 2UUPA 2CUNA 1JECA 3AJRA 4BCDA 3NHYA 1ZGZA 1PUXA 1LD3A 3DGFC 4IDCA 5ENZA 3RBVA 1NXTA 1JIKA 4CMCA 1RPNA 3GGPA 4IIVA 1O77A 1NVDA 4NEHB 4TKVA 2YZMA 1WUJS 5CG2A 5IFLA 1NYTA 1SXJC 3LT5A 4HAVA 2ZATA 4G81A 3FZNA 4TKUA 1JTFA 5EE3A 4F4FA 1FLNA 1ONPA 4WVFA 1ID1A 2WQZA 5MN5A 2QT0A 4MRPA 4PTZA 4NQRA 4U0KA 3GJTA 2H0RA 2HK6A 3AR9A 1J90A 1G19A 1K3UB 2O7QA 4EGSA 5KQMA 2JATA 3L6OO 2R96A 5AOAA 2XIQA 3GLFB 2YXLA 3W8RA 2YJ4A 1U3DA 4AZ0A 2VSYA 5JJ5A 3NWBA 1NJ6A 1YQTA 3IODA 1Q6ZA 4R2XA 3EWNA 1TLLA 2QENA 5ETJA 4ZYLA 5EWMA 2XCUA 3QJGA 1CVLA 1CUBA 5KX5F 2OKGA 4YJFA 4MTLA 1SOUA 1WUHS 4DCTA 2CE7A 2HF9A 4BO3A 2GJ8A 2QP4A 2Z6UA 1Q0ZA 1LDMA 4J3NA 1CC1S 2CL7X 4G56A 5ES4B 1GKLA 1ZEMA 3DE7X 3GA0A 1IK6A 4NG5A 5I8PA 1MG0A 4ZAVA 1OLXB 4JBYA 1UADA 2ZSHA 3MLAA 3UGQA 1YZTA 4RPHA 5E0KB 4OLJA 3W7AA 5IZCC 4AP5A 2AZMA 3AHIA 2H7YA 5JAIA 1YXMA 3RRMA 1GCIA 2FWBA 1KVTA 1VB5A 2WLTA 2O2ZA 1BDBA 2ZDQA 3AW8A 1SQ5A 1PLLA 3ETCA 4BQNA 4D5EA 2C8JA 2HU5A 4KRXA 2UZ3A 4HXFB 4FTWA 3H2JA 3D3EA 4JKOA 3KTFA 1FC0A 2MU1A 5BR1A 1I01A 1SCIA 2I80A 3BB1A 2OK7A 3H11A 5TMEA 3GLFE 5EG5A 3JZDA 3N58A 1K4KA 2W8BA 4RWZA 4UHJA 2H7XA 5DW3A 2VA9A 3EXHC 4F8EA 4BBAA 4QKQA 3MIIA 4F2PA 1UJ5A 4BQEA 1WBDA 1YL5A 4EF4A 4NXMB 1MX5A 1DRWA 4N8DA 1C1XA 4DMKA 5F2EA 5HP4A 2EW8A 2JHFA 2OMKA 3WR5A 3RU9A 2R60A 4UU1A 3ZE9A 2I4TA 3FF4A 4F11A 2NYRA 5JI2E 3EVNA 2P2LA 4ZAFA 3IYLW 1Z4NA 1Z4PX 3FFXA 4ZEMA 2ZBUA 3IDSA 5EXDA 4RH3A 2J3JA 1T10A 4M83A 3PC2A 4B3CA 1I10A 2VPYA 3BPSA 4D9EA 2Q7XA 4NCBA 4Z4QA 1CJBA 4FDVA 2JFBA 3KEQA 2JAUA 4QHTA 4O2BF 2AJ8A 4X8OA 2EYUA 2J0UB 3BIOA 1QXSA 3RTCA 1A4XA 3ETHA 2ZRMA 2R8YA 3MJRA 5JYBA 2A4KA 1GUZA 1L5LA 3IKJA 1FF9A 4MVJF 4PZYA 2H54A 4KGVA 2ZJ3A 1PD1A 3D8SA 2Z3ZA 4MKGA 4RVGA 3HCFA 2HJVA 3GARA 1ADJA 1XQYA 1H5UA 2GZHA 4HEA6 5M3BA 2JAXA 3WWPA 5JMOA 1NG9A 1L4UA 1F7VA 1FFHA 3MS2A 1L7QA 2HRQA 1K08A 4GE0A 