3O9TA

Effector domain from influenza a/pr/8/34 ns1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
b'SRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFAW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 33
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9tA00
3O9RA 3O9UA 3RVCA 3O9QA 3O9SA 3EE9A 3M5RA 3O9TA 3D6RA 4OPHA 3F5TA 3KWIA 2KKZA 3KWGA 4OPAA 2GX9A 3L4QA 3P31A 3P39A 2RHKA 3P38A 3OA9A 3EE8A
chains in the Genus database with same CATH superfamily
3KHYA 2VWKA 4GVMA 3OYDA 4HWIA 1J5OA 3ID6A 1V4TA 4IO9L 3LDOA 3WEEB 5AQPA 4CZHA 3AA4A 3AVNA 2HSTA 4IWVA 3HVRA 3SAHA 3VA0A 5AFUA 4JI1K 3NF9A 1HYZA 3E01A 4BE2A 3K0SA 3AVLA 1JJ2M 4Y0WA 3RSEA 3W3DA 3H3OB 3SPZA 4JKHA 2KFZA 4DR5K 3VQQA 2E2NA 1Z26A 4C8MA 5FPMA 4CHPA 4N47A 3AV9A 3ENBA 3ID8A 3SQ4A 2ETJA 4BRNA 1FJGK 4H0OA 1BA0A 2KKZA 3OJUA 1EXQA 3LP2A 4E1MA 4CIFA 3BDPA 1Q8IA 1DTTA 1IG9A 3O1WA 3VQ4A 2IAJA 4B3SK 2RHKA 1QVFM 1LV5A 2HB5A 4DSEA 2P9KA 4DF4A 3ASMA 4HTLA 2E2OA 3R9PA 2P9SB 5BRFA 4GV9A 5HRNA 1JL1A 1RT2A 1NKEA 2QK9A 3VA3A 3QO9A 3LP0A 3CETA 1YJNN 4DSJA 2O4IA 4QCLA 1EWQA 3SNNA 1ASWA 1HNWK 4CF2A 3SJJA 4PKIA 1HLUA 3KK2A 4DQIA 3LDSA 2G8HA 1SL2A 1RNHA 3WQTA 1C1BA 3O9RA 3IKMA 2UXBK 3H1VX 2Z1HA 3ZSOA 2F8SA 4IDHA 3QICA 1HR0K 3LWMA 4CGDA 2FC0A 3DLGA 4A5AA 3FZMA 4WFBL 1W2BM 3C0BA 5AQLA 4B9NA 2YNIA 3OVNA 3ULDA 1J5EK 1C0TA 3OW2M 2D1KA 1VSKA 5EVZA 4E7JA 4FZZA 4CJFA 3SPYA 4H5RA 2X6SA 3V9UA 2GUIA 3ZLJA 1FXXA 2KQ2A 3E9OA 4CJEA 4Z94A 2P5OA 3O8MA 2AJQA 3DJCA 3OYLA 4QS8A 3HYFA 3TAPA 4EFHA 1F21A 3D6RA 5BRHA 2KHOA 4FK0A 2D0AA 3C94A 4FJ9A 3KWIA 1BO5O 2VYPA 1K73O 4ELUA 1NKCA 2UXCK 4DTNA 3IMXA 4FJNA 5FROA 1GOBA 1HRHA 3ZT1A 3KLEA 2P9KB 2ZJQL 3TI0A 2W41A 2IVOA 3H3NO 4M3YA 2OPRA 3WXLA 4FJXA 4CEZA 1TV6A 4JRQA 2YKMA 2ZGZA 4CFAA 3UKRA 1NGEA 3CF5L 4O4GA 1NU0A 4C8KA 3I56N 1IO2A 4B3OA 3V1QA 4BREA 4FLTA 3VF4A 4I7FA 3LWLA 3KIOA 4CK1A 3D2FB 3NVKA 2Q0RA 4IFEA 4WQ5A 4CECA 5BPLA 3TAFA 1IV0A 2GWKA 5J2QA 1Q86O 1VK0A 3AO2A 3O9TA 3VETA 4LFAK 3SI6A 3O4WA 3CCEN 4WCEL 4Z4HA 1TL1A 4BG8A 2B4JA 4DLGA 5E26A 4X62K 4CBXA 4H0YB 3QLHA 3L2UA 1ZBLA 3T1HK 3NHGA 3O4NA 3P39A 2W6LA 3HPHA 3M8PA 3PO4A 1UA0A 1YITN 2O8BA 2WC9A 3LP1A 3OYKA 4BWJA 4O44A 1NK7A 3OYFA 2IVNA 3NH0A 3ZT0A 4CF1A 5TKWA 1RCHA 4FJMA 3OYCA 5JLFA 4FLWA 1W7AA 3FR0A 3ZSWA 3D2EB 1YTUA 2YHYA 2E88A 1NOYA 4CD1A 4M41A 4BRHA 4EP5A 3PV8A 4LF5K 5KRTA 5EY4A 3LM2A 1S9GA 1KLMA 3SBGA 3L2WA 1BQMA 2RKIA 4DV2K 5JLHA 2IC3A 1GLAG 1L3SA 4I9LA 4DG1A 2GWJA 4E1NA 1C0MA 1ATNA 1IKVA 1HKBA 1VQ9N 3UKRB 3KLHA 1J6ZA 2D0PA 3CJCA 4KI4A 2I5JA 3T69A 1DLOA 3V9SA 4DQQA 4B9LA 4YOVA 1VSFA 4BRGA 1OH7A 4GKJK 3DLHA 4BRFA 4CCHA 1TAUA 1BGXT 5KTQA 3CM6A 1I3AA 1GLFO 1XUPO 1WLJA 3L8BA 1S1XA 4CJKA 5B8HA 1HNZK 3TSUA 3AGRA 4O0JA 5C2DA 4C1NI 1RBRA 1YJWN 4CJ4A 4ISEA 4DS5A 4JAXA 4PKHA 4DTUA 4AILC 1TKDA 4DFKA 1LW0A 2E6MA 3VQPA 3A8YA 3NGZA 2E5LK 1NMNA 3CJ7A 3O3GA 1NMDA 4IBNA 3AO5A 4CEEA 2DFEA 4J2DA 4DR1K 3JYTA 1SKSA 4YDUA 3G71N 5GAEP 4B3RK 4JKCA 1VQ4N 4ISGA 2OCEA 4LSNA 4QAGA 3IFRA 3CPWM 1IBKK 3NGIA 1K8AO 3MEEA 5LMUK 1KFDA 2QXFA 1B9DA 4EZ6A 4HTUA 4CD3A 1D9FA 2D0OA 4J2BA 1HQEA 1C6VA 1P8ZA 3VTHA 1T6DA 3VQCA 5M1FA 4CZEA 3JXUA 3VQEA 1IKYA 3MX2A 3B8AX 4H4MA 3TTCA 1ATSA 1O1WA 4F2RA 3ATUA 2A40A 4FZXC 4EAHD 2GBZA 3J81O 3BF1A 4FWOA 4CHZA 3OYIA 2UUBK 3THYA 3IG1A 1OVYA 4NCAA 3P5JA 4FPBA 2YHWA 3BF3A 5SZTA 4BR5A 4DS4A 3DRSA 3CIPA 4JNEA 2VQEK 4FM2A 3C6UA 4CZJA 2XRIA 5ELZA 4JKAA 4K42A 4JLHA 1LW2A 3LAKA 4BRMA 1YVNA 1SS6A 3LDQA 1SZ2A 5M1NA 4FWQA 3PY8A 4B3TK 3RR7A 1C0GA 2G8IA 3HJFA 2QI2A 1MWMA 2FF3B 1KAZA 1CZ9A 3T1YK 3RWUA 1DT9A 2QA4N 3ZSZA 1VQ8N 2Q36A 3CPEA 1XHXA 3CYMA 5LJWA 3HBTA 4HVJA 4OPAA 1NM1A 1NGBA 2P9NA 3ZSYA 4G9ZA 3A0IX 1VQKN 1HKGA 1E3MA 3LANA 1EO1A 1LWCA 3ZSXA 4I2PA 3WQUA 2YCHA 4CHNA 4I6MB 1NGIA 3AA5X 3DM2A 2QWLA 2QWRA 3HO1A 4IOAL 4LF7K 3M1FA 4KB0A 2F4VK 3FZKA 3VMFB 2CH6A 2WOMA 1RT6A 1IH7A 2DFFA 2FXUA 3G0ZA 4OPKA 3C65A 5I42A 2E2PA 4LY7A 3VQ7A 1BI4A 3WNFA 1IKWA 2Z1GA 1VHXA 2EX3A 3A5OC 1Z6RA 2HBLA 4JI8K 4IJAA 4BVPA 3OY9A 1C1CA 4GKKK 4E7LA 2G8WA 3AVCA 2BH1A 4CJ5A 2O4GA 4M3RA 4CZMA 2E1ZA 3DRPA 3QEVA 3RMBA 4DQ8A 3VEVA 1TKTA 4BACA 4CFDA 1WB9A 1VQNN 4FJ8A 1JLGA 1BQNA 4H5WA 3CCSN 4WYBA 5FLXO 1I94K 2GTDA 3AARA 4KH6A 4H5NA 4AHCA 1XWLA 3D7EO 4B1VA 4CK2A 3NH2A 3E1YA 3LAMA 5CZ2A 1GOAA 1RBUA 1S1WA 3U8XA 1QSYA 4NYFA 4O8UA 3VQ5A 4BC4A 3NMUA 1N6QA 2OA8A 1YIJN 4KH4A 1VSLA 4LD0A 3WNGA 4AQYK 3O9SA 5EOYA 2QXLA 3G10A 2HF3A 3RMDA 4DU4A 5CYMA 4DTSA 2PYJA 5AQGA 1TYQA 3DMJA 5JS1A 1RILA 4IFYA 3OYAA 4KI6A 2NRHA 3F9MA 1BI4B 3O6WA 1ASUA 3TAGA 1KCFA 2O8DA 3VF6A 1RDUA 4FM1A 1QSLA 1ILYA 2YX6A 2P9UB 2FBYA 2GEMA 3NVMA 4B1ZA 3NAEA 5KGWA 4BWMA 4KFBA 4BDZA 4IFVA 4H5VA 2VQFK 2RF2A 4CFCA 3HOTA 3OS2A 4CEOA 5EXWA 4FWNA 2ASPA 4CEQA 4X66K 4BGAA 5FPDA 1HQUA 3ISNC 4JK7A 4CFBA 3SBTA 2XY5A 3NGYA 2FBXA 3CJ9A 3FZHA 1QS4A 2IVPA 1N33K 5BR9A 3K5NA 3C7NA 4DU3A 2ZF5O 4BVOA 1T3VA 3R3LA 4O55A 5F2RA 3K2PA 4JKEA 3QEPA 1NK5A 1VRTA 4DCHA 3RRGA 1JLEA 4MO4A 5HBMA 4ISFA 2OTLN 3EN9A 3QERA 3JSMA 2O8FA 2IIRA 3EE9A 2YHAA 4B9UA 2FSKA 2GV9A 3VESA 3DXKA 2QTDA 3GDQA 4KB1A 1K8KA 2DPNA 3BY5A 3EKSA 1TYQB 4FW2A 4WE1A 3NE6A 3IUCA 3MCAB 4ZHRA 3D45A 2QKBA 2VG6A 1ASVA 3VEOA 2O8DB 4NCGA 4N56A 4BRAA 2FSNA 3O3FA 3QBXA 4BGBA 1TKZA 5KPRA 1NK0A 3ZT4A 3THWA 5HRPA 3MAQA 1T44A 3LL3A 5AQIA 4ELVA 4BE0A 1OKJA 4BRCA 1GLJO 3HI0A 3CQXA 3H1QA 2D0CA 1BCOA 1S6PA 1V4SA 3D0PA 1YJ9N 1NJIO 3WNHA 1HX1A 3LPUA 2B6AA 3BZCA 3HTVA 3SV3A 2DFHA 4BR2A 4CEAA 3AA2A 3CERA 2XO7A 3MDQA 4BC2A 3RRHA 3SQ0A 4H5TA 3UB5A 4BC3A 4DV5K 5I3UA 3THVA 4HCCA 4WQ5C 2KTQA 4MFBA 1RDWX 3OYBA 3MXMA 4FZYA 1IBMK 1ZC6A 3VGLA 1S22A 2Q0UA 3OBYA 3QINA 4FWSA 4BRQA 2ZWHA 3DLEA 3BUZB 3A5NC 3H46O 4W5QA 1BOTO 2HVIA 5BRDA 2YNHA 2QWPA 3ULEA 2HHSA 1QVGM 4KTZA 4PHTX 4DTOA 1DTQA 1NGCA 3ZYYX 4CJUA 3CCLN 3L3UA 5C42A 1RT1A 3AVBA 3B6PA 1K8KB 2HHVA 1XI1A 3FFIA 3J8AA 3CM5A 1WOQA 3DLBA 2HVHA 2OPQA 1MDUB 1EX4A 4DUYK 4RCHA 2IDOA 2JGUA 4FJIA 1NKBA 4Z0UA 5GAHP 4CIEA 1KVBA 5GINA 4GV3A 5IWAK 1HNIA 4DMNA 3NFAA 1BCMA 4J8FA 5DM6L 1WUAA 3SUNA 4F8RA 1XNQK 3N4QA 4AM7A 4AHRA 4CEFA 3CJBA 3RSEB 3TR8A 1U4BA 3PO5A 2PZSA 1NGHA 1X9JA 4MO5A 4DV4K 4FWLA 3MEGA 4DQSA 1NJZA 1ZXOA 2A1SA 1TUYA 4FWMA 3QIOA 1KAXA 3JS6A 4BE1A 1HYVA 1YAGA 4DV3K 4X64K 5CYQA 1K6YA 4YOTA 4KHUA 3U4LA 2FSJA 1U04A 2YI1A 4CJQA 3O3HA 4DU1A 3L2RA 1J53A 1OH6A 4OX9K 3TPQA 1MWKA 1Q81O 3QFUA 3L0QA 4DUZK 2GUPA 1N5YA 4CZKA 5AQHA 1W97L 3GG4A 3TTFA 2HNZA 3VENA 1UAXA 1WAJA 4XH4A 1DEJA 3KD5E 4YDUC 1NG9A 