3O9TA

Effector domain from influenza a/pr/8/34 ns1
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
117
structure length
117
Chain Sequence
SRYLTDMTLEEMSRDWSMLIPKQKVAGPLCIRMDQAIMDKNIILKANFSVIFDRLETLILLRAFTEEGAIVGEISPLPSLPGHTAEDVKNAVGVLIGGLEWNDNTVRVSETLQRFAW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nonstructural protein 1
publication title A Transient Homotypic Interaction Model for the Influenza A Virus NS1 Protein Effector Domain.
pubmed doi rcsb
source organism Influenza a virus
molecule tags Viral protein
total genus 33
structure length 117
sequence length 117
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.330 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3o9tA00
3KWIA 3F5TA 3L4QA 3OA9A 3O9UA 3KWGA 3P39A 3M5RA 3P38A 3D6RA 2GX9A 3O9RA 3O9TA 4OPAA 4OPHA 2KKZA 2RHKA 3P31A 3EE9A 3EE8A 3RVCA 3O9SA 3O9QA
chains in the Genus database with same CATH superfamily
3O8MA 5AQIA 1ZXOA 3UKUB 4B9LA 1N36K 2OTJN 1W2BM 1BI4B 4I6MB 4DUYK 2Z1GA 1IKXA 4CZGA 3HT3A 4DTJA 4JV5K 4U67L 3QBWA 3VQCA 3B6PA 4FCYA 3SV3A 3WUHA 2O8CA 4DF4A 3MEDA 3FZMA 4BRKA 2G8HA 4FJLA 4M3ZA 4KO0A 4DU4A 1WUAA 3JYTA 4ISFA 2A5XA 1FKPA 2WBNA 4OPHA 3UIQA 3LDLA 2E2QA 4CJRA 3SMPA 1HKGA 4CJ5A 1GLFO 5AQSA 4KHYA 5JS1A 4A59A 2P9UB 1HQEA 1XNRK 1U4BA 2VG7A 4CF2A 1D9FA 4CFBA 5EX5A 3CF5L 3OYFA 1KD1O 4DR2K 2HVHA 5AZIA 5AQWA 4BRGA 4FLVA 4F9OA 2UU9K 2HHVA 2D0AA 5GIPA 5KRSA 4FVMA 2O8EA 4KTWA 2FBVA 3UKRB 2VG5A 5GIOA 4Z4HA 1WBDA 1VSLA 4YORA 3L3UA 4YNQA 2ZGZA 2P9KA 4JKGB 3OYLA 1FK9A 3RSEA 4CJLA 5AQYA 4WQ5A 4N47A 4ZTFA 4Z4FA 2E8AA 3CJ7A 1S1VA 3RR8A 2QK9A 4JS5A 2OZSA 3K57A 4A5BA 2VQEK 2LSNA 3KLGA 3A5NC 4BDYA 1VRUA 4F2RA 2P9NA 3MWTA 5TKYA 3WEEA 5C10A 1DT9A 3AA3A 3LDOA 3TTDA 2CGKA 3SQ2A 2O8BB 1GOCA 2P9PA 3NGIA 3VN5A 4CJWA 4JLHA 3DLHA 4WQ5C 1ZC6A 4LF7K 1ASUA 2JLEA 3T1HK 1RT5A 1EXQA 2RN2A 1RNHA 1JL2A 3T69A 3B8AX 2E20A 3WNHA 4CK2A 5M1NA 3RR7A 4JI6K 4CFCA 4BRPA 4CZJA 4LD0A 2HHSA 1VSIA 4KHNA 4DR1K 3CFRA 3LANA 4FK4A 3J80O 3LAMA 4N5SA 3DXMA 3S3OA 4O4GA 4W5QA 5GAGP 4OKEA 5FRMA 1JCGA 3NH1A 3OJUA 1YXQA 3IUCA 2E6MA 1VSMA 1YVNA 4X65K 1JLAA 4JNEA 3CMAN 4FLXA 4JKBA 4H8KA 1VSFA 5BN8A 3CJBA 1RILA 4AHRA 5J2MA 3JSMA 2P9UA 3BUZB 3K9JA 4F3OA 2ZE2A 2HHHK 5LJWA 4BRFA 3ZSXA 3ZT0A 3C65A 2AA4A 5KGWA 3R9PA 3SAHA 3BGRA 1EX4A 4DQSA 4YDUA 2P51A 4W5OA 3BZCA 1FJGK 3IMXA 4Z4EA 4AH9A 4FZXC 2OANA 4DWIA 3TR8A 2KKZA 3A5MC 3AVLA 1E4FT 1X1PA 5CE3A 3E9OA 4KRFA 4BACA 1QE1A 4KV8A 3QEXA 3ZSZA 1LW0A 3MXJA 1T03A 4E1MA 1C6VA 3D2EB 4YDUC 1L3SA 4R5PA 3CCJN 4LF6K 4CHNA 4JI5K 3I0SA 3ZT2A 2XY8A 2G8UA 1NGAA 4OGCA 3V1RA 3VQ7A 1K73O 3NF6A 4DV5K 1NBWA 4NLCA 2Q3SA 3CJ9A 2E88A 4BRCA 4J2EA 1B9DA 4MFBA 4Y1CA 1LWEA 4FYDA 2QWNA 5J1EA 2J4RA 4HTUA 4FJGA 4PKHA 5BRDA 1XI1A 3CQXA 3OS2A 1QHTA 4YOTA 4CVNE 2B6AA 3V1QA 1WSFA 3AAQA 1R0AA 5EVZA 4LC9B 2HBLA 4JKHA 3RTVA 1YTAA 4M63C 3CG7A 1MDUB 3VQ8A 1U45A 4IOXA 1WN7A 5F0XA 2ZM6K 3FR0A 3AO4A 4Y1DA 4I2QA 1GLAG 1O13A 1NK4A 5GAEP 1ZBLA 4RW9A 4IKFA 1N33K 2O8FA 2UUAK 2W42A 3THWB 3WXLA 2P9SB 1NKBA 2GWKA 4O44A 3SBTA 2UUCK 1XMQK 1IG8A 4ID5A 4CF8A 2A42A 4DV1K 5BPNA 1NMDA 2UXBK 4FWKA 4FWPA 3NF8A 1HYSA 2VWJA 3ZLJA 3OYJA 3IAYA 4HUFA 3I33A 4FL9A 3SNNA 3ZCMA 4BWMA 4M41A 4FWLA 3EZ5A 2IVOA 4BWJA 2Q1NA 1NK0A 3KKSA 5GADP 3ZEUB 3QFUA 3CCUN 1LW2A 4CIFA 4RWTA 3DI6A 3PIOL 4KH6A 1S3XA 2WONA 4IEIA 3I0RA 1KFSA 1HJRA 4JK8A 3L8BA 1S1XA 4JEPA 3VQBA 1QQCA 4EP5A 2F8TA 2CGLA 5CZ1A 1VSJA 4Z4GA 1X9WA 1LAWA 2X6SA 2E5LK 2ZD1A 5HOOA 1BA0A 5C25A 1KAYA 3HOSA 1BQMA 3VF6A 2VCPA 4JHDB 1NGCA 1HRHA 3VQAA 1K8KB 2FXUA 3OYKA 3QEWA 4DF8A 3EYZA 2VWBA 4H03B 4CJTA 3SUPA 4YFUA 3AO3A 4DQQA 1RBRA 2HNYA 2GUPA 4H5NA 1KAZA 4JRPA 1U04A 2QW9A 5FLXO 4BQZA 5DM7L 2QWQA 1BG3A 3U4LA 3ZETA 3WXMB 2WFBA 3R8EA 2Z1IA 4GMJB 4O8UA 1DKGD 1CZAN 2QWMA 1NK8A 3I8BA 2G8KA 4JKCA 4BR9A 3A5OC 2RKIA 5BR9A 2PYJA 5AR0A 4NXMK 4CEDA 1FXXA 4B1VA 1VQLN 3QIPA 2BH1A 4IDHA 2HF3A 1X9SA 3U9ZA 1C1BA 4B1XB 1BIZA 3AVCA 1YJWN 2A3ZA 3AVIA 1X9MA 4AILC 3RMCA 4KBOA 2P9SA 1ATSA 3ID6A 3L2RA 1SUQA 5LMNK 2JWLA 4FWSA 4A2BA 2HB5A 4DUZK 1VSEA 3S41A 4OKJA 3ULEB 2NZTA 1Q8IA 1BGXT 2A40A 2QXLA 1S1TA 1NGBA 4CD3A 5HRSA 2ZJQL 1NWKA 3AVAA 3SBGA 3KTQA 4CEAA 1VRTA 1T8EA 1K6YA 5C42A 2FLOA 1RFQA 2A1SA 4BE2A 2KFZA 4BC3A 1QZ6A 5AQKA 4CBUA 2GELA 2PFUA 2DTUA 3TSQA 1R59O 2IS3A 4O5BA 3ZT3A 3MWPA 4BREA 4FWOA 3NHGA 1YHQN 1L3VA 3F9MA 2FF6A 1IG9A 1EP4A 4QS8A 5KI6A 1CLQA 1M90O 4E1NA 4IBNA 4DCHA 2OYQA 3L2WA 3AO5A 3HSTB 4Q5VA 1JLEA 4PHTX 4HCBA 4QAGA 3SPZA 3OYNA 5HRNA 3ZSOA 2PYLA 1VQ9N 4CF1A 2O8CB 3OYBA 3LPTA 4IJAA 4A61A 1IBKK 1ASVA 3P31A 4FM0A 3EKSA 4GV6A 4IG0A 2VQFK 3AVBA 4GKKK 5H1SQ 1YIJN 1D4XA 4HVJA 3V9UA 4BR0A 4BQLA 1OVQA 1UAXA 3AGRA 1WAJA 1VQNN 4K43A 3V9ZA 2CH6A 3RRHA 4HCCA 3DRSA 1K9MO 3J81O 3NCIA 2ASOA 1C0UA 3M5RA 3EY1A 3VEWA 3SYZA 5C2DA 4BC2A 1WSHA 4FPBA 5C0YA 1OH6A 3FZKA 5KTQA 1HNVA 3OYMA 3DOLA 4AM6A 3CCRN 5BRHA 4B9NA 3QEVA 4FK2A 2OPRA 3SQ4A 4ELUA 3M1FA 4FLZA 2V7YA 1TGOA 5AZIB 1RCHA 3WT0A 4B3RK 3O3GA 3QMLA 3R3LA 3MAQA 4AM7A 4LF8K 2O8EB 1KFDA 3VTHA 4CHQA 1U2VA 4DHYA 4C8KA 2P9KB 3CJAA 4NCGA 3EE9A 4DU3A 5M1OA 4DTOA 4CJEA 3RSEB 5GINA 3DLGA 3H1VX 3F9KA 3N4PA 4LFAK 3KLIA 3OBWA 1S6PA 4OPJA 1TYQA 4BRQA 4DV3K 4B1YB 4CD1A 4KB0A 1V4TA 1EO1A 1TK0A 1T3VA 4KHWA 4H0XB 2P9NB 3J7AP 4DV7K 4DTMA 3LDQA 3AGKA 4DV2K 2ZJRL 3WEEB 2IVPA 5FPEA 4JKFA 2O8DA 1O1WA 1J5OA 2ITGA 4M3UA 2P9PB 4H5WA 1BU6O 3GE1A 4BRAA 4CEQA 3CCQN 4LFBK 1KAXA 3EZWA 4BY9C 3MK6A 3V1OA 3F2KA 3QBXA 4Z94A 4X64K 1BCOA 3PO5A 1EKEA 4FLYA 3OYIA 4CJ3A 4IJNA 5I42A 4FOEA 1KVCA 1REVA 1NGHA 4CGHA 3LALA 2UXCK 1KLNA 4DV0K 3P1GA 3VETA 3DLLL 3C6TA 3BZKA 2FBYA 3AVHA 4JK9A 3JAMO 3OJSA 3L6QA 1U48A 4JN4A 3NF7A 3DXMB 3FZFA 4EAHD 1NGIA 2GWJA 4DS4A 4H0OA 3IFRA 1NGDA 4CHOA 2KZMA 4CEOA 2RPIA 4B1ZA 3BP8A 1NMNA 4YY3K 3O5BA 2O4IA 4DS5A 4DFMA 3L2UA 3OHRA 3LP0A 5EY4A 4BROA 4RW6A 5BR8K 1YT3A 1RT4A 3ZSQA 1KLMA 3LM2A 3MN7A 2GEMA 3OY9A 2PZSA 2ZF5O 4GY2B 1RTJA 2DFFA 5HRRA 3ZT4A 3HPOA 4NXNK 4W5RA 1SS6A 2WTUA 3SUNA 2CH5A 4X62K 1ZBIA 1VQ6N 2F7TA 4EFHA 3NGZA 1VSDA 1YI2N 2VGMA 3QNOA 1HNXK 3TAPA 4YOWA 2Q31A 3O9RA 4NCBA 3BF1A 1NG9A 4H0YB 3U3GA 1YITN 4KB1A 2ITMA 4DQ8A 3IG1A 5AQLA 2YV0X 1IKYA 1QQOA 1WB9A 2NLXA 4PL7A 4IFYA 2UYTA 3V4IA 2XO7A 1T44A 2W40A 3H45C 5AQTA 5KQ8A 1I94K 3P5JA 3RWUA 1GLCG 1DTQA 2HSTA 1HPZA 1LCUA 3FZHA 1XWLA 3VQ9A 2W6KA 3HM9A 4OPAA 1NK5A 1IBMK 4CHPA 2QTDA 3MECA 4XH1A 1SL2A 4LF5K 4ILJA 4KHSA 5FPNA 4K42A 2QI2A 5CYMA 3V9WA 2H3GX 3FGUA 1C0FA 2Q97A 3OYHA 1NOZA 3R1XA 4IOAL 1DEJA 1I39A 1GLDG 1NGGA 4E7LA 4DV6K 