3O9WC

Recognition of a glycolipid antigen by the inkt cell tcr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
203
Chain Sequence
b'TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o9wC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o9wC02
2WZPD 5D7LB 1P4IH 2PO6B 5J1AA 4KJWC 1DBAL 4LKCB 3W11D 3MNVA 5HHXH 1AXSA 3FQWB 5AEAA 1F2QA 4JQXA 4NQCE 4QRTA 5F21B 4CKVX 5IB5B 3L3KB 5CBAB 4MD0A 4OZHB 2GUOA 4WTXA 2RFXA 3A6BL 1U2CA 1K4CA 3IKCA 1I9IL 1IM3B 5K59E 5TFSL 3EDEA 5D71L 1UWXK 3VFSA 1JN6B 4JFDE 4XBEL 4P9MH 3VFPA 4OZ4A 3J7HA 3L5XH 3FO2A 4G8FB 4KUZL 4NHCL 3HAEH 1MREL 3PJSB 5HHMD 4KROC 1WISA 4TSBH 1GZPA 3QO0B 4OLVL 4FN0A 4X6CE 1WWAX 3VFGH 2OCFD 2XKSA 4JKPL 2YBRA 4ZUSB 3MRLB 3VWKA 4PJDB 5GGQL 3O6FA 1UA6H 5BJTA 2P5EE 3K8MA 1LK3L 1KULA 2NY4D 1A3RH 1JHKH 1JUFA 2VC2L 3ZL4H 2X70B 1QFWL 3U7YH 2PUQT 5T3XL 3BPOC 2IANE 4PJEF 1FZJA 3BZEB 1AGDB 1A47A 3QEQB 2AXGA 3VXUE 4WFHD 5IVZA 3BJ91 1ADQH 4NO2A 2B4CH 1U58A 2FH8A 1C5CH 4JN1L 2C7UB 2UUDH 5ADOL 2AEPL 3TYFB 1F97A 4PJBF 5EU3A 3RVWD 1T0NA 1ZLSH 4P48A 4BZYA 2YPLB 4HH9B 4EXKA 1A7OH 1A1MA 3QR2A 2P5WE 3UJTH 2J6EA 1N64H 1U3HC 2MKWA 4WJ5A 5A2LH 4KMQA 4LHQB 2VITB 1CZ8H 4LPYA 1HH6B 1H3UA 2VXUH 1I8KB 3D0VA 1CK0H 4HPYL 3RDTA 1LO2L 4ZXBA 4F15C 4Z7VF 3HHRB 3MBXH 3FQTB 4NQSB 3BOVA 3N9GH 4XC1L 4K71C 1H15A 3MODL 4ODUA 4XVTL 5H37H 3SJVA 4POZD 3ZDXE 2GFBB 5BS0B 2B1HL 2Y6SC 3MLSH 1MCBA 3RWJB 4OD1L 4LEXL 3MV7D 1BZ7B 1IT9H 3L7FB 4MSWB 3OKYA 4PRID 5CP7A 4Y5YA 3PABB 5HGHA 4FG6D 5MERB 2NY0D 1YEHH 1AO7E 3HLAA 4XTRC 3H3BC 2V5YA 5IK3B 2R1WA 3I6KB 3MRMA 3MMEB 4AIOA 3MLPA 3MV9D 3E6HB 4PRNB 3KXFA 3V52L 3EJYC 1UH2A 5C0AA 1OAQL 1OGAE 3DYOA 5TE4L 5I15H 1ES0B 4GSDL 2HT3C 4WI6A 3I02A 4CMMB 3CVHA 1WEJL 3NMEA 1MCNA 1HSAA 3T2NH 4JO2L 4OIBA 3OMZA 4EEEA 3VD9A 3QNZA 2R0ZL 5ESAA 4F9PA 3K3QA 2RB8A 2BFVL 5I17A 3CFIC 4X8JA 5GGRY 5FYKE 1XZ0B 5D1QC 3RKDD 3L3IB 1A2YA 4CDGC 3MNWB 2Q6WA 3S35X 3EFFA 1E4WL 3SQOH 1AGBB 5ISZE 2H6PA 3RNQB 2A83B 3AAZA 4GW5B 3ZTJH 3GI9L 3HPJA 5BZDA 5EU6D 4POUB 4KFZC 1KJ3L 4KTDL 2AGJL 2R4RL 3FONB 1ZAGA 3ROOB 3DSFL 3JV0A 4KK9C 4O2EA 4YX2H 5GSVB 6FABL 3HE6A 4V1DA 2O5XH 1UG9A 3SGDH 2BNRD 5EU4A 3RZCD 2DICA 3ZHDA 4ZFOB 3KPSE 4HUKB 32C2B 3TJHC 4XBPA 4WV1A 4TVSa 2LQRA 4BH7A 3MRQB 5FUCC 4M02A 1HXMA 1AQDA 3HPLB 5DHVA 1NPUA 1ZT1A 3D0LB 5EFIA 4OZHF 4R0LC 4OV5B 4MJIA 1A6VH 5FXCH 2EICA 3VFVA 5FF6B 4XCEB 1KG0A 3RWDA 3QUXB 3MRKB 3V5HB 5DURB 3P0VL 4Y7MA 1GGTA 1DUYB 3OXRB 4LP5A 1O0VA 1HHGA 2HRPH 1T66C 3S36L 3CH1B 5I76A 4R4ND 4J3SA 5HPMA 1BJMA 1NGWB 5DD5L 3CXDH 3BZDA 1R6VA 1OAXL 3QG7L 1SYVA 4M1CD 2VDLL 3QFJA 2EDXA 5DD6A 5DQDL 4I77L 4KRPB 1CXKA 1RZKL 4H20L 4PJDF 4NKDA 1ZGLP 3ARXA 1A21A 1EAPB 4JO3L 1IGFL 5C09D 1CE6B 3D9AH 5DFWH 4NJ9L 3SE9H 2Y06H 1T5XB 5DHYA 3ILPB 2HTKC 4Z0XB 5ITBL 2Q1EA 2XN9D 5D93C 4PP2A 4F7EA 1KEML 1IBGL 2CLRB 1DLHA 5CJBA 4WUKL 3LB6D 3MA7A 2NX5B 3OG4B 3WHE0 4L8DA 4YK4C 1G7IA 4P23B 2NY1C 4PJHF 4AEHL 5A3ID 2LVCA 5F7DB 3K74B 4Y4HA 3O3DA 4N0UA 2OQJA 2WP3O 4IRJC 2NY6B 2UUDK 4PJ5A 2GIYA 4BFIB 1OWRM 1T1XB 5DQ9A 3U4BH 5GSRA 4JM4L 4HJ0D 5K9QG 4JVPA 4ZTOH 1U93B 1U8OA 4LMQI 3BRFA 4MMXC 4OF3A 4OLUH 2EC8A 2MJWA 4LSVL 3O45A 5F72S 1LP9B 2VXQL 1HQ4A 4GG6E 3ECBB 2YUXA 4XPGL 4ZPTB 4OCSH 1NL0L 4U3XA 1TVBB 4BZ2L 1OTSC 1ZA6A 4Y19A 1MCQA 4HWBL 1ZGLA 5E24E 4IMKA 4XCFL 3OKNA 2JB6B 3QCUL 4LSSL 2AABH 4MQXC 5F9OH 3AUVA 1NLDL 1AGEB 3I2CH 5BVPL 4HKJA 1OARL 4J3VA 5E4IA 5FHAH 3TNMB 5BOZG 5KOMC 4MB3A 2J4WL 1OD7A 4XWOC 3FO9B 1JPFA 2J88H 5DGQA 5E7BA 3LKSB 5E8OA 1EO8L 1NGPL 4ODTH 2DYPB 2VIRB 5C0CD 2FO4B 4QRQA 3H6JA 4HX1B 3DVGB 1Q0XH 1GYAA 4MCZB 1HWHB 2ZNWA 4FP8H 1GOFA 4GO6B 5SWZD 5FM5O 3U0TA 3T0EC 3CX5J 3QDME 2NYYD 4TUJA 5FGCB 2ZUTA 3IS0X 4KXZH 5IB2B 1XF3B 4XNMB 2ZCHH 5F88A 3F7PC 4WTWA 4LRIA 5GGSA 1K4DA 4CW1A 2XWJA 2GT9B 2YC1B 4RGNE 4HJJH 1VKXB 3BIKA 4FOMA 5DJDB 5E2TL 5HDQL 1TPXB 4OCXH 3KWWB 4N9GB 5BRZB 4DKFL 1Y6KR 3SGDI 4OJFH 2YRPA 2C3VA 3UBXG 1S7XB 3ET9F 1EXUA 4LMQE 2E7BA 2VXVH 5I1AB 1Y6NR 2DI7A 5F70A 2FJHB 3T77A 5IQ7H 1Z6JT 3UX9B 5D6DA 2GITB 5C9KA 1A6AB 3NIDE 1CD1A 1U91B 1CFTB 4NFDA 4RRPG 2AI0L 2DQUH 1DQMH 4PRPB 3KPPB 5KW9H 4QRRD 5DFTA 3LEXA 2JJWA 3OZ9L 1F8TL 3TO4D 2NQCA 4N68A 3EZJB 1JGUH 1ZVYA 3QDGD 4JREB 3TFKD 4CADA 3M1BA 4DK3A 3SCMD 4OTXH 3VFNA 3UJJH 5I1DA 1MOEA 1DANT 3BFOA 4M7LL 3DO7B 5KVDL 3PQYB 3CLFL 4K3JL 3DX7B 1FPTL 1VFAA 1T83A 1QZ1A 1B88A 4ZQKA 1KB5H 4F57L 4PJGF 3H42H 4XPFH 3W5NA 5HI5C 1MIEL 5MENA 4M4RA 4NQEA 1W0WA 1MJJB 3C8DA 1D5ZB 5EN2A 4NUGH 1JNLH 5GS0H 2VMFA 1PEWA 5LCVL 1OAUH 2R29H 4MNQD 3F12A 3NVQA 2VJXA 1BWWA 5IW1A 3EYUL 3MRBA 2CLZA 4JJ5A 1EUUA 3QIUD 5A2JH 3NTCL 2KZ1B 