5CY4A 1MU2A 4FVUA 1S6QA 2JWKA 3P31A 3DYAA 3K5LA 2ZM6K 4FLXA 4KHQA 4OLBA 5M1KA 3VPZA 1U2VA 5E84A 4EIAA 3SCXA 2F9WA 4DSKA 1MA9B 1NGJA 2OTJN 5HROA 4RWTA 3H45C 3EEQA 1NBWA 2PFUA 2HHUA 3DI6A 4IEIA 4LFCK 4CJVA 4B1UB 3SAGA 4GY2B 1E4FT 1ZBIA 1XMQK 4LF4K 5FDLA 1T03A 3HK2A 3FE1A 5I9EB 3AVKA 2PBDA 4Q0BA 2FBTA 3DLLL 5J2MA 4HUEA 3U6FA 4W5NA 5AQKA 3A2FA 4K41A 3L2VA 4EHTA 5CR4A 4MDBA 4IKFA 1RT5A 2YJEA 1BA1A 1Q7YO 4YY3K 4Z4EA 1KLNA 4H03B 4F4KA 1LAVA 1OH8A 4YHHK 2AA4A 3KLGA 1BISA 1WBDA 3MCPA 1RTDA 3RVCA 3PUFA 1KRPA 1WN7A 2DY4A 3ZSQA 2ASOA 1HNVA 2HNDA 4NLCA 3NH1A 2NRVA 4FM0A 3M5RA 2X78A 3RTVA 3VEWA 4CZIA 5J2PA 4JS4A 4FYDA 1C0FA 4DV7K 3MN6A 1WSGA 5LJVA 2R7YA 3OJSA 2FF6A 2ZE2A 4FOEA 4DFMA 4MLHA 4FPAA 4KHPK 3UIQA 3L6QA 1JLQA 1XMOK 3Q7BA 5C2FA 4DR6K 4JKDA 3SZ2A 4H0VB 3C6TA 2D4WA 4IOXA 4ELTA 4Z4GA 1CZBA 3CD6N 4CGFA 4HHTA 1YUWA 4A2AA 4AM6A 4KKOA 2ZJRL 4C8OA 4B1WB 3CCMN 3ALYA 3M8QA 4LC9B 1LWEA 4ID5A 3I55N 4CK3A 3PX0A 3KK1A 4JI0K 3CCUN 1FKPA 2Q1NA 1U47A 4BY9C 2QEXN 2O8BB 1T05A 5KRSA 1LCUA 4LH4A 3KK3A 2DTUA 3AAQA 3EY1A 4C23A 3WNEA 3KTQA 4OPJA 3PLAA 1NK4A 4CE9A 2PYLA 3V1RA 3PSFA 3WXKA 3AA3A 2KW4A 5C10A 4JI7K 3K59A 1RGIA 1QHAA 4AHSA 1S72N 1RDCA 3TABA 4B9MA 4HCBA 2QWMA 1NK9A 3EO3A 1O13A 1QZ6A 3P1GA 4JI3K 1A5WA 4M7XA 3DAWA 4CHOA 4CHYA 3SK3A 1VRUA 5H1SQ 2NRRA 2HBJA 3M6GA 3KKSA 3TWHA 2QKKA 1D4XA 4DKWA 4CESA 4NO7A 5JVHL 3RMCA 1CXUA 2BUPA 1N32K 4B08A 2YKNA 4KHSA 1GLLO 1U45A 1VQON 1TAQA 5CHIA 1KAYA 2IS3A 3E9PA 1WSEA 3AVIA 3TSPA 3SQ1A 2B5JA 3HPOA 3TARA 5AQYA 3TAMA 3E9LA 4A61A 3M3ZA 1JCEA 4M45A 4GW6A 3KD1E 3G25A 3U3GA 3GL1A 4X65K 3DRRA 4KO0A 3EL2A 1QE1A 5AQJA 3CXCM 3VERA 5EX5A 3TSQA 3NDKA 2V7ZA 5AQWA 5HP1A 1S1TA 2NUBA 4K8XA 2BE2A 4XH5A 4UY8O 5IT9O 3OS0A 2VG7A 3GBTA 4JEPA 2Q97A 4IOCL 4FK4A 4JKFA 3HP6A 4WQ4C 2XY6A 3O5BA 3JAMO 2P9IA 1NGFA 4E19A 1NLVA 1SL0A 2V52B 3V4IA 3G4SN 3LPTA 2ZD1A 3ZT3A 4CJRA 3T19A 5HRRA 1JLFA 1VQ6N 3G6EN 5F0XA 3MK6A 4L8RB 1L5UA 5BR8K 3I8DA 2P9LA 4JKGA 5SWMA 3THYB 1TKXA 5AQOA 4GVEA 3V1OA 4AH9A 4O5BA 3UKUA 3PX6A 4PWDA 2P9PA 4DV1K 2Y1JA 4O0IA 2YNFA 4N5SA 4FW1A 2W40A 3FFKB 3I33A 4Y1CA 4OKEA 5LMNK 4JD2A 4JI2K 5MLCQ 2FLOA 4IO8A 3TU5A 4FWKA 4IG3A 1VSEA 2E4LA 2G8FA 3ZX3A 4CI6A 2PY5A 2HHHK 3HVTA 5D3GA 2IOCA 3F9KA 4BR0A 4F3TA 1VQ7N 2YNGA 1EQYA 3VTIA 2F8TA 2QW9A 5F1XA 3EKUA 4CIGA 2P9NB 4E1JA 4KREA 2HHXA 2G8UA 3WXIA 2P9IB 2CGJA 4H0XB 4A5BA 3OS1A 3J7ZO 4KHWA 1DKGD 1D9DA 2OPPA 3F2KA 1JLBA 3TANA 3GE1A 2OYQA 2P51A 4LF6K 3QNOA 4CGJA 4LF9K 1TUUA 4ILGB 4NXNK 2Q31A 2HHTA 4BRKA 3FGUA 3F73A 3SQ2A 1FKOA 3DWLA 1UWBA 4OO1J 1NJXA 4JKBA 4ILJA 2XHBA 1RBVA 5M1PA 3LZIA 1LWFA 4I2QA 3PIOL 3BEXA 2JLEA 3CC2N 2P9PB 2QWOA 1SV5A 3HSCA 4WF9L 2O8CA 4FWPA 1NK8A 2YHXA 4AHTA 5J2NA 4FLUA 1RDAA 2ZGYA 1JXEA 4CJPA 3IDHA 4JD2B 3SUOA 1CZAN 4E7IA 1WSFA 2HBMA 2CGLA 3VEZA 3ZSVA 4KRFA 4M7YA 3J7YP 5LL6Z 5AQZA 5HL7L 4JK9A 3WEEA 1OH5A 1XC9A 4C8LA 2HMIA 2WTUA 4Z4IA 1BIUA 5M1OA 1X9SA 3DXMA 5AQXA 1VQPN 2FBVA 1Y97A 2CH5A 4J2EA 4FOIA 3M8SA 4FCYA 4JHDA 2Q2RA 3J80O 5C25A 3LM9A 4ICLA 4FJ7A 2KFNA 4CVNE 3THXA 3P83D 1S9EA 4PA1A 4KV8A 4ID1A 4YORA 4BRLA 2KZZA 1LAWA 3E66A 4H4OA 1L3TA 3MN5A 4R79A 3VQDA 5GIOA 1TK5A 3HL8A 2YV0X 4LH5A 3B6OA 1SKRA 4M3ZA 4XIUA 3P38A 4W5OA 1IBLK 4N76A 3ITHA 3LDNA 2AP1A 4BG9A 2J4RA 5GAGP 3CJ1A 1ZBHA 3I8BA 4J2AA 4YOYA 1X9WA 2O8CB 3DLRA 1ZBFA 4BRPA 3OYJA 3CQ8A 5M1QA 2I7NA 2NZTA 4DR2K 2KLAA 3AO1A 3ZX0A 4OKJA 2WONA 3AVFA 1HJRA 3K5OA 4OJRA 5LY3A 4E0DA 1WNSA 5FRMA 3IAYA 1RTJA 3SAFA 2X74A 4DSLA 4QS7A 4Z4CA 1HPZA 2OZSA 2E1YA 3OHRA 3MECA 3AVAA 1BG3A 3LDPA 1GLCG 2OZMA 3AAPA 1FW6A 4QS9A 5C12A 3MXIA 3DXMB 3C6HA 4FJ5A 4M63C 1N34K 5FRNA 3C7NB 3V81A 4IG0A 2BANA 4JHDB 3HOSA 3VQAA 5HOOA 4FL9A 1OVQA 4BROA 3THXB 3IS9A 1QTMA 3T7ZA 4M42A 2O8FB 4OLAA 3KKRA 3L3VA 1RBTA 5KI6A 3DXKB 3H08A 4HUGA 2X6NA 3U9DA 3CC7N 4JN4A 4YOWA 1YT3A 5AR0A 2ITGA 1NK6A 1QQOA 3ENHA 4EZ9A 1FK9A 3WXJA 1A5VA 2ATQA 1NJYA 3HZ6A 2A3ZA 1Q18A 5AQRA 1ITGA 3TAQA 4LF8K 4CHQA 3O4QA 3THWB 1Q9YA 1HUXA 4B8AB 4JYAK 5KPZA 5KGXA 5JS2A 5BREA 3NF7A 3W0LA 1NGAA 2HF4A 3P4IA 3CFOA 4CJSA 2P5GA 3AVMA 2NRZA 1WSJA 1VQLN 1KD1O 3D2FA 4IZ9A 4FJLA 4F9OA 2A6AA 3PX4A 2D5RA 3CCVN 1X3NA 5KQDA 4B8CA 3VOVA 1UA1A 5CZ1A 4PL7A 2A1RA 2E6LA 1WSIA 2UYTA 3CCJN 4E7KA 4OPHA 3CC4N 2YJFA 3VQ6A 3RR8A 3ZCMA 4FJJA 4UQGA 1QQMA 5T7BA 4DV0K 4FO0A 4GV6A 1BHLA 4A2BA 1SUQA 2WFBA 4RW4A 4FVMA 1G15A 3ULEB 1UOCA 3MEDA 4PY5A 5AQUA 3D2EA 3DLKA 1EWRA 4BR7A 3CI5A 4JI6K 1S3XA 1U48A 4BQZA 2UUAK 2HBKA 3O1BA 1GLEG 4EP4A 5FPEA 3EZ5A 4Z4FA 3OBWA 3EZWA 2Y1IA 4EHUA 4HUFA 3OYNA 1KC8O 1NOZA 4CF8A 4BRIA 3HRGA 1HMVA 2H3GX 3HSTB 3VQ8A 1ZBSA 4CJTA 4DHYA 2A41A 1YF5L 3U3YA 4ILHA 1SQKA 4DF8A 4GNIA 3RMAA 1RTHA 3TTDA 4NLBA 4BR4A 2RE2A 2OANA 5C15A 3LP3A 1C1AA 5E41A 1N8RO 4M3XA 1BL3A 1TK8A 3MN9A 1QQNA 4IXCA 3QESA 2KZMA 4PL8A 4MDAA 2XY8A 4A62A 5C0YA 4FJHA 1KFSA 3CCQN 5HLFA 4IJNA 4NXMK 4KHYA 4KHNA 3VF2A 4W5TA 5BPMA 3SV4A 5AQNA 1S1UA 1WAFA 4K43A 3OA9A 5JVGL 4NYNA 4XEIA 4B9TA 1BDGA 4RG8A 2HNYA 3HPGA 4CJLA 3CMAN 5DM7L 4BRDA 5GIPA 2BDPA 2NRTA 3NF8A 3S3OA 2F96A 3QNNA 4DFPA 1GLDG 2VG5A 2F7TA 3O08A 3DOLA 4FWRA 2D0BA 3LZJA 4YFUA 3N4PA 1X9MA 4KAZA 5FPNA 4YOXA 3R8EA 3QB0A 4DWIA 3BGRA 3ZEUA 3QBWA 3CFRA 4K25A 2CGKA 2P1JA 1SAZA 4KTQA 3VGKA 4DSFA 3I0SA 1KVAA 3CCRN 1U2VB 3AVHA 4GMJB 4FXDA 3AVJA 2GX9A 4H0PA 1N36K 4CERA 5C24A 2ZJPL 3CJAA 2W6KA 2HW3A 3V9WA 4OGEA 5BN9A 1X1PA 2VWBA 3MWTA 1JCFA 5AQVA 1QQCA 3SMPA 4H8KA 5HRSA 4RW8A 4FJKA 4W5RA 1TVRA 3MWPA 3VQBA 4YOUA 3HT3A 3U9ZA 2RN2A 3GOIA 3QMLA 4KTWA 1QSSA 3SLCA 1S1VA 4V19S 4DTMA 2HOEA 1RT7A 3LALA 4DLEA 3VN5A 1IKXA 1BWFO 5AQMA 4A59A 2I7PA 1M1KO 1QZ5A 4KH5A 1G99A 4G1QA 3VGMA 3KK7A 2VGMA 3QIPA 4MQ3A 1YVUA 4OVLA 4C8NA 4RTFD 4K0KK 5AQQA 4B9SA 1B92A 1HKCA 3CHWA 1NGDA 1RFQA 1VSHA 4CBWA 3Q7CA 3ZETA 1RDDA 3R1XA 4RW7A 3OYMA 4JRPA 1KQSM 4I6MA 3VEYA 3K5MA 2A42A 3IRXA 3O80A 4DB3A 3ZEUB 4M3WA 2NRXA 5A2QO 5AZIA 3QEXA 3WXMB 4BC5A 1QHTA 5AZJA 2QWQA 2HHWA 3PSIA 3SJHA 2HMPA 1X3MA 4FLVA 3NBPA 2GELA 4O5FA 2E8AA 1J54A 1C0UA 3S3NA 3KZBA 3S3MA 1W9HA 1VSJA 4WFNL 1VQ5N 3O9QA 5KQ8A 3NF6A 4DSIA 1NGGA 1S5JA 1CLQA 2EHGA 1JL2A 4WFAL 4OGCA 4CGGA 1JLAA 2NNWA 3SUQA 5J1EA 2G8KA 3QETA 2LSNA 1Q9XA 3V9XA 1JLCA 1JXBA 1RT4A 4O8KA 5CE3A 1YI2N 2EWSA 1TL3A 1WBBA 1KSPA 2UXDK 1R59O 3OYEA 3SMSA 5JMVA 4U67L 4C1NK 4FLYA 3QEWA 2WBNA 1VSMA 1T8EA 3PIPL 1ESVA 3T3FA 3S41A 4CEBA 4CF9A 1GOCA 4CJ7A 1KVCA 1ATRA 2RPIA 3HM8A 2JWLA 4DTPA 2BTFA 1Z05A 4E89A 1LOTB 5TKYA 4JV5K 4CZLA 1L3VA 1YXQA 4L3QA 4KBOA 4CGHA 