3FZLA 2YJFA 1TV6A 1JCFA 5ADXA 4EZ9A 3VGMA 3ZT1A 2RF2A 4BVPA 3VPZA 4MQ3A 3QLHA 4CBWA 4TSXA 3OYEA 4O5FA 1C1CA 2HBJA 4LF4K 3MCPA 4FWMA 1X9JA 2HHQA 4FJNA 1JL1A 3CPEA 4E7IA 4O0IA 1GLJO 4YOYA 3VEOA 4DFKA 3CCMN 4H5TA 3QINA 3C0BA 5HBMA 4CBXA 2ZJPL 3LWLA 2O8FB 4GVMA 1RGIA 4K41A 1N34K 4GNIA 1HMVA 4B9QA 3O4WA 2BE2A 5J2NA 3MN5A 5CYQA 1VSKA 3TPQA 4FLTA 3ZX0A 3TTCA 2ASMA 2VGNA 1EETA 3TANA 4BDPA 4JI8K 3TARA 1F21A 4E7KA 3ZSVA 5FPDA 2GV9A 4FJJA 2HHWA 2P1JA 4DFJA 4DR6K 2F96A 4NB4A 3L4IA 4BRHA 1BHLA 4HWIA 3DJCA 3TAGA 2QKKA 4ZTJA 1QSLA 1RDCA 4KH4A 5CZ2A 3QETA 5HLFA 3K58A 4AF1A 4DSIA 1K8AO 4GV3A 4EZ6A 4BC4A 3O3FA 4B3TK 1NJZA 1U47A 4CJQA 1BA1A 1QHAA 3QDKA 1BO5O 2OA8A 2VYPA 5FDLA 3WQUA 4U7BA 4WFNL 1JLFA 3C6HA 3TAQA 4B8AB 2YKMA 4M3YA 4JI7K 3CFOA 1NU0A 1QS4A 3GBTA 3T19A 3CERA 3CCEN 4M45A 3CCVN 1VQ4N 3A0IX 2YI1A 2YHYA 3TU5A 3RMDA 3AO1A 1J5EK 1A5WA 1SKWA 4FJMA 2E2PA 2QWPA 4K8XA 4E7HA 5HP1A 1NOYA 2B4JA 1VSHA 3ZETB 1T05A 1TKTA 3K5OA 1HX1A 2Q0UA 4DKWA 4LFCK 3VEVA 4DV4K 5BREA 2GX9A 2P9LA 1HR0K 1E4GT 1TKDA 2Q0RA 4B9TA 1MWKA 3VGLA 1T6CA 1VK0A 1Z05A 1NK6A 4GW6A 3MDQA 4DLEA 2GUIA 4DTUA 2E1ZA 2YHAA 1QZ5A 3AVKA 3SCXA 3P83D 4YOUA 5C12A 5C15A 1NJIO 1LWCA 4PKGA 1YF5L 5AQUA 2KLAA 3IRXA 3DLEA 3GDQA 3OYGA 3M6GA 1BIUA 4DQRA 3DRPA 4W5TA 3BF3A 4M7XA 4EHTA 2GTDA 3A8YA 3NFAA 1Q82O 3LDSA 3J7YP 3LWMA 4B9SA 2IIRA 2WUSA 3CC4N 3QESA 3M8QA 5M1QA 2GBZA 1W97L 3G6EN 4X66K 1XQSC 4F3TA 5AQFA 2D0OA 1RT2A 3F73A 4H5VA 4MDAA 3TTFA 4F2SA 1JLBA 5CR4A 4IOCL 4KREA 1IO2A 3IS9A 1OVYA 5MLCQ 4E3SA 1EWRA 3ENOA 5E84A 1Z25A 4CGJA 4IZ9A 4N41A 3DLRA 1JXBA 3CC7N 5D3GA 2KW4A 2QWRA 4UY8O 3TWHA 3ZSRA 1CZ9A 2Q36A 1YJNN 1JJ2M 4B1WB 5BN9A 1IKWA 4CK3A 1H1VA 4WYBA 4BRLA 3S3MA 2IVNA 3HPHA 3A2FA 4B08A 3NH0A 4DQIA 3SUQA 1KSPA 3LM9A 1UOCA 3O9QA 3VTIA 3DWLA 4MDBA 3VENA 2AJQA 3AVGA 3AA2A 1HYVA 3WQTA 1M1KO 3HPGA 1S6QA 4CE9A 4CJ7A 4I7FA 4KHQA 2FSNA 3E1YA 1JLGA 3D2FB 5AQOA 3MEGA 1IH7A 1Q7YO 1TVRA 2F8SA 3DAWA 3SLCA 4JI1K 4ISEA 1KTQA 5CY4A 1SL1A 3CI5A 4YOXA 1QVGM 4CGFA 1FKOA 4Z0UA 2CGJA 1RDBA 5AJ3K 3ATVA 3NMUA 1QQNA 3V6DA 4BR5A 3RMAA 1KRPA 3H3OB 3V9XA 4CZKA 3U6FA 2JWKA 2QEXN 4FJKA 2FBTA 1D8YA 3QB0A 3CPWM 2NRTA 3LL3A 1NJWA 4FO0A 3NH2A 1YUWA 1NJXA 1U2VB 3K5NA 4FJ8A 3IDHA 4MLHA 4CJVA 1G15A 4BG9A 3NAEA 1HYZA 3WXIA 3OTOK 3O4NA 3PY8A 1RDDA 1RTDA 3MMVA 4YOVA 2F9TA 1WSEA 1XMOK 1TYQB 2KFNA 3CCSN 5LL6Z 4L3QA 3FFIA 2F4VK 4M3TA 4FLUA 1Q86O 4OGEA 1S5JA 1CXUA 3NDKA 3CHWA 4C1NK 4H5RA 4F8RA 2QWOA 5LJVA 1S9EA 4ZHRA 4M3RA 2O8DB 4QOZB 3CXCM 5M1PA 4AHCA 3SUOA 4IG3A 2DPNA 4B9UA 3AA5X 1MA9B 2EHGA 5GAHP 5ADXH 3ASMA 1IKVA 1Z6RA 4A5AA 3EEQA 3KD1E 4KFBA 1HKBA 4DR3K 3K59A 3MXIA 1RTIA 3PLAA 4J2BA 2F9WA 1DLOA 1X3NA 2P5OA 5LMUK 4IEEA 3VOVA 3QIOA 3O6WA 4BR2A 4MO4A 4EP4A 3R6MA 4PKIA 3ZSYA 1NNEA 5AQVA 3AVJA 4CF9A 2IC3A 4DSKA 1W7AA 4ILGB 1HNZK 5I3UA 2G8FA 3U3YA 3ID8A 1IV0A 4E7JA 4BVOA 3PO4A 4B3SK 3H46O 3EE8A 3FE1A 4KHUA 4DB3A 4FWRA 4JAXA 2HNZA 4I9QA 4EIAA 3QO9A 3GL1A 1RT3A 3SK3A 1WSIA 3D2FA 3H1QA 1VAZA 1A5VA 4C1NI 3VQQA 4CJFA 4JS4A 4N56A 1QVFM 4CJUA 1EWQA 5SWMA 1B9FA 1U49A 3P4IA 3NF9A 3I8DA 4FVUA 1QTMA 3U9DA 5AQXA 2B5JA 5M1KA 2WOMA 4OPKA 3AY9A 1NGEA 1RT1A 5J2PA 3JXUA 1XC9A 3AARA 4WE1A 4EHUA 3MXMA 4CZIA 4NYFA 1NM1A 2KHOA 2Z1JA 5AFUA 4H4MA 2YJEA 4G1QA 3J8AA 3OYDA 2Z1HA 4JKAA 5EU7A 1WLJA 2QM1A 2DFHA 4DTNA 2OTLN 4C8MA 4ELTA 2HMIA 3RMBA 2KZZA 1HQUA 1ZBSA 2XY7A 2X6NA 4CF0A 1KQSM 3AVFA 3NVMA 3NGYA 4DSLA 1RBSA 2I7NA 1NKCA 3F5TA 4ILHA 3HSCA 3E66A 5TKWA 2QWLA 1C0TA 4WQ4A 1ATRA 3KHYA 1MU2A 1N6QA 1RDAA 4B3MK 3DXKA 1D9DA 3KLHA 1D5AA 3Q7CA 1HKCA 1ZBUA 4O55A 4G9ZA 3C94A 2HW3A 3L3VA 1VQPN 4CCHA 3H08A 4MLEA 2KTQA 2YNGA 4CEZA 4FWNA 3DOKA 1RDUA 3OBYA 3ZX3A 2O4GA 2G8VA 3DLKA 1J6ZA 4AHSA 1HUXA 3M8RA 4FWQA 3RRGA 4CERA 3VA3A 1TL1A 4ELVA 4KI4A 1XUPO 4BRDA 1OH8A 2QXFA 4E1JA 4FM2A 4IO9L 5KPZA 3ISNC 4KHPK 3TABA 1JXEA 3KIOA 4NO7A 1C0GA 5C24A 3BEXA 5IWAK 3THXB 3VA0A 2G8WA 4A57A 4IFVA 1KXPA 3P38A 3OYCA 4I2PA 2BDPA 2IGIA 2P5GA 3OW2M 3CFPA 1HNWK 4C8NA 3LP3A 5HL7L 3AVNA 4CJ4A 1S22A 2X74A 2E6LA 4BR4A 1RBVA 1L3UA 3HJFA 3O3HA 2UXDK 3ENHA 5ELZA 3C6UA 3THYA 1RT7A 3AAPA 4JD2A 3OS0A 3VESA 4YHHK 3MX5A 3IKMA 2XY6A 2P9IA 3E9PA 5AQHA 4F4KA 1QSSA 3DMJA 5E41A 3L2QA 4BE0A 3NVKA 4LSNA 3O08A 4M7YA 3ZYYX 1TKZA 3D7EO 4JI4K 3LZIA 2E2NA 2WC9A 3H6EA 4JRQA 3HOTA 1WNSA 2EWSA 1RDWX 3O9SA 3HXMA 2HMPA 5SZTA 2YNHA 5KGXA 5K14A 2V7ZA 4DSEA 1SV5A 1JLQA 5BRFA 3SPYA 4QS7A 3BY5A 1BL3A 3VQ4A 4BGAA 5JMVA 1U6ZA 3B6OA 4KPYA 3HO1A 5DM6L 2NUBA 2ATQA 3PSFA 4Z4IA 5IT9O 1LAVA 3SQ1A 1TK5A 4HUEA 2DY4A 3HBTA 4JKEA 5JLFA 4RW8A 3E01A 1OH7A 1RBUA 3VQ5A 3VMFB 2YX6A 1KVAA 4KKOA 4FOIA 2FSJA 3N4QA 1A5XA 1I3AA 1Y64A 4AQYK 4M3WA 2BUPA 4DU1A 3OS1A 1GLEG 4WCEL 1JCEA 4DR4K 3AVMA 3KJVA 4ICLA 3SZ2A 4J2DA 4CJSA 3VQEA 4XIUA 3WNFA 2P9LB 3SAGA 3CM5A 1TL3A 2HVIA 3C7NB 5KPTA 3QERA 2ETJA 3VERA 3HP9A 3VF2A 4KTQA 4B9VA 3UKUA 1BISA 2VG6A 4MO5A 3CQ8A 4FW2A 5E26A 3HK2A 4RTFD 4IFEA 3THXA 1BI4A 4W5NA 4I6MA 3FLCO 4CHZA 3LDNA 4DLGA 4N76A 1QSYA 3G0ZA 4ID1A 4CEBA 4C23A 4FJ9A 1ESVA 4DMNA 2A41A 3DYAA 2YCHA 5AQQA 3CQYA 4CZFA 3ZSWA 3SAFA 1BWFO 1VHXA 3CM6A 3CJ1A 4FM1A 2A1RA 2V51B 4DQPA 5B8HA 2YKNA 1XC3A 3MEEA 1YAGA 3OA9A 4DTPA 3QICA 3WXKA 2W41A 3V9SA 4NCAA 2QKBA 3CYMA 3G25A 1GOAA 1RTHA 3LAKA 3CCLN 1RT6A 3K2PA 4CECA 4FJHA 1DGKN 3K0SA 4Q0BA 2IDOA 4WFBL 5T7BA 3O4QA 3VEXA 1P8ZA 3PV8A 4RCHA 4HHTA 3HZ6A 1BOTO 3DLBA 4QCLA 3EL2A 3QEPA 4XH5A 3NE6A 1N5YA 1CZBA 4CZEA 3TAEA 1J54A 3PIPL 4CJPA 3OVNA 3HYFA 3SMSA 4QS9A 3HRGA 5BPMA 3KK1A 2I5JA 1HJOA 3SV4A 3H3NO 1UA0A 3D45A 3U8XA 3Q7BA 4XH4A 3UKRA 1N8RO 4JKGA 4OLAA 3K9KA 3V81A 3D0PA 4BGBA 1IBLK 4CIEA 2XRIA 1SL0A 3TAMA 1EQYA 1RBTA 1VQON 3KK3A 1JLCA 2NRRA 2D1KA 5AZJB 5C2FA 3KK2A 5LY3A 4LF9K 3ULDA 2NRHA 3FFKB 4E19A 3AO2A 3DRRA 3QFPA 4A2AA 5JICA 1TUYA 4NLBA 2O8BA 4CZMA 3C7NA 4CFAA 1VQ7N 3ZX2A 1XNQK 3CD6N 2Q2RA 3E9LA 5KPRA 3J7ZO 1TKXA 3CMEN 4J2AA 1E3MA 1NGFA 2HHTA 5AFUH 2IOCA 5JVHL 5A2QO 1Q9XA 2G8IA 2ASPA 3DM2A 2PAVA 1WAFA 4PQUA 3M8SA 2OPPA 4BRNA 4FXDA 4LSLA 3VGKA 3HI0A 1ASWA 1YVUA 4HTLA 3W0LA 1TAQA 3C6AA 3T1YK 1XHZA 3K5LA 4JK7A 3L0QA 1WOQA 2NRWA 3OYAA 1NLVA 2NRZA 2YHBA 3HL8A 3GOIA 3LPUA 5JVGL 3PX0A 3UE5A 5F2RA 4JKDA 1UA1A 5HRPA 1VQMN 2KQ2A 1MWMA 4CJKA 4DFPA 2VWKA 5EXWA 1GOBA 4CEEA 1B92A 2FBXA 5DK5A 1TUUA 1SAZA 5J2QA 2HBKA 3CIPA 4WF9L 4PWDA 4CGDA 5KQDA 4E89A 3WNGA 1J9AA 1Y97A 3MN6A 4RG8A 3VQ6A 5FRNA 1N32K 4FJIA 4O0JA 4CFDA 1Z26A 2OPSA 4H4OA 1NK9A 4GV9A 3THVA 2W6LA 4BC5A 3HVTA 5AQJA 4KTZA 4IDKA 3PX6A 2YNFA 4IO8A 4PL8A 2EX3A 2NRVA 1W0HA 3CC2N 3MCAB 