1VPOH 1LD9A 4ZTPH 4MB4A 4Y89A 5E2VH 4DZ8A 5LWYH 3IDGA 1IQWH 1IAIL 3HB3C 1ZVSB 3ULVC 5L8LB 4GBXB 3VFTA 1PW3A 2FATH 5AYUL 3MA9H 3ZYOA 3RQ3A 3O11A 1U92B 2Z92A 5MI0B 1HWGB 1YEKL 4UDUB 3R4DA 4Z7UE 1YPZB 1OGAB 4K8RH 3CCHA 2A6KB 4YO0A 1HHJA 4E41B 3NFSL 1G9NC 1JGVH 2XRAH 4G6FD 1RVFH 1CTNA 5C07D 1D5BB 1CT8A 4UQ3A 1G7QA 1P7HL 2W65B 2GSIA 4KQ4L 1NC2D 4FQPA 1J9CT 1GCFA 1NBYB 3LD8C 2P8LA 3ARZA 4P9HH 2YD7A 5FYKL 3RVXD 3MJ6A 4OUUB 4GRLA 2X09A 3GRWA 3QUZB 1RZ7L 3OKLB 4AIXA 4NZRH 4Z77B 3FQRA 2HKFL 4LDEB 4C56A 2KDGA 3OQ3B 4HT1H 5IP4A 1LP9F 3GNMH 3MXVL 2ZSWB 3MROA 4ONFH 3UTTD 2GSGB 1D9KB 1TZGL 1K8DA 5HYEA 1E4KC 3KPSB 1UACL 1YMHB 1XH3B 4CBPA 4M4PA 2GCYB 5EBLB 4QHNB 3O6KL 3V4PH 4OLZH 1F90H 4L29B 5T1LD 3HC4L 2OZ4H 1YEIL 4LAQL 2AAVA 3JV4A 3VXOA 1C08A 4DKDC 4MXWH 4XWGH 4G6JL 4RISH 3BN9D 2IH3A 5HBBA 4FZEL 3P4MB 1YEFH 2Q20A 4QRPB 5GQBA 4JCLA 1I3UA 5BO1L 4JANB 4ELME 4WFEE 2FHFA 3BUTA 4TVPD 4X4ZA 1WBXB 1KIPA 2FWOA 5HD8C 5IIEA 4JGUA 3K81A 4S0TD 4ONOA 2UZYB 4YHYC 1IKFH 3HMWH 3LVEA 3BKMH 5FGBA 4XC3L 5BV7L 1KXVC 1L0YA 1MPAL 2R2CA 2W1NA 1A1OA 1BZ9A 2EIDA 2QJDA 2WAHA 4OFVA 4XPHL 2FLBT 3LQAL 5E00B 4LVHB 1CDJA 3EDDA 4U1GB 4U6VH 3WIFB 1P4IL 5D2NA 1FVCA 4NN5C 1TCRB 4LGSB 1DBBH 1G1YA 2HT4C 3BP7A 3MJ7A 5HHXL 3FFCD 5T1MB 2QHLA 4WUUD 5E8EB 4C54A 1YUHA 5KN5B 1L9NA 1EZVY 4FXLA 3TIDB 4MAUH 1MHHB 2X1XR 3HUJE 1YC7A 5JHDB 4X7CC 1WT5C 4JM2C 1ZHNA 2YWYA 3MRDB 3G6AA 1QSVA 5H2BA 5HVHB 4LP4A 3BPLC 4P9ML 5TF0A 5D8JH 4ORZC 2WINA 3L5XL 4NT6B 3FL7A 1MRFH 1KTRL 4JRYD 4MZ2A 4R8WH 3NABH 1UXSB 3CX2A 4TSBL 4MA8H 4JFFB 4N5EC 3REVB 2LTQB 3VFGL 2XACC 4Y5VA 5I73C 2AJUL 3QQ9D 4GG6B 4MNGE 4WI4A 3LKRA 2I5YH 3G6JE 5IB4B 1LWRA 5DRXB 4P5MB 2ZCKH 3IDJB 5JW4M 1UA6L 1JE6A 5DO2C 3UBXB 4QYOB 2QADC 1IGJB 4X6DB 1NMAH 1S7WB 4JZOA 4M8QA 1A3RL 4DZBB 1JHKL 3HNVH 5EBWA 3EO9H 4MXQD 3IF1A 3ZL4L 1AY1H 2F8XC 3U7YL 1TVDA 1CLYH 4P46A 5HY9B 4G5ZH 4R96B 1TJHH 1WFTA 5C0ND 3IDYC 1D5XB 2N1KA 4MA1B 1G7JA 1FSKC 1TIUA 5JO5A 2VZTA 5A43C 1MHEA 3AREB 3MO1A 4QRUA 1ADQL 2NTFA 2B4CL 1C5CL 2VQTA 2DBJA 1XCTB 5TF1H 4XXDA 2IPKB 1QYGH 1Q9WB 2Y4SA 3FO1A 2E7HA 1SQ2N 1ZLSL 4H25B 4JO4H 1DQDH 1EERB 3DXAE 4F37F 3LKOB 1A7OL 1BX2A 3O3AA 2YD4A 4NDMB 3VGDA 3OF6D 3UJTL 2D4FA 1N64L 4AQOA 1WUNT 5C08A 5FK9B 1CZ8L 5IUSA 2EDOA 2VXUL 1YPZF 4MAYA 4J4PC 2GJ6E 4X4ME 5IEKA 1CK0L 3CC5A 3MV11 4Z5RB 4TSCH 2JJVA 4O51A 1YEGH 2Z8RA 5HJ3B 5T3XD 5CJQH 3MBXL 5D1ZC 1G6RH 2HJFA 5EOTB 3N9GL 5C7XH 1E4XH 2G5BB 5ICYB 1K8IB 1TENA 2O5YH 3VW3H 1X5KA 1JI2A 1T7YA 4HULB 3MLSL 1NGQH 4ZUVB 3QEQD 5CWSA 5FOBB 1FAKT 1MELA 1IT9L 1QLRA 2BDNH 2H3NA 3LKPA 1KXTB 1QSZA 3HS0B 5F93C 4JFPA 2IPUG 2VZVA 2VLLB 3TO2A 1YEHL 2RCSH 3WLBB 2I07B 3MNZB 3GJFA 5BOPA 4AG4H 1I1AC 4D0DB 2YPLD 4I18C 2VO5A 3BEWA 3M8OH 2D7OA 4Y5XB 3DVNB 4HWZA 3VXSB 3LDBC 1Q94B 1L6ZA 4GRMB 5H35A 4H0IA 5I15L 1RSFA 2F74B 2BMKB 4OGAD 1WBZA 4KC3B 3IJHA 3L6FA 4XXCC 3EDFA 2JF1A 3T2NL 4Q9QH 3QWOA 1ORQA 3IFOB 5KVEH 1U0QA 5TH2B 3IRPX 1MLCA 2XYCA 1A14H 3B3IB 3MQIA 3CUPB 4WHCA 4K7PY 1BP3B 3SQOL 5B3NA 3FQUB 1XIWA 4AZ8A 2VXSH 4GS7C 1TCMA 2IFFH 5I16A 2EC9U 2PKDA 3L3OA 3TH3T 3WN5B 5GGUA 2FZ3A 3QUKA 2BX5A 3C5ZC 5E56A 1NBVH 2G60H 4F8TA 3BGFC 3ULUC 3DMMC 4YX2L 1OGTB 2WWKO 4XCYA 2O5XL 5J56B 3WFBH 1T2JA 3ARTA 2B0SH 3CZFB 3TZVA 4Q6IB 5I8OH 3QJHB 3TBTA 4P59H 2M2DA 3HAEA 3HZVA 3NPZB 2Q7YB 4LLYA 3G04A 1A6VL 5GRUH 5HHNB 5F9JA 1PD6A 3RIAK 2D7MA 3PWVA 2CR6A 4AENA 5IT2H 3MYJA 4P5TA 4QHUA 4QOKE 3C6LA 1NCWH 3QEHB 4NFBA 1LEGA 2HRPL 2V7NB 3CU1A 2G5RA 3QFDB 4JRXA 1LO0H 1T1YB 3ME0A 4LLWA 2P44B 4JGJA 1VESA 3VD5A 3CXDL 3VD4A 4Z8FH 5DJCA 1MVFA 3NFNB 1AD0B 1ZOXA 1T03L 5CGYD 3RI5F 5HVGB 1HEZA 4GG6F 5J1AB 1QRNA 2VLKB 4U1KA 3MNVB 1AXSB 1A64A 2XPGA 4J12A 1G9ML 2OJEA 3NBNA 4YQXH 4QRTB 1M05A 1DDHA 3S88H 4D3CH 3RVUC 2GUOB 4X6DF 3D9AL 1YYMH 1Z9MA 4MA3A 5A40E 2RFXB 4CJ1A 1K4CB 2Y06L 3IKCB 3VG0H 3VXRD 1FYTE 5HYSA 3C87A 1CFNA 1FP5A 1VHPA 5M7QA 4ZYKA 2NXYC 3VFPB 2VLME 2XTJB 3FO2B 4LLAA 4C59B 1BF2A 5ENWB 1S7QA 2AEWA 4ZO8A 3SKMA 4LQ1A 4LCUB 3QUXD 4G80A 4P2RD 1GZPB 4ELMB 5CAYB 4R7DA 1E4XI 3RWHA 2OYPA 3ARUA 1T2QH 2YBRB 1U95A 1BJ1J 3U4BL 1RAMA 2EECA 4M6OH 3O6FB 4ZTOL 2DAVA 2DMKA 5BJTB 3H9SE 2X2YA 4OLUL 3MXWH 5B4MD 4YFLF 4KZEH 2BY0A 4LDOB 5HHOA 1SY6L 4M3KB 4OCSL 1F11B 1CL7H 3TIEA 1H0DA 3WFEH 4NFCA 3DBXB 4N0RA 4GAFB 1FZJB 1S9XA 2AABL 3VDCA 5F9OL 2AXGB 3I2CL 1P7QB 4RSVA 3GMLA 1TTFA 1ND0A 4XH2A 2DJSA 5L2KE 1RZ8A 2JLLA 5FHAL 1TJGH 3WEXA 3QCTH 3U7AA 2BHYA 2NX5D 3HG1E 5EU3B 3KYKL 1IARB 1AC6A 1T0NB 1YN7A 3NIDF 5IBLD 4HK0A 2J88L 1A1MB 3NPSB 4WI3A 2NY6D 4ODTL 3RX7A 4RX4D 3P73A 4WJ5B 3GKZA 3U7WH 3CD4A 5FYJE 5J4MA 3VFUA 3BH9B 