3VAYA 3JSAA 4H17A 1TO1E 3AFHA 1WCWA 3EWIA 2VK2A 2GGSA 3KR1A 5TPZD 2CFSA 4R84A 3CZRA 4EG5A 4EPXA 3RFUA 1Z18A 1BX0A 4NICA 2Q0XA 3A6PC 1P1BA 4IRMA 2IZZA 4EKNB 2C59A 4HDNA 1KQNA 3KQVA 4LHSA 5JD6A 3EQ6A 3RC2A 2FK8A 2BJWA 1HMYA 3M83A 1AUOA 4HS9A 3VSAA 5KKAA 5DYWA 4ETNA 1TU3A 1ESEA 3O2SB 4EBBA 3EPPA 4EMUA 4CLRA 5HZKA 1CQJB 2C2BA 3NDRA 4MRMA 4GLBA 2VPTA 4XQ0A 1J1IA 3OQMA 2QUIA 2PMWB 3WL4A 2VVTA 3I34X 3LZCA 3PEFA 4Z54A 1P2TA 1HDEA 3HCWA 3AIMA 2GAOA 4MQ6A 3NNNA 1AX9A 1DUVG 3DCNA 3IQHX 2XD9A 2PWPA 2H9IA 3WYNA 3BIWA 1P9LA 3ZDFA 3HJFA 5CFQA 3THWA 1FYDA 4CLOA 3L0YA 3O93A 3OT1A 2I7DA 5E95A 2DC1A 4G1BA 3RK1A 4U5QA 4QG7A 1D7AA 4HLQB 1YB2A 4WZZA 3AUYA 3HDTA 2XCOA 1H2FA 3PC6A 4BRWA 2C7BA 4N3AA 4QVKA 2Y2UA 5KTSA 2FP4A 3KR2A 4D8WA 2W2OA 3LDHA 16PKA 1G4UR 2IHBA 3QG1A 4PYKA 4OFBA 3L5KA 5DYTA 3IHKA 2BZSA 2C2XA 2RGUA 4X3OA 5G1PA 4CNBA 4KMRA 4IFTA 3SYKA 3X44A 3CCFA 5AVJA 1N2EA 3O8CA 4PIPA 1XTIA 1Y4ZA 2GYYA 2P5TB 1ETUA 3EBPA 3GFPA 4D8TA 1EIWA 2ZB4A 1AA6A 3GJ3A 1FIUA 2A9KA 2X6QA 1SR8A 2YWDA 1P0MA 1RTTA 2FZEA 3CG0A 4TWIA 4EPWA 4UNRA 2Y3IA 8GPBA 2ZSJA 2H51A 4DGSA 5AESA 1V7PC 5C2JB 5JSZB 5ALOA 2ETVA 2V6JA 2I99A 2IU0A 1EQUA 2GKOA 2B35A 4AZ0B 1QOZA 3MPUA 4A6EA 3DBLB 3LOQA 3NXKA 5M7EA 3TLEA 1DMSA 1XZGA 4IKPA 3IB6A 1USUA 3EFEA 3A1TA 4FX5A 3ZWCA 2P0AA 1D2RA 1XTUA 2VHXA 4E4YA 4D8VA 1BTOA 1ZY2A 3NBZC 1G7RA 1LTQA 1VHJA 2PGOA 1Q6YA 4DLAA 1U3VA 1CK4A 1VHLA 2NWQA 3AR2A 3N2EA 3PYLA 4HAZA 1WWKA 5IXSA 1P17A 4L78A 4JVMA 1EJ0A 3DCYA 3LYAA 2OQRA 1RYHA 2QP9X 2IZ7A 3QKSA 4KO4S 3PQEA 2QW1A 2M6KA 5JAPA 3G5AA 2P30A 3KEOA 4XD2A 3IJEB 4PAQA 1Q1BA 2O5RA 5DSTA 1TA4A 2XSZD 5F1KA 4BFSA 4LF4B 4GQBA 4MKIA 3V1KA 4YHBA 2P6OA 3FROA 1SY7A 2GZ2A 1CDZA 1R18A 1I7LA 2H4HA 3JQCA 4FK8A 4L28A 4X6YA 1RP7A 5U1PA 3WLTA 3U7EB 4QO8A 3F96A 4B45A 4O4IB 2IOYA 1IY0A 3KETA 2QTTA 4MPJA 4R54A 4CU2A 3ZK7A 2BFMA 