3VEZA 2OZMA 2D4WA 4C8LA 3C95A 1KC8O 4JYAK 2HHXA 5FROA 4JI0K 3S9HA 3O1WA 4FW1A 2Y1JA 2E1YA 4RW7A 1J53A 2JGUA 4FJXA 1DTTA 2OCEA 3NBPA 5AQZA 1VQKN 4RW4A 5M1FA 4GVEA 1WSGA 1Q9YA 3T1AA 4B1UB 3CETA 1W9HA 4CI6A 3D2EA 4V19S 4CZLA 3O80A 1BUPA 5AZJA 3W3DA 2NNWA 1BDGA 2E2OA 5CHIA 2ZQBA 1SZ2A 4OLBA 1OH5A 1BQNA 4WFAL 4IWVA 1C0MA 3KKRA 1UWBA 2BGGA 2PBDA 3TSPA 1C1AA 4DR5K 2NRXA 1ZBFA 2D0BA 4DTSA 3KVGA 1CXQA 4AHTA 2XY5A 3SI6A 2FF3B 1NJYA 3O1BA 1L3TA 2QA4N 1Q18A 4DG1A 3EN9A 4LH5A 1HLUA 1WSJA 4OKKA 3T3FA 4M3XA 4CGGA 1V4SA 4IXCA 4HUGA 3BDPA 3WNEA 2RHKA 4L8RB 3WXJA 3A5LC 1TAUA 4H0TB 2BANA 3G4SN 3THWA 4JI2K 3GG4A 5F1XA 4H0VB 2HBMA 4B8CA 1YTUA 4CZHA 3DXKB 3G10A 1FW6A 3JS6A 5BPLA 4FSVA 3TI0A 2OPQA 5KRTA 2HHUA 2FC0A 3HTVA 4BRIA 4R79A 3AA4A 3MX2A 3UB5A 2R7YA 1NK7A 3M8PA 4CESA 1QQMA 5JLHA 2V52B 3CJCA 1S9GA 3SQ0A 3TAFA 1HNIA 3G71N 2RE2A 4PUOA 1P90A 4DR7K 3PUFA 1VQ8N 4CEFA 3ZEUA 3PX4A 1ZYQA 5DMRA 2AP1A 1GLBG 3KLEA 3L4QA 4CK1A 1NKEA 3S3NA 4CW7B 4ISGA 1S1UA 4C8OA 3HM8A 2I7PA 4B9MA 2PY5A 4CHYA 3ENBA 1ILYA 2X78A 2D0CA 4KAZA 4BG8A 3EO3A 1KCFA 3KWIA 3MN9A 3KLFA 3LDPA 4BDZA 3KZBA 4KI6A 1G99A 4OVLA 4JHDA 2UUBK 4JI3K 4K0KK 3SJJA 1OKJA 1K8KA 3D6RA 1LOTB 3O9TA 1BCMA 3THYB 2D5RA 4JD2B 4I9LA 4OJRA 4DTXA 3EKUA 1T7PA 4FJ5A 2P9IB 1LV5A 1ZBHA 4BRMA 2YHWA 5AQNA 4Y0WA 4FZZA 1KVBA 4AHUA 3VF4A 3VQPA 4CGIA 4CIGA 2XHBA 1GLLO 4GKJK 3KWGA 4O8KA 4UQGA 1LWFA 1WBBA 3VQDA 4Z4CA 1S72N 3LP2A 1TK8A 1JKHA 4PA1A 4XEIA 5AQRA 2HNDA 4H0PA 3K5MA 4A62A 4KH5A 3HVRA 3QEIA 4DTRA 2HOEA 1ITGA 5AQPA 1T6DA 3RVCA 2D0PA 1IJJA 3L2VA 3M3ZA 1SQKA 1YJ9N 5JS2A 4NYNA 2BTFA 4FK0A 3O9UA 3SJHA 2ZWHA 4OO1J 4DSJA 3P39A 3KD5E 3HP6A 4K25A 3ITHA 2HF4A 4LH4A 2YNIA 1HPMA 3ULEA 2Y1IA 5I9EB 1Q81O 4LY7A 2DFEA 4BE1A 3ATUA 1VQ5N 2IAJA 3PSIA 3KK7A 4FPAA 4FJ7A 4M42A 4B3OA 1SKRA 3QNNA 5AQGA 1L5UA 2FSKA 4DSFA 1XHXA 1X3MA 3I56N 5EOYA 2YHXA 2A6AA 4AHVA 5FPMA 3AV9A 4BR7A 4WQ4C 3TSUA 3LZJA 1SKSA 3I55N 3ALYA 4E0DA 4K8ZA 3VEYA 5AQMA 4PY5A 3LP1A 5HROA 4OX9K 3T7ZA 4FLWA 2ZGYA 2E4LA 1ATNA 1NGJA 4J8FA 1S1WA 4FZYA
chains in the Genus database with same CATH topology
1W97L 3G6EN 1XQSC 3LDNA 3O8MA 3MWPA 5AQIA 5AQFA 1ZXOA 4FWOA 3UKUB 4BREA 2D0OA 1YHQN 4H5VA 4MDAA 3TTFA 2OTJN 3F9MA 1W2BM 2FF6A 4I6MB 4C23A 5CR4A 1ESVA 4QS8A 4IOCL 2A41A 1M90O 1OVYA 2YCHA 4CZGA 5AQQA 3CQYA 4CZFA 3SAFA 1BWFO 5MLCQ 4DCHA 3CJ1A 4U67L 3QBWA 3ENOA 5E84A 4IZ9A 3WUHA 4PHTX 3CC7N 2V51B 2QWRA 4UY8O 5B8HA 2Q36A 1YJNN 1XC3A 3FZMA 4BRKA 1YAGA 1JJ2M 3OA9A 3QICA 4B1WB 5BN9A 3WXKA 2W41A 1H1VA 1VQ9N 3G25A 4WYBA 4BRLA 1WUAA 2IVNA 4ISFA 3CCLN 2A5XA 1DGKN 2WBNA 4OPHA 4IJAA 3LDLA 2E2QA 4A61A 4WFBL 3P31A 3VEXA 1P8ZA 3SMPA 3EKSA 1HKGA 4GV6A 4RCHA 3HZ6A 3LM9A 1BOTO 1GLFO 3O9QA 5AQSA 3VTIA 5H1SQ 3DWLA 1D4XA 4MDBA 1YIJN 3EL2A 4A59A 2P9UB 4BR0A 3VENA 4BQLA 4XH5A 3AGRA 1VQNN 3WQTA 1M1KO 4K43A 2CH6A 4CZEA 3PIPL 4CJ7A 1K9MO 3SMSA 2FSNA 2ASOA 3E1YA 4QS9A 3HRGA 3M5RA 5EX5A 3VEWA 5BPMA 3D2FB 5AQOA 3CF5L 1KD1O 1HJOA 5C2DA 3H3NO 4BC2A 3U8XA 3Q7BA 4XH4A 3UKRA 1Q7YO 4FPBA 1N8RO 5C0YA 3FZKA 5AZIA 5AQWA 4BRGA 4JKGA 4F9OA 3DAWA 3SLCA 4AM6A 3K9KA 4ISEA 3CCRN 5GIPA 5BRHA 4BGBA 3M1FA 3CI5A 3UKRB 5GIOA 4YOXA 1QVGM 2V7YA 4YORA 5AZIB 1EQYA 2ZGZA 2P9KA 4JKGB 1VQON 2CGJA 3WT0A 2NRRA 2D1KA 5AZJB 3RSEA 3ATVA 3QMLA 3R3LA 4AM7A 1QQNA 5C2FA 5LY3A 3NMUA 5AQYA 4BR5A 3VTHA 2NRHA 3FFKB 4WQ5A 3H3OB 1U2VA 2E8AA 3CJ7A 3QFPA 4A2AA 2P9KB 4CZKA 3CJAA 4DHYA 5JICA 3EE9A 1TUYA 5M1OA 4NLBA 4A5BA 2JWKA 3C7NA 4CZMA 2QEXN 3RSEB 5GINA 1VQ7N 3ZX2A 3QB0A 3CPWM 3A5NC 2NRTA 2Q2RA 3E9LA 3H1VX 3LL3A 3N4PA 3CD6N 4FO0A 2P9NA 1YUWA 3MWTA 5KPRA 3J7ZO 5TKYA 3OBWA 1U2VB 3CMEN 1TYQA 4BRQA 1NGFA 3WEEA 5C10A 3IDHA 4MLHA 1DT9A 3LDOA 5AFUH 3TTDA 2CGKA 4B1YB 4CD1A 4BG9A 5JVHL 2P9PA 1V4TA 3WXIA 1EO1A 2ASPA 2PAVA 1T3VA 4H0XB 2P9NB 3MMVA 3LDQA 4WQ5C 1ZC6A 2F9TA 3AGKA 4BRNA 4YOVA 2ZJRL 1TYQB 3WEEB 2IVPA 5FPEA 3VGKA 3HI0A 4JKFA 3CCSN 4HTLA 4L3QA 3W0LA 2P9PB 4H5WA 1BU6O 3GE1A 3C6AA 4BRAA 3T69A 3B8AX 3CCQN 2E20A 4JK7A 3L0QA 1WOQA 1Q86O 1KAXA 3EZWA 5M1NA 2NRWA 3MK6A 4BY9C 3CHWA 3F2KA 4H5RA 3QBXA 4C1NK 1NLVA 2NRZA 2QWOA 4Z94A 3GOIA 5LJVA 5JVGL 4BRPA 4CZJA 5M1PA 3CXCM 3UE5A 2DPNA 5F2RA 4JKDA 1VQMN 4IJNA 1MA9B 5GAHP 5ADXH 4FOEA 1MWMA 1Z6RA 3DXMA 1NGHA 5EXWA 4A5AA 3VETA 3DLLL 1HKBA 5GAGP 4JK9A 1JCGA 1TUUA 3PLAA 3L6QA 1YXQA 3IUCA 1SAZA 2F9WA 1YVNA 1X3NA 4JN4A 2HBKA 3CIPA 4WF9L 3DXMB 3FZFA 4IEEA 3O6WA 3VOVA 4MO4A 4BR2A 5KQDA 4EAHD 3R6MA 4PKIA 1NGIA 2GWJA 5AQVA 3MN6A 4H0OA 4JNEA 3IFRA 1NGDA 3CMAN 4JKBA 4B1ZA 5BN8A 4ILGB 3CJBA 3BP8A 4GV9A 4BC5A 5AQJA 3O5BA 3ID8A 2P9UA 3OHRA 4IO8A 4PL8A 3BUZB 3K9JA 5EY4A 4BROA 2NRVA 4BVOA 3CC2N 5LJWA 3H46O 3EE8A 4BRFA 3MCAB 3FE1A 3VEZA 3C65A 2D4WA 3LM2A 2GEMA 3MN7A 4DB3A 4FWRA 4JAXA 2ZF5O 4GY2B 1KC8O 4EIAA 2AA4A 3GL1A 3R9PA 3SAHA 3SK3A 3D2FA 3O1WA 3H1QA 1VAZA 2E1YA 1SS6A 4YDUA 4C1NI 2CH5A 1VQ6N 2F7TA 4EFHA 5AQZA 3IMXA 1YI2N 1QVFM 2VGMA 1VQKN 4YOWA 2Q31A 5M1FA 3O9RA 4GVEA 2OANA 3BF1A 4B1UB 3CETA 3P4IA 4H0YB 1YITN 2ITMA 4FVUA 3U9DA 4CI6A 4DQ8A 2KKZA 5AQXA 5AQLA 3A5MC 5M1KA 3D2EA 1E4FT 3AY9A 1NGEA 3O80A 4CZLA 1BUPA 3E9OA 5CE3A 3JXUA 3AARA 1QQOA 2NLXA 5AZJA 4PL7A 2UYTA 4EHUA 3W3DA 4CZIA 2NNWA 1T44A 1NM1A 2W40A 1BDGA 2E2OA 3D2EB 2KHOA 3H45C 4YDUC 5AQTA 5KQ8A 5CHIA 3CCJN 5AFUA 1SZ2A 2YJEA 3J8AA 1GLCG 2HSTA 4WFAL 4IWVA 4JKAA 1NGAA 2QM1A 3FZHA 1LCUA 2OTLN 1K73O 4OPAA 2PBDA 3TSPA 1NBWA 2NRXA 2QTDA 4XH1A 1ZBSA 4ILJA 4NLCA 3CJ9A 5FPNA 4K42A 2E88A 4BRCA 2QI2A 3KVGA 2H3GX 2QWNA 3FGUA 1C0FA 2Q97A 3NVMA 1KQSM 2J4RA 2I7NA 3R1XA 4PKHA 5BRDA 4IOAL 1DEJA 3CQXA 1GLDG 3F5TA 4YOTA 4ILHA 1NGGA 3HSCA 3E66A 5TKWA 2FF3B 3FZLA 2YJFA 2QWLA 4WQ4A 3AAQA 1ATRA 3O1BA 2QA4N 1Q18A 5EVZA 4LC9B 1JCFA 2HBLA 3KHYA 4JKHA 5ADXA 3EN9A 1HLUA 4M63C 3VGMA 3DXKA 4BVPA 3VPZA 1V4SA 4IXCA 3Q7CA 1MDUB 2RHKA 1HKCA 4IOXA 4G9ZA 3WXJA 3A5LC 4H0TB 3G4SN 4CBWA 5F0XA 3GG4A 5F1XA 3FR0A 4O5FA 1VQPN 1GLAG 2HBJA 1O13A 2HBMA 4H0VB 3MCPA 4CZHA 5GAEP 3DXKB 4MLEA 3JS6A 1X9JA 4FWMA 5BPLA 4FSVA 4FWNA 3CPEA 1GLJO 1RDUA 3OBYA 3ZX3A 4YOYA 3VEOA 3WXLA 2P9SB 3HTVA 4BRIA 4H5TA 4R79A 3CCMN 2GWKA 1J6ZA 1HUXA 3MX2A 3SBTA 3UB5A 1IG8A 4FWQA 2ZJPL 3C0BA 4CBXA 1QQMA 5JLHA 2V52B 3CJCA 1XUPO 2A42A 1RGIA 4K41A 4BRDA 5BPNA 3G71N 1NMDA 4E1JA 4FWKA 4GNIA 4B9QA 2RE2A 4FWPA 3O4WA 1P90A 4IO9L 1VQ8N 5KPZA 3ZEUA 3MN5A 3TPQA 3ZX0A 3TTCA 3I33A 2AP1A 2ASMA 2VGNA 1GLBG 4FL9A 4NO7A 3L4QA 1C0GA 4FWLA 2IVOA 3BEXA 5FPDA 4ISGA 2Q1NA 4A57A 1KXPA 5GADP 3P38A 3ZEUB 3QFUA 3CCUN 3HM8A 2I7PA 4NB4A 4BRHA 3L4IA 4RWTA 3OW2M 3PIOL 4KH6A 5HL7L 1S3XA 