2ITMA 5K14A 3ZETB 1DGKN 2A5XA 3EE8A 4U7BA 1M90O 3CFPA 5AQSA 4Y1DA 2BGGA 3L2QA 1RBSA 1CXQA 1RTIA 3SYZA 4ZTFA 4N41A 5AZIB 4CBUA 4CEDA 4JI4K 1XC3A 4FSVA 4K8ZA 1HPMA 4TSXA 1YHQN 5AZJB 4Q5VA 1XNRK 1ZBUA 2ASMA 3H6EA 3K57A 1BUPA 1GLBG 2YHBA 3T1AA 1IG8A 5DMRA 4AF1A 5EU7A 1EP4A 4IDKA 4XH1A 3VQ9A 1U6ZA 1ZYQA 4DV6K 3O9UA 1IJJA 4CZGA 2P9UA 1JCGA 3AO4A 2E20A 2QWNA 5DK5A 3WUHA 1HJOA 4M3UA 4AHVA 3ZSRA 3CMEN 4B1YB 2Q3SA 4NB4A 1HYSA 1XHZA 3AO3A 4E3SA 3OYGA 1Z25A 5ADXH 2VCPA 1TGOA 2QM1A 3WT0A 4JS5A 1VSIA 3C95A 3AGKA 3BP8A 2Z1JA 5AJ3K 3OYHA 1YTAA 4DTRA 4RW9A 2O8EA 1WSHA 4FJGA 1VSDA 3FZFA 4BR9A 4M3TA 3OTOK 4A57A 4CJ3A 4NCBA 3KWGA 4B9QA 2XY7A 4F2SA 1K9MO 4H0TB 4B9VA 2UU9K 4BDPA 3V6DA 4F3OA 2HHQA 2P9LB 1L3UA 1D5AA 4B1XB 1EKEA 4JKGB 2NRWA 4ZTJA 1T6CA 3KJVA 1U49A 4DFJA 3ENOA 4CGIA 3K9JA 4I9QA 3UKUB 1R0AA 1JKHA 4CZFA 3EYZA 3NCIA 3KLIA 1T7PA 4DR3K 4B3MK 4DTXA 2IGIA 4DQRA 1SKWA 1NNEA 1NWKA 4E7HA 4BQLA 3FZLA 4RW6A 1VQMN 3L4IA 1SL1A 5AFUH 5BN8A 3I0RA 5KPTA 3A5MC 1D8YA 3CG7A 4BDYA 1P90A 4QOZB 1E4GT 2VGNA 3TAEA 1TK0A 2F9TA 1H1VA 2W42A 3MN7A 5AQTA 1W0HA 4JI5K 1KTQA 3MMVA 3R6MA 1VAZA 3F5TA 1J9AA 3HXMA 2NLXA 3MX5A 4WQ4A 3A5LC 1RT3A 1HNXK 1KXPA 3J7AP 3L4QA 3KLFA 4PUOA 2UUCK 4FK2A 4AHUA 4DTJA 4LSLA 4FLZA 1NJWA 4DR4K 3FLCO 3V9ZA 1A5XA 3C6AA 3HM9A 2VWJA 3ATVA 3DOKA 2O8EB 5ADXA 4IEEA 4DR7K 1REVA 4KPYA 3LDLA 1I39A 4OKKA 4PKGA 2Z1IA 3ZX2A 1RDBA 3VEXA 2G8VA 4MLEA 4LFBK 3AY9A 4YNQA 3QEIA 1Y64A 4CJWA 4CF0A 1XQSC 3QDKA 4CW7B 3ZT2A 2ZQBA 3AVGA 3BZKA 2E2QA 1Q82O 5GADP 3K9KA 5AQFA 3CQYA 5BPNA 2WUSA 2V7YA 3KVGA 4DQPA 2P9SA 3M8RA 1EETA 1BIZA 4JK8A 1B9FA 3SUPA 4R5PA 3HP9A 2V51B 2PAVA 3MXJA 3K58A 1BU6O 3S9HA 4PQUA 3QFPA 2OPSA 3UE5A 5JICA
chains in the Genus database with same CATH topology
3KHYA 2QWMA 2GTDA 3AARA 4KH6A 3EO3A 1O13A 1QZ6A 4H5NA 4HWIA 3D7EO 1V4TA 3ID6A 1KC8O 4IO9L 4M7XA 3DAWA 4B1VA 3SK3A 4BRIA 5H1SQ 3LDOA 3WEEB 5AQPA 2NRRA 3HRGA 3E1YA 2HBJA 2H3GX 4CZHA 3M6GA 1ZBSA 2HSTA 4DHYA 2A41A 1D4XA 4IWVA 3SAHA 1YF5L 4ILHA 5AFUA 4DKWA 4NO7A 1SQKA 3U8XA 4GNIA 1JJ2M 4Y0WA 3RSEA 3TTDA 3W3DA 5JVHL 4O8UA 4NLBA 4BC4A 2RE2A 4BR4A 2BUPA 3NMUA 2OANA 3H3OB 5C15A 1YIJN 4JKHA 1N8RO 1GLLO 4KH4A 3MN9A 1QQNA 4IXCA 1VQON 2E2NA 5CHIA 1KAYA 3E9PA 4PL8A 4MDAA 5FPMA 3O9SA 5EOYA 4A62A 2QXLA 3ENBA 3ID8A 2HF3A 3TSPA 5C0YA 4BRNA 3CCQN 4H0OA 5AQYA 5AQGA 1TYQA 1BA0A 2KKZA 3E9LA 4IJNA 3M3ZA 1JCEA 4A61A 3G25A 2NRHA 3VF2A 3F9MA 5BPMA 3O6WA 3GL1A 3O1WA 5AQNA 4K43A 2RHKA 1QVFM 3OA9A 3VF6A 1RDUA 5JVGL 3EL2A 4XEIA 5AQJA 3CXCM 1BDGA 2P9KA 3VERA 4HTLA 2E2OA 5EX5A 2YX6A 3TSQA 5DM7L 2V7ZA 3R9PA 5AQWA 3CMAN 1ILYA 4BRDA 2P9UB 2P9SB 5BRFA 4GV9A 2GEMA 5GIPA 2NRTA 3NVMA 4B1ZA 4H5VA 1GLDG 3CETA 4XH5A 1YJNN 4UY8O 2F7TA 3HOTA 3O08A 4FWRA 3GBTA 4JEPA 5EXWA 2Q97A 3N4PA 4PKIA 4IOCL 1HLUA 4FWNA 4JKFA 2ASPA 4WQ4C 5FPNA 3O5BA 4YOXA 2P9IA 3R8EA 1NGFA 1NLVA 3WQTA 4BGAA 5FPDA 3O9RA 3QB0A 3IKMA 2V52B 4JK7A 3ZEUA 3SBTA 3QBWA 3H1VX 3G4SN 4K25A 2CGKA 4IDHA 3CJ9A 3FZHA 1SAZA 3VGKA 2IVPA 3QICA 5BR9A 3CCRN 1VQ6N 1U2VB 3G6EN 4A5AA 4WFBL 3FZMA 3C7NA 1W2BM 3C0BA 5AQLA 2ZF5O 5F0XA 3MK6A 1T3VA 2GX9A 3R3LA 4H0PA 5F2RA 4BVOA 2ZJPL 2P9LA 3OW2M 3CJAA 4JKEA 4JKGA 2D1KA 5EVZA 4DCHA 4MO4A 4ISFA 2OTLN 5BN9A 4H5RA 3EN9A 2VWBA 3MWTA 1JCFA 5AQVA 3E9OA 2IIRA 3SMPA 5AQOA 4GVEA 3EE9A 3UKUA 2FSKA 4Z94A 3O8MA 2P9PA 3MWPA 3VESA 3DJCA 3DXKA 4QS8A 4YOUA 2QTDA 3GDQA 3U9ZA 1K8KA 4EFHA 3D6RA 3GOIA 2W40A 5BRHA 2KHOA 3FFKB 3QMLA 2DPNA 3KWIA 1BO5O 3EKSA 1TYQB 2VYPA 1K73O 3SLCA 3I33A 4JD2A 3IUCA 2HOEA 3MCAB 3IMXA 1BWFO 5MLCQ 2FLOA 3VEOA 5AQMA 4IO8A 3TU5A 4A59A 2I7PA 4FWKA 1M1KO 4BRAA 1QZ5A 4KH5A 1G99A 2FSNA 2P9KB 3QBXA 3ZX3A 4BGBA 3VGMA 4CI6A 3KK7A 5KPRA 2W41A 2IVOA 3H3NO 1T44A 3WXLA 3LL3A 5AQIA 2VGMA 1OKJA 4BRCA 2ZGZA 1GLJO 3UKRA 3HI0A 3CQXA 1NGEA 3H1QA 3CF5L 4RTFD 4BR0A 1V4SA 1YJ9N 1NJIO 1VQ7N 5AQQA 1HX1A 1EQYA 3HTVA 3VTIA 2QW9A 1HKCA 5F1XA 3I56N 3CHWA 3EKUA 4BR2A 1NGDA 2P9NB 4E1JA 1RFQA 4BREA 4CBWA 3VF4A 3Q7CA 3ZETA 3CERA 3D2FB 3NVKA 2Q0RA 3R1XA 3WXIA 2P9IB 3MDQA 4BC2A 2CGJA 1KQSM 4I6MA 4IFEA 4WQ5A 3VEYA 5BPLA 2GWKA 2A42A 1Q86O 3O80A 4H0XB 4DB3A 5M1NA 3ZEUB 4A5BA 4H5TA 2NRXA 3J7ZO 5AZIA 3UB5A 4BC3A 3WXMB 4BC5A 3O9TA 1DKGD 4WQ5C 3VETA 3F2KA 3O4WA 3CCEN 1RDWX 5AZJA 3GE1A 2QWQA 4WCEL 3SJHA 4BG8A 1ZC6A 3VGLA 1S22A 1TUUA 4ILGB 2HMPA 2Q0UA 3OBYA 5E26A 1X3MA 4FWSA 4BRQA 4CBXA 2ZWHA 4H0YB 2Q31A 3BUZB 2GELA 3A5NC 4O5FA 3H46O 2E8AA 4BRKA 3P39A 3FGUA 1BOTO 3KZBA 5BRDA 3DWLA 4WFNL 4OO1J 2QWPA 1VQ5N 1YITN 4JKBA 4ILJA 3ULEA 2WC9A 3O9QA 5KQ8A 4PHTX 1QVGM 5M1PA 1NGGA 1NGCA 3ZYYX 3PIOL 2IVNA 3BEXA 3CC2N 2P9PB 3CCLN 4WFAL 2QWOA 3HSCA 5TKWA 4WF9L 4FWPA 5JLFA 2YHXA 3FR0A 1K8KB 2NNWA 3D2EB 3J8AA 1WOQA 2YHYA 2E88A 4CD1A 2ZGYA 4BRHA 1MDUB 3IDHA 4JD2B 4RCHA 1CZAN 2HBMA 2CGLA 3VEZA 4O8KA 5CE3A 1YI2N 2EWSA 5EY4A 4M7YA 1R59O 3LM2A 3SMSA 3SBGA 5GAHP 5JMVA 4U67L 4C1NK 5AQZA 5JLHA 2WBNA 5HL7L 4JK9A 5GINA 3WEEA 1GLAG 4GV3A 3PIPL 1ESVA 2GWJA 5M1OA 3S41A 1HKBA 1ATNA 1VQ9N 3UKRB 4CJ7A 4J8FA 1ATRA 5DM6L 1WUAA 1J6ZA 3HM8A 2JWLA 3DXMA 2BTFA 3N4QA 5AQXA 1VQPN 2D0PA 3CJCA 1Z05A 1LOTB 2CH5A 5TKYA 4AM7A 4FOIA 4CZLA 3T69A 1YXQA 3CJBA 3RSEB 4L3QA 4JHDA 2Q2RA 4KBOA 4BRGA 2ITMA 4YOVA 4BRFA 3ZETB 1DGKN 2A5XA 3EE8A 3LM9A 4U7BA 1M90O 1NGHA 1X9JA 1GLFO 5AQSA 1XUPO 4MO5A 4FWLA 4YORA 5B8HA 5AZIB 4BRLA 1ZXOA 3TSUA 3AGRA 1TUYA 4CBUA 1XC3A 4FWMA 4C1NI 5C2DA 1KAXA 4FSVA 1YJWN 1HPMA 3JS6A 3E66A 1YHQN 1YAGA 5AZJB 4ISEA 3MN5A 4R79A 4YOTA 2ASMA 3H6EA 5GIOA 4JAXA 4PKHA 3U4LA 1BUPA 2FSJA 1GLBG 2YI1A 3A8YA 1IG8A 4AF1A 3CJ7A 2ZJQL 1NMDA 3TPQA 1MWKA 1Q81O 3P38A 4XH1A 4BG9A 3LDNA 2AP1A 1U6ZA 2J4RA 3QFUA 3O9UA 1IJJA 5GAGP 3L0QA 2GUPA 3CJ1A 4CZGA 4CZKA 2P9UA 1JCGA 5AQHA 2E20A 1W97L 2QWNA 3I8BA 3GG4A 4YDUA 3TTFA 3WUHA 1HJOA 4YOYA 3G71N 5GAEP 3CMEN 4B1YB 3VENA 4NB4A 4XH4A 1DEJA 4JKCA 4BRPA 4ISGA 1VQ4N 5M1QA 5ADXH 3IFRA 4YDUC 2I7NA 2VCPA 2NZTA 3CPWM 2KLAA 2OTJN 2QM1A 3WT0A 3ZX0A 4FVUA 1K8AO 3AGKA 2JWKA 3P31A 3BP8A 5LY3A 4CD3A 2D0OA 3SAFA 1P8ZA 3VTHA 1T6DA 5M1KA 5M1FA 4QS7A 4CZEA 3JXUA 2E1YA 3OHRA 3MX2A 3B8AX 1BG3A 3TTCA 3VPZA 3FZFA 3LDPA 1GLCG 1ATSA 1U2VA 5E84A 4BR9A 3AAPA 4EIAA 2F9WA 3ATUA 1MA9B 4QS9A 5C12A 1NGJA 2A40A 3C6HA 3DXMB 3H45C 4A57A 3KWGA 4M63C 1NBWA 4B9QA 4EAHD 2PFUA 4RWTA 1K9MO 3C7NB 4H0TB 4JHDB 3BF1A 4FWOA 3HOSA 2P9LB 4B1XB 4JKGB 4IEIA 5HOOA 4FL9A 4B1UB 1OVYA 3SAGA 2NRWA 4GY2B 1E4FT 4BROA 1T6CA 4FPBA 3T7ZA 2YHWA 3FE1A 3BF3A 3ENOA 4BR5A 3K9JA 5I9EB 2PBDA 3UKUB 3DLLL 4CZFA 3CIPA 