1IB0A 1OFUA 5LQCA 1C81A 1U9CA 2CSXA 1NUHA 1RM4A 3LH5A 2BGUA 1OUMA 3ZE1B 4GL2A 2ZETA 2AZXA 4YHHB 2I2DA 5U4QA 3WLHA 4ZI7B 3U7GA 3GJQA 3IT3A 4AJ4A 4NSNA 1JPVA 1YRWA 3VI4B 1P2VA 2OO3A 4WLEA 3OJ0A 3E7FA 3AY6A 1SXJD 1RJWA 1ZHFA 5CXXA 3A0UA 3P9SA 1H2ZA 4KWEA 1BKSB 1ULTA 2REXB 1NF3A 4FFRA 4IHJF 3BREA 2XQKA 2RI1A 4R16A 1Y48E 2PQ6A 2BFFB 5LYYA 3WK4A 5DCWA 3VAAA 3D4LA 2L18A 1X1RA 3BK1A 3GEIA 4MZXA 3FPEA 3IXLA 3MTJA 4RO0A 4C7MA 4Q24A 1JXQA 3AUFA 3PWSA 1Z7WA 2J7PA 3B9PA 2GSDA 5AD1A 1U1IA 1AGYA 1WP4A 3NP9A 3S7ZA 3G5LA 3IV7A 4L57A 5JWOA 1VL5A 4EK9A 4G09A 3K92A 4JC0A 4QVIA 3A1CA 4BMSA 1PQWA 4DA4A 1R0KA 4A27A 4RVNA 2LVBA 2RJOA 4EZBA 1B3RA 1HMPA 1JEQA 1SBYA 3F4BA 4PPNA 5EQDA 3F6YA 4AYXA 7REQA 1FQJA 4ZOBA 3X2SA 3BB3A 4RK6A 5E3JA 1MG5A 3ESDA 2R6R1 1VE5A 1QDLB 2ZCUA 4ZVMA 2ISQA 1WLYA 2WJAA 4YJDA 3OJXA 2WT8A 3OVMA 1BEUB 2XHEA 3NDJA 1SFRA 2NU6A 3QH4A 4YUVA 1KEEA 5AI0A 3J81k 1B0PA 3K5PA 3KZKA 4OHCA 1NHWA 3QXXA 5LQNA 1L4BA 4RK5A 1KU6A 2H4XA 3AJEA 5GV8A 4I50A 2YRWA 2FRDA 4F6CA 1U6KA 4CLXA 2BFWA 2ENWA 4LHEA 1EUYA 1NE2A 2YVKA 4E1BA 1J2JA 5ALYA 3T8YA 4X1YA 2Y27A 3F8TA 4MYTA 4RA9B 2QX6A 4O3FA 3H6GA 1EXDA 2FUKA 3PDWA 4NFSA 1RR6A 5GIOE 8ABPA 1A98A 5F21A 5FNVB 3AR3A 3K4QA 2PWBA 1Z2CA 4ZVKA 4HZIA 4QUJA 3M1AA 3IIMA 3GT3A 4BJ5A 4HP8A 2VL7A 2MINB 4ER3A 1QWSA 2BGMA 4G5FA 4CV0A 5BW8A 3T5PA 2I55A 5IWCA 2ZRLA 4WKNA 1RTKA 1QE3A 3EXG2 4OM8A 5G53C 4PQYA 1CEEA 3PT5A 4LDNA 2XQFA 2FX2A 2G5GX 5EWLA 1ORIA 3PNMA 4R0MA 2YNMC 3RBAA 3A2LA 1GXSA 4A9AA 2BZ0A 1COWA 1CY7A 2XT6A 4LYGA 4QDKA 1XCBA 2ICAA 2ODAA 4KQJA 3BIXA 4EKEA 4DB4A 1TEZA 2ZSIA 3VPFA 5H4HA 2ZRNA 3CKKA 1TW2A 4MKFA 4C3OB 1Z5ZA 3ANYB 5H3HA 4IWXA 5EERA 5K3EA 5LXTB 5CIWA 2AJBA 2YJGA 3HRKA 2AC4A 5DX8A 3Q5DA 2QAGC 2DTXA 3A37A 3OTQA 4QGGA 3L6UA 3UAWA 4YUXA 5K0BA 3VH1A 3N5KA 2JBWA 3QE9Y 2I7XA 1SIBE 2C78A 3L06A 4FR0A 1QYDA 3U4MA 