4HWIA 4IEIA 3DJCA 1S22A 3ENBA 1ILYA 4BR4A 4JK8A 4KH4A 4BG8A 3EO3A 4AF1A 3ENHA 5ELZA 3KWIA 3MN9A 1K8AO 4JEPA 4GV3A 3AAPA 3LDPA 4JD2A 4BC4A 3VESA 3MX5A 3IKMA 3KZBA 2P9IA 3E9PA 2CGLA 1G99A 5AQHA 4JHDA 1OKJA 1K8KA 3D6RA 3NVKA 1BA1A 1QHAA 3O08A 3QDKA 4M7YA 3D7EO 3ZYYX 1LOTB 1BO5O 2E2NA 3O9TA 1BA0A 2WC9A 5HOOA 3H6EA 1KAYA 4JD2B 2VYPA 3HOSA 3EKUA 3VF6A 3HOTA 2P9IB 2VCPA 2EWSA 1RDWX 3O9SA 2YHWA 1NGCA 4JHDB 5AQNA 4Y0WA 3WQUA 4BRMA 4U7BA 1K8KB 2HMPA 4WFNL 2FXUA 3C6HA 2V7ZA 2VWBA 4H03B 3VF4A 3GBTA 1GLLO 2GUPA 3KWGA 4H5NA 4O8KA 1KAZA 3CERA 5BRFA 3CCEN 4QS7A 1S72N 3CCVN 2QW9A 1VQ4N 3A0IX 4BQZA 4BGAA 5JMVA 4XEIA 5AQRA 2YI1A 1U6ZA 2YHYA 3TU5A 4H0PA 4A62A 5DM7L 2QWQA 1BG3A 4KH5A 3U4LA 3ZETA 3WXMB 5DM6L 2HOEA 2WFBA 3R8EA 5AQPA 1T6DA 3RVCA 4O8UA 2D0PA 1IJJA 2E2PA 1DKGD 1CZAN 3M3ZA 2QWPA 1SQKA 2QWMA 1YJ9N 3I8BA 3ZETB 3HBTA 4JKCA 4JKEA 4BR9A 5JLFA 2BTFA 3A5OC 1HX1A 3O9UA 2Q0UA 3SJHA 5BR9A 2ZWHA 4OO1J 3VMFB 4DKWA 2YX6A 5AR0A 3P39A 4FOIA 2FSJA 3VEVA 3N4QA 5BREA 4B1VA 1VQLN 2GX9A 1Y64A 4K25A 2P9LA 2BUPA 1E4GT 2BH1A 4IDHA 2HF4A 2HF3A 3U9ZA 1GLEG 1HPMA 1JCEA 1MWKA 2Q0RA 3ULEA 3VGLA 4WCEL 4B1XB 5I9EB 1Q81O 1VQ5N 1T6CA 3ATUA 1YJWN 1Z05A 2A3ZA 3KK7A 4FPAA 4KBOA 2P9SA 1ATSA 3ID6A 5AQGA 3MDQA 2FSKA 2P9LB 3SAGA 2JWLA 4FWSA 2E1ZA 4A2BA 3S41A 1X3MA 3I56N 2NZTA 2A40A 2QXLA 5EOYA 2YHXA 2A6AA 3ULEB 1QZ5A 3C7NB 5FPMA 1NGBA 4YOUA 4CD3A 5C12A 2ZJQL 5C15A 1NJIO 5KPTA 4BR7A 1NWKA 1YF5L 4PKGA 2KLAA 4WQ4C 5AQUA 3SBGA 3TSUA 3I55N 3GDQA 3VERA 3M6GA 3VF2A 2FLOA 3VEYA 3BF3A 5AQMA 4M7XA 1RFQA 2GTDA 4EHTA 3UKUA 4MO5A 3A8YA 3T7ZA 5E26A 1Q82O 4BC3A 2ZGYA 4RTFD 1QZ6A 5AQKA 4CBUA 2GELA 2IIRA 2PFUA 2WUSA 4IFEA 1ATNA 3TSQA 1NGJA 4J8FA 3CC4N 4I6MA 3FLCO 1R59O 5M1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KWI A;  3F5T A;  3L4Q A;  3OA9 A;  3O9U A;  3KWG A;  3P39 A;  3M5R A;  3P38 A;  3D6R A;  2GX9 A;  3O9R A;  3O9T A;  4OPA A;  4OPH A;  2KKZ A;  2RHK A;  3P31 A;  3EE9 A;  3EE8 A;  3RVC A;  3O9S A;  3O9Q A; 
#chains in the Genus database with same CATH topology
 3O8M A;  5AQI A;  1ZXO A;  3UKU B;  4B9L A;  1N36 K;  2OTJ N;  1W2B M;  1BI4 B;  4I6M B;  4DUY K;  2Z1G A;  1IKX A;  4CZG A;  3HT3 A;  4DTJ A;  4JV5 K;  4U67 L;  3QBW A;  3VQC A;  3B6P A;  4FCY A;  3SV3 A;  3WUH A;  2O8C A;  4DF4 A;  3MED A;  3FZM A;  4BRK A;  2G8H A;  4FJL A;  4M3Z A;  4KO0 A;  4DU4 A;  1WUA A;  3JYT A;  4ISF A;  2A5X A;  1FKP A;  2WBN A;  4OPH A;  3UIQ A;  3LDL A;  2E2Q A;  4CJR A;  3SMP A;  1HKG A;  4CJ5 A;  1GLF O;  5AQS A;  4KHY A;  5JS1 A;  4A59 A;  2P9U B;  1HQE A;  1XNR K;  1U4B A;  2VG7 A;  4CF2 A;  1D9F A;  4CFB A;  5EX5 A;  3CF5 L;  3OYF A;  1KD1 O;  4DR2 K;  2HVH A;  5AZI A;  5AQW A;  4BRG A;  4FLV A;  4F9O A;  2UU9 K;  2HHV A;  2D0A A;  5GIP A;  5KRS A;  4FVM A;  2O8E A;  4KTW A;  2FBV A;  3UKR B;  2VG5 A;  5GIO A;  4Z4H A;  1WBD A;  1VSL A;  4YOR A;  3L3U A;  4YNQ A;  2ZGZ A;  2P9K A;  4JKG B;  3OYL A;  1FK9 A;  3RSE A;  4CJL A;  5AQY A;  4WQ5 A;  4N47 A;  4ZTF A;  4Z4F A;  2E8A A;  3CJ7 A;  1S1V A;  3RR8 A;  2QK9 A;  4JS5 A;  2OZS A;  3K57 A;  4A5B A;  2VQE K;  2LSN A;  3KLG A;  3A5N C;  4BDY A;  1VRU A;  4F2R A;  2P9N A;  3MWT A;  5TKY A;  3WEE A;  5C10 A;  1DT9 A;  3AA3 A;  3LDO A;  3TTD A;  2CGK A;  3SQ2 A;  2O8B B;  1GOC A;  2P9P A;  3NGI A;  3VN5 A;  4CJW A;  4JLH A;  3DLH A;  4WQ5 C;  1ZC6 A;  4LF7 K;  1ASU A;  2JLE A;  3T1H K;  1RT5 A;  1EXQ A;  2RN2 A;  1RNH A;  1JL2 A;  3T69 A;  3B8A X;  2E20 A;  3WNH A;  4CK2 A;  5M1N A;  3RR7 A;  4JI6 K;  4CFC A;  4BRP A;  4CZJ A;  4LD0 A;  2HHS A;  1VSI A;  4KHN A;  4DR1 K;  3CFR A;  3LAN A;  4FK4 A;  3J80 O;  3LAM A;  4N5S A;  3DXM A;  3S3O A;  4O4G A;  4W5Q A;  5GAG P;  4OKE A;  5FRM A;  1JCG A;  3NH1 A;  3OJU A;  1YXQ A;  3IUC A;  2E6M A;  1VSM A;  1YVN A;  4X65 K;  1JLA A;  4JNE A;  3CMA N;  4FLX A;  4JKB A;  4H8K A;  1VSF A;  5BN8 A;  3CJB A;  1RIL A;  4AHR A;  5J2M A;  3JSM A;  2P9U A;  3BUZ B;  3K9J A;  4F3O A;  2ZE2 A;  2HHH K;  5LJW A;  4BRF A;  3ZSX A;  3ZT0 A;  3C65 A;  2AA4 A;  5KGW A;  3R9P A;  3SAH A;  3BGR A;  1EX4 A;  4DQS A;  4YDU A;  2P51 A;  4W5O A;  3BZC A;  1FJG K;  3IMX A;  4Z4E A;  4AH9 A;  4FZX C;  2OAN A;  4DWI A;  3TR8 A;  2KKZ A;  3A5M C;  3AVL A;  1E4F T;  1X1P A;  5CE3 A;  3E9O A;  4KRF A;  4BAC A;  1QE1 A;  4KV8 A;  3QEX A;  3ZSZ A;  1LW0 A;  3MXJ A;  1T03 A;  4E1M A;  1C6V A;  3D2E B;  4YDU C;  1L3S A;  4R5P A;  3CCJ N;  4LF6 K;  4CHN A;  4JI5 K;  3I0S A;  3ZT2 A;  2XY8 A;  2G8U A;  1NGA A;  4OGC A;  3V1R A;  3VQ7 A;  1K73 O;  3NF6 A;  4DV5 K;  1NBW A;  4NLC A;  2Q3S A;  3CJ9 A;  2E88 A;  4BRC A;  4J2E A;  1B9D A;  4MFB A;  4Y1C A;  1LWE A;  4FYD A;  2QWN A;  5J1E A;  2J4R A;  4HTU A;  4FJG A;  4PKH A;  5BRD A;  1XI1 A;  3CQX A;  3OS2 A;  1QHT A;  4YOT A;  4CVN E;  2B6A A;  3V1Q A;  1WSF A;  3AAQ A;  1R0A A;  5EVZ A;  4LC9 B;  2HBL A;  4JKH A;  3RTV A;  1YTA A;  4M63 C;  3CG7 A;  1MDU B;  3VQ8 A;  1U45 A;  4IOX A;  1WN7 A;  5F0X A;  2ZM6 K;  3FR0 A;  3AO4 A;  4Y1D A;  4I2Q A;  1GLA G;  1O13 A;  1NK4 A;  5GAE P;  1ZBL A;  4RW9 A;  4IKF A;  1N33 K;  2O8F A;  2UUA K;  2W42 A;  3THW B;  3WXL A;  2P9S B;  1NKB A;  2GWK A;  4O44 A;  3SBT A;  2UUC K;  1XMQ K;  1IG8 A;  4ID5 A;  4CF8 A;  2A42 A;  4DV1 K;  5BPN A;  1NMD A;  2UXB K;  4FWK A;  4FWP A;  3NF8 A;  1HYS A;  2VWJ A;  3ZLJ A;  3OYJ A;  3IAY A;  4HUF A;  3I33 A;  4FL9 A;  3SNN A;  3ZCM A;  4BWM A;  4M41 A;  4FWL A;  3EZ5 A;  2IVO A;  4BWJ A;  2Q1N A;  1NK0 A;  3KKS A;  5GAD P;  3ZEU B;  3QFU A;  3CCU N;  1LW2 A;  4CIF A;  4RWT A;  3DI6 A;  3PIO L;  4KH6 A;  1S3X A;  2WON A;  4IEI A;  3I0R A;  1KFS A;  1HJR A;  4JK8 A;  3L8B A;  1S1X A;  4JEP A;  3VQB A;  1QQC A;  4EP5 A;  2F8T A;  2CGL A;  5CZ1 A;  1VSJ A;  4Z4G A;  1X9W A;  1LAW A;  2X6S A;  2E5L K;  2ZD1 A;  5HOO A;  1BA0 A;  5C25 A;  1KAY A;  3HOS A;  1BQM A;  3VF6 A;  2VCP A;  4JHD B;  1NGC A;  1HRH A;  3VQA A;  1K8K B;  2FXU A;  3OYK A;  3QEW A;  4DF8 A;  3EYZ A;  2VWB A;  4H03 B;  4CJT A;  3SUP A;  4YFU A;  3AO3 A;  4DQQ A;  1RBR A;  2HNY A;  2GUP A;  4H5N A;  1KAZ A;  4JRP A;  1U04 A;  2QW9 A;  5FLX O;  4BQZ A;  5DM7 L;  2QWQ A;  1BG3 A;  3U4L A;  3ZET A;  3WXM B;  2WFB A;  3R8E A;  2Z1I A;  4GMJ B;  4O8U A;  1DKG D;  1CZA N;  2QWM A;  1NK8 A;  3I8B A;  2G8K A;  4JKC A;  4BR9 A;  3A5O C;  2RKI A;  5BR9 A;  2PYJ A;  5AR0 A;  4NXM K;  4CED A;  1FXX A;  4B1V A;  1VQL N;  3QIP A;  2BH1 A;  4IDH A;  2HF3 A;  1X9S A;  3U9Z