4JNEA 3DXKB 5AQKA 4K41A 4CZJA 5ELZA 4JKAA 4K42A 3U9DA 5CR4A 4EHTA 3CC7N 4MDBA 4JN4A 4YOWA 4BRMA 1NWKA 1YVNA 1SS6A 2YJEA 3LDQA 1SZ2A 1BA1A 3FZLA 4FWQA 5AR0A 4BQLA 3L4IA 1QQOA 3ENHA 1Q7YO 5AFUH 5BN8A 1VQMN 1C0GA 4H03B 2QI2A 1MWMA 2FF3B 2AA4A 3WXJA 5KPTA 1KAZA 3A5MC 1P90A 3HZ6A 2A3ZA 1E4GT 1Q18A 3MCPA 5AQRA 2VGNA 3RVCA 1DT9A 2F9TA 2QA4N 2ASOA 4NLCA 1H1VA 1VQ8N 2NRVA 3M5RA 1HUXA 3MN7A 2Q36A 5AQTA 3CPEA 3VEWA 4CZIA 5KPZA 3MMVA 3R6MA 1VAZA 5LJWA 1C0FA 3F5TA 3HBTA 2NLXA 3MX5A 4WQ4A 3MN6A 3W0LA 1NGAA 5BREA 3A5LC 4OPAA 2HF4A 5LJVA 1NM1A 2FF6A 3P4IA 1KXPA 1NGBA 3L4QA 2P9NA 4G9ZA 3A0IX 1VQKN 4FOEA 2NRZA 4MLHA 1HKGA 4FPAA 1VQLN 1KD1O 3D2FA 4IZ9A 3L6QA 4F9OA 1EO1A 2A6AA 3Q7BA 3FLCO 3WQUA 2YCHA 3C6AA 5C2FA 3ATVA 4I6MB 4JKDA 3CCVN 1NGIA 1X3NA 4H0VB 5KQDA 2D4WA 4IOXA 3CD6N 2QWLA 2QWRA 3VOVA 4IEEA 5ADXA 4IOAL 4PL7A 3M1FA 3FZKA 3VMFB 2CH6A 3LDLA 2UYTA 3CCJN 4OPHA 1YUWA 2FXUA 4A2AA 3CC4N 4PKGA 2YJFA 4AM6A 3ZX2A 2ZJRL 3C65A 3VEXA 4MLEA 3AY9A 2E2PA 1QQMA 4B1WB 3CCMN 1Y64A 1XQSC 3A5OC 4FO0A 1Z6RA 3QDKA 4LC9B 2HBLA 4GV6A 3I55N 4IJAA 4A2BA 2WFBA 4BVPA 2E2QA 3CCUN 1Q82O 5GADP 3K9KA 5AQFA 3CQYA 2Q1NA 4BY9C 2BH1A 5BPNA 2WUSA 2QEXN 3ULEB 1LCUA 4CZMA 2E1ZA 2V7YA 3KVGA 4DQ8A 2P9SA 3VEVA 3AAQA 5AQUA 4C23A 3D2EA 4JK8A 4BR7A 3CI5A 3PLAA 1S3XA 1VQNN 2V51B 4BQZA 2PAVA 2HBKA 3O1BA 3WXKA 1GLEG 1BU6O 5C10A 5FPEA 4H5WA 1RGIA 1QHAA 3QFPA 4WYBA 3OBWA 3CCSN 1S72N 3EZWA 3UE5A 4EHUA 5JICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9R A;  3O9U A;  3RVC A;  3O9Q A;  3O9S A;  3EE9 A;  3M5R A;  3O9T A;  3D6R A;  4OPH A;  3F5T A;  3KWI A;  2KKZ A;  3KWG A;  4OPA A;  2GX9 A;  3L4Q A;  3P31 A;  3P39 A;  2RHK A;  3P38 A;  3OA9 A;  3EE8 A; 
#chains in the Genus database with same CATH topology
 3KHY A;  2VWK A;  4GVM A;  3OYD A;  4HWI A;  1J5O A;  3ID6 A;  1V4T A;  4IO9 L;  3LDO A;  3WEE B;  5AQP A;  4CZH A;  3AA4 A;  3AVN A;  2HST A;  4IWV A;  3HVR A;  3SAH A;  3VA0 A;  5AFU A;  4JI1 K;  3NF9 A;  1HYZ A;  3E01 A;  4BE2 A;  3K0S A;  3AVL A;  1JJ2 M;  4Y0W A;  3RSE A;  3W3D A;  3H3O B;  3SPZ A;  4JKH A;  2KFZ A;  4DR5 K;  3VQQ A;  2E2N A;  1Z26 A;  4C8M A;  5FPM A;  4CHP A;  4N47 A;  3AV9 A;  3ENB A;  3ID8 A;  3SQ4 A;  2ETJ A;  4BRN A;  1FJG K;  4H0O A;  1BA0 A;  2KKZ A;  3OJU A;  1EXQ A;  3LP2 A;  4E1M A;  4CIF A;  3BDP A;  1Q8I A;  1DTT A;  1IG9 A;  3O1W A;  3VQ4 A;  2IAJ A;  4B3S K;  2RHK A;  1QVF M;  1LV5 A;  2HB5 A;  4DSE A;  2P9K A;  4DF4 A;  3ASM A;  4HTL A;  2E2O A;  3R9P A;  2P9S B;  5BRF A;  4GV9 A;  5HRN A;  1JL1 A;  1RT2 A;  1NKE A;  2QK9 A;  3VA3 A;  3QO9 A;  3LP0 A;  3CET A;  1YJN N;  4DSJ A;  2O4I A;  4QCL A;  1EWQ A;  3SNN A;  1ASW A;  1HNW K;  4CF2 A;  3SJJ A;  4PKI A;  1HLU A;  3KK2 A;  4DQI A;  3LDS A;  2G8H A;  1SL2 A;  1RNH A;  3WQT A;  1C1B A;  3O9R A;  3IKM A;  2UXB K;  3H1V X;  2Z1H A;  3ZSO A;  2F8S A;  4IDH A;  3QIC A;  1HR0 K;  3LWM A;  4CGD A;  2FC0 A;  3DLG A;  4A5A A;  3FZM A;  4WFB L;  1W2B M;  3C0B A;  5AQL A;  4B9N A;  2YNI A;  3OVN A;  3ULD A;  1J5E K;  1C0T A;  3OW2 M;  2D1K A;  1VSK A;  5EVZ A;  4E7J A;  4FZZ A;  4CJF A;  3SPY A;  4H5R A;  2X6S A;  3V9U A;  2GUI A;  3ZLJ A;  1FXX A;  2KQ2 A;  3E9O A;  4CJE A;  4Z94 A;  2P5O A;  3O8M A;  2AJQ A;  3DJC A;  3OYL A;  4QS8 A;  3HYF A;  3TAP A;  4EFH A;  1F21 A;  3D6R A;  5BRH A;  2KHO A;  4FK0 A;  2D0A A;  3C94 A;  4FJ9 A;  3KWI A;  1BO5 O;  2VYP A;  1K73 O;  4ELU A;  1NKC A;  2UXC K;  4DTN A;  3IMX A;  4FJN A;  5FRO A;  1GOB A;  1HRH A;  3ZT1 A;  3KLE A;  2P9K B;  2ZJQ L;  3TI0 A;  2W41 A;  2IVO A;  3H3N O;  4M3Y A;  2OPR A;  3WXL A;  4FJX A;  4CEZ A;  1TV6 A;  4JRQ A;  2YKM A;  2ZGZ A;  4CFA A;  3UKR A;  1NGE A;  3CF5 L;  4O4G A;  1NU0 A;  4C8K A;  3I56 N;  1IO2 A;  4B3O A;  3V1Q A;  4BRE A;  4FLT A;  3VF4 A;  4I7F A;  3LWL A;  3KIO A;  4CK1 A;  3D2F B;  3NVK A;  2Q0R A;  4IFE A;  4WQ5 A;  4CEC A;  5BPL A;  3TAF A;  1IV0 A;  2GWK A;  5J2Q A;  1Q86 O;  1VK0 A;  3AO2 A;  3O9T A;  3VET A;  4LFA K;  3SI6 A;  3O4W A;  3CCE N;  4WCE L;  4Z4H A;  1TL1 A;  4BG8 A;  2B4J A;  4DLG A;  5E26 A;  4X62 K;  4CBX A;  4H0Y B;  3QLH A;  3L2U A;  1ZBL A;  3T1H K;  3NHG A;  3O4N A;  3P39 A;  2W6L A;  3HPH A;  3M8P A;  3PO4 A;  1UA0 A;  1YIT N;  2O8B A;  2WC9 A;  3LP1 A;  3OYK A;  4BWJ A;  4O44 A;  1NK7 A;  3OYF A;  2IVN A;  3NH0 A;  3ZT0 A;  4CF1 A;  5TKW A;  1RCH A;  4FJM A;  3OYC A;  5JLF A;  4FLW A;  1W7A A;  3FR0 A;  3ZSW A;  3D2E B;  1YTU A;  2YHY A;  2E88 A;  1NOY A;  4CD1 A;  4M41 A;  4BRH A;  4EP5 A;  3PV8 A;  4LF5 K;  5KRT A;  5EY4 A;  3LM2 A;  1S9G A;  1KLM A;  3SBG A;  3L2W A;  1BQM A;  2RKI A;  4DV2 K;  5JLH A;  2IC3 A;  1GLA G;  1L3S A;  4I9L A;  4DG1 A;  2GWJ A;  4E1N A;  1C0M A;  1ATN A;  1IKV A;  1HKB A;  1VQ9 N;  3UKR B;  3KLH A;  1J6Z A;  2D0P A;  3CJC A;  4KI4 A;  2I5J A;  3T69 A;  1DLO A;  3V9S A;  4DQQ A;  4B9L A;  4YOV A;  1VSF A;  4BRG A;  1OH7 A;  4GKJ K;  3DLH A;  4BRF A;  4CCH A;  1TAU A;  1BGX T;  5KTQ A;  3CM6 A;  1I3A A;  1GLF O;  1XUP O;  1WLJ A;  3L8B A;  1S1X A;  4CJK A;  5B8H A;  1HNZ K;  3TSU A;  3AGR A;  4O0J A;  5C2D A;  4C1N I;  1RBR A;  1YJW N;  4CJ4 A;  4ISE A;  4DS5 A;  4JAX A;  4PKH A;  4DTU A;  4AIL C;  1TKD A;  4DFK A;  1LW0 A;  2E6M A;  3VQP A;  3A8Y A;  3NGZ A;  2E5L K;  1NMN A;  3CJ7 A;  3O3G A;  1NMD A;  4IBN A;  3AO5 A;  4CEE A;  2DFE A;  4J2D A;  4DR1 K;  3JYT A;  1SKS A;  4YDU A;  3G71 N;  5GAE P;  4B3R K;  4JKC A;  1VQ4 N;  4ISG A;  2OCE A;  4LSN A;  4QAG A;  3IFR A;  3CPW M;  1IBK K;  3NGI A;  1K8A O;  3MEE A;  5LMU K;  1KFD A;  2QXF A;  1B9D A;  4EZ6 A;  4HTU A;  4CD3 A;  1D9F A;  2D0O A;  4J2B A;  1HQE A;  1C6V A;  1P8Z A;  3VTH A;  1T6D A;  3VQC A;  5M1F A;  4CZE A;  3JXU A;  3VQE A;  1IKY A;  3MX2 A;  3B8A X;  4H4M A;  3TTC A;  1ATS A;  1O1W A;  4F2R A;  3ATU A;  2A40 A;  4FZX C;  4EAH D;  2GBZ A;  3J81 O;  3BF1 A;  4FWO A;  4CHZ A;  3OYI A;  2UUB K;  3THY A;  3IG1 A;  1OVY A;  4NCA A;  3P5J A;  4FPB A;  2YHW A;  3BF3 A;  5SZT A;  4BR5 A;  4DS4 A;  3DRS A;  3CIP A;  4JNE A;  2VQE K;  4FM2 A;  3C6U A;  4CZJ A;  2XRI A;  5ELZ A;  4JKA A;  4K42 A;  4JLH A;  1LW2 A;  3LAK A;  4BRM A;  1YVN A;  1SS6 A;  3LDQ A;  1SZ2 A;  5M1N A;  4FWQ A;  3PY8 A;  4B3T K;  3RR7 A;  1C0G A;  2G8I A;  3HJF A;  2QI2 A;  1MWM A;  2FF3 B;  1KAZ A;  1CZ9 A;  3T1Y K;  3RWU A;  1DT9 A;  2QA4 N;  3ZSZ A;  1VQ8 N;  2Q36 A;  3CPE A;  1XHX A;  