1Q0XL 5GS1C 4FP8L 3D0VB 3ESVF 2PW1B 1JPST 4Q74A 3RDTB 4YIQA 3BO8A 4ODXA 4ZXBB 1WGOA 1JHLH 2XY2A 2XV6B 4KTEH 4LDLB 2ZCHL 4X6EA 1T20B 2EDYA 4Y88A 4J7RA 1H15B 4HJJL 3T65B 1EPFA 4OCXL 1N4XL 3D18A 4R97C 4M48H 2P1YA 3GJEA 1YJDC 5BQ7B 4OJFL 4NQCD 2F15A 3NN8A 2VXVL 4PGDA 4Y5YB 5CP7B 5HDBF 5HGHB 3NGBC 5I75B 5IQ7L 3NCMA 4MQTB 3RUGA 4U2ZA 3HLAB 3PE9A 4IOSD 3OKKA 2R9HD 3K1KC 4OCWH 2Y7QA 3ARGA 3BVNA 4JFDD 4LF3A 4KPHH 3MRMB 4P4KB 4JKKA 4KKCD 4HXBH 2DQUL 1DQML 1EIBA 5KW9L 2HFFA 4YAQA 3KXFB 4P2QE 4LOUD 5DT1H 1VSCA 5JNYB 1X5ZA 2DQCH 5KJRH 4ZO6A 1JGUL 1Z5LA 5ESVA 3LKNA 5HI3D 4HG4J 3I02B 1KYOK 1TZHA 4OTXL 4KK6D 3UJJL 1DQLH 4Z7UF 1FNHA 1P6FA 1KTLA 3QNZB 3SDXE 2X89D 3V5KA 5I17B 4X8JB 1ONQA 3QNYA 2WWKT 1KB5L 3ZDZF 1FE8H 1A2YB 2FGWH 3H42L 4XPFL 2Q6WB 3SO3C 3U79A 3EFFB 3LHPH 3QQ4A 2H6PB 3DETC 4ZO9A 3AAZB 4NUGL 1J0IA 1JNLL 5GS0L 2IAND 3HPJB 5BZDB 1FNGA 1J86A 1JF1A 3VXUD 2R29L 3KLHC 1ZHKA 4HLZG 1LO5B 2IQ9H 4M9OA 1VPOL 4JY4A 2B20A 4ZTPL 4O2EB 3HE6B 4V1DB 5E2VL 5IG7A 5LWYL 1ETZB 2ZUXA 1IQWL 3BDBA 3RNKA 2MQ3A 1Y0LA 4XBPB 3TCLA 3TC9A 4WV1B 1G7LA 2FATL 5HHVH 2VXTH 3MA9L 1A9BA 4G7YH 3RWIA 2HWZL 3O9WD 1AQDB 1H5BA 2P5WD 3BHBA 4NC0B 4OGXH 5DHVB 1ZT1B 5EFIB 3WNKA 3RX8A 5LGKA 4WW2C 4MJIB 1JV5B 3U30C 5E95B 3VFVB 1KN4H 1KG0B 3AC0A 2WW8A 3RWDB 5LAXA 4POZC 5J1TC 1D3CA 2H9GB 3WS3B 1JGVL 2EXYD 5DJ6B 2XRAL 5FM8A 1HHGB 2B1AH 5DF0A 1RVFL 1OW0A 4C58B 1ZSDA 5I76B 5I9QC 2R2HA 4G42A 2X4UA 4FG6C 3U4EB 1RUKH 2NY0C 1SYVB 4ELMF 3PL6D 3X3GH 4YJZL 5DD6B 2P8MA 3CSGA 5DS8B 4P9HL 4IRZH 3PWNA 4NKDB 3DO3A 3W9EA 3UJIH 1JNNH 4NZRL 1AO7D 4XP1H 2A6IA 1IRAY 4G8GE 4ONFL 5DHYB 1IM9A 4Y8AA 1GOGA 4UZGA 2VL5A 3F58H 5CJXA 3MA7B 1NBZB 3IT8D 5CEZH 1QKZH 4L8DB 4Y4KD 1FNFA 4J8RA 1WAAE 3RKDC 4Y8DC 1OGAD 2KQMA 4Y4HB 4D8PA 2PF6A 3O3DB 3V4PL 5HPOA 2OQJB 4OLZL 1F90L 3QCVH 4DWHA 2OZ4L 4PJ5B 4PRHE 4BELD 3B8YA 2G2RA 3MLTA 4PJXE 4MXWL 1I7RA 3GSRA 4PGCA 4XWGL 5GSRB 4RISL 5JA9A 3EOYG 1JPGB 2XFXA 3NCBB 1YEFL 1U8OB 2I25N 5FYKD 3PGCB 4CRPA 4DVBB 1X5GA 5JXAH 4ODWA 1QPPA 4QTIH 3OKDA 2VLRA 1HQ4B 1QNZL 5TGBA 4XMLH 3KYMA 5ISZD 3PWPE 4I5BB 1J5OH 4Y19B 4G8IA 1IKFL 1WZ1H 3HMWL 3BKML 1ZGLB 2DQJH 3EW3B 1PGRB 1FZMB 4QGTA 3W0WB 7FABH 2IAMD 3N1GC 4HKJB 2ITCA 3STLA 3UMTA 5EOCJ 3LS5H 3SKUD 3WFCH 4UMGA 4MX7A 2OR9H 1MAKA 3I3DA 1HH9B 1PVHA 4U6VL 2ERJB 2NY3B 4AM0A 3KPSD 3B5TA 1DBBL 5EZLA 3PWUB 1CS6A 3SQBA 1JPFB 5ALCH 1T3FB 1QLFB 4JFOA 5TDPA 4G7VH 1JGEA 4IRSD 4MAUL 4X5WA 5D96C 2YZ8A 4TNWF 1HHHB 3QWQB 1DJSA 1IEAA 4ZMAT 5D8JL 1MCLA 5EO9A 3ZE2E 3QBTB 2HJLB 1VFMA 4ZPVA 1MRFL 4TUJB 4R8WL 3AM8A 3NABL 5E6YA 4UNUA 1AP2A 1C12A 4HBQA 2B2XL 3H9SB 4YNYA 15C8H 4MA8L 5GGSB 4X4MA 3QIBA 3T4AA 2XWJB 4CW1B 2WANA 3SGJA 5J13C 1VGKA 4A2MA 4NQVA 3ZKXB 2I5YL 1RIVH 4OBSA 4L3CA 3SOBH 2C3VB 2ZCKL 5KSAA 2JJSA 4MHHI 1DR9A 4N1EA 4PGZA 3SDAC 4JPIA 1NMAL 3T77B 5A3IC 3HNTH 3SDCB 3HNVL 2GTZB 3EO9L 3BP6A 3ARWA 5H8DA 1EEYA 1AY1L 1CD1B 5ICXB 5L2KB 4G5ZL 4A6YH 2V2XB 1KCRL 4HJ0C 2EKJA 2UY7A 2PXYC 4WI9A 4XNXH 1A6TA 3LEXB 4ZDHA 2BY2A 3UPCA 4ZG1A 3EKCA 4PGJA 2GY5A 4DJMA 5E9DE 4CADB 1X5HA 3M1BB 4Y2DD 3VFNB 5TF1L 4YHPB 4JPWH 4ELKA 2Y36H 4O58L 4JO4L 1DQDL 4K94H 4ONGH 3UPRA 3QB7C 1GL4B 4NYLA 3MBEB 5ACLA 1RU9H 4Z78A 2O26U 4HUNB 1N5AA 5SV3A 2KBGA 3H3PH 5CSBA 2C1OB 2X4PA 4NQEB 4HC1H 1W0WB 4HMCA 1QSEE 4JPVL 3IDXH 4TSCL 4LCWE 1YEGL 5CJQL 1BD2A 1B0GA 5KVGH 1G6RL 3U0WH 1QSFE 4IEFB 3CMGA 2CLZB 3MRBB 4JJ5B 5C7XL 1E4XL 1BFOA 1QOKA 3CDFA 3G08A 3GHBH 3BDYH 2O5YL 3VW3L 2VLJA 1R3LA 4DZ8B 1UQSA 2AQ2A 3IDGB 3ZTNH 3T3PF 2D7QA 3VFTB 3KPRE 4PY7A 2NYYC 3LZFH 3EJJX 1R24A 4M7KH 3IXTA 4XZUB 2Z92B 4ALAH 5GS2H 2RCSL 1WIUA 4Y16C 4JE4B 5IMOA 1NMCB 3CCHB 4AG4L 4ZNEA 2IBZX 4N5UA 3PDOA 2A9MH 1HHJB 3VXMA 2V17H 2BXYA 3IFPA 3O2VH 4ZFFA 1TQCB 1E28A 3M8OL 2MKLC 1CT8B 4JRWA 1G7QB 3FHAA 3R06A 2FEDD 4MLSA 3O6LH 4B53A 5CHNA 4NQDA 3LQMA 4RGND 1U2HA 1UM4L 1YY8A 3QO1A 1KIUA 3QUMB 2P8LB 3ZDYE 3FTGA 2D4DA 3L95A 4KJQC 4Q9QL 2JJTA 5KVEL 1YQVH 1K6QH 3FQRB 1EJ6A 1CN4A 1A14L 4MA7H 5J12C 2KL6A 3C2SA 3OHXA 1GRWA 1H9VA 2VR4A 4NQXA 4LSRH 3PGDA 4R3SA 3MROB 3TFKC 5DEFB 4BA8A 2VXSL 2UZXB 2C5DC 2IFFL 3ZE1E 1K8DB 4JZJC 3RRQA 1AH1A 4PRAB 5E08H 4F58H 2YPVH 3I84A 5K93A 1MHCB 4LVNB 1NBVL 2G60L 4PG2A 4QRSB 1FYTA 1BWMA 3D3VE 5CEZE 1RUAH 3O2DA 3F7QA 1SJEA 3SDDD 1PX4A 3VD7A 2B0SL 1X9QA 1C08B 5I8OL 4J3TA 3VXSD 5CCKH 4P59L 2IH3B 3VGAB 2AV1A 1XGQA 4XNYH 3HAEG 5DZLA 4ORGA 5GRUL 4PJFB 3O41A 5I1HH 4WU5A 4XBGA 3DX9A 3QPXH 2DL9A 2FWOB 1KPRB 4PJAA 1AE6H 4WI5A 5IIEB 5IT2L 1AXTH 1U8HA 1NCWL 1EFQA 2GYSA 4OAWB 4HIJA 1LO0L 1KACB 1C16A 3H2WA 1A1OB 1BZ9B 2HVJA 4RFOH 5I6XC 3PWLB 2SEBB 3HE7B 4HK3N 4LLDA 