A;  1C1B A;  4B1X B;  1BIZ A;  3AVC A;  1YJW N;  2A3Z A;  3AVI A;  1X9M A;  4AIL C;  3RMC A;  4KBO A;  2P9S A;  1ATS A;  3ID6 A;  3L2R A;  1SUQ A;  5LMN K;  2JWL A;  4FWS A;  4A2B A;  2HB5 A;  4DUZ K;  1VSE A;  3S41 A;  4OKJ A;  3ULE B;  2NZT A;  1Q8I A;  1BGX T;  2A40 A;  2QXL A;  1S1T A;  1NGB A;  4CD3 A;  5HRS A;  2ZJQ L;  1NWK A;  3AVA A;  3SBG A;  3KTQ A;  4CEA A;  1VRT A;  1T8E A;  1K6Y A;  5C42 A;  2FLO A;  1RFQ A;  2A1S A;  4BE2 A;  2KFZ A;  4BC3 A;  1QZ6 A;  5AQK A;  4CBU A;  2GEL A;  2PFU A;  2DTU A;  3TSQ A;  1R59 O;  2IS3 A;  4O5B A;  3ZT3 A;  3MWP A;  4BRE A;  4FWO A;  3NHG A;  1YHQ N;  1L3V A;  3F9M A;  2FF6 A;  1IG9 A;  1EP4 A;  4QS8 A;  5KI6 A;  1CLQ A;  1M90 O;  4E1N A;  4IBN A;  4DCH A;  2OYQ A;  3L2W A;  3AO5 A;  3HST B;  4Q5V A;  1JLE A;  4PHT X;  4HCB A;  4QAG A;  3SPZ A;  3OYN A;  5HRN A;  3ZSO A;  2PYL A;  1VQ9 N;  4CF1 A;  2O8C B;  3OYB A;  3LPT A;  4IJA A;  4A61 A;  1IBK K;  1ASV A;  3P31 A;  4FM0 A;  3EKS A;  4GV6 A;  4IG0 A;  2VQF K;  3AVB A;  4GKK K;  5H1S Q;  1YIJ N;  1D4X A;  4HVJ A;  3V9U A;  4BR0 A;  4BQL A;  1OVQ A;  1UAX A;  3AGR A;  1WAJ A;  1VQN N;  4K43 A;  3V9Z A;  2CH6 A;  3RRH A;  4HCC A;  3DRS A;  1K9M O;  3J81 O;  3NCI A;  2ASO A;  1C0U A;  3M5R A;  3EY1 A;  3VEW A;  3SYZ A;  5C2D A;  4BC2 A;  1WSH A;  4FPB A;  5C0Y A;  1OH6 A;  3FZK A;  5KTQ A;  1HNV A;  3OYM A;  3DOL A;  4AM6 A;  3CCR N;  5BRH A;  4B9N A;  3QEV A;  4FK2 A;  2OPR A;  3SQ4 A;  4ELU A;  3M1F A;  4FLZ A;  2V7Y A;  1TGO A;  5AZI B;  1RCH A;  3WT0 A;  4B3R K;  3O3G A;  3QML A;  3R3L A;  3MAQ A;  4AM7 A;  4LF8 K;  2O8E B;  1KFD A;  3VTH A;  4CHQ A;  1U2V A;  4DHY A;  4C8K A;  2P9K B;  3CJA A;  4NCG A;  3EE9 A;  4DU3 A;  5M1O A;  4DTO A;  4CJE A;  3RSE B;  5GIN A;  3DLG A;  3H1V X;  3F9K A;  3N4P A;  4LFA K;  3KLI A;  3OBW A;  1S6P A;  4OPJ A;  1TYQ A;  4BRQ A;  4DV3 K;  4B1Y B;  4CD1 A;  4KB0 A;  1V4T A;  1EO1 A;  1TK0 A;  1T3V A;  4KHW A;  4H0X B;  2P9N B;  3J7A P;  4DV7 K;  4DTM A;  3LDQ A;  3AGK A;  4DV2 K;  2ZJR L;  3WEE B;  2IVP A;  5FPE A;  4JKF A;  2O8D A;  1O1W A;  1J5O A;  2ITG A;  4M3U A;  2P9P B;  4H5W A;  1BU6 O;  3GE1 A;  4BRA A;  4CEQ A;  3CCQ N;  4LFB K;  1KAX A;  3EZW A;  4BY9 C;  3MK6 A;  3V1O A;  3F2K A;  3QBX A;  4Z94 A;  4X64 K;  1BCO A;  3PO5 A;  1EKE A;  4FLY A;  3OYI A;  4CJ3 A;  4IJN A;  5I42 A;  4FOE A;  1KVC A;  1REV A;  1NGH A;  4CGH A;  3LAL A;  2UXC K;  1KLN A;  4DV0 K;  3P1G A;  3VET A;  3DLL L;  3C6T A;  3BZK A;  2FBY A;  3AVH A;  4JK9 A;  3JAM O;  3OJS A;  3L6Q A;  1U48 A;  4JN4 A;  3NF7 A;  3DXM B;  3FZF A;  4EAH D;  1NGI A;  2GWJ A;  4DS4 A;  4H0O A;  3IFR A;  1NGD A;  4CHO A;  2KZM A;  4CEO A;  2RPI A;  4B1Z A;  3BP8 A;  1NMN A;  4YY3 K;  3O5B A;  2O4I A;  4DS5 A;  4DFM A;  3L2U A;  3OHR A;  3LP0 A;  5EY4 A;  4BRO A;  4RW6 A;  5BR8 K;  1YT3 A;  1RT4 A;  3ZSQ A;  1KLM A;  3LM2 A;  3MN7 A;  2GEM A;  3OY9 A;  2PZS A;  2ZF5 O;  4GY2 B;  1RTJ A;  2DFF A;  5HRR A;  3ZT4 A;  3HPO A;  4NXN K;  4W5R A;  1SS6 A;  2WTU A;  3SUN A;  2CH5 A;  4X62 K;  1ZBI A;  1VQ6 N;  2F7T A;  4EFH A;  3NGZ A;  1VSD A;  1YI2 N;  2VGM A;  3QNO A;  1HNX K;  3TAP A;  4YOW A;  2Q31 A;  3O9R A;  4NCB A;  3BF1 A;  1NG9 A;  4H0Y B;  3U3G A;  1YIT N;  4KB1 A;  2ITM A;  4DQ8 A;  3IG1 A;  5AQL A;  2YV0 X;  1IKY A;  1QQO A;  1WB9 A;  2NLX A;  4PL7 A;  4IFY A;  2UYT A;  3V4I A;  2XO7 A;  1T44 A;  2W40 A;  3H45 C;  5AQT A;  5KQ8 A;  1I94 K;  3P5J A;  3RWU A;  1GLC G;  1DTQ A;  2HST A;  1HPZ A;  1LCU A;  3FZH A;  1XWL A;  3VQ9 A;  2W6K A;  3HM9 A;  4OPA A;  1NK5 A;  1IBM K;  4CHP A;  2QTD A;  3MEC A;  4XH1 A;  1SL2 A;  4LF5 K;  4ILJ A;  4KHS A;  5FPN A;  4K42 A;  2QI2 A;  5CYM A;  3V9W A;  2H3G X;  3FGU A;  1C0F A;  2Q97 A;  3OYH A;  1NOZ A;  3R1X A;  4IOA L;  1DEJ A;  1I39 A;  1GLD G;  1NGG A;  4E7L A;  4DV6 K;  3FZL A;  2YJF A;  1TV6 A;  1JCF A;  5ADX A;  4EZ9 A;  3VGM A;  3ZT1 A;  2RF2 A;  4BVP A;  3VPZ A;  4MQ3 A;  3QLH A;  4CBW A;  4TSX A;  3OYE A;  4O5F A;  1C1C A;  2HBJ A;  4LF4 K;  3MCP A;  4FWM A;  1X9J A;  2HHQ A;  4FJN A;  1JL1 A;  3CPE A;  4E7I A;  4O0I A;  1GLJ O;  4YOY A;  3VEO A;  4DFK A;  3CCM N;  4H5T A;  3QIN A;  3C0B A;  5HBM A;  4CBX A;  2ZJP L;  3LWL A;  2O8F B;  4GVM A;  1RGI A;  4K41 A;  1N34 K;  4GNI A;  1HMV A;  4B9Q A;  3O4W A;  2BE2 A;  5J2N A;  3MN5 A;  5CYQ A;  1VSK A;  3TPQ A;  4FLT A;  3ZX0 A;  3TTC A;  2ASM A;  2VGN A;  1EET A;  3TAN A;  4BDP A;  4JI8 K;  3TAR A;  1F21 A;  4E7K A;  3ZSV A;  5FPD A;  2GV9 A;  4FJJ A;  2HHW A;  2P1J A;  4DFJ A;  4DR6 K;  2F96 A;  4NB4 A;  3L4I A;  4BRH A;  1BHL A;  4HWI A;  3DJC A;  3TAG A;  2QKK A;  4ZTJ A;  1QSL A;  1RDC A;  4KH4 A;  5CZ2 A;  3QET A;  5HLF A;  3K58 A;  4AF1 A;  4DSI A;  1K8A O;  4GV3 A;  4EZ6 A;  4BC4 A;  3O3F A;  4B3T K;  1NJZ A;  1U47 A;  4CJQ A;  1BA1 A;  1QHA A;  3QDK A;  1BO5 O;  2OA8 A;  2VYP A;  5FDL A;  3WQU A;  4U7B A;  4WFN L;  1JLF A;  3C6H A;  3TAQ A;  4B8A B;  2YKM A;  4M3Y A;  4JI7 K;  3CFO A;  1NU0 A;  1QS4 A;  3GBT A;  3T19 A;  3CER A;  3CCE N;  4M45 A;  3CCV N;  1VQ4 N;  3A0I X;  2YI1 A;  2YHY A;  3TU5 A;  3RMD A;  3AO1 A;  1J5E K;  1A5W A;  1SKW A;  4FJM A;  2E2P A;  2QWP A;  4K8X A;  4E7H A;  5HP1 A;  1NOY A;  2B4J A;  1VSH A;  3ZET B;  1T05 A;  1TKT A;  3K5O A;  1HX1 A;  2Q0U A;  4DKW A;  4LFC K;  3VEV A;  4DV4 K;  5BRE A;  2GX9 A;  2P9L A;  1HR0 K;  1E4G T;  1TKD A;  2Q0R A;  4B9T A;  1MWK A;  3VGL A;  1T6C A;  1VK0 A;  1Z05 A;  1NK6 A;  4GW6 A;  3MDQ A;  4DLE A;  2GUI A;  4DTU A;  2E1Z A;  2YHA A;  1QZ5 A;  3AVK A;  3SCX A;  3P83 D;  4YOU A;  5C12 A;  5C15 A;  1NJI O;  1LWC A;  4PKG A;  1YF5 L;  5AQU A;  2KLA A;  3IRX A;  3DLE A;  3GDQ A;  3OYG A;  3M6G A;  1BIU A;  4DQR A;  3DRP A;  4W5T A;  3BF3 A;  4M7X A;  4EHT A;  2GTD A;  3A8Y A;  3NFA A;  1Q82 O;  3LDS A;  3J7Y P;  3LWM A;  4B9S A;  2IIR A;  2WUS A;  3CC4 N;  3QES A;  3M8Q A;  5M1Q A;  2GBZ A;  1W97 L;  3G6E N;  4X66 K;  1XQS C;  4F3T A;  5AQF A;  2D0O A;  1RT2 A;  3F73 A;  4H5V A;  4MDA A;  3TTF A;  4F2S A;  1JLB A;  5CR4 A;  4IOC L;  4KRE A;  1IO2 A;  3IS9 A;  1OVY A;  5MLC Q;  4E3S A;  1EWR A;  3ENO A;  5E84 A;  1Z25 A;  4CGJ A;  4IZ9 A;  4N41 A;  3DLR A;  1JXB A;  3CC7 N;  5D3G A;  2KW4 A;  2QWR A;  4UY8 O;  3TWH A;  3ZSR A;  1CZ9 A;  2Q36 A;  1YJN N;  1JJ2 M;  4B1W B;  5BN9 A;  1IKW A;  4CK3 A;  1H1V A;  4WYB A;  4BRL A;  3S3M A;  2IVN A;  3HPH A;  3A2F A;  4B08 A;  3NH0 A;  