3CYM A;  5LJW A;  3HBT A;  4HVJ A;  4OPA A;  1NM1 A;  1NGB A;  2P9N A;  3ZSY A;  4G9Z A;  3A0I X;  1VQK N;  1HKG A;  1E3M A;  3LAN A;  1EO1 A;  1LWC A;  3ZSX A;  4I2P A;  3WQU A;  2YCH A;  4CHN A;  4I6M B;  1NGI A;  3AA5 X;  3DM2 A;  2QWL A;  2QWR A;  3HO1 A;  4IOA L;  4LF7 K;  3M1F A;  4KB0 A;  2F4V K;  3FZK A;  3VMF B;  2CH6 A;  2WOM A;  1RT6 A;  1IH7 A;  2DFF A;  2FXU A;  3G0Z A;  4OPK A;  3C65 A;  5I42 A;  2E2P A;  4LY7 A;  3VQ7 A;  1BI4 A;  3WNF A;  1IKW A;  2Z1G A;  1VHX A;  2EX3 A;  3A5O C;  1Z6R A;  2HBL A;  4JI8 K;  4IJA A;  4BVP A;  3OY9 A;  1C1C A;  4GKK K;  4E7L A;  2G8W A;  3AVC A;  2BH1 A;  4CJ5 A;  2O4G A;  4M3R A;  4CZM A;  2E1Z A;  3DRP A;  3QEV A;  3RMB A;  4DQ8 A;  3VEV A;  1TKT A;  4BAC A;  4CFD A;  1WB9 A;  1VQN N;  4FJ8 A;  1JLG A;  1BQN A;  4H5W A;  3CCS N;  4WYB A;  5FLX O;  1I94 K;  2GTD A;  3AAR A;  4KH6 A;  4H5N A;  4AHC A;  1XWL A;  3D7E O;  4B1V A;  4CK2 A;  3NH2 A;  3E1Y A;  3LAM A;  5CZ2 A;  1GOA A;  1RBU A;  1S1W A;  3U8X A;  1QSY A;  4NYF A;  4O8U A;  3VQ5 A;  4BC4 A;  3NMU A;  1N6Q A;  2OA8 A;  1YIJ N;  4KH4 A;  1VSL A;  4LD0 A;  3WNG A;  4AQY K;  3O9S A;  5EOY A;  2QXL A;  3G10 A;  2HF3 A;  3RMD A;  4DU4 A;  5CYM A;  4DTS A;  2PYJ A;  5AQG A;  1TYQ A;  3DMJ A;  5JS1 A;  1RIL A;  4IFY A;  3OYA A;  4KI6 A;  2NRH A;  3F9M A;  1BI4 B;  3O6W A;  1ASU A;  3TAG A;  1KCF A;  2O8D A;  3VF6 A;  1RDU A;  4FM1 A;  1QSL A;  1ILY A;  2YX6 A;  2P9U B;  2FBY A;  2GEM A;  3NVM A;  4B1Z A;  3NAE A;  5KGW A;  4BWM A;  4KFB A;  4BDZ A;  4IFV A;  4H5V A;  2VQF K;  2RF2 A;  4CFC A;  3HOT A;  3OS2 A;  4CEO A;  5EXW A;  4FWN A;  2ASP A;  4CEQ A;  4X66 K;  4BGA A;  5FPD A;  1HQU A;  3ISN C;  4JK7 A;  4CFB A;  3SBT A;  2XY5 A;  3NGY A;  2FBX A;  3CJ9 A;  3FZH A;  1QS4 A;  2IVP A;  1N33 K;  5BR9 A;  3K5N A;  3C7N A;  4DU3 A;  2ZF5 O;  4BVO A;  1T3V A;  3R3L A;  4O55 A;  5F2R A;  3K2P A;  4JKE A;  3QEP A;  1NK5 A;  1VRT A;  4DCH A;  3RRG A;  1JLE A;  4MO4 A;  5HBM A;  4ISF A;  2OTL N;  3EN9 A;  3QER A;  3JSM A;  2O8F A;  2IIR A;  3EE9 A;  2YHA A;  4B9U A;  2FSK A;  2GV9 A;  3VES A;  3DXK A;  2QTD A;  3GDQ A;  4KB1 A;  1K8K A;  2DPN A;  3BY5 A;  3EKS A;  1TYQ B;  4FW2 A;  4WE1 A;  3NE6 A;  3IUC A;  3MCA B;  4ZHR A;  3D45 A;  2QKB A;  2VG6 A;  1ASV A;  3VEO A;  2O8D B;  4NCG A;  4N56 A;  4BRA A;  2FSN A;  3O3F A;  3QBX A;  4BGB A;  1TKZ A;  5KPR A;  1NK0 A;  3ZT4 A;  3THW A;  5HRP A;  3MAQ A;  1T44 A;  3LL3 A;  5AQI A;  4ELV A;  4BE0 A;  1OKJ A;  4BRC A;  1GLJ O;  3HI0 A;  3CQX A;  3H1Q A;  2D0C A;  1BCO A;  1S6P A;  1V4S A;  3D0P A;  1YJ9 N;  1NJI O;  3WNH A;  1HX1 A;  3LPU A;  2B6A A;  3BZC A;  3HTV A;  3SV3 A;  2DFH A;  4BR2 A;  4CEA A;  3AA2 A;  3CER A;  2XO7 A;  3MDQ A;  4BC2 A;  3RRH A;  3SQ0 A;  4H5T A;  3UB5 A;  4BC3 A;  4DV5 K;  5I3U A;  3THV A;  4HCC A;  4WQ5 C;  2KTQ A;  4MFB A;  1RDW X;  3OYB A;  3MXM A;  4FZY A;  1IBM K;  1ZC6 A;  3VGL A;  1S22 A;  2Q0U A;  3OBY A;  3QIN A;  4FWS A;  4BRQ A;  2ZWH A;  3DLE A;  3BUZ B;  3A5N C;  3H46 O;  4W5Q A;  1BOT O;  2HVI A;  5BRD A;  2YNH A;  2QWP A;  3ULE A;  2HHS A;  1QVG M;  4KTZ A;  4PHT X;  4DTO A;  1DTQ A;  1NGC A;  3ZYY X;  4CJU A;  3CCL N;  3L3U A;  5C42 A;  1RT1 A;  3AVB A;  3B6P A;  1K8K B;  2HHV A;  1XI1 A;  3FFI A;  3J8A A;  3CM5 A;  1WOQ A;  3DLB A;  2HVH A;  2OPQ A;  1MDU B;  1EX4 A;  4DUY K;  4RCH A;  2IDO A;  2JGU A;  4FJI A;  1NKB A;  4Z0U A;  5GAH P;  4CIE A;  1KVB A;  5GIN A;  4GV3 A;  5IWA K;  1HNI A;  4DMN A;  3NFA A;  1BCM A;  4J8F A;  5DM6 L;  1WUA A;  3SUN A;  4F8R A;  1XNQ K;  3N4Q A;  4AM7 A;  4AHR A;  4CEF A;  3CJB A;  3RSE B;  3TR8 A;  1U4B A;  3PO5 A;  2PZS A;  1NGH A;  1X9J A;  4MO5 A;  4DV4 K;  4FWL A;  3MEG A;  4DQS A;  1NJZ A;  1ZXO A;  2A1S A;  1TUY A;  4FWM A;  3QIO A;  1KAX A;  3JS6 A;  4BE1 A;  1HYV A;  1YAG A;  4DV3 K;  4X64 K;  5CYQ A;  1K6Y A;  4YOT A;  4KHU A;  3U4L A;  2FSJ A;  1U04 A;  2YI1 A;  4CJQ A;  3O3H A;  4DU1 A;  3L2R A;  1J53 A;  1OH6 A;  4OX9 K;  3TPQ A;  1MWK A;  1Q81 O;  3QFU A;  3L0Q A;  4DUZ K;  2GUP A;  1N5Y A;  4CZK A;  5AQH A;  1W97 L;  3GG4 A;  3TTF A;  2HNZ A;  3VEN A;  1UAX A;  1WAJ A;  4XH4 A;  1DEJ A;  3KD5 E;  4YDU C;  1NG9 A;  5CY4 A;  1MU2 A;  4FVU A;  1S6Q A;  2JWK A;  3P31 A;  3DYA A;  3K5L A;  2ZM6 K;  4FLX A;  4KHQ A;  4OLB A;  5M1K A;  3VPZ A;  1U2V A;  5E84 A;  4EIA A;  3SCX A;  2F9W A;  4DSK A;  1MA9 B;  1NGJ A;  2OTJ N;  5HRO A;  4RWT A;  3H45 C;  3EEQ A;  1NBW A;  2PFU A;  2HHU A;  3DI6 A;  4IEI A;  4LFC K;  4CJV A;  4B1U B;  3SAG A;  4GY2 B;  1E4F T;  1ZBI A;  1XMQ K;  4LF4 K;  5FDL A;  1T03 A;  3HK2 A;  3FE1 A;  5I9E B;  3AVK A;  2PBD A;  4Q0B A;  2FBT A;  3DLL L;  5J2M A;  4HUE A;  3U6F A;  4W5N A;  5AQK A;  3A2F A;  4K41 A;  3L2V A;  4EHT A;  5CR4 A;  4MDB A;  4IKF A;  1RT5 A;  2YJE A;  1BA1 A;  1Q7Y O;  4YY3 K;  4Z4E A;  1KLN A;  4H03 B;  4F4K A;  1LAV A;  1OH8 A;  4YHH K;  2AA4 A;  3KLG A;  1BIS A;  1WBD A;  3MCP A;  1RTD A;  3RVC A;  3PUF A;  1KRP A;  1WN7 A;  2DY4 A;  3ZSQ A;  2ASO A;  1HNV A;  2HND A;  4NLC A;  3NH1 A;  2NRV A;  4FM0 A;  3M5R A;  2X78 A;  3RTV A;  3VEW A;  4CZI A;  5J2P A;  4JS4 A;  4FYD A;  1C0F A;  4DV7 K;  3MN6 A;  1WSG A;  5LJV A;  2R7Y A;  3OJS A;  2FF6 A;  2ZE2 A;  4FOE A;  4DFM A;  4MLH A;  4FPA A;  4KHP K;  3UIQ A;  3L6Q A;  1JLQ A;  1XMO K;  3Q7B A;  5C2F A;  4DR6 K;  4JKD A;  3SZ2 A;  4H0V B;  3C6T A;  2D4W A;  4IOX A;  4ELT A;  4Z4G A;  1CZB A;  3CD6 N;  4CGF A;  4HHT A;  1YUW A;  4A2A A;  4AM6 A;  4KKO A;  2ZJR L;  4C8O A;  4B1W B;  3CCM N;  3ALY A;  3M8Q A;  4LC9 B;  1LWE A;  4ID5 A;  3I55 N;  4CK3 A;  3PX0 A;  3KK1 A;  4JI0 K;  3CCU N;  1FKP A;  2Q1N A;  1U47 A;  4BY9 C;  2QEX N;  2O8B B;  1T05 A;  5KRS A;  1LCU A;  4LH4 A;  3KK3 A;  2DTU A;  3AAQ A;  3EY1 A;  4C23 A;  3WNE A;  3KTQ A;  4OPJ A;  3PLA A;  1NK4 A;  4CE9 A;  2PYL A;  3V1R A;  3PSF A;  3WXK A;  3AA3 A;  2KW4 A;  5C10 A;  4JI7 K;  3K59 A;  1RGI A;  1QHA A;  4AHS A;  1S72 N;  1RDC A;  3TAB A;  4B9M A;  4HCB A;  2QWM A;  1NK9 A;  3EO3 A;  1O13 A;  1QZ6 A;  3P1G A;  4JI3 K;  1A5W A;  4M7X A;  3DAW A;  4CHO A;  4CHY A;  3SK3 A;  1VRU A;  5H1S Q;  2NRR A;  2HBJ A;  3M6G A;  3KKS A;  3TWH A;  2QKK A;  1D4X A;  4DKW A;  4CES A;  4NO7 A;  5JVH L;  3RMC A;  1CXU A;  2BUP A;  1N32 K;  4B08 A;  2YKN A;  4KHS A;  1GLL O;  1U45 A;  1VQO N;  1TAQ A;  5CHI A;  1KAY A;  