4NBYB 4Z8FL 4Z7OE 1LMKA 3GMRA 1B4JH 1JZ4A 5D2NB 1RZFH 3V6OC 1YEEH 1FVCB 5D1QA 4GLRH 3MJ7B 2DWEB 3ESUF 3VWKC 2JCCE 4OGYH 3ZO0A 5GZNC 4YQXL 1YUHB 1Q72H 5SWQB 3S88L 2PYEE 4G9DA 5CMAB 4D3CL 1YYML 1KC5H 1FL5A 1QFUH 1G84A 4GAJH 3D69A 3HG1A 2F53E 5HYSG 3G6AB 5H2BB 1R3JA 4K23H 4C83A 4BSJA 2V9TA 2WINB 2BNQE 3RVXC 2OXGA 3GSQA 3U1SH 4KK5D 2YD9A 2P4AB 3W5MA 3LOWA 4PY8I 3MYZA 1P7KA 4KKNA 1KV3A 3QJFA 3LSOB 5IBUG 1X7QA 5DVMA 2F8VA 4K3HA 3MJ9A 2HJKA 4AH2B 1IAKA 4J1UA 3GSUB 4L4VA 4Y1AA 4Y5VB 4Q9CA 1XF4A 2FNBA 2D0GA 4JY6A 1OAZH 2UZIH 1RZIB 3LKRB 4OLXH 2JIXA 1DVFD 4M6OL 4R0LA 4LIQE 4K3DH 4Q2ZA 5K33A 3TT1H 4XPAH 3KPMB 2F19H 2EC9T 3MXWL 3CSPA 4JZOB 4NCC2 4KZEL 3NPSC 5EBWB 2VLKD 2VERN 1BVLA 3VFMB 5H37G 1CL7L 4HIXH 2Y1VA 2ZUQB 2P46B 4ZAKD 4BK5A 1A22B 2FSEA 3CFKA 4QHLB 3UPAA 1Q0YH 5ICZA 3WFEL 3V0AC 3BN9C 2Z31A 3HRZA 5L0QC 4X5XB 1S7TA 4FRWA 5JO5B 3BGMA 4L4TB 2BZDA 1WQVT 1MHEB 3MO1B 4QRUB 2ADFH 4AEIL 2NTFB 4LKXA 1K9TA 1NC4B 1MJ7H 2X4RA 1TJGL 1F6AA 2C1PB 2IADA 3QCTL 5I18L 4XXDB 1LNUA 2W9EH 1S7RA 3DV6A 3FO1B 4U4BA 1YY9D 5HYQA 3SKJH 4JVWA 2EEDA 1T5WA 5I66B 1ZEAH 2ICWB 4WFED 3O3AB 5JORA 1FIEA 3U7WL 5C08B 5I1EH 4PJIE 5FA3A 4U6XA 2LABA 5FKAA 4MAYB 4EBQH 1GC1H 5IEKB 4NN7C 5EZJA 1I85A 4D9RE 5DI8B 4EI5A 3B9EA 1DUZB 1JHLL 4R9HA 3GM0A 1GZQB 4KTEL 4D0CB 3IDIB 5C0BE 5IQ9A 2P45B 2HJFB 4IRJA 5EC1A 1UH4A 5J57B 3KJ4B 1WICA 4NO3A 3MLVH 4M48L 5TDOA 3Q3GA 1NUNB 2VOTA 3ZTJG 2UWEE 1JZ6A 1P7QD 4XNUH 1QLRB 3LKPB 1GPOH 1Q9KB 5C0DB 5J3HC 5IJVB 4JFPB 5H94A 3TO2B 5I19H 1UWEH 4H1LB 4QT5A 4XNZC 3GJFB 4OCWL 3KVQA 4KPHL 1WC7A 3R0MA 1IGCH 3BUYB 4HXBL 2NPLX 5EOQH 1LQSR 3OGOE 3BEWB 5KSBE 2X42A 2X41A 1T7ZA 4R6UA 4JFZH 2X1OA 2NW2A 4ZSOA 5DT1L 4OD2A 2DQCL 5DEGB 5KJRL 5C0JA 2A73A 2NR6D 4MXQC 3QDJB 4ZXBD 2HMID 1DQLL 1HHIA 1YEJH 3QWOB 2GJJA 1ORQB 4GLRI 4MJ6B 3HR5A 1XAUA 5EU7E 2Z8SA 1MLCB 1FE8L 1BEYH 2FGWL 2PYFA 1J11A 4PJFF 2OR7A 1QSFB 3P30H 3LHPL 3MFFB 1XIWB 2X9YA 4CN1A 2X10A 3RGVA 4E5XA 3MR9A 3O3BB 5AG8A 3L3OB 1RQ5A 1U8LA 5GGUB 5ACZA 1J0YA 4PTUA 2HTLD 5I2IA 4G8GA 4P4KD 2IQ9L 1BJ8A 1GIGH 3CFBA 1PQZA 1CDHA 2IGFH 3JTSB 4X7SH 2Q76A 5BXFA 1J8HA 2Z35A 5GJTH 8FABA 2R1YA 5E6IA 2MHAA 3TH2T 3TBTB 3DXAD 3T04D 6CGTA 5HHVL 1OVZA 2VXTL 4G7YL 4OGXL 3HZVB 3DSNA 2AK4E 3AU1A 3SE4C 4FQJH 4LASH 4ZODA 4LLYB 2OSLA 3G04B 4RGMB 4NRZB 5F9JB 1KN4L 1AC0A 5ILTH 1CD9B 2GJ6D 3VMNA 1HE7A 3PWVB 1IKNA 4AENB 4NNYA 3MYJB 4QHUB 3C6LB 1QR1A 1LEGB 2B1AL 2N7BA 2P24B 4JRXB 3GSOA 4PJXF 4Z7WA 5GS0D 4LLWB 1MCJA 1QFPA 3BD5A 4J3WA 4HIIA 1I8MA 1RUKL 2Q8AH 1AD9A 3WNPA 2VSDA 1O5DT 1EBAA 1SBSH 4BH8A 1HEZB 2XY1A 4U1KB 4IRZL 4GW4A 4MXVF 3NCJH 3N1MC 3BYTA 4TRPH 3BRDA 1X44A 4UIMA 1M05B 3UJIL 1DDHB 1JNNL 1SHMA 5D1XB 4XP1L 1QA9B 2XKNB 4MA3B 4HUUA 4I48B 5F1OB 1A6WH 5HYSB 5FDWA 4OGAC 1E4JA 1CFNB 2VL4A 4H8WH 5GGRA 4ZYKB 4HHAA 1JF6A 3RIFF 5CZVH 5D72L 2FIKA 3F58L 5HGAB 1Y18B 1S7QB 2DJUA 3SKMB 5KAQG 5CEZL 1JBJA 1QKZL 5BMFH 2R56H 3NOIA 1GH7A 3WIHA 5L2JA 4G80B 2NZ9C 4GXVH 5IBUB 4I4WA 4FQHB 4HUMB 3QCVL 4R7DB 2I26N 5HTSA 3FB7B 3C5SA 3KDMB 1OTUD 1FZKA 1E27B 4NZJA 4RA3A 5CIPH 5F3BA 5JXAL 3DTXB 4QTIL 1ED3A 1ACYH 5HHOB 4XMLL 4HGWA 3EDKA 3IDMA 1J5OL 4XX1E 4TYUA 1S7SA 3TIEB 1MCSA 1WZ1L 1H0DB 5HDLA 1UC6A 3S3SA 3E3QC 3X17A 2K3TA 2X7LA 7FABL 4PP1D 2A2QT 4Y0GA 1ND0B 3LS5L 2DWDB 3WFCL 2PYEB 1RZ8B 3JWNC 2OR9L 3C6SA 3GO1H 4LRIC 4AIZA 3I75A 3DUHA 2R2BA 3D25A 1YN7B 5TQ2H 4HK0B 3MRIA 5ALCL 3GUTA 3BIAX 4BYHA 1B6UA 4G7VL 4GQPH 2UVEA 3S98A 3QI9A 4YGVA 4S10A 3P73B 1AIFA 3VFUB 4KGLA 4JO1H 2CKBH 1WTGT 3Q48A 5CGYC 1L7IH 4L9LC 4UUJA 1E4KA 3OV6A 5D6DC 1FVDA 2BSRA 4QOKD 2RJMA 3SE8H 1C5DA 4YIQB 3ZKMD 3BO8B 3L5WA 5DFVD 5AAMA 1A9EB 1OTTC 4X6EB 4APQA 3TGXA 3VE0B 15C8L 2CRMA 2VQUA 3MOAL 1QVOA 1YNKH 1S8DA 3K46A 1FAIL 1UB6A 1MWAH 5FCSH 5GRYA 2EO9A 1KGCD 3PP4H 3D18B 3GJEB 3QDAA 3OKEA 1UM5H 3W0WD 2ZUWA 3SOBL 5D2LE 1PZUB 4I8DA 1N2RB 4NBZB 2W59A 4PGDB 2CPCA 2NY3D 1T83C 3RUGB 3HNTL 1T04A 4KRNA 2LV4A 2Y7QB 3ARGB 3AB0C 3BVNB 4LF3B 5IESH 1HIMH 3MUGB 1WIOA 2VLMD 4A6YL 5DRZA 3MV9E 5D7JB 5FUZH 1QHPA 3PF2A 5I71B 1RZKC 4XNXL 2OJZH 4HS6B 2KUTA 4MGXA 3H9YA 1FJ1A 5DC4B 3QA3A 1ACZA 4U3CA 1Z5LB 5ESVB 3LKNB 4QY8A 3RPIA 3ARVA 4LAJH 4S0SD 3TVMA 1EGJA 4I0PD 4JPWL 3UTSA 2YS4A 4F8QA 3UTZA 2Y36L 5CZXC 4ONGL 3H9SD 4LSTH 1KTLB 5FHBH 2EDHA 1EX0A 1BGXH 2DN7A 3GSNA 1ONQB 4PRBA 1RU9L 4ERSH 1ORSA 3AGVA 4JQVC 3H3KA 3H3PL 3QQ4B 3L9RA 3PHSA 4JQIH 2Q3ZA 4ISVB 1FL3A 3MRHA 4HC1L 5EU6E 3RBGA 3IDXL 2R23B 1FNGB 2BRQA 4LLUB 3ZDYF 3SDCD 4NQUA 5KVGL 1ZHKB 5FV1L 1T7WA 3U0WL 3D1MC 1KPVA 4DTGH 2IWGA 5L2KD 3GHBL 4JY4B 2R0LH 3BDYL 2VB5A 5IG7B 3LQZA 1AKJB 1RY7B 3ZTNL 2A6JB 