3WXMA 1P1FA 3KZNA 5FBLB 4KN6A 2OCLA 4HHEA 4Y1RA 4GAEA 5DMXA 1QIGA 4B80A 1SIOA 1NPTO 4JITA 1NHGA 4LQDA 4URZR 2NGRA 1UK7A 4RZXA 1IBCA 2HLPA 2OBFA 4EENA 4TV9A 5CA1F 1VLZA 1OB5A 1U3CA 5LB4A 4KI0A 5KTPA 1WZIA 4MCJA 2D8AA 2D59A 2JEZA 1BXRB 3C39A 2MYNA 3QMPA 3N0WA 4QYXA 4EBFA 3GLIB 5LUBA 4KQKA 4MP6A 1CXZA 1ODTC 4QUKA 2BJHA 4GM4A 5FYQA 4AS2A 3GX1A 4AUMA 3WJ2A 2PBZA 4YMVA 4GDFA 1TUBB 1ZA2A 4R2KA 5HE8A 3WLKX 3WYCA 2I76A 4EHAA 4O33A 1YQDA 3HYTA 4I8XA 2LCQA 1KMHB 1R6VA 2D3TA 1J21A 3AKEA 3NVDA 3ZLTA 2GF2A 2C9OA 2ONZA 1H6CA 1QVAA 5CHEA 1L7MA 3IEMA 1JLMA 2JH3A 4L95C 1V96A 4L3WA 5JPDA 1YS4A 2X3FA 4G9GA 1R0WA 3KPWA 4G0VA 4DB2A 3W78A 3AVWA 2LCFA 4HUTA 3ORHA 4PBRA 2WSYB 1QPBA 4NAHA 4OHPA 5CD9A 2XCIA 1YQXA 2EXXA 3EGOA 4JMLA 1VE3A 1BIFA 2J48A 1IEVA 1E3QA 2GM5A 4HB4A 2QR3A 1RQRA 3DMRA 1YNSA 1GA4A 4QDJA 5H7XA 3RASA 1NBIA 1U3UA 5F7OA 5E2IA 3ESXA 3GN1A 3JQ7A 3KT0A 1FYXA 4ZN6A 4CIWA 4OBBA 1P4JA 4MQEA 4YJ2A 2ZU0C 4BZPA 3SSMA 1T1JA 3BD9A 4BBJA 3QA3E 5GJWC 1G18A 1R8JA 2PBLA 2QTVA 3WWZA 1DADA 3P0HA 1TJ5A 3TCNA 3WP1B 1KIFA 5B64A 2GCPA 5B30A 4KR3A 2TMGA 1YACA 3ZHYA 4BNDB 4DDKA 2COUA 4TTPA 3EGEA 2ZULA 4PXAA 1NRWA 1KORA 4BDSA 4D92A 2SKDA 1VMIA 2WAOA 1N3IA 3DT9A 4QU0A 2VH1A 5IAKA 4EY8A 2WAMA 3V7WA 1DEAA 5I4BA 1NI4B 4MAMA 4FD2A 5FADA 2JB9A 1XLTA 3NBUA 1F12A 4Q9DA 1HKUA 1XNRB 3CC8A 2XNDD 1N2BA 2JJYA 3D2BA 3F7OA 1Z4OA 1LTHR 4UE2A 3SXUA 4NX2A 1E62A 1WETA 3G2PA 1E6MA 1KYYA 1Q7RA 4N6OA 4DF3A 2ZIGA 3S1AA 1LH0A 1EVLA 4MEAA 1GGMA 2WJVA 4Q4AB 4QXRA 2KBFA 2JCYA 2Q50A 3H75A 1EQAA 3IPYA 4UUMA 3NU1A 4FR2A 4PLTA 4LDRA 2XA2A 4IGIA 1EGAA 3AWIA 2NO6A 3HYRA 1XKLA 1VTKA 1A69A 4WLFA 1R15A 2D2VA 1RLUA 1CERA 5CJJA 5EP3A 4AN4A 1AKTA 3U4QA 1B0UA 4D7AA 2VA8A 3DDHA 3E2IA 2ZKLA 2OHVA 1OPXA 2IEDA 5CVJA 3KR9A 2Z4SA 4DV1B 2GBCA 4JEIA 3GVPA 4OQEA 4QUDA 4DR4B 2GXSA 4Q66C 1UXKA 3AEKB 3BF8A 5ILQA 