4DQI A;  3SUQ A;  1KSP A;  3LM9 A;  1UOC A;  3O9Q A;  3VTI A;  3DWL A;  4MDB A;  3VEN A;  2AJQ A;  3AVG A;  3AA2 A;  1HYV A;  3WQT A;  1M1K O;  3HPG A;  1S6Q A;  4CE9 A;  4CJ7 A;  4I7F A;  4KHQ A;  2FSN A;  3E1Y A;  1JLG A;  3D2F B;  5AQO A;  3MEG A;  1IH7 A;  1Q7Y O;  1TVR A;  2F8S A;  3DAW A;  3SLC A;  4JI1 K;  4ISE A;  1KTQ A;  5CY4 A;  1SL1 A;  3CI5 A;  4YOX A;  1QVG M;  4CGF A;  1FKO A;  4Z0U A;  2CGJ A;  1RDB A;  5AJ3 K;  3ATV A;  3NMU A;  1QQN A;  3V6D A;  4BR5 A;  3RMA A;  1KRP A;  3H3O B;  3V9X A;  4CZK A;  3U6F A;  2JWK A;  2QEX N;  4FJK A;  2FBT A;  1D8Y A;  3QB0 A;  3CPW M;  2NRT A;  3LL3 A;  1NJW A;  4FO0 A;  3NH2 A;  1YUW A;  1NJX A;  1U2V B;  3K5N A;  4FJ8 A;  3IDH A;  4MLH A;  4CJV A;  1G15 A;  4BG9 A;  3NAE A;  1HYZ A;  3WXI A;  3OTO K;  3O4N A;  3PY8 A;  1RDD A;  1RTD A;  3MMV A;  4YOV A;  2F9T A;  1WSE A;  1XMO K;  1TYQ B;  2KFN A;  3CCS N;  5LL6 Z;  4L3Q A;  3FFI A;  2F4V K;  4M3T A;  4FLU A;  1Q86 O;  4OGE A;  1S5J A;  1CXU A;  3NDK A;  3CHW A;  4C1N K;  4H5R A;  4F8R A;  2QWO A;  5LJV A;  1S9E A;  4ZHR A;  4M3R A;  2O8D B;  4QOZ B;  3CXC M;  5M1P A;  4AHC A;  3SUO A;  4IG3 A;  2DPN A;  4B9U A;  3AA5 X;  1MA9 B;  2EHG A;  5GAH P;  5ADX H;  3ASM A;  1IKV A;  1Z6R A;  4A5A A;  3EEQ A;  3KD1 E;  4KFB A;  1HKB A;  4DR3 K;  3K59 A;  3MXI A;  1RTI A;  3PLA A;  4J2B A;  2F9W A;  1DLO A;  1X3N A;  2P5O A;  5LMU K;  4IEE A;  3VOV A;  3QIO A;  3O6W A;  4BR2 A;  4MO4 A;  4EP4 A;  3R6M A;  4PKI A;  3ZSY A;  1NNE A;  5AQV A;  3AVJ A;  4CF9 A;  2IC3 A;  4DSK A;  1W7A A;  4ILG B;  1HNZ K;  5I3U A;  2G8F A;  3U3Y A;  3ID8 A;  1IV0 A;  4E7J A;  4BVO A;  3PO4 A;  4B3S K;  3H46 O;  3EE8 A;  3FE1 A;  4KHU A;  4DB3 A;  4FWR A;  4JAX A;  2HNZ A;  4I9Q A;  4EIA A;  3QO9 A;  3GL1 A;  1RT3 A;  3SK3 A;  1WSI A;  3D2F A;  3H1Q A;  1VAZ A;  1A5V A;  4C1N I;  3VQQ A;  4CJF A;  4JS4 A;  4N56 A;  1QVF M;  4CJU A;  1EWQ A;  5SWM A;  1B9F A;  1U49 A;  3P4I A;  3NF9 A;  3I8D A;  4FVU A;  1QTM A;  3U9D A;  5AQX A;  2B5J A;  5M1K A;  2WOM A;  4OPK A;  3AY9 A;  1NGE A;  1RT1 A;  5J2P A;  3JXU A;  1XC9 A;  3AAR A;  4WE1 A;  4EHU A;  3MXM A;  4CZI A;  4NYF A;  1NM1 A;  2KHO A;  2Z1J A;  5AFU A;  4H4M A;  2YJE A;  4G1Q A;  3J8A A;  3OYD A;  2Z1H A;  4JKA A;  5EU7 A;  1WLJ A;  2QM1 A;  2DFH A;  4DTN A;  2OTL N;  4C8M A;  4ELT A;  2HMI A;  3RMB A;  2KZZ A;  1HQU A;  1ZBS A;  2XY7 A;  2X6N A;  4CF0 A;  1KQS M;  3AVF A;  3NVM A;  3NGY A;  4DSL A;  1RBS A;  2I7N A;  1NKC A;  3F5T A;  4ILH A;  3HSC A;  3E66 A;  5TKW A;  2QWL A;  1C0T A;  4WQ4 A;  1ATR A;  3KHY A;  1MU2 A;  1N6Q A;  1RDA A;  4B3M K;  3DXK A;  1D9D A;  3KLH A;  1D5A A;  3Q7C A;  1HKC A;  1ZBU A;  4O55 A;  4G9Z A;  3C94 A;  2HW3 A;  3L3V A;  1VQP N;  4CCH A;  3H08 A;  4MLE A;  2KTQ A;  2YNG A;  4CEZ A;  4FWN A;  3DOK A;  1RDU A;  3OBY A;  3ZX3 A;  2O4G A;  2G8V A;  3DLK A;  1J6Z A;  4AHS A;  1HUX A;  3M8R A;  4FWQ A;  3RRG A;  4CER A;  3VA3 A;  1TL1 A;  4ELV A;  4KI4 A;  1XUP O;  4BRD A;  1OH8 A;  2QXF A;  4E1J A;  4FM2 A;  4IO9 L;  5KPZ A;  3ISN C;  4KHP K;  3TAB A;  1JXE A;  3KIO A;  4NO7 A;  1C0G A;  5C24 A;  3BEX A;  5IWA K;  3THX B;  3VA0 A;  2G8W A;  4A57 A;  4IFV A;  1KXP A;  3P38 A;  3OYC A;  4I2P A;  2BDP A;  2IGI A;  2P5G A;  3OW2 M;  3CFP A;  1HNW K;  4C8N A;  3LP3 A;  5HL7 L;  3AVN A;  4CJ4 A;  1S22 A;  2X74 A;  2E6L A;  4BR4 A;  1RBV A;  1L3U A;  3HJF A;  3O3H A;  2UXD K;  3ENH A;  5ELZ A;  3C6U A;  3THY A;  1RT7 A;  3AAP A;  4JD2 A;  3OS0 A;  3VES A;  4YHH K;  3MX5 A;  3IKM A;  2XY6 A;  2P9I A;  3E9P A;  5AQH A;  4F4K A;  1QSS A;  3DMJ A;  5E41 A;  3L2Q A;  4BE0 A;  3NVK A;  4LSN A;  3O08 A;  4M7Y A;  3ZYY X;  1TKZ A;  3D7E O;  4JI4 K;  3LZI A;  2E2N A;  2WC9 A;  3H6E A;  4JRQ A;  3HOT A;  1WNS A;  2EWS A;  1RDW X;  3O9S A;  3HXM A;  2HMP A;  5SZT A;  2YNH A;  5KGX A;  5K14 A;  2V7Z A;  4DSE A;  1SV5 A;  1JLQ A;  5BRF A;  3SPY A;  4QS7 A;  3BY5 A;  1BL3 A;  3VQ4 A;  4BGA A;  5JMV A;  1U6Z A;  3B6O A;  4KPY A;  3HO1 A;  5DM6 L;  2NUB A;  2ATQ A;  3PSF A;  4Z4I A;  5IT9 O;  1LAV A;  3SQ1 A;  1TK5 A;  4HUE A;  2DY4 A;  3HBT A;  4JKE A;  5JLF A;  4RW8 A;  3E01 A;  1OH7 A;  1RBU A;  3VQ5 A;  3VMF B;  2YX6 A;  1KVA A;  4KKO A;  4FOI A;  2FSJ A;  3N4Q A;  1A5X A;  1I3A A;  1Y64 A;  4AQY K;  4M3W A;  2BUP A;  4DU1 A;  3OS1 A;  1GLE G;  4WCE L;  1JCE A;  4DR4 K;  3AVM A;  3KJV A;  4ICL A;  3SZ2 A;  4J2D A;  4CJS A;  3VQE A;  4XIU A;  3WNF A;  2P9L B;  3SAG A;  3CM5 A;  1TL3 A;  2HVI A;  3C7N B;  5KPT A;  3QER A;  2ETJ A;  3VER A;  3HP9 A;  3VF2 A;  4KTQ A;  4B9V A;  3UKU A;  1BIS A;  2VG6 A;  4MO5 A;  3CQ8 A;  4FW2 A;  5E26 A;  3HK2 A;  4RTF D;  4IFE A;  3THX A;  1BI4 A;  4W5N A;  4I6M A;  3FLC O;  4CHZ A;  3LDN A;  4DLG A;  4N76 A;  1QSY A;  3G0Z A;  4ID1 A;  4CEB A;  4C23 A;  4FJ9 A;  1ESV A;  4DMN A;  2A41 A;  3DYA A;  2YCH A;  5AQQ A;  3CQY A;  4CZF A;  3ZSW A;  3SAF A;  1BWF O;  1VHX A;  3CM6 A;  3CJ1 A;  4FM1 A;  2A1R A;  2V51 B;  4DQP A;  5B8H A;  2YKN A;  1XC3 A;  3MEE A;  1YAG A;  3OA9 A;  4DTP A;  3QIC A;  3WXK A;  2W41 A;  3V9S A;  4NCA A;  2QKB A;  3CYM A;  3G25 A;  1GOA A;  1RTH A;  3LAK A;  3CCL N;  1RT6 A;  3K2P A;  4CEC A;  4FJH A;  1DGK N;  3K0S A;  4Q0B A;  2IDO A;  4WFB L;  5T7B A;  3O4Q A;  3VEX A;  1P8Z A;  3PV8 A;  4RCH A;  4HHT A;  3HZ6 A;  1BOT O;  3DLB A;  4QCL A;  3EL2 A;  3QEP A;  4XH5 A;  3NE6 A;  1N5Y A;  1CZB A;  4CZE A;  3TAE A;  1J54 A;  3PIP L;  4CJP A;  3OVN A;  3HYF A;  3SMS A;  4QS9 A;  3HRG A;  5BPM A;  3KK1 A;  2I5J A;  1HJO A;  3SV4 A;  3H3N O;  1UA0 A;  3D45 A;  3U8X A;  3Q7B A;  4XH4 A;  3UKR A;  1N8R O;  4JKG A;  4OLA A;  3K9K A;  3V81 A;  3D0P A;  4BGB A;  1IBL K;  4CIE A;  2XRI A;  1SL0 A;  3TAM A;  1EQY A;  1RBT A;  1VQO N;  3KK3 A;  1JLC A;  2NRR A;  2D1K A;  5AZJ B;  5C2F A;  3KK2 A;  5LY3 A;  4LF9 K;  3ULD A;  2NRH A;  3FFK B;  4E19 A;  3AO2 A;  3DRR A;  3QFP A;  4A2A A;  5JIC A;  1TUY A;  4NLB A;  2O8B A;  4CZM A;  3C7N A;  4CFA A;  1VQ7 N;  3ZX2 A;  1XNQ K;  3CD6 N;  2Q2R A;  3E9L A;  5KPR A;  3J7Z O;  1TKX A;  3CME N;  4J2A A;  1E3M A;  1NGF A;  2HHT A;  5AFU H;  2IOC A;  5JVH L;  5A2Q O;  1Q9X A;  2G8I A;  2ASP A;  3DM2 A;  2PAV A;  1WAF A;  4PQU A;  3M8S A;  2OPP A;  4BRN A;  4FXD A;  4LSL A;  3VGK A;  3HI0 A;  1ASW A;  1YVU A;  4HTL A;  3W0L A;  1TAQ A;  3C6A A;  3T1Y K;  1XHZ A;  3K5L A;  4JK7 A;  3L0Q A;  1WOQ A;  2NRW A;  3OYA A;  1NLV A;  