2AJZA 4OZGE 3QIWA 3RNKB 1NQBA 3QHFH 3CJJA 1G7LB 3LZFL 1ZV5A 1JTOA 1A9BB 3M17B 3RWIB 4M7KL 4GRLC 1H5BB 3BHBB 4ALAL 2A77H 1MF2H 4OV6F 5FYJD 4POYA 3QWRA 2OK0L 5DJ8A 2FLRT 2Z93A 4NZDA 2JK5A 3A6CH 1B0RA 3MBED 2V17L 1F3RB 1R5WA 4MDIB 1BIIB 3P4OB 1CU4L 4L3EA 1ZSDB 4NHUA 4UQ2A 4G42B 3HMXL 3DX6B 1NDMA 3BH8A 3O6LL 5EUOA 2C4XA 3RL1A 2P8MB 1F4YH 1I8LC 5D5ME 4KKCC 4PGEA 4NO0D 5CFHA 2GQHA 3PWNB 3W9EB 1YQVL 4LOUC 3LN9A 1K6QL 3VRIA 4MA7L 1NCDL 1TITA 2DQFA 4QF1A 4L4JA 5JOEA 2ED7A 4W4OC 2Y72A 2F58L 1EEUA 1IM9B 4KK6C 5D1ZA 4O2CA 1FNEB 3K0WA 1X4YA 2VL5B 3WXVH 4P2QD 3V4UH 5E08L 4F58L 2YPVL 4OIIH 4E42B 1W72A 5JIHA 1X5LA 4J8RB 4C55A 1PG7W 5BW7C 2F53A 2JCCF 5J6GA 1PLGH 1RUAL 4D8PB 2P8PA 4ODBD 3GMMA 4YHNA 1MY5A 2BNQA 5J6HA 2G2RB 1J88A 4PGCB 3GSRB 5CCKL 2BVEA 4OFPA 1BHGA 4XNYL 4RMVA 3O4OB 1J0HA 4ODWB 5AWNH 4WI8A 3C5JA 1I1AA 3GMPB 3OKDB 4KQ3H 5I1HL 4XCNA 5TGBB 5FUCE 1QTYT 4NC1E 1KUMA 1RIHH 3THMH 3QPXL 4YUEL 1W2KT 1AE6L 1WTLA 1FV1B 4MQSB 1ITCA 1AXTL 4G8IB 1JYVA 4CVWA 4HDIA 4EUPA 1W8NA 1JYWA 5FB8A 2CIIA 3O9WC 1WV7T 2J8UA 4RFOL 3WNLA 1UKTA 2NW3B 1EA9C 3AXLB 4XXCA 5FO9A 3TV3H 4MX7B 4NP4H 4ZFZA 2XWBA 1B4JL 4AM0B 1NFIA 4XB7A 1RZFL 1YEEL 1V05A 5JPNB 1DSFH 1KNOA 1NLBH 2QSVA 5DDHA 4LSPH 2EXYC 3JWDH 5K9KB 5EBMA 4QO1A 3GZKA 2B5IB 3QHZH 4OGYL 4JFOB 3MTRA 1Q72L 5TDPB 1KIRA 1JGEB 1KENH 5C0CE 1KC5L 3FB6B 4GAJL 4X5WB 5CUSH 1UJ3C 1JZ2A 2KH2B 4OQTH 3RUGF 2X1PA 3ARDB 3BD4A 3PL6C 1MFEH 3WS6C 1YQ2A 1ZMYA 1Z0MA 3FOMA 3N06B 1IEAB 4K2UH 3C5ZA 4K23L 5D4QA 4P46C 4R2GC 1U3YA 5EO9B 4ZPVB 1S7VA 1C5BL 3DMMA 4X6FA 5C86A 3U1SL 1UB5A 1KCSH 4PJIA 1C12B 2O5ZH 4YNYB 4GKSB 5MEPB 3QIBB 3T4AB 1TQBB 4DQOH 2CKNA 3VGFA 5J11B 4JFXA 3WD5H 1VGKB 3MLZH 1LE5A 4NQVB 1OAZL 2UZIL 3G6DL 4LU5H 3ZHKA 1BLNA 4OLXL 4L3CB 2F54B 3AS3A 1PKOA 3HE7D 4K3DL 3TT1L 4XPAL 4Y4KC 1NCCL 4YR6A 1YDPB 2F19L 4JPIB 4JFEE 2NNAB 4IS6A 3D48R 5KS9E 3BP6B 1EEYB 4U1IA 2UWEA 2HG5A 1Q0YL 5CD3A 3IKKA 3V95A 5DRNB 4EN3B 1WSST 1T0MA 2APTA 1JNHA 3HI5H 2GK0A 2AP2A 3OJMB 1A6TB 2VUOA 1OT1A 4ZDHB 2ADFL 2GAZA 3QDGE 1OSZA 3P3YA 1I3GH 4XI5D 1MJ7L 4OZIB 4PRHD 5IVXA 1OAYH 2W9EL 4ELKB 2YEZA 1HHKA 3UPRB 3I3EA 2VDOH 5DUBB 3SKJL 3FMGH 4PBXA 1ZEAL 3CSYB 5KSBF 4F7PA 2IAMC 1LK2A 2B7DT 3KPQA 5HI4D 5I1EL 5L88H 5LG1A 3PWPD 1P5UA 1VB9A 3MLYH 5T3XH 1DQQB 2FD6H 4L3AA 4EBQL 1GC1L 1YMMA 5IMMA 1FORH 3GSWA 1P2CA 2DLIA 4KROB 3CK0H 3WFDH 5FM5M 4MNQE 1BD2B 3LN5B 1I1RA 1B0GB 3WJJA 1WVZA 3CPLA 3T0EE 4IRSC 4WU7B 1CFSA 3V79C 4Z95H 1BFOB 3O4LA 2UV3A 3PG2A 2VLJB 5D7IE 2OTUB 4ETYA 1UQSB 5CEXA 3MLVL 3QP3A 1CICD 1X3DA 3IU3A 3ARFC 4L4TD 4PY7B 4XNUL 1GPOL 4HZAA 2NXZD 1NC4D 3IXTB 2APBA 4GAYA 5SX5H 5BV7C 3DRQB 5I19L 1UWEL 2ORBH 4FFWD 3LV3A 2WMPA 3BPOB 5IMOB 1UT9A 1WCBA 4PLKC 4HCRH 3WKNA 3LQAC 1IGCL 3B6SA 4HUVA 3VXMB 1CXIA 3IFPB 5EOQL 3FZUD 1E28B 1CDYA 1AGCA 2MNUA 4JFZL 5IR1A 5KAQF 3MRGA 4HS3A 4MAYD 3U0PB 1F13A 3CGTA 4U1MA 4YWGH 4F3FB 4NQDB 4WWKD 4LFHD 3KPLA 1YY8B 3E1F1 4PJEE 3QO1B 2GTWB 2FDBP 5DJ0A 3F5WA 5DMGC 2EE3A 2NY2D 4OKDA 5DVOA 3L95B 2BVPA 1FG2A 1YEJL 2JB5H 4KMTL 3TZVC 1U3HB 4LPWA 4Y4FA 2P42B 3MV8A 5GS1A 2ESVA 2A6DB 1BEYL 3OHXB 5LGJA 1BQSA 3DV4A 2QEJA 4HMDA 4NNXA 1KB9K 4NQXB 3FB5A 3PGDB 3P30L 4R3SB 1ZWIA 3RVVD 5LKNA 4Y2DC 4F15B 4OFIA 4P5TC 2LU4A 3EDJA 4L9DA 2GEEA 4KI5E 4K71B 4CU7A 1OAQH 4TNVF 3RVTC 2BVUA 4G9FE 3BKYH 4CVXB 1GIGL 3ROLA 1KT2A 2WUBH 1SJEB 2IGFL 3JZ7A 5E9DD 2F8OA 4OT1H 4ZUWA 4Z7VE 4X7SL 1TNMA 5ESQA 5GJTL 5K9JH 1PFCA 2FO1A 4KDTA 2AV1B 4R90H 4X99A 4TSAH 3W81A 3QDJD 4FQJL 2V5RA 4LASL 3PHOB 4ORGB 3O41B 4WU5B 4XBGB 3DX9B 5ILTL 2B4CC 1IQDA 1ULVA 4PJAB 1QSED 4FHBD 1U8HB 1T1ZA 2QL1A 4LCWD 5KSVB 1UXWA 4HIJB 1RJLA 3BPNC 2CD0A 3ARBC 4JVUA 1C16B 5LXGH 5FECB 1QSFD 1MUJA 1M7XA 6FABH 1XIWD 3O6MH 4N0FA 4U0RC 2Q8AL 3SPVA 4DFIA 1HILB 1HXYA 1SBSL 3F7YB 3KPRD 3DPBA 3X11A 5D1QB 3T1WA 3MUJA 3NCJL 1DE4A 4TRPL 1IGYA 5EUKB 4W70A 2ICEA 2XQYG 2CIKA 2FEDC 1FL5B 4R4BB 3VRJA 5JDSA 5CP3H 4RGNC 3REWA 4WWID 1A6WL 1PZ5B 1CE1H 4U33A 3HZYA 4RA0C 4H8WL 4C83B 5CZVL 1SMAA 4JRYE 4YDLC 5KOVC 3KAAA 3GSQB 4AT6A 1HK6A 2BSSB 5BMFL 2R56L 1DN0A 2AJYH 4GXVL 2VKXA 2HJKB 1IAKB 4J1UB 4L4VB 4Y1AB 1LILA 4OZIF 1XF4B 1RJYA 1OPGH 4JY6B 5JOFB 1CQYA 3ILQD 3GSXA 2JIXB 4R0LB 4WW2A 4Q2ZB 3RWEB 5D7LE 2E7MA 2WQRA 1ZHLB 4UNTA 3VXTB 1ACYL 3OTTA 3KHOA 3JXAA 3MRFA 1SJHA 4MJ4A 2AEQH 1RJCA 3SDDC 3MV7A 1CYGA 1NAMB 3FRUB 2FSEB 4OZHE 4MD5A 4TUOA 1ZT4A 4PRIA 3IJSA 5D1XD 5KSUA 2Z31B 1MFAH 3HRZB 5JA8B 2WK2A 5FUOH 7CGTA 1NAML 4QCIB 1HINH 1KJ2B 2EDFA 3D3VD 1AR2A 3TLRA 4LKXB 4K7FB 2ZKHH 1NGZA 3GO1L 5B3JE 1V7MH 2IADB 3MV9A 4Q7DA 4CN4A 5DMKA 1S7RB 5TQ2L 4RAVA 2ADIA 5DSCA 4FMKA 