2IS3 A;  3E9P A;  1WSE A;  3AVI A;  3TSP A;  3SQ1 A;  2B5J A;  3HPO A;  3TAR A;  5AQY A;  3TAM A;  3E9L A;  4A61 A;  3M3Z A;  1JCE A;  4M45 A;  4GW6 A;  3KD1 E;  3G25 A;  3U3G A;  3GL1 A;  4X65 K;  3DRR A;  4KO0 A;  3EL2 A;  1QE1 A;  5AQJ A;  3CXC M;  3VER A;  5EX5 A;  3TSQ A;  3NDK A;  2V7Z A;  5AQW A;  5HP1 A;  1S1T A;  2NUB A;  4K8X A;  2BE2 A;  4XH5 A;  4UY8 O;  5IT9 O;  3OS0 A;  2VG7 A;  3GBT A;  4JEP A;  2Q97 A;  4IOC L;  4FK4 A;  4JKF A;  3HP6 A;  4WQ4 C;  2XY6 A;  3O5B A;  3JAM O;  2P9I A;  1NGF A;  4E19 A;  1NLV A;  1SL0 A;  2V52 B;  3V4I A;  3G4S N;  3LPT A;  2ZD1 A;  3ZT3 A;  4CJR A;  3T19 A;  5HRR A;  1JLF A;  1VQ6 N;  3G6E N;  5F0X A;  3MK6 A;  4L8R B;  1L5U A;  5BR8 K;  3I8D A;  2P9L A;  4JKG A;  5SWM A;  3THY B;  1TKX A;  5AQO A;  4GVE A;  3V1O A;  4AH9 A;  4O5B A;  3UKU A;  3PX6 A;  4PWD A;  2P9P A;  4DV1 K;  2Y1J A;  4O0I A;  2YNF A;  4N5S A;  4FW1 A;  2W40 A;  3FFK B;  3I33 A;  4Y1C A;  4OKE A;  5LMN K;  4JD2 A;  4JI2 K;  5MLC Q;  2FLO A;  4IO8 A;  3TU5 A;  4FWK A;  4IG3 A;  1VSE A;  2E4L A;  2G8F A;  3ZX3 A;  4CI6 A;  2PY5 A;  2HHH K;  3HVT A;  5D3G A;  2IOC A;  3F9K A;  4BR0 A;  4F3T A;  1VQ7 N;  2YNG A;  1EQY A;  3VTI A;  2F8T A;  2QW9 A;  5F1X A;  3EKU A;  4CIG A;  2P9N B;  4E1J A;  4KRE A;  2HHX A;  2G8U A;  3WXI A;  2P9I B;  2CGJ A;  4H0X B;  4A5B A;  3OS1 A;  3J7Z O;  4KHW A;  1DKG D;  1D9D A;  2OPP A;  3F2K A;  1JLB A;  3TAN A;  3GE1 A;  2OYQ A;  2P51 A;  4LF6 K;  3QNO A;  4CGJ A;  4LF9 K;  1TUU A;  4ILG B;  4NXN K;  2Q31 A;  2HHT A;  4BRK A;  3FGU A;  3F73 A;  3SQ2 A;  1FKO A;  3DWL A;  1UWB A;  4OO1 J;  1NJX A;  4JKB A;  4ILJ A;  2XHB A;  1RBV A;  5M1P A;  3LZI A;  1LWF A;  4I2Q A;  3PIO L;  3BEX A;  2JLE A;  3CC2 N;  2P9P B;  2QWO A;  1SV5 A;  3HSC A;  4WF9 L;  2O8C A;  4FWP A;  1NK8 A;  2YHX A;  4AHT A;  5J2N A;  4FLU A;  1RDA A;  2ZGY A;  1JXE A;  4CJP A;  3IDH A;  4JD2 B;  3SUO A;  1CZA N;  4E7I A;  1WSF A;  2HBM A;  2CGL A;  3VEZ A;  3ZSV A;  4KRF A;  4M7Y A;  3J7Y P;  5LL6 Z;  5AQZ A;  5HL7 L;  4JK9 A;  3WEE A;  1OH5 A;  1XC9 A;  4C8L A;  2HMI A;  2WTU A;  4Z4I A;  1BIU A;  5M1O A;  1X9S A;  3DXM A;  5AQX A;  1VQP N;  2FBV A;  1Y97 A;  2CH5 A;  4J2E A;  4FOI A;  3M8S A;  4FCY A;  4JHD A;  2Q2R A;  3J80 O;  5C25 A;  3LM9 A;  4ICL A;  4FJ7 A;  2KFN A;  4CVN E;  3THX A;  3P83 D;  1S9E A;  4PA1 A;  4KV8 A;  4ID1 A;  4YOR A;  4BRL A;  2KZZ A;  1LAW A;  3E66 A;  4H4O A;  1L3T A;  3MN5 A;  4R79 A;  3VQD A;  5GIO A;  1TK5 A;  3HL8 A;  2YV0 X;  4LH5 A;  3B6O A;  1SKR A;  4M3Z A;  4XIU A;  3P38 A;  4W5O A;  1IBL K;  4N76 A;  3ITH A;  3LDN A;  2AP1 A;  4BG9 A;  2J4R A;  5GAG P;  3CJ1 A;  1ZBH A;  3I8B A;  4J2A A;  4YOY A;  1X9W A;  2O8C B;  3DLR A;  1ZBF A;  4BRP A;  3OYJ A;  3CQ8 A;  5M1Q A;  2I7N A;  2NZT A;  4DR2 K;  2KLA A;  3AO1 A;  3ZX0 A;  4OKJ A;  2WON A;  3AVF A;  1HJR A;  3K5O A;  4OJR A;  5LY3 A;  4E0D A;  1WNS A;  5FRM A;  3IAY A;  1RTJ A;  3SAF A;  2X74 A;  4DSL A;  4QS7 A;  4Z4C A;  1HPZ A;  2OZS A;  2E1Y A;  3OHR A;  3MEC A;  3AVA A;  1BG3 A;  3LDP A;  1GLC G;  2OZM A;  3AAP A;  1FW6 A;  4QS9 A;  5C12 A;  3MXI A;  3DXM B;  3C6H A;  4FJ5 A;  4M63 C;  1N34 K;  5FRN A;  3C7N B;  3V81 A;  4IG0 A;  2BAN A;  4JHD B;  3HOS A;  3VQA A;  5HOO A;  4FL9 A;  1OVQ A;  4BRO A;  3THX B;  3IS9 A;  1QTM A;  3T7Z A;  4M42 A;  2O8F B;  4OLA A;  3KKR A;  3L3V A;  1RBT A;  5KI6 A;  3DXK B;  3H08 A;  4HUG A;  2X6N A;  3U9D A;  3CC7 N;  4JN4 A;  4YOW A;  1YT3 A;  5AR0 A;  2ITG A;  1NK6 A;  1QQO A;  3ENH A;  4EZ9 A;  1FK9 A;  3WXJ A;  1A5V A;  2ATQ A;  1NJY A;  3HZ6 A;  2A3Z A;  1Q18 A;  5AQR A;  1ITG A;  3TAQ A;  4LF8 K;  4CHQ A;  3O4Q A;  3THW B;  1Q9Y A;  1HUX A;  4B8A B;  4JYA K;  5KPZ A;  5KGX A;  5JS2 A;  5BRE A;  3NF7 A;  3W0L A;  1NGA A;  2HF4 A;  3P4I A;  3CFO A;  4CJS A;  2P5G A;  3AVM A;  2NRZ A;  1WSJ A;  1VQL N;  1KD1 O;  3D2F A;  4IZ9 A;  4FJL A;  4F9O A;  2A6A A;  3PX4 A;  2D5R A;  3CCV N;  1X3N A;  5KQD A;  4B8C A;  3VOV A;  1UA1 A;  5CZ1 A;  4PL7 A;  2A1R A;  2E6L A;  1WSI A;  2UYT A;  3CCJ N;  4E7K A;  4OPH A;  3CC4 N;  2YJF A;  3VQ6 A;  3RR8 A;  3ZCM A;  4FJJ A;  4UQG A;  1QQM A;  5T7B A;  4DV0 K;  4FO0 A;  4GV6 A;  1BHL A;  4A2B A;  1SUQ A;  2WFB A;  4RW4 A;  4FVM A;  1G15 A;  3ULE B;  1UOC A;  3MED A;  4PY5 A;  5AQU A;  3D2E A;  3DLK A;  1EWR A;  4BR7 A;  3CI5 A;  4JI6 K;  1S3X A;  1U48 A;  4BQZ A;  2UUA K;  2HBK A;  3O1B A;  1GLE G;  4EP4 A;  5FPE A;  3EZ5 A;  4Z4F A;  3OBW A;  3EZW A;  2Y1I A;  4EHU A;  4HUF A;  3OYN A;  1KC8 O;  1NOZ A;  4CF8 A;  4BRI A;  3HRG A;  1HMV A;  2H3G X;  3HST B;  3VQ8 A;  1ZBS A;  4CJT A;  4DHY A;  2A41 A;  1YF5 L;  3U3Y A;  4ILH A;  1SQK A;  4DF8 A;  4GNI A;  3RMA A;  1RTH A;  3TTD A;  4NLB A;  4BR4 A;  2RE2 A;  2OAN A;  5C15 A;  3LP3 A;  1C1A A;  5E41 A;  1N8R O;  4M3X A;  1BL3 A;  1TK8 A;  3MN9 A;  1QQN A;  4IXC A;  3QES A;  2KZM A;  4PL8 A;  4MDA A;  2XY8 A;  4A62 A;  5C0Y A;  4FJH A;  1KFS A;  3CCQ N;  5HLF A;  4IJN A;  4NXM K;  4KHY A;  4KHN A;  3VF2 A;  4W5T A;  5BPM A;  3SV4 A;  5AQN A;  1S1U A;  1WAF A;  4K43 A;  3OA9 A;  5JVG L;  4NYN A;  4XEI A;  4B9T A;  1BDG A;  4RG8 A;  2HNY A;  3HPG A;  4CJL A;  3CMA N;  5DM7 L;  4BRD A;  5GIP A;  2BDP A;  2NRT A;  3NF8 A;  3S3O A;  2F96 A;  3QNN A;  4DFP A;  1GLD G;  2VG5 A;  2F7T A;  3O08 A;  3DOL A;  4FWR A;  2D0B A;  3LZJ A;  4YFU A;  3N4P A;  1X9M A;  4KAZ A;  5FPN A;  4YOX A;  3R8E A;  3QB0 A;  4DWI A;  3BGR A;  3ZEU A;  3QBW A;  3CFR A;  4K25 A;  2CGK A;  2P1J A;  1SAZ A;  4KTQ A;  3VGK A;  4DSF A;  3I0S A;  1KVA A;  3CCR N;  1U2V B;  3AVH A;  4GMJ B;  4FXD A;  3AVJ A;  2GX9 A;  4H0P A;  1N36 K;  4CER A;  5C24 A;  2ZJP L;  3CJA A;  2W6K A;  2HW3 A;  3V9W A;  4OGE A;  5BN9 A;  1X1P A;  2VWB A;  3MWT A;  1JCF A;  5AQV A;  1QQC A;  3SMP A;  4H8K A;  5HRS A;  4RW8 A;  4FJK A;  4W5R A;  1TVR A;  3MWP A;  3VQB A;  4YOU A;  3HT3 A;  3U9Z A;  2RN2 A;  3GOI A;  3QML A;  4KTW A;  1QSS A;  3SLC A;  1S1V A;  4V19 S;  4DTM A;  2HOE A;  1RT7 A;  3LAL A;  4DLE A;  3VN5 A;  1IKX A;  1BWF O;  5AQM A;  4A59 A;  2I7P A;  1M1K O;  1QZ5 A;  4KH5 A;  1G99 A;  4G1Q A;  3VGM A;  3KK7 A;  2VGM A;  3QIP A;  4MQ3 A;  1YVU A;  4OVL A;  4C8N A;  4RTF D;  4K0K K;  5AQQ A;  4B9S A;  1B92 A;  1HKC A;  3CHW A;  1NGD A;  1RFQ A;  1VSH A;  4CBW A;  3Q7C A;  3ZET A;  1RDD A;  3R1X A;  4RW7 A;  3OYM A;  