2GRAA 3NWEA 4QQRA 4TQ9A 1QFSA 2PZEA 3U62A 1JQLB 1FTQA 1ODLA 1GR1A 1RC1A 4LWZA 4EG6A 4FKMA 4JT8A 2WT9A 1W8DA 3AERA 4XVUA 2DULA 3U44A 1NXOA 3CSDA 2BCEA 3BTSA 1B14A 5FL3A 4NBTA 1PGOA 1SQ6A 5JSZA 2HCFA 3ONDA 4IYJA 4FMDF 2BYTA 1NW8A 2ADOA 2X76A 4DQDA 2A1UA 1ZD3A 2HSGA 3O95A 4RH0A 1AD2A 5AK4A 2IBTA 1W2WB 2ODTX 2HUNA 2WVJA 4OQQA 1GKKA 1R0XA 2WJPA 3TIIA 4D9BA 2ZR8A 2PT9A 1FX1A 1KZYC 3VZPA 1ZGJA 1GAEO 2JBAB 5LOVB 2O8BA 3HABA 3KQSA 2WU0A 4GNKA 1E9FA 1KEZA 1T9BA 2QMZA 3OQVA 4H31A 4ZA2A 2OQVA 3RS9A 3ZLJA 3NOXA 2VNSA 3P20A 4D4IA 5D86A 2ZTLA 3Q2KA 3ZCXA 3ETJA 421PA 1HZZA 2ZYVX 1XZ8A 5J3JA 3ENNA 3FNFA 4L9AA 3S44A 1J56A 1Z36A 3W9SA 2ZE7A 4ZOEA 3GJ5A 3SFTA 1NL3A 2LNDA 2AG5A 1TM3E 3EMVA 3F1LA 1UR5A 3H9JA 3N1UA 5ELLA 4AQDA 2Q21A 3PK0A 1HQDA 1QTQA 2OZKA 4ZWNA 1RDFA 2ACWA 1BNCA 1WV1A 1ZKDA 3KTDA 4Y2RA 3WGUA 4E15A 3UJ9A 4P93A 4EWLA 3ORQA 4YAGA 4XFDA 1DFHA 1VMKA 2X14A 4KBFA 3EXEB 1UCFA 3GFFA 4MQ5A 1M72A 4YCAA 2ZB8A 1VBMA 4KUGA 4W9NA 2JFFA 1OI7A 2CDAA 4PC7A 4KH1A 4LJ5A 4F7DA 4LJ4A 2R8EA 5TEVA 1QQ5A 5TNXA 4EGAA 1TJ3A 3VSCA 3CRNA 3BXPA 1E2PA 2JHAA 3D0KA 3NTUA 4JQZA 2O2HA 3NKFA 3AKYA 5JXHA 2R84A 3BXEA 3THYA 3EGXA 1KWKA 3NR2A 2NU7B 3SOZA 4NDNE 1ZYUA 4K8OA 3UUWA 3TW8A 1AO0A 4OOEA 3DOFA 1QIFA 3H83A 4TSKA 5BQ5A 1CUFA 3EZXA 4BO9A 1W49A 2O8FA 1PE0A 4JQOA 5LBTA 3CF2A 3ESAA 2HCJB 2UYCA 2B5WA 4J1TA 3ZU4A 3W2TA 4POOA 3C3DA 3EIWA 4G26A 3O3CA 2XE8A 3AERB 1T4MA 2JJQA 4IDNA 1F20A 3BD7A 2QD5A 5JUWA 3NBQA 4EQ6B 1UT5A 2CMGA 3AUXA 3AONB 3KB6A 2GN0A 3OCZA 1FLVA 4OQXA 4BX8A 4PONA 1TM4E 3I61A 1MT0A 3KEGA 4LY6A 1GJRA 3I1FA 3Q3HA 4KNYA 3C4QA 1QANA 2M1ZA 2WTMA 2WC1A 1BO6A 1A9ZA 3BORA 4P0PB 4CM3A 3W05A 3UFXA 1N1DA 5KNCA 5CT4A 2CNWD 3EVBA 4NZOA 3GLHB 5DB4A 3JYOA 3L1UA 1OMOA 3WJ1A 1PKXA 2XQIA 3FDFA 4XJXA 3LQYA 4BFXA 3GMTA 3MWDA 1A7JA 1P5ZB 3R5HA 4M9XA 1PS0A 4KR0A 2R0QC 3QFFA 5AQ1A 