1T5WB 2OM5A 5EPMA 3HI1A 4QXTA 5JORB 2B39A 3BMVA 5F6HI 5SX5K 1CDBA 4PJDE 1J8KA 1I3RA 5D93B 4JO1L 3H7BA 2CKBL 4XHJD 5FA3B 4U6XB 2BNUB 5FKAB 3RWCA 4D9LH 1L7IL 1MCFA 4M61A 1Q38A 4YK4B 1DCLA 5EZJB 5I0ZA 3SE8L 2NY1B 4PRDA 3OB8A 3QCUH 1BQHA 2FYYA 1KTDA 2BERA 1CGXA 4IRJB 1IC5H 4HUXA 5EC1B 2EYSA 3ARPA 3UTPD 2CK0H 1YNKL 2EE2A 3OJDB 1MWAL 3QUYC 5E1AA 5EU6A 4NO3B 5T3ZE 2YN5A 2WSKA 4HH8A 1MVUB 1VFBA 3QEQE 1BAFH 1UM5L 5SX4H 2A74A 3NAAH 2EDEA 4KKAD 1FYHB 5F1KC 2PYED 4LCCA 3D87B 4N0YH 4GKNA 4H5SA 2BNRA 5H94B 3RZCA 4RMQA 2E6QA 1D6VH 4OZGA 1HYSD 2DF3A 5KANI 4NKOA 5IESL 1HIML 1WC7B 1HCFX 5F97E 1DVFC 5FUZL 3GMOA 2C3HA 4OZFB 4AEFA 2OJZL 2NW2B 1OQXA 3MRNA 4ZSOB 1CDIA 3WFHA 4OD2B 4P4RB 2QR0A 1Q9LA 1HYRC 4JAMA 4OF8A 1Y6MR 5GRWA 5C0JB 2A73B 3O8XD 2DBLH 4HXAH 1URLA 1NDGB 1QFWM 2HLFD 5DJYA 1HHIB 4ZAKC 2H8PA 4NSKA 3LPFA 3BW9A 4LSTL 4IOIA 2K7PA 2F9BT 1BGXL 3HR5B 5BS0E 2DOCA 4ERSL 2YMXH 2EDRA 1QLEL 3T0EB 2EE6A 5E03A 3QG6A 2Z8WC 3QULB 4JQIL 3AMLA 3G9VA 2XT1B 4PJAF 3MR9B 1MRDH 5J8OA 5E8DH 1UADC 2XZCH 3S4SA 3GMQA 1BOGA 5C09A 2OS7A 3FCTA 1KJVA 5I2IB 2JTDA 3KGRA 4DTGL 1DN2A 3T09A 2XN9A 5DJAB 1PQZB 2R0LL 5D7JD 4TUKH 3KS0J 2G9HA 2Q76B 5BXFB 1YC8A 5DZOA 3RU8L 1J8HB 3IRZA 2FJGA 2IH1A 1MCCA 1RZJH 8FABB 1FPTH 5E6IB 2MHAB 4P3WA 3MJ8A 3WDIA 3CXHK 5F3HA 1FVEA 4OF0A 3BZ4A 2A77L 1MF2L 5AZEH 1KOAA 2W91A 1A4KA 1K2DA 1R5VA 2VH5H 4D9RD 3A6CL 1QR1B 4N90E 2ZUUA 2QQLH 2K7QA 5C0BD 1UZ8A 4HGKC 3GSOB 3N85H 5GGVY 2R8SH 5DUMH 3O81A 2EYRA 3O2WH 3LS4H 4HIIB 1I8MB 1AD9B 4MD4A 2Q8BL 2X4SB 4HV8A 5F96H 4DW2L 5IW3A 2R0KH 3WJLC 1F4YL 4BH8B 2JE8A 4A2LA 1XGTA 4GW4B 3I9GH 3Q6GH 4UIMB 5GGSY 1AKJD 5EC2A 4UI2A 4HUUB 1NKOA 5FDWB 1MCPH 3TA3D 5GGRB 5JZ7D 4HHAB 4TTDD 4B5EA 3CFJA 3WXVL 5IVNA 3V4UL 1NUDA 1T89C 4OIIL 1N26A 4KQ4H 5L2JB 1SYSA 2ZZUT 3RWFB 2IMNA 5SWZA 3E8UH 1PLGL 4I4WB 4I2XE 4TQEH 3ULUE 4HIEA 3G5XA 2VISA 2Q86B 1HSBB 2BSTA 3QNXB 5BZWA 2C3XA 3C5SB 2ARWA 5IROC 43C9B 1FZKB 5B38A 4PJ7E 2HTLC 5GJSL 5AWNL 5T1DH 1ED3B 4KQ3L 1U8KA 2HRLA 5IMLA 3INUL 3THML 1RIHL 3IDMB 3U6RA 1JF5A 4KY1H 1S7SB 3KPOA 4OIAA 4EUPG 1P4LA 4M03A 1B90A 2ID5A 3JTTB 4YC2C 1CGWA 3AM8C 1F2XK 2X7LB 1S9WA 3LD8B 4MJ5A 5KS9A 3TV3L 4NP4L 1TZIB 1XF2B 3QIBC 3H0TB 2NX5E 3BKJH 5FDYA 4AIZB 5JIIA 4LBEA 4QRRA 1DSFL 3VWJD 1NLBL 2R2BB 3D25B 3NFPB 4LSPL 3JWDL 2W92A 2BVTA 3MRIB 3L5HA 5DLMH 3B8SA 5KSAC 5IHBA 3QDGA 4L1DA 2AK4D 4U1JB 5GS0C 1KENL 4HLJA 4YGVB 1INEH 4NKQB 3SCMA 4BKLA 1AIFB 5CUSL 5B8CC 4OQTL 4JZJA 1MFEL 4HAGA 1FVDB 2BSRB 2EIBA 1S78D 4K2UL 2AV7A 3QRFM 1LP9E 2V7HA 3MCLL 4GH7B 5DHXB 1A6ZA 4XB8A 5EIIA 1KCSL 3SKOA 2O5ZL 4B41A 1A6PA 2FHBA 2WWMD 1QVOB 2BHZA 3P77A 4DQOL 1S8DB 1UB6B 1DQJB 3WD5L 3MLZL 4GRWE 1M7IA 4LU5L 3OKEB 4FQ1H 4K8RC 3BP5A 2XZAH 1A6UH 3QIUA 1X5YA 2E6PA 5IB3A 2UYLA 5ETUA 3V5DB 5EZOH 3U36A 4YHYB 1T04B 3I6GA 1PDKA 2LU7A 2DQHL 4QHKI 3PWJA 2OTWA 5DRZB 3NCEB 5D7IF 2ZPKH 4MLIA 2JKXA 3HI5L 4P9HC 4D2NA 5JXEC 4TTGA 3ARDD 1GGIH 5I1GH 1KLGB 1UKSA 4AJ0A 3V6OA 3AFLA 4IOFC 1I3GL 4NN5B 2AJUH 3R8BB 3RPIB 1NCBH 5FGCE 4ZO7A 5C07A 1IAII 1OAYL 2BVOA 4M6MH 3QT2A 4U2YA 2Y25A 2VDOL 5T5NG 2BCKA 4JM2B 3RFZC 1J05A 4YGAB 3GSNB 3FMGL 1NC2A 4PRBB 1F4WH 35C8L 3VFRA 5BRZE 4X7DC 3LEVH 3B43A 3EYOA 3BPLB 1ORSB 5L88L 3MLYL 1E6JH 1OB1B 3JWOH 2FD6L 2F54D 1FORL 2ZCLH 3MRHB 2ICES 4WHTA 4QXUH 1A8JH 1NFDE 2BC4B 3ULSA 3CK0L 3WFDL 5FFLA 1N8ZA 3RWGA 4PJBA 4HKXA 4FABH 1T6VN 1A1NA 5D6CA 3UTTA 5I73B 1KPVB 5T5FL 2W0KA 4Z95L 2PW2A 1JJUA 4PRPE 1B0WA 1H8SA 1R5IA 4EN3D 3LQZB 2X1QA 5DQJA 1GSMA 2EDDA 2QADB 3IVKB 2W38A 3ZKMC 1U8MA 5EA0H 3BEVA 4HUWA 5DFVC 4J2XA 4NRXA 2JJTC 4PG9A 5LQBH 5T1LA 2HFEA 4F37K 4KI5F 2YR3A 2ORBL 3L7EB 3QISA 3FQNB 3PQYE 2C3GA 5FKPA 3IDYB 1RURL 3CFCH 3IFLL 3MGOB 2EIEA 1ZA3A 4HCRL 2JK5B 1FSKB 4LARH 3WCYA 1IFHH 3RY6A 3S3JA 1R5WB 2DTSA 4F7MB 2KQNA 1MIMH 1U8QA 2IEPA 4JFQA 4L3EB 2C9AA 2DQDH 4NHUB 4UQ2B 3D39B 3K8KA 1C1EH 1BQLH 5EUOB 4YWGL 4PG2C 3T4YA 3RL1B 3U2SA 3ULVF 1EFXD 2L7UA 2QV2A 1S3KH 4N8VB 3V2AR 1GGUA 1FN4B 3C09C 4PGEB 1MI5B 3Q1SH 2PCPA 3P9WB 2JB5L 2CLVA 1I1YA 3RTQD 4JHZA 2HLAA 2IBGA 2A1WH 3NIFE 1FO0A 2Y9RT 3D2UD 1M7DA 3ELAT 3FFCA 1NGXB 4WUUA 4I0PC 1T1WA 2ADGA 5D1ZB 4N8PA 1ZLWH 1S7UA 4FFVD 2XI9A 4JN2A 4L8BB 1H3WM 1YPZE 1W72B 4ZOEA 1REIA 4DGYH 4LSUH 1FC2D 3V6BR 4KI1A 4E41E 4FQLH 1HI6B 2CUIA 3BKYL 3RJQB 5J6GB 5DK2A 4CDHA 2P8PB 2WUBL 3MRPA 1OM3H 4Z7QE 4YHNB 4OT1L 4OQTA 4JRYA 3RP1A 4FTVE 5K9JL 2XA8H 4RDQG 2IG2H 3VDAA 4PTTA 4NPYB 3VRLE 4R90L 1GJIA 4TSAL 3GHEH 3WIIH 4CU8A 2RHEA 1I1AB 2YSSA 1NH6A 1MJUH 4I18B 4XCNB 2EDKA 4RAUA 3FT2A 5ANMB 4PJCA 4RQQA 1U3HD 3HZMB 1YN6A 4HWEH 1U8NB 1VEMA 3L3DA 1IAIM 3LDBB 3W39A 