4JRP A;  1KQS M;  4I6M A;  3VEY A;  3K5M A;  2A42 A;  3IRX A;  3O80 A;  4DB3 A;  3ZEU B;  4M3W A;  2NRX A;  5A2Q O;  5AZI A;  3QEX A;  3WXM B;  4BC5 A;  1QHT A;  5AZJ A;  2QWQ A;  2HHW A;  3PSI A;  3SJH A;  2HMP A;  1X3M A;  4FLV A;  3NBP A;  2GEL A;  4O5F A;  2E8A A;  1J54 A;  1C0U A;  3S3N A;  3KZB A;  3S3M A;  1W9H A;  1VSJ A;  4WFN L;  1VQ5 N;  3O9Q A;  5KQ8 A;  3NF6 A;  4DSI A;  1NGG A;  1S5J A;  1CLQ A;  2EHG A;  1JL2 A;  4WFA L;  4OGC A;  4CGG A;  1JLA A;  2NNW A;  3SUQ A;  5J1E A;  2G8K A;  3QET A;  2LSN A;  1Q9X A;  3V9X A;  1JLC A;  1JXB A;  1RT4 A;  4O8K A;  5CE3 A;  1YI2 N;  2EWS A;  1TL3 A;  1WBB A;  1KSP A;  2UXD K;  1R59 O;  3OYE A;  3SMS A;  5JMV A;  4U67 L;  4C1N K;  4FLY A;  3QEW A;  2WBN A;  1VSM A;  1T8E A;  3PIP L;  1ESV A;  3T3F A;  3S41 A;  4CEB A;  4CF9 A;  1GOC A;  4CJ7 A;  1KVC A;  1ATR A;  2RPI A;  3HM8 A;  2JWL A;  4DTP A;  2BTF A;  1Z05 A;  4E89 A;  1LOT B;  5TKY A;  4JV5 K;  4CZL A;  1L3V A;  1YXQ A;  4L3Q A;  4KBO A;  4CGH A;  2ITM A;  5K14 A;  3ZET B;  1DGK N;  2A5X A;  3EE8 A;  4U7B A;  1M90 O;  3CFP A;  5AQS A;  4Y1D A;  2BGG A;  3L2Q A;  1RBS A;  1CXQ A;  1RTI A;  3SYZ A;  4ZTF A;  4N41 A;  5AZI B;  4CBU A;  4CED A;  4JI4 K;  1XC3 A;  4FSV A;  4K8Z A;  1HPM A;  4TSX A;  1YHQ N;  5AZJ B;  4Q5V A;  1XNR K;  1ZBU A;  2ASM A;  3H6E A;  3K57 A;  1BUP A;  1GLB G;  2YHB A;  3T1A A;  1IG8 A;  5DMR A;  4AF1 A;  5EU7 A;  1EP4 A;  4IDK A;  4XH1 A;  3VQ9 A;  1U6Z A;  1ZYQ A;  4DV6 K;  3O9U A;  1IJJ A;  4CZG A;  2P9U A;  1JCG A;  3AO4 A;  2E20 A;  2QWN A;  5DK5 A;  3WUH A;  1HJO A;  4M3U A;  4AHV A;  3ZSR A;  3CME N;  4B1Y B;  2Q3S A;  4NB4 A;  1HYS A;  1XHZ A;  3AO3 A;  4E3S A;  3OYG A;  1Z25 A;  5ADX H;  2VCP A;  1TGO A;  2QM1 A;  3WT0 A;  4JS5 A;  1VSI A;  3C95 A;  3AGK A;  3BP8 A;  2Z1J A;  5AJ3 K;  3OYH A;  1YTA A;  4DTR A;  4RW9 A;  2O8E A;  1WSH A;  4FJG A;  1VSD A;  3FZF A;  4BR9 A;  4M3T A;  3OTO K;  4A57 A;  4CJ3 A;  4NCB A;  3KWG A;  4B9Q A;  2XY7 A;  4F2S A;  1K9M O;  4H0T B;  4B9V A;  2UU9 K;  4BDP A;  3V6D A;  4F3O A;  2HHQ A;  2P9L B;  1L3U A;  1D5A A;  4B1X B;  1EKE A;  4JKG B;  2NRW A;  4ZTJ A;  1T6C A;  3KJV A;  1U49 A;  4DFJ A;  3ENO A;  4CGI A;  3K9J A;  4I9Q A;  3UKU B;  1R0A A;  1JKH A;  4CZF A;  3EYZ A;  3NCI A;  3KLI A;  1T7P A;  4DR3 K;  4B3M K;  4DTX A;  2IGI A;  4DQR A;  1SKW A;  1NNE A;  1NWK A;  4E7H A;  4BQL A;  3FZL A;  4RW6 A;  1VQM N;  3L4I A;  1SL1 A;  5AFU H;  5BN8 A;  3I0R A;  5KPT A;  3A5M C;  1D8Y A;  3CG7 A;  4BDY A;  1P90 A;  4QOZ B;  1E4G T;  2VGN A;  3TAE A;  1TK0 A;  2F9T A;  1H1V A;  2W42 A;  3MN7 A;  5AQT A;  1W0H A;  4JI5 K;  1KTQ A;  3MMV A;  3R6M A;  1VAZ A;  3F5T A;  1J9A A;  3HXM A;  2NLX A;  3MX5 A;  4WQ4 A;  3A5L C;  1RT3 A;  1HNX K;  1KXP A;  3J7A P;  3L4Q A;  3KLF A;  4PUO A;  2UUC K;  4FK2 A;  4AHU A;  4DTJ A;  4LSL A;  4FLZ A;  1NJW A;  4DR4 K;  3FLC O;  3V9Z A;  1A5X A;  3C6A A;  3HM9 A;  2VWJ A;  3ATV A;  3DOK A;  2O8E B;  5ADX A;  4IEE A;  4DR7 K;  1REV A;  4KPY A;  3LDL A;  1I39 A;  4OKK A;  4PKG A;  2Z1I A;  3ZX2 A;  1RDB A;  3VEX A;  2G8V A;  4MLE A;  4LFB K;  3AY9 A;  4YNQ A;  3QEI A;  1Y64 A;  4CJW A;  4CF0 A;  1XQS C;  3QDK A;  4CW7 B;  3ZT2 A;  2ZQB A;  3AVG A;  3BZK A;  2E2Q A;  1Q82 O;  5GAD P;  3K9K A;  5AQF A;  3CQY A;  5BPN A;  2WUS A;  2V7Y A;  3KVG A;  4DQP A;  2P9S A;  3M8R A;  1EET A;  1BIZ A;  4JK8 A;  1B9F A;  3SUP A;  4R5P A;  3HP9 A;  2V51 B;  2PAV A;  3MXJ A;  3K58 A;  1BU6 O;  3S9H A;  4PQU A;  3QFP A;  2OPS A;  3UE5 A;  5JIC A; 
#chains in the Genus database with same CATH homology
 3KHY A;  2QWM A;  2GTD A;  3AAR A;  4KH6 A;  3EO3 A;  1O13 A;  1QZ6 A;  4H5N A;  4HWI A;  3D7E O;  1V4T A;  3ID6 A;  1KC8 O;  4IO9 L;  4M7X A;  3DAW A;  4B1V A;  3SK3 A;  4BRI A;  5H1S Q;  3LDO A;  3WEE B;  5AQP A;  2NRR A;  3HRG A;  3E1Y A;  2HBJ A;  2H3G X;  4CZH A;  3M6G A;  1ZBS A;  2HST A;  4DHY A;  2A41 A;  1D4X A;  4IWV A;  3SAH A;  1YF5 L;  4ILH A;  5AFU A;  4DKW A;  4NO7 A;  1SQK A;  3U8X A;  4GNI A;  1JJ2 M;  4Y0W A;  3RSE A;  3TTD A;  3W3D A;  5JVH L;  4O8U A;  4NLB A;  4BC4 A;  2RE2 A;  4BR4 A;  2BUP A;  3NMU A;  2OAN A;  3H3O B;  5C15 A;  1YIJ N;  4JKH A;  1N8R O;  1GLL O;  4KH4 A;  3MN9 A;  1QQN A;  4IXC A;  1VQO N;  2E2N A;  5CHI A;  1KAY A;  3E9P A;  4PL8 A;  4MDA A;  5FPM A;  3O9S A;  5EOY A;  4A62 A;  2QXL A;  3ENB A;  3ID8 A;  2HF3 A;  3TSP A;  5C0Y A;  4BRN A;  3CCQ N;  4H0O A;  5AQY A;  5AQG A;  1TYQ A;  1BA0 A;  2KKZ A;  3E9L A;  4IJN A;  3M3Z A;  1JCE A;  4A61 A;  3G25 A;  2NRH A;  3VF2 A;  3F9M A;  5BPM A;  3O6W A;  3GL1 A;  3O1W A;  5AQN A;  4K43 A;  2RHK A;  1QVF M;  3OA9 A;  3VF6 A;  1RDU A;  5JVG L;  3EL2 A;  4XEI A;  5AQJ A;  3CXC M;  1BDG A;  2P9K A;  3VER A;  4HTL A;  2E2O A;  5EX5 A;  2YX6 A;  3TSQ A;  5DM7 L;  2V7Z A;  3R9P A;  5AQW A;  3CMA N;  1ILY A;  4BRD A;  2P9U B;  2P9S B;  5BRF A;  4GV9 A;  2GEM A;  5GIP A;  2NRT A;  3NVM A;  4B1Z A;  4H5V A;  1GLD G;  3CET A;  4XH5 A;  1YJN N;  4UY8 O;  2F7T A;  3HOT A;  3O08 A;  4FWR A;  3GBT A;  4JEP A;  5EXW A;  2Q97 A;  3N4P A;  4PKI A;  4IOC L;  1HLU A;  4FWN A;  4JKF A;  2ASP A;  4WQ4 C;  5FPN A;  3O5B A;  4YOX A;  2P9I A;  3R8E A;  1NGF A;  1NLV A;  3WQT A;  4BGA A;  5FPD A;  3O9R A;  3QB0 A;  3IKM A;  2V52 B;  4JK7 A;  3ZEU A;  3SBT A;  3QBW A;  3H1V X;  3G4S N;  4K25 A;  2CGK A;  4IDH A;  3CJ9 A;  3FZH A;  1SAZ A;  3VGK A;  2IVP A;  3QIC A;  5BR9 A;  3CCR N;  1VQ6 N;  1U2V B;  3G6E N;  4A5A A;  4WFB L;  3FZM A;  3C7N A;  1W2B M;  3C0B A;  5AQL A;  2ZF5 O;  5F0X A;  3MK6 A;  1T3V A;  2GX9 A;  3R3L A;  4H0P A;  5F2R A;  4BVO A;  2ZJP L;  2P9L A;  3OW2 M;  3CJA A;  4JKE A;  4JKG A;  2D1K A;  5EVZ A;  4DCH A;  4MO4 A;  4ISF A;  2OTL N;  5BN9 A;  4H5R A;  3EN9 A;  2VWB A;  3MWT A;  1JCF A;  5AQV A;  3E9O A;  2IIR A;  3SMP A;  5AQO A;  4GVE A;  3EE9 A;  3UKU A;  2FSK A;  4Z94 A;  3O8M A;  2P9P A;  3MWP A;  3VES A;  3DJC A;  3DXK A;  4QS8 A;  4YOU A;  2QTD A;  3GDQ A;  3U9Z A;  1K8K A;  4EFH A;  3D6R A;  3GOI A;  2W40 A;  5BRH A;  2KHO A;  3FFK B;  3QML A;  2DPN A;  3KWI A;  1BO5 O;  3EKS A;  1TYQ B;  2VYP A;  1K73 O;  3SLC A;  3I33 A;  4JD2 A;  3IUC A;  2HOE A;  3MCA B;  3IMX A;  1BWF O;  5MLC Q;  2FLO A;  3VEO A;  5AQM A;  4IO8 A;  3TU5 A;  4A59 A;  2I7P A;  4FWK A;  1M1K O;  4BRA A;  1QZ5 A;  4KH5 A;  1G99 A;  2FSN A;  2P9K