2NRZ A;  2YHB A;  3HL8 A;  3GOI A;  3LPU A;  5JVG L;  3PX0 A;  3UE5 A;  5F2R A;  4JKD A;  1UA1 A;  5HRP A;  1VQM N;  2KQ2 A;  1MWM A;  4CJK A;  4DFP A;  2VWK A;  5EXW A;  1GOB A;  4CEE A;  1B92 A;  2FBX A;  5DK5 A;  1TUU A;  1SAZ A;  5J2Q A;  2HBK A;  3CIP A;  4WF9 L;  4PWD A;  4CGD A;  5KQD A;  4E89 A;  3WNG A;  1J9A A;  1Y97 A;  3MN6 A;  4RG8 A;  3VQ6 A;  5FRN A;  1N32 K;  4FJI A;  4O0J A;  4CFD A;  1Z26 A;  2OPS A;  4H4O A;  1NK9 A;  4GV9 A;  3THV A;  2W6L A;  4BC5 A;  3HVT A;  5AQJ A;  4KTZ A;  4IDK A;  3PX6 A;  2YNF A;  4IO8 A;  4PL8 A;  2EX3 A;  2NRV A;  1W0H A;  3CC2 N;  3MCA B;  3VEZ A;  2OZM A;  2D4W A;  4C8L A;  3C95 A;  1KC8 O;  4JYA K;  2HHX A;  5FRO A;  4JI0 K;  3S9H A;  3O1W A;  4FW1 A;  2Y1J A;  2E1Y A;  4RW7 A;  1J53 A;  2JGU A;  4FJX A;  1DTT A;  2OCE A;  3NBP A;  5AQZ A;  1VQK N;  4RW4 A;  5M1F A;  4GVE A;  1WSG A;  1Q9Y A;  3T1A A;  4B1U B;  3CET A;  1W9H A;  4CI6 A;  3D2E A;  4V19 S;  4CZL A;  3O80 A;  1BUP A;  5AZJ A;  3W3D A;  2NNW A;  1BDG A;  2E2O A;  5CHI A;  2ZQB A;  1SZ2 A;  4OLB A;  1OH5 A;  1BQN A;  4WFA L;  4IWV A;  1C0M A;  3KKR A;  1UWB A;  2BGG A;  2PBD A;  3TSP A;  1C1A A;  4DR5 K;  2NRX A;  1ZBF A;  2D0B A;  4DTS A;  3KVG A;  1CXQ A;  4AHT A;  2XY5 A;  3SI6 A;  2FF3 B;  1NJY A;  3O1B A;  1L3T A;  2QA4 N;  1Q18 A;  4DG1 A;  3EN9 A;  4LH5 A;  1HLU A;  1WSJ A;  4OKK A;  3T3F A;  4M3X A;  4CGG A;  1V4S A;  4IXC A;  4HUG A;  3BDP A;  3WNE A;  2RHK A;  4L8R B;  3WXJ A;  3A5L C;  1TAU A;  4H0T B;  2BAN A;  3G4S N;  3THW A;  4JI2 K;  3GG4 A;  5F1X A;  4H0V B;  2HBM A;  4B8C A;  1YTU A;  4CZH A;  3DXK B;  3G10 A;  1FW6 A;  3JS6 A;  5BPL A;  4FSV A;  3TI0 A;  2OPQ A;  5KRT A;  2HHU A;  2FC0 A;  3HTV A;  4BRI A;  4R79 A;  3AA4 A;  3MX2 A;  3UB5 A;  2R7Y A;  1NK7 A;  3M8P A;  4CES A;  1QQM A;  5JLH A;  2V52 B;  3CJC A;  1S9G A;  3SQ0 A;  3TAF A;  1HNI A;  3G71 N;  2RE2 A;  4PUO A;  1P90 A;  4DR7 K;  3PUF A;  1VQ8 N;  4CEF A;  3ZEU A;  3PX4 A;  1ZYQ A;  5DMR A;  2AP1 A;  1GLB G;  3KLE A;  3L4Q A;  4CK1 A;  1NKE A;  3S3N A;  4CW7 B;  4ISG A;  1S1U A;  4C8O A;  3HM8 A;  2I7P A;  4B9M A;  2PY5 A;  4CHY A;  3ENB A;  1ILY A;  2X78 A;  2D0C A;  4KAZ A;  4BG8 A;  3EO3 A;  1KCF A;  3KWI A;  3MN9 A;  3KLF A;  3LDP A;  4BDZ A;  3KZB A;  4KI6 A;  1G99 A;  4OVL A;  4JHD A;  2UUB K;  4JI3 K;  4K0K K;  3SJJ A;  1OKJ A;  1K8K A;  3D6R A;  1LOT B;  3O9T A;  1BCM A;  3THY B;  2D5R A;  4JD2 B;  4I9L A;  4OJR A;  4DTX A;  3EKU A;  1T7P A;  4FJ5 A;  2P9I B;  1LV5 A;  1ZBH A;  4BRM A;  2YHW A;  5AQN A;  4Y0W A;  4FZZ A;  1KVB A;  4AHU A;  3VF4 A;  3VQP A;  4CGI A;  4CIG A;  2XHB A;  1GLL O;  4GKJ K;  3KWG A;  4O8K A;  4UQG A;  1LWF A;  1WBB A;  3VQD A;  4Z4C A;  1S72 N;  3LP2 A;  1TK8 A;  1JKH A;  4PA1 A;  4XEI A;  5AQR A;  2HND A;  4H0P A;  3K5M A;  4A62 A;  4KH5 A;  3HVR A;  3QEI A;  4DTR A;  2HOE A;  1ITG A;  5AQP A;  1T6D A;  3RVC A;  2D0P A;  1IJJ A;  3L2V A;  3M3Z A;  1SQK A;  1YJ9 N;  5JS2 A;  4NYN A;  2BTF A;  4FK0 A;  3O9U A;  3SJH A;  2ZWH A;  4OO1 J;  4DSJ A;  3P39 A;  3KD5 E;  3HP6 A;  4K25 A;  3ITH A;  2HF4 A;  4LH4 A;  2YNI A;  1HPM A;  3ULE A;  2Y1I A;  5I9E B;  1Q81 O;  4LY7 A;  2DFE A;  4BE1 A;  3ATU A;  1VQ5 N;  2IAJ A;  3PSI A;  3KK7 A;  4FPA A;  4FJ7 A;  4M42 A;  4B3O A;  1SKR A;  3QNN A;  5AQG A;  1L5U A;  2FSK A;  4DSF A;  1XHX A;  1X3M A;  3I56 N;  5EOY A;  2YHX A;  2A6A A;  4AHV A;  5FPM A;  3AV9 A;  4BR7 A;  4WQ4 C;  3TSU A;  3LZJ A;  1SKS A;  3I55 N;  3ALY A;  4E0D A;  4K8Z A;  3VEY A;  5AQM A;  4PY5 A;  3LP1 A;  5HRO A;  4OX9 K;  3T7Z A;  4FLW A;  2ZGY A;  2E4L A;  1ATN A;  1NGJ A;  4J8F A;  1S1W A;  4FZY A; 
#chains in the Genus database with same CATH homology
 1W97 L;  3G6E N;  1XQS C;  3LDN A;  3O8M A;  3MWP A;  5AQI A;  5AQF A;  1ZXO A;  4FWO A;  3UKU B;  4BRE A;  2D0O A;  1YHQ N;  4H5V A;  4MDA A;  3TTF A;  2OTJ N;  3F9M A;  1W2B M;  2FF6 A;  4I6M B;  4C23 A;  5CR4 A;  1ESV A;  4QS8 A;  4IOC L;  2A41 A;  1M90 O;  1OVY A;  2YCH A;  4CZG A;  5AQQ A;  3CQY A;  4CZF A;  3SAF A;  1BWF O;  5MLC Q;  4DCH A;  3CJ1 A;  4U67 L;  3QBW A;  3ENO A;  5E84 A;  4IZ9 A;  3WUH A;  4PHT X;  3CC7 N;  2V51 B;  2QWR A;  4UY8 O;  5B8H A;  2Q36 A;  1YJN N;  1XC3 A;  3FZM A;  4BRK A;  1YAG A;  1JJ2 M;  3OA9 A;  3QIC A;  4B1W B;  5BN9 A;  3WXK A;  2W41 A;  1H1V A;  1VQ9 N;  3G25 A;  4WYB A;  4BRL A;  1WUA A;  2IVN A;  4ISF A;  3CCL N;  2A5X A;  1DGK N;  2WBN A;  4OPH A;  4IJA A;  3LDL A;  2E2Q A;  4A61 A;  4WFB L;  3P31 A;  3VEX A;  1P8Z A;  3SMP A;  3EKS A;  1HKG A;  4GV6 A;  4RCH A;  3HZ6 A;  3LM9 A;  1BOT O;  1GLF O;  3O9Q A;  5AQS A;  3VTI A;  5H1S Q;  3DWL A;  1D4X A;  4MDB A;  1YIJ N;  3EL2 A;  4A59 A;  2P9U B;  4BR0 A;  3VEN A;  4BQL A;  4XH5 A;  3AGR A;  1VQN N;  3WQT A;  1M1K O;  4K43 A;  2CH6 A;  4CZE A;  3PIP L;  4CJ7 A;  1K9M O;  3SMS A;  2FSN A;  2ASO A;  3E1Y A;  4QS9 A;  3HRG A;  3M5R A;  5EX5 A;  3VEW A;  5BPM A;  3D2F B;  5AQO A;  3CF5 L;  1KD1 O;  1HJO A;  5C2D A;  3H3N O;  4BC2 A;  3U8X A;  3Q7B A;  4XH4 A;  3UKR A;  1Q7Y O;  4FPB A;  1N8R O;  5C0Y A;  3FZK A;  5AZI A;  5AQW A;  4BRG A;  4JKG A;  4F9O A;  3DAW A;  3SLC A;  4AM6 A;  3K9K A;  4ISE A;  3CCR N;  5GIP A;  5BRH A;  4BGB A;  3M1F A;  3CI5 A;  3UKR B;  5GIO A;  4YOX A;  1QVG M;  2V7Y A;  4YOR A;  5AZI B;  1EQY A;  2ZGZ A;  2P9K A;  4JKG B;  1VQO N;  2CGJ A;  3WT0 A;  2NRR A;  2D1K A;  5AZJ B;  3RSE A;  3ATV A;  3QML A;  3R3L A;  4AM7 A;  1QQN A;  5C2F A;  5LY3 A;  3NMU A;  5AQY A;  4BR5 A;  3VTH A;  2NRH A;  3FFK B;  4WQ5 A;  3H3O B;  1U2V A;  2E8A A;  3CJ7 A;  3QFP A;  4A2A A;  2P9K B;  4CZK A;  3CJA A;  4DHY A;  5JIC A;  3EE9 A;  1TUY A;  5M1O A;  4NLB A;  4A5B A;  2JWK A;  3C7N A;  4CZM A;  2QEX N;  3RSE B;  5GIN A;  1VQ7 N;  3ZX2 A;  3QB0 A;  3CPW M;  3A5N C;  2NRT A;  2Q2R A;  3E9L A;  3H1V X;  3LL3 A;  3N4P A;  3CD6 N;  4FO0 A;  2P9N A;  1YUW A;  3MWT A;  5KPR A;  3J7Z O;  5TKY A;  3OBW A;  1U2V B;  3CME N;  1TYQ A;  4BRQ A;  1NGF A;  3WEE A;  5C10 A;  3IDH A;  4MLH A;  1DT9 A;  3LDO A;  5AFU H;  3TTD A;  2CGK A;  4B1Y B;  4CD1 A;  4BG9 A;  5JVH L;  2P9P A;  1V4T A;  3WXI A;  1EO1 A;  2ASP A;  2PAV A;  1T3V A;  4H0X B;  2P9N B;  3MMV A;  3LDQ A;  4WQ5 C;  1ZC6 A;  2F9T A;  3AGK A;  4BRN A;  4YOV A;  2ZJR L;  1TYQ B;  3WEE B;  2IVP A;  5FPE A;  3VGK A;  3HI0 A;  4JKF A;  3CCS N;  4HTL A;  4L3Q A;  3W0L A;  2P9P B;  4H5W A;  1BU6 O;  3GE1 A;  3C6A