1BOYA 4EUPB 3TBWA 1YEDA 1JYNA 3KYNA 5E7FA 2VN7A 5FB8B 4LKCA 5LXGL 2J8UB 3L3JB 4GKZA 3FQWA 3O6ML 1SMOA 5EORL 5FO9B 5TDNB 5IB5A 4ZFZB 1EK3A 2DQEH 2EZ0D 2XWBB 1P53A 3DHMA 4HW6A 1NFIB 3CDCA 5M94B 1GHFL 5DDHB 3MC0A 1U8PA 2Y6SD 5EBMB 4ZFOL 3R0NA 4PJ8C 2X4TA 1JN6A 3OAYH 4LVOC 1FFRA 3CH8A 1KIRB 4X4XA 4BM7A 1JRHL 2M8XA 4P2OD 5HYJB 4GS7B 3NCYP 3OX8B 3U9PH 1N3NA 5ITFA 1TLKA 3UBXI 1CE1L 4NO5B 4QRPE 3FOMB 3QO0A 3C5ZB 4I2XB 2E5EA 5B3JF 3BGFB 3OF6A 3EOBB 3GGWA 3DMMB 4X6FB 5HHPB 4HPOH 1UB5B 5JQHC 4ZUSA 4FFYH 2Z31C 4PJDA 5J9PB 2W0FB 5DD0H 3UDWC 3I3BA 1I7UB 2AJYL 4PJ7B 1T03H 4KTYA 3EJYD 2DQIH 4OD3H 5IBTH 4JFXB 1LE5B 1OPGL 4I0CC 3HZKA 5I1KH 1G9MH 1BLNB 3MLXH 3EYQC 3RI5K 3SE4A 3F65A 4JM2F 2VQ1A 3MFGB 1DBMH 4CNIA 2ARJB 4JLRA 3B9KD 2WIMA 2L0DA 4IS6B 4BQCA 1P1ZB 1AGDA 2AEQL 3QEQA 2EE9A 4PJHA 2HG5B 4WO4D 4YFLI 3BSZH 4PR5A 5CD3B 5JHDE 1T0MB 1I85C 3TYFA 1JNHB 4EI5C 1MFAL 5FUOL 1EEZA 4S1QH 1HINL 4LLVB 3FO0H 2GAZB 3PIQA 2YPLA 2BVQB 2ZKHL 3TN0D 1J7VR 4OI8A 1XGPA 2FBOJ 3EGSA 1L6XA 3GMNA 2OI9C 1V7ML 4KK9D 1MRCH 1HH6A 4NIKB 1V3JA 4JFFE 2EO1A 2YEZB 1HHKB 2LAGB 1N5YH 1S9YA 2WM0A 3KNBB 3TJHD 1E6OL 4ESKA 4L4VD 1SY6H 3BESR 4YDJA 5JHLH 1EDQA 3KPQB 2NXYB 2ED8A 4MQ7A 3P40A 4D9LL 5I1IH 1YMMB 4E0RA 1UCTA 2QHRH 3GSWB 4X6DE 1P2CB 1Z3GH 5JDJA 2GFBA 1BQHG 1WZLA 4GRWB 3JUZA 4YBLC 4YE4H 5GXBB 4JKWA 3DOSA 4LHUD 4D0BA 3RWJA 3CPLB 3RGHA 5HYIA 1IC5L 1T66D 4ENED 1CFSB 3DUUA 1RK1A 2E7LC 4HZLA 4YXLH 3O4LB 2CK0L 5EUOF 5C1MB 5FM4A 3KYKH 5MERA 3RY5A 1BAFL 1DTUA 3IU3B 1BPVA 2P48B 3AS1A 1F02I 3NAAL 3I6KA 4XVUC 1UEYA 2XA3A 4GG8A 3EBAA 1BFTA 2I60H 3C60D 4N0YL 5C0FA 3E6HA 2IQAA 4M7ZC 4YHOH 1D6VL 2D7TH 1WCBB 3NCFB 2ATPA 3QPQD 2ZJSH 1HZHH 3B6SB 1ES0A 4HUVB 2BSED 1ZLWK 3RGVC 3K7UA 3FT4B 1AGCB 1L7TH 1BBJA 2A38A 3D85D 1F45A 1N4XH 2NY1D 1KFAH 4QXWA 2DBLL 2PTVA 5ADPH 4IBLT 4HXAL 5K9OB 5DJ0B 3F5WB 2GY7B 1NGYA 4RMTA 1WZKA 2BVPB 1FG2B 1AGBA 2DLFH 1V8HA 3RNQA 5E6IC 2MMXA 3MV8B 1NFDB 4JFED 1K5NA 2ESVB 5GS1B 3AROA 4L9LA 3VXPA 5LGJB 3DV4B 2YMXL 5F1IB 3FB5B 1ZWIB 3FONA 3ROOA 3ZE0F 5HGGS 5INDA 1IKNC 4YEEA 1MRDL 3Q6FB 2QLVB 1MH5A 1RFDH 5E8DL 4XVSH 2XZCL 3S4SG 1P69B 3WLWD 1OTSD 1K3ZA 1MJ8H 32C2A 3VXRA 1MFCH 2J8UF 1A3LH 1KIQA 4RFEA 4R97B 3ROLB 1KT2B 5HI4C 1QBMH 5ELIA 4LL9A 4PJGA 4M8VA 4TUKL 4ZUWB 3V7AG 3VXSE 5ESQB 5CLWA 1RZJL 5HHMB 3RPKA 1JWMA 3NGBB 4P2RA 5GIRA 4X99B 3S35H 3LMJH 1A4JA 1U41A 3ALPA 3OAYK 4XWOD 5AZEL 2GW5A 2D2OA 5C92A 3CH1A 2YD6A 1XF1A 1AGFA 5F7UA 4JJHA 1JGDA 2VH5L 2DKUA 2OMBA 1U6AH 5HDBE 1CICC 1T1ZB 3G5VA 5DA0B 1UXWB 1VACA 3ULUF 2QQLL 1RJLB 1G7PA 1FHGA 2NXZC 1II4E 3L3GB 3N85L 3T0ED 1MY7A 2R8SL 5DUML 2P49B 3O2WL 3LS4L 4ZOBA 1ZHBA 4N0FB 5EWIH 5ALBH 4PGBA 4FFWC 4PJ7F 5F96L 1HXYB 2YD5A 5E4EC 2R0KL 1CE6A 3X11B 2HWZH 2R15A 1DE4B 3I9GL 1FFNA 3Q6GL 2WBJD 3WE6A 4JQVA 5JIPA 3SO3B 4JZNA 5LVEA 2VABB 2CIKB 2AQ3A 5IB1A 1XGRA 4U1NB 5DHVH 3VRJB 5JDSB 4WWKC 1MCEA 3REWB 3WYRA 1OP9A 4S1SH 1MCPL 3HZYB 4Z76A 3ZDZE 3VI4F 2NY2C 3BE1H 4G8EA 4RX4A 4AT6B 4FTVB 4BFIA 2E8YA 5E8PA 3S7GA 1DN0B 3E8UL 2YD1A 3TH4T 2OP4H 1T6WA 1JZ5A 1AHWC 3RVVC 4TQEL 3UROR 3HR6A 1LP9A 1RJYB 4R26H 2H32B 4HWBA 5TQ0H 2V6HA 3C8HA 4GMSL 4WW2B 2WP3T 4B0MM 3U30B 5B39A 3FQXB 5B38G 1A7PH 5DK0A 3KPNB 5T1DL 1XFPA 3F7VA 4UT6H 5T1KD 2VLKE 3CDGB 3QI9C 3MRFB 1SJHB 5F8RC 4UTAH 1AGEA 1XR8A 1I7TA 4NQCA 4XNQB 4WFGE 4KY1L 5I9QB 4PRIB 5HI5D 1T80A 4KI5D 2A9NH 2NY0B 1NMBH 4GRWF 4KXZI 4RWHA 4ETQB 2YZ1A 4G9FD 1I8LA 4JFDA 3QXTA 3RX5A 4DVRH 2MCG1 4APQC 2XTJE 3ZKND 1NGZB 3BKJL 3KYOA 3RHWF 3B9AA 3X13A 1WITA 4ONHB 4ZUUB 1G1CA 2R39A 1LVEA 5DMKB 5EO1B 2D7NA 4RAVB 2ADIB 5DSCB 4X6CA 3HB3D 5DLML 3ULVD 4FQXD 2V2WA 4W4OA 3FB8A 5EPMB 4Q97A 1QNZH 4QXTB 4WVRA 3UYRH 1INEL 3WNMA 5IB2A 1I3RB 4GMTH 2AKRA 2ZSVB 1JPSH 3H7BB 1WLHA 2P5EA 3RWCB 3S6CA 4OF7A 2X89A 2X1WL 5BW7A 1VKXA 1VFOA 5DJDA 4PS4L 3KWWA 4EQ2A 5JW5A 2Z91B 1Z9OA 4KGJA 3I50H 4PJ9D 4U1HA 1CI5A 3UAJC 2EYSB 2AXJA 3T2OA 2HT2C 5I1AA 2IANA 2CJUH 2MQ0A 1VFBB 4X0KA 3VXUA 3TVMC 3KYAA 2GITA 4FQ1L 1A6AA 1U36A 2IBBA 2XZAL 5HVWA 1A6UL 2A74B 4FXGA 2BJMH 1NFDF 5C9JB 4GKNB 2BNRB 3RZCB 2HVKB 5EZOL 2D3VA 4KUCF 2HAZA 5IVOA 2QTEA 3OPZH 5LBSL 5GGVH 2IPUK 5IFHH 3BYYA 1HQRB 1EHAA 3GKWH 4TNWK 3O9WA 3ILQC 2P5WA 2VAAA 4MCYA 5C0EA 1PKQB 2ZPKL 4BSVA 3GMOB 3M07A 3ES6B 2B2XH 3DO7A 3MRNB 2O61A 1NUGA 1GGIL 3WFHB 5I1GL 2QR0B 1Q9LB 4JAMB 5CGMA 3DX7A 5FCUH 3MRJB 1NCBL 4KJYA 4S2SB 5DJYB 4KHTH 2H8PB 4JKMA 2J2ZA 4M6ML 5FYKU 4QGYA 3DI3B 4RDQF 3QIWC 3BW9B 3FN9A 5D96B 1UJ3A 3SJVE 1MJJA 5D7LD 2WIIA 2PO6D 3PL6A 1MCDA 1F4WL 3QAZC 3WS6A 3GB7B 3LEVL 5FO8A 5GRVK 3FAWA 3OBAA 4M9PA 3STZB 3NA4A 3QG6B 4W4NA 5I8CB 