B;  3QBX A;  3ZX3 A;  4BGB A;  3VGM A;  4CI6 A;  3KK7 A;  5KPR A;  2W41 A;  2IVO A;  3H3N O;  1T44 A;  3WXL A;  3LL3 A;  5AQI A;  2VGM A;  1OKJ A;  4BRC A;  2ZGZ A;  1GLJ O;  3UKR A;  3HI0 A;  3CQX A;  1NGE A;  3H1Q A;  3CF5 L;  4RTF D;  4BR0 A;  1V4S A;  1YJ9 N;  1NJI O;  1VQ7 N;  5AQQ A;  1HX1 A;  1EQY A;  3HTV A;  3VTI A;  2QW9 A;  1HKC A;  5F1X A;  3I56 N;  3CHW A;  3EKU A;  4BR2 A;  1NGD A;  2P9N B;  4E1J A;  1RFQ A;  4BRE A;  4CBW A;  3VF4 A;  3Q7C A;  3ZET A;  3CER A;  3D2F B;  3NVK A;  2Q0R A;  3R1X A;  3WXI A;  2P9I B;  3MDQ A;  4BC2 A;  2CGJ A;  1KQS M;  4I6M A;  4IFE A;  4WQ5 A;  3VEY A;  5BPL A;  2GWK A;  2A42 A;  1Q86 O;  3O80 A;  4H0X B;  4DB3 A;  5M1N A;  3ZEU B;  4A5B A;  4H5T A;  2NRX A;  3J7Z O;  5AZI A;  3UB5 A;  4BC3 A;  3WXM B;  4BC5 A;  3O9T A;  1DKG D;  4WQ5 C;  3VET A;  3F2K A;  3O4W A;  3CCE N;  1RDW X;  5AZJ A;  3GE1 A;  2QWQ A;  4WCE L;  3SJH A;  4BG8 A;  1ZC6 A;  3VGL A;  1S22 A;  1TUU A;  4ILG B;  2HMP A;  2Q0U A;  3OBY A;  5E26 A;  1X3M A;  4FWS A;  4BRQ A;  4CBX A;  2ZWH A;  4H0Y B;  2Q31 A;  3BUZ B;  2GEL A;  3A5N C;  4O5F A;  3H46 O;  2E8A A;  4BRK A;  3P39 A;  3FGU A;  1BOT O;  3KZB A;  5BRD A;  3DWL A;  4WFN L;  4OO1 J;  2QWP A;  1VQ5 N;  1YIT N;  4JKB A;  4ILJ A;  3ULE A;  2WC9 A;  3O9Q A;  5KQ8 A;  4PHT X;  1QVG M;  5M1P A;  1NGG A;  1NGC A;  3ZYY X;  3PIO L;  2IVN A;  3BEX A;  3CC2 N;  2P9P B;  3CCL N;  4WFA L;  2QWO A;  3HSC A;  5TKW A;  4WF9 L;  4FWP A;  5JLF A;  2YHX A;  3FR0 A;  1K8K B;  2NNW A;  3D2E B;  3J8A A;  1WOQ A;  2YHY A;  2E88 A;  4CD1 A;  2ZGY A;  4BRH A;  1MDU B;  3IDH A;  4JD2 B;  4RCH A;  1CZA N;  2HBM A;  2CGL A;  3VEZ A;  4O8K A;  5CE3 A;  1YI2 N;  2EWS A;  5EY4 A;  4M7Y A;  1R59 O;  3LM2 A;  3SMS A;  3SBG A;  5GAH P;  5JMV A;  4U67 L;  4C1N K;  5AQZ A;  5JLH A;  2WBN A;  5HL7 L;  4JK9 A;  5GIN A;  3WEE A;  1GLA G;  4GV3 A;  3PIP L;  1ESV A;  2GWJ A;  5M1O A;  3S41 A;  1HKB A;  1ATN A;  1VQ9 N;  3UKR B;  4CJ7 A;  4J8F A;  1ATR A;  5DM6 L;  1WUA A;  1J6Z A;  3HM8 A;  2JWL A;  3DXM A;  2BTF A;  3N4Q A;  5AQX A;  1VQP N;  2D0P A;  3CJC A;  1Z05 A;  1LOT B;  2CH5 A;  5TKY A;  4AM7 A;  4FOI A;  4CZL A;  3T69 A;  1YXQ A;  3CJB A;  3RSE B;  4L3Q A;  4JHD A;  2Q2R A;  4KBO A;  4BRG A;  2ITM A;  4YOV A;  4BRF A;  3ZET B;  1DGK N;  2A5X A;  3EE8 A;  3LM9 A;  4U7B A;  1M90 O;  1NGH A;  1X9J A;  1GLF O;  5AQS A;  1XUP O;  4MO5 A;  4FWL A;  4YOR A;  5B8H A;  5AZI B;  4BRL A;  1ZXO A;  3TSU A;  3AGR A;  1TUY A;  4CBU A;  1XC3 A;  4FWM A;  4C1N I;  5C2D A;  1KAX A;  4FSV A;  1YJW N;  1HPM A;  3JS6 A;  3E66 A;  1YHQ N;  1YAG A;  5AZJ B;  4ISE A;  3MN5 A;  4R79 A;  4YOT A;  2ASM A;  3H6E A;  5GIO A;  4JAX A;  4PKH A;  3U4L A;  1BUP A;  2FSJ A;  1GLB G;  2YI1 A;  3A8Y A;  1IG8 A;  4AF1 A;  3CJ7 A;  2ZJQ L;  1NMD A;  3TPQ A;  1MWK A;  1Q81 O;  3P38 A;  4XH1 A;  4BG9 A;  3LDN A;  2AP1 A;  1U6Z A;  2J4R A;  3QFU A;  3O9U A;  1IJJ A;  5GAG P;  3L0Q A;  2GUP A;  3CJ1 A;  4CZG A;  4CZK A;  2P9U A;  1JCG A;  5AQH A;  2E20 A;  1W97 L;  2QWN A;  3I8B A;  3GG4 A;  4YDU A;  3TTF A;  3WUH A;  1HJO A;  4YOY A;  3G71 N;  5GAE P;  3CME N;  4B1Y B;  3VEN A;  4NB4 A;  4XH4 A;  1DEJ A;  4JKC A;  4BRP A;  4ISG A;  1VQ4 N;  5M1Q A;  5ADX H;  3IFR A;  4YDU C;  2I7N A;  2VCP A;  2NZT A;  3CPW M;  2KLA A;  2OTJ N;  2QM1 A;  3WT0 A;  3ZX0 A;  4FVU A;  1K8A O;  3AGK A;  2JWK A;  3P31 A;  3BP8 A;  5LY3 A;  4CD3 A;  2D0O A;  3SAF A;  1P8Z A;  3VTH A;  1T6D A;  5M1K A;  5M1F A;  4QS7 A;  4CZE A;  3JXU A;  2E1Y A;  3OHR A;  3MX2 A;  3B8A X;  1BG3 A;  3TTC A;  3VPZ A;  3FZF A;  3LDP A;  1GLC G;  1ATS A;  1U2V A;  5E84 A;  4BR9 A;  3AAP A;  4EIA A;  2F9W A;  3ATU A;  1MA9 B;  4QS9 A;  5C12 A;  1NGJ A;  2A40 A;  3C6H A;  3DXM B;  3H45 C;  4A57 A;  3KWG A;  4M63 C;  1NBW A;  4B9Q A;  4EAH D;  2PFU A;  4RWT A;  1K9M O;  3C7N B;  4H0T B;  4JHD B;  3BF1 A;  4FWO A;  3HOS A;  2P9L B;  4B1X B;  4JKG B;  4IEI A;  5HOO A;  4FL9 A;  4B1U B;  1OVY A;  3SAG A;  2NRW A;  4GY2 B;  1E4F T;  4BRO A;  1T6C A;  4FPB A;  3T7Z A;  2YHW A;  3FE1 A;  3BF3 A;  3ENO A;  4BR5 A;  3K9J A;  5I9E B;  2PBD A;  3UKU B;  3DLL L;  4CZF A;  3CIP A;  4JNE A;  3DXK B;  5AQK A;  4K41 A;  4CZJ A;  5ELZ A;  4JKA A;  4K42 A;  3U9D A;  5CR4 A;  4EHT A;  3CC7 N;  4MDB A;  4JN4 A;  4YOW A;  4BRM A;  1NWK A;  1YVN A;  1SS6 A;  2YJE A;  3LDQ A;  1SZ2 A;  1BA1 A;  3FZL A;  4FWQ A;  5AR0 A;  4BQL A;  3L4I A;  1QQO A;  3ENH A;  1Q7Y O;  5AFU H;  5BN8 A;  1VQM N;  1C0G A;  4H03 B;  2QI2 A;  1MWM A;  2FF3 B;  2AA4 A;  3WXJ A;  5KPT A;  1KAZ A;  3A5M C;  1P90 A;  3HZ6 A;  2A3Z A;  1E4G T;  1Q18 A;  3MCP A;  5AQR A;  2VGN A;  3RVC A;  1DT9 A;  2F9T A;  2QA4 N;  2ASO A;  4NLC A;  1H1V A;  1VQ8 N;  2NRV A;  3M5R A;  1HUX A;  3MN7 A;  2Q36 A;  5AQT A;  3CPE A;  3VEW A;  4CZI A;  5KPZ A;  3MMV A;  3R6M A;  1VAZ A;  5LJW A;  1C0F A;  3F5T A;  3HBT A;  2NLX A;  3MX5 A;  4WQ4 A;  3MN6 A;  3W0L A;  1NGA A;  5BRE A;  3A5L C;  4OPA A;  2HF4 A;  5LJV A;  1NM1 A;  2FF6 A;  3P4I A;  1KXP A;  1NGB A;  3L4Q A;  2P9N A;  4G9Z A;  3A0I X;  1VQK N;  4FOE A;  2NRZ A;  4MLH A;  1HKG A;  4FPA A;  1VQL N;  1KD1 O;  3D2F A;  4IZ9 A;  3L6Q A;  4F9O A;  1EO1 A;  2A6A A;  3Q7B A;  3FLC O;  3WQU A;  2YCH A;  3C6A A;  5C2F A;  3ATV A;  4I6M B;  4JKD A;  3CCV N;  1NGI A;  1X3N A;  4H0V B;  5KQD A;  2D4W A;  4IOX A;  3CD6 N;  2QWL A;  2QWR A;  3VOV A;  4IEE A;  5ADX A;  4IOA L;  4PL7 A;  3M1F A;  3FZK A;  3VMF B;  2CH6 A;  3LDL A;  2UYT A;  3CCJ N;  4OPH A;  1YUW A;  2FXU A;  4A2A A;  3CC4 N;  4PKG A;  2YJF A;  4AM6 A;  3ZX2 A;  2ZJR L;  3C65 A;  3VEX A;  4MLE A;  3AY9 A;  2E2P A;  1QQM A;  4B1W B;  3CCM N;  1Y64 A;  1XQS C;  3A5O C;  4FO0 A;  1Z6R A;  3QDK A;  4LC9 B;  2HBL A;  4GV6 A;  3I55 N;  4IJA A;  4A2B A;  2WFB A;  4BVP A;  2E2Q A;  3CCU N;  1Q82 O;  5GAD P;  3K9K A;  5AQF A;  3CQY A;  2Q1N A;  4BY9 C;  2BH1 A;  5BPN A;  2WUS A;  2QEX N;  3ULE B;  1LCU A;  4CZM A;  2E1Z A;  2V7Y A;  3KVG A;  4DQ8 A;  2P9S A;  3VEV A;  3AAQ A;  5AQU A;  4C23 A;  3D2E A;  4JK8 A;  4BR7 A;  3CI5 A;  3PLA A;  1S3X A;  1VQN N;  2V51 B;  4BQZ A;  2PAV A;  2HBK A;  3O1B A;  3WXK A;  1GLE G;  1BU6 O;  5C10 A;  5FPE A;  4H5W A;  1RGI A;  1QHA A;  3QFP A;  4WYB A;  3OBW A;  3CCS N;  1S72 N;  3EZW A;  3UE5 A;  4EHU A;  5JIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...