A;  4BRA A;  3T69 A;  3B8A X;  3CCQ N;  2E20 A;  4JK7 A;  3L0Q A;  1WOQ A;  1Q86 O;  1KAX A;  3EZW A;  5M1N A;  2NRW A;  3MK6 A;  4BY9 C;  3CHW A;  3F2K A;  4H5R A;  3QBX A;  4C1N K;  1NLV A;  2NRZ A;  2QWO A;  4Z94 A;  3GOI A;  5LJV A;  5JVG L;  4BRP A;  4CZJ A;  5M1P A;  3CXC M;  3UE5 A;  2DPN A;  5F2R A;  4JKD A;  1VQM N;  4IJN A;  1MA9 B;  5GAH P;  5ADX H;  4FOE A;  1MWM A;  1Z6R A;  3DXM A;  1NGH A;  5EXW A;  4A5A A;  3VET A;  3DLL L;  1HKB A;  5GAG P;  4JK9 A;  1JCG A;  1TUU A;  3PLA A;  3L6Q A;  1YXQ A;  3IUC A;  1SAZ A;  2F9W A;  1YVN A;  1X3N A;  4JN4 A;  2HBK A;  3CIP A;  4WF9 L;  3DXM B;  3FZF A;  4IEE A;  3O6W A;  3VOV A;  4MO4 A;  4BR2 A;  5KQD A;  4EAH D;  3R6M A;  4PKI A;  1NGI A;  2GWJ A;  5AQV A;  3MN6 A;  4H0O A;  4JNE A;  3IFR A;  1NGD A;  3CMA N;  4JKB A;  4B1Z A;  5BN8 A;  4ILG B;  3CJB A;  3BP8 A;  4GV9 A;  4BC5 A;  5AQJ A;  3O5B A;  3ID8 A;  2P9U A;  3OHR A;  4IO8 A;  4PL8 A;  3BUZ B;  3K9J A;  5EY4 A;  4BRO A;  2NRV A;  4BVO A;  3CC2 N;  5LJW A;  3H46 O;  3EE8 A;  4BRF A;  3MCA B;  3FE1 A;  3VEZ A;  3C65 A;  2D4W A;  3LM2 A;  2GEM A;  3MN7 A;  4DB3 A;  4FWR A;  4JAX A;  2ZF5 O;  4GY2 B;  1KC8 O;  4EIA A;  2AA4 A;  3GL1 A;  3R9P A;  3SAH A;  3SK3 A;  3D2F A;  3O1W A;  3H1Q A;  1VAZ A;  2E1Y A;  1SS6 A;  4YDU A;  4C1N I;  2CH5 A;  1VQ6 N;  2F7T A;  4EFH A;  5AQZ A;  3IMX A;  1YI2 N;  1QVF M;  2VGM A;  1VQK N;  4YOW A;  2Q31 A;  5M1F A;  3O9R A;  4GVE A;  2OAN A;  3BF1 A;  4B1U B;  3CET A;  3P4I A;  4H0Y B;  1YIT N;  2ITM A;  4FVU A;  3U9D A;  4CI6 A;  4DQ8 A;  2KKZ A;  5AQX A;  5AQL A;  3A5M C;  5M1K A;  3D2E A;  1E4F T;  3AY9 A;  1NGE A;  3O80 A;  4CZL A;  1BUP A;  3E9O A;  5CE3 A;  3JXU A;  3AAR A;  1QQO A;  2NLX A;  5AZJ A;  4PL7 A;  2UYT A;  4EHU A;  3W3D A;  4CZI A;  2NNW A;  1T44 A;  1NM1 A;  2W40 A;  1BDG A;  2E2O A;  3D2E B;  2KHO A;  3H45 C;  4YDU C;  5AQT A;  5KQ8 A;  5CHI A;  3CCJ N;  5AFU A;  1SZ2 A;  2YJE A;  3J8A A;  1GLC G;  2HST A;  4WFA L;  4IWV A;  4JKA A;  1NGA A;  2QM1 A;  3FZH A;  1LCU A;  2OTL N;  1K73 O;  4OPA A;  2PBD A;  3TSP A;  1NBW A;  2NRX A;  2QTD A;  4XH1 A;  1ZBS A;  4ILJ A;  4NLC A;  3CJ9 A;  5FPN A;  4K42 A;  2E88 A;  4BRC A;  2QI2 A;  3KVG A;  2H3G X;  2QWN A;  3FGU A;  1C0F A;  2Q97 A;  3NVM A;  1KQS M;  2J4R A;  2I7N A;  3R1X A;  4PKH A;  5BRD A;  4IOA L;  1DEJ A;  3CQX A;  1GLD G;  3F5T A;  4YOT A;  4ILH A;  1NGG A;  3HSC A;  3E66 A;  5TKW A;  2FF3 B;  3FZL A;  2YJF A;  2QWL A;  4WQ4 A;  3AAQ A;  1ATR A;  3O1B A;  2QA4 N;  1Q18 A;  5EVZ A;  4LC9 B;  1JCF A;  2HBL A;  3KHY A;  4JKH A;  5ADX A;  3EN9 A;  1HLU A;  4M63 C;  3VGM A;  3DXK A;  4BVP A;  3VPZ A;  1V4S A;  4IXC A;  3Q7C A;  1MDU B;  2RHK A;  1HKC A;  4IOX A;  4G9Z A;  3WXJ A;  3A5L C;  4H0T B;  3G4S N;  4CBW A;  5F0X A;  3GG4 A;  5F1X A;  3FR0 A;  4O5F A;  1VQP N;  1GLA G;  2HBJ A;  1O13 A;  2HBM A;  4H0V B;  3MCP A;  4CZH A;  5GAE P;  3DXK B;  4MLE A;  3JS6 A;  1X9J A;  4FWM A;  5BPL A;  4FSV A;  4FWN A;  3CPE A;  1GLJ O;  1RDU A;  3OBY A;  3ZX3 A;  4YOY A;  3VEO A;  3WXL A;  2P9S B;  3HTV A;  4BRI A;  4H5T A;  4R79 A;  3CCM N;  2GWK A;  1J6Z A;  1HUX A;  3MX2 A;  3SBT A;  3UB5 A;  1IG8 A;  4FWQ A;  2ZJP L;  3C0B A;  4CBX A;  1QQM A;  5JLH A;  2V52 B;  3CJC A;  1XUP O;  2A42 A;  1RGI A;  4K41 A;  4BRD A;  5BPN A;  3G71 N;  1NMD A;  4E1J A;  4FWK A;  4GNI A;  4B9Q A;  2RE2 A;  4FWP A;  3O4W A;  1P90 A;  4IO9 L;  1VQ8 N;  5KPZ A;  3ZEU A;  3MN5 A;  3TPQ A;  3ZX0 A;  3TTC A;  3I33 A;  2AP1 A;  2ASM A;  2VGN A;  1GLB G;  4FL9 A;  4NO7 A;  3L4Q A;  1C0G A;  4FWL A;  2IVO A;  3BEX A;  5FPD A;  4ISG A;  2Q1N A;  4A57 A;  1KXP A;  5GAD P;  3P38 A;  3ZEU B;  3QFU A;  3CCU N;  3HM8 A;  2I7P A;  4NB4 A;  4BRH A;  3L4I A;  4RWT A;  3OW2 M;  3PIO L;  4KH6 A;  5HL7 L;  1S3X A;  4HWI A;  4IEI A;  3DJC A;  1S22 A;  3ENB A;  1ILY A;  4BR4 A;  4JK8 A;  4KH4 A;  4BG8 A;  3EO3 A;  4AF1 A;  3ENH A;  5ELZ A;  3KWI A;  3MN9 A;  1K8A O;  4JEP A;  4GV3 A;  3AAP A;  3LDP A;  4JD2 A;  4BC4 A;  3VES A;  3MX5 A;  3IKM A;  3KZB A;  2P9I A;  3E9P A;  2CGL A;  1G99 A;  5AQH A;  4JHD A;  1OKJ A;  1K8K A;  3D6R A;  3NVK A;  1BA1 A;  1QHA A;  3O08 A;  3QDK A;  4M7Y A;  3D7E O;  3ZYY X;  1LOT B;  1BO5 O;  2E2N A;  3O9T A;  1BA0 A;  2WC9 A;  5HOO A;  3H6E A;  1KAY A;  4JD2 B;  2VYP A;  3HOS A;  3EKU A;  3VF6 A;  3HOT A;  2P9I B;  2VCP A;  2EWS A;  1RDW X;  3O9S A;  2YHW A;  1NGC A;  4JHD B;  5AQN A;  4Y0W A;  3WQU A;  4BRM A;  4U7B A;  1K8K B;  2HMP A;  4WFN L;  2FXU A;  3C6H A;  2V7Z A;  2VWB A;  4H03 B;  3VF4 A;  3GBT A;  1GLL O;  2GUP A;  3KWG A;  4H5N A;  4O8K A;  1KAZ A;  3CER A;  5BRF A;  3CCE N;  4QS7 A;  1S72 N;  3CCV N;  2QW9 A;  1VQ4 N;  3A0I X;  4BQZ A;  4BGA A;  5JMV A;  4XEI A;  5AQR A;  2YI1 A;  1U6Z A;  2YHY A;  3TU5 A;  4H0P A;  4A62 A;  5DM7 L;  2QWQ A;  1BG3 A;  4KH5 A;  3U4L A;  3ZET A;  3WXM B;  5DM6 L;  2HOE A;  2WFB A;  3R8E A;  5AQP A;  1T6D A;  3RVC A;  4O8U A;  2D0P A;  1IJJ A;  2E2P A;  1DKG D;  1CZA N;  3M3Z A;  2QWP A;  1SQK A;  2QWM A;  1YJ9 N;  3I8B A;  3ZET B;  3HBT A;  4JKC A;  4JKE A;  4BR9 A;  5JLF A;  2BTF A;  3A5O C;  1HX1 A;  3O9U A;  2Q0U A;  3SJH A;  5BR9 A;  2ZWH A;  4OO1 J;  3VMF B;  4DKW A;  2YX6 A;  5AR0 A;  3P39 A;  4FOI A;  2FSJ A;  3VEV A;  3N4Q A;  5BRE A;  4B1V A;  1VQL N;  2GX9 A;  1Y64 A;  4K25 A;  2P9L A;  2BUP A;  1E4G T;  2BH1 A;  4IDH A;  2HF4 A;  2HF3 A;  3U9Z A;  1GLE G;  1HPM A;  1JCE A;  1MWK A;  2Q0R A;  3ULE A;  3VGL A;  4WCE L;  4B1X B;  5I9E B;  1Q81 O;  1VQ5 N;  1T6C A;  3ATU A;  1YJW N;  1Z05 A;  2A3Z A;  3KK7 A;  4FPA A;  4KBO A;  2P9S A;  1ATS A;  3ID6 A;  5AQG A;  3MDQ A;  2FSK A;  2P9L B;  3SAG A;  2JWL A;  4FWS A;  2E1Z A;  4A2B A;  3S41 A;  1X3M A;  3I56 N;  2NZT A;  2A40 A;  2QXL A;  5EOY A;  2YHX A;  2A6A A;  3ULE B;  1QZ5 A;  3C7N B;  5FPM A;  1NGB A;  4YOU A;  4CD3 A;  5C12 A;  2ZJQ L;  5C15 A;  1NJI O;  5KPT A;  4BR7 A;  1NWK A;  1YF5 L;  4PKG A;  2KLA A;  4WQ4 C;  5AQU A;  3SBG A;  3TSU A;  3I55 N;  3GDQ A;  3VER A;  3M6G A;  3VF2 A;  2FLO A;  3VEY A;  3BF3 A;  5AQM A;  4M7X A;  1RFQ A;  2GTD A;  4EHT A;  3UKU A;  4MO5 A;  3A8Y A;  3T7Z A;  5E26 A;  1Q82 O;  4BC3 A;  2ZGY A;  4RTF D;  1QZ6 A;  5AQK A;  4CBU A;  2GEL A;  2IIR A;  2PFU A;  2WUS A;  4IFE A;  1ATN A;  3TSQ A;  1NGJ A;  4J8F A;  3CC4 N;  4I6M A;  3FLC O;  1R59 O;  5M1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...