4UDYX 3UKDA 4NCNA 2BUAA 2Q62A 3RVBA 4YT5A 5IYZB 3WNZA 2FXVA 3WBKA 3OZAA 1M75A 2C9MA 4WCFA 4X41A 4ZPJA 3I72A 4EJSC 4CUJA 3OFND 5JD3A 4DKXA 1V16A 3CS3A 5K9ZA 4BPBA 4WNIA 4PHGA 3VR0A 3VZBA 1SC4A 1Y1LA 1ZP6A 1X87A 5GONA 5HIJA 1TVKA 1VECA 2FETA 3OZXA 3IQWA 3Q7EA 1O94C 4YJHA 5EJ8A 5KYWA 3SD7A 1L4FA 2PL9A 1HYBA 2I2CA 1EINA 1Y3HA 4XYLA 5TMDA 1JFLA 3ZK9A 2BAGA 2YWJA 3BJEA 2UYYA 5JEDA 3W5IA 3VOBA 4BC1A 4GC5A 1FRNA 4E6PA 1Q21A 2XD4A 3H2BA 3BF7A 4QXAA 3RJZA 2PSHA 1P61B 2EJCA 1MENA 2XYQA 4RHFA 4XGQA 2X6TA 3S68A 3E23A 3PDIA 3ZV6A 4LSWA 2QN2A 2X0DA 2RAVA 2W6MA 2ZSAA 4G8DA 2WTAA 1T2DA 2BEKA 3IMEA 1ZZGA 2GNPA 4TMWA 4C1BA 2OXFA 1E60A 4IUYA 4CIAA 4RAQA 1U5BA 2EGGA 4DUZB 3AVXA 1W5SA 2JFXA 3FR8A 3QPCA 4GMHA 4ETWA 2W8BB 4FFLA 4BNZA 3UA3A 3VKVA 2QVBA 4I2VA 2FR1A 1DTWA 2V7TA 2NUAB 1YMQA 4P3OA 5CP8A 5B2FA 1UK6A 1UWVA 3OQNA 2AQKA 3EGWA 3HN7A 3AJ9A 1T0HB 2I78A 3EGXB 4E2YA 1HKHA 2ZRKA 1BCRA 3WOHA 4QG3A 1EK0A 3VVMA 3UK2A 1B4DA 1NJGA 5BXQC 4INOA 3V3TA 5BW4A 1XCMA 1BSVA 2DFTA 1ISHA 3UT5B 3G5UA 4YLGA 4CW7A 1C0IA 5LP1A 3FW1A 3L04A 2GSWA 2X3YA 2BV3A 2VJMA 1U8AA 3ZYCA 4DIBA 4F3NA 4J1QA 5HJEA 2BEUB 1T36B 5B7NA 2B1RA 4QBIA 5GM2A 1SC3A 4NZYA 2PKQP 1BU5A 1LLFA 1M6HA 3E9CA 4GZ3A 4H2DA 2AYYA 2AEJA 3K0AA 1GAJA 4P7KA 2ZCJA 3IEIA 4O1IA 1P1CA 1EUDB 3WMFA 1BS9A 3T7DA 1DIHA 5EWMB 1J7JA 1UMBA 3B8HA 3WGNA 3ZE8A 1YVRA 4LVCA 2AQIA 4CKEB 1QX4A 2CDRA 4B4UA 1F4VA 2FUCA 3U13A 3E81A 4QFBA 4B17A 4QAQA 4L5AA 3ZHBA 4DQXA 3ZJYA 5L6MB 5AVZA 1XLUA 2P2DA 2CUTA 2YXPX 4EARA 4UTZA 4MUBA 2MWMA 4MEBA 3L7AA 1E2QA 1FXUA 2HADA 1O4VA 4P1ZA 1PWYE 2BSQA 3A6DA 2I1VB 1OXMA 3SZMA 5AK3A 5E6UA 5FA8A 1R9NA 2QM0A 2P5SA 1BYIA 4H3VA 1Y1TA 1OBHA 2LR0A 2W71A 3DT8A 4O1MA 5C46F 1CQPA 3HSSA 1QZXA 1I9GA 1G8FA 2PKEA 2V0CA 4D0RA 2WUGA 2DCMA 2RHRA 4FIZA 3RSQA 2WU4A 1PVDA 4KWHA 3O1HB 3C4JA 1QU3A 2IC5A 4FUQA 1YQGA 1P0FA