1E6JL 3JWOL 1W0VB 1KCRH 1OOAA 2ZCLL 3C9NB 4QXUL 3UTQB 3OKMA 3S4SB 3GMQB 5C09B 3FCTB 1AO7A 1KJVB 4C4KO 2YD3A 4FABL 1FNLA 1XR9A 3BQUC 5J13B 3C8KA 2XN9B 2P7TA 5MP6L 3TM6A 3DHJA 3KXFE 4O58H 3NIFF 2FJGB 2IH1B 4EZMA 1S5HA 4Y4KA 4UDUA 3SDAB 5FYJH 4H0HB 5EA0L 3MJ8B 5I1LB 1OGAA 2LU3A 5F3HB 5CZKA 1FVEB 4IDLA 4OF5A 5E8NB 5LQBL 2XOTA 1T4KB 2YA2A 5F44A 4FFZH 1A4KB 4FA8A 1D5MB 1K2DB 2VTFA 3CFCL 43CAB 1MSPA 4JPVH 2PXYB 4JM2D 4LARL 1IFHL 3DIFA 4JB9H 4Z7QF 4DOHB 2AXFA 2BRRH 4HFWA 4YFEA 5JPMA 1NBYA 2AK1H 3KLDA 1MIML 4KKAC 1UZ8B 3RL2A 2DQDL 1OP5H 5ISZA 4LEOA 4LPTA 1C1EL 2EYRB 3U82B 1BQLL 3VRLF 3VD3A 3OKLA 1NCUA 4HV8B 4UDTA 4YXKH 3SHSA 4Z7NF 5CKGA 5T3ZD 3LKQA 1S3KL 4LNRB 5CKAA 2EDNA 4N5ED 1DEEB 4WEMB 2ZSWA 1WCQA 2X4OB 3Q1SL 1R0AH 2IAMA 1XGTB 2GSGA 4FQIH 4V1DE 3NCYS 1CF8H 4IM8A 1F3DH 1HCVA 2A1WL 4OB5H 3KPSA 5DO2D 3BAEH 1XH3A 3O8XC 1G7HB 4RFNC 4QHNA 4CU6A 4UT7H 1T7VA 3DROB 4XGZB 1XGUA 4IRSA 5IEHB 4MJIE 3VCLA 4L29A 3CFJB 1BECA 4ZS6D 4DGYL 3FAXA 4LSUL 1SYSB 1UM4H 4FQLL 5AUMA 5SWZB 1OM3L 3ARFA 1R3HA 5AZ2H 4OSUH 1TFHA 4HIEB 3G5XB 1IILE 2VISB 1X4XA 2BSTB 1WBXA 2XA8L 4M93C 1VFUA 5HDOA 3QUMH 2IG2L 1NSNH 3D39D 2OL3B 4Y16B 1UVQB 3QFJE 5BS0D 5B38B 3GHEL 5J7CC 3WIIL 3GRWH 4KWUA 5DRWB 3T3PE 5LJYH 1MJUL 2I9LA 1U8KB 5IMLB 1Z9SA 1MI5D 1KN2H 3A0OA 3U6RB 3O0RH 3K1DA 4HWEL 4UBDC 3V4VH 3KPOB 4OM1H 1P4LB 1JCKA 4YLQT 3WIFA 2H45A 4J4PD 3EFDH 4KKLC 2J5LC 1BVKB 3RKPA 1TCRA 1NCAH 4K94C 2OTPA 1JYXA 1S9WB 4MJ5B 2XZZA 5KN5A 2DQEL 3LEYH 1MHHA 1S9KC 3DURA 4LBEB 3TP4A 5T33H 3MRDA 5J12B 5E5MB 4N0UE 4PJ5E 4PY8J 2VDQL 4B7LA 2WNGA 4Y2DA 4BKLB 1IAOB 1CGSH 3U9PL 4JZJB 4LLMB 3S96B 2X5PA 4UAOC 1B3JA 4NKMB 4N90D 2AV7B 1LO3H 2IBZY 3OXSA 3REVA 3ISWA 4GG6A 4HPOL 1A6ZB 1RHFA 5IKCB 4FFYL 5EIIB 5FA4A 3DGGA 3SKOB 5DRXA 5DD0L 4Y19E 2BHUA 1J1OH 2COQA 3UBXA 3G5ZA 3P77B 4GQ9H 1KGCE 1N7ML 3P11H 5HVFB 2DQIL 4OD3L 5IBTL 4W81A 3W0WE 5I1KL 3I6LE 3MLXL 3BP5B 3CMOH 4MD0B 4RRPA 1DBML 2VZSA 1ADQA 5IB3B 3ALXA 3ZYJA 3AY4A 4L8SA 4XHQA 3VFSB 1F6LL 4OZ4B 3ARBA 3BSZL 3Q2CA 4RMSA 2OTWB 5I6XB 5HYJD 4OUOA 3BPCA 4HIHA 3ZZ1A 4BSWA 3X14A 2IPKA 2DB8A 4S1QL 5DURD 4BFBD 2CUMA 2ZOLA 3WJJC 1KJMA 4H25A 3FO0L 3QDMA 3E3QE 3LKOA 4U1SA 1JWSA 3ULUD 4NDMA 4G6FB 1FG9C 3VWKB 1F5WA 5FK9A 4PIRF 3VGEA 1MRCL 4OI7A 3MACH 2BCKB 2V5SA 1J05B 1J87A 4KRPD 1N5YL 1NC2B 1JUFB 5FGSA 5JHLL 2A0LD 3KJ6H 1F4AA 1E0OB 5CSZA 1F6FB 2YK1H 5I1IL 5ICYA 2QHRL 5JMOC 1Z3GL 3VWJC 4YHZL 2YRLA 3ULSB 3HA0A 1N8ZB 4YE4L 3RWGB 4HKXB 5IVZB 5F7EH 2VSCA 4AEIH 4NO2B 3VDBA 4ZUVA 1U58B 1A1NB 1OP5K 3UTTB 2EXWC 3QEUA 4GUPA 4YXLL 2VDMH 4PBWD 5I18H 1R5IB 4PLNC 2VLLA 4P23D 4XRCA 1VADA 5KZCB 4DUXA 3IS1X 4N0CD 2I07A 3MNZA 4WHYG 1HNFA 1U8MB 4JFYA 3BEVB 5C6TH 4KHXL 1T2XA 1BREA 4HUWB 5AAWA 2I60L 4NRXB 4Y4FC 3SDDA 2G75A 3QXDA 4U0QB 2WWMC 4KKBD 3DVNA 5BVJA 4YHOL 2D7TL 4OFYD 1EBPA 1Q94A 3W11C 1N6VA 1ZA3B 5L0QB 2ZJSL 1HZHL 2F74A 3K80A 3GBNH 1L7TL 1U8QB 3MLRH 4DCQA 4JFQB 2NXYD 3EOAA 2VZ3A 2DMBA 4NQEE 4ODUB 3SJVB 3IFOA 3DJ9A 3U2SB 5KANG 1KFAL 1GGYA 5ADPL 4X9GA 2DL2A 5C8JA 1FH5H 3B3IA 2HFGH 3CUPA 3MSPA 2PCPB 2DLFL 2CLVB 3IU4H 4KDTC 5IM7A 1I1YB 2HLAB 1LEIA 3VFWA 2YOCA 4KVCH 1FO0B 4NN7B 2R1WB 3LPGA 1M7DB 1B9ZA 3FFCB 4WUUB 4H1LH 2ADGB 2DYPD 1S7UB 3GJFH 1RFDL 4JN2B 4XVSL 2D0HA 3PXHA 1IEBA 4PLJD 1V5JA 3MZGB 2R2EA 4Z7UA 5C0AB 4HF5H 1MJ8L 3QJHA 3UO1H 2NY4C 3QUYA 1MFCL 1A3LL 4H26A 4OQ1A 3CVHB 1QBML 2Q7YA 1HSAB 3MRRA 4NRYA 5HHNA 4EVNA 4CMHC 5ESAB 2YUZA 1R3IH 1G6VK 3ARYA 1JHTA 3AVEA 5BRZD 3PUCA 3FFDA 3LMJL 3QEHA 1RUPH 3S35L 5E2UH 4XNZB 2V7NA 5GRVL 2YSSB 3QFDA 1T1YA 2DKSA 4RMRA 4NCC1 4BJLA 4RAUB 3FT2B 4PUBH 4WRLA 1JPTH 1DVFA 1C7TA 4PJCB 4RQQB 3RVWC 1U6AL 4NM4H 1AD0A 3J8F7 4I3RH 1KTKE 4C56E 4DGVH 4NUJA 3KYNB 4KUCD 5IHUH 4YZFF 2VLKA 4U7MA 4GKZB 4PRPD 5EWIL 2V9QA 4ZAKA 5ALBL 5EU4B 5KVMC 1IE5A 1VGEH 3PXJA 5F6IC 1SEQL 4UIKH 4BH7B 1GC1C 1HXMB 1U8PB 3W2DH 2X4TB 3MCKA 4AQ1B 4X4XB 5ENWA 1FCCA 3PQYD 3QXAA 4YEFA 1N3NB 4LCUA 5ITFB 4S1SL 4OCYH 1CL7I 3V7MA 5I74C 4ELMA 3B4NA 4Q0XH 3BE1L 4PJFE 3T0AA 3GGWB 3OAUH 5HPMB 4H0GA 4FXKA 3RTQC 1SEBA 4P2YA 3UZVB 1QBAA 3QFJB 1KPUA 3V8OA 4X9FA 1SY6A 5KVFH 4LSDA 2OP4L 4PB9H 1HN1A 2QSTA 4K07A 4I0KA 4K3GA 2BOCA 4W68A 4R26L 3HZKB 5TQ0L 1GGCH 4WFFE 4WY7H 4FFVC 1F11A 5B39G 1JL8A 1QQDA 2VQ1B 4D9QE 1A7PL 4CNIB 4JLRB 2K1MA 3DBXA 5J06A 1FZOA 5D2NE 4GBXD 4UT6L 1LEKA 3LRHA 1XMWA 1JNJA 4WNQA 5AYQA 4UTAL 4PJHB 3FRPA 1P7QA 2ICWI 4PP2B 4F7EB 5D72H 1DLHB 3EO0A 4PR5B 3HUJA 3EO1A 2ED9A 3DVFA 1PYWA 1G7IB 3DETD 2A9NL 1NMBL 5GGTH 1QBLH 3RIFK 5MHSE 4G6MH 1EEZB 4IIQC 4E41D 4N0UB 3WJLA 3MRCA 4DVRL 3PIQB 5DVKA 3Q5YA 3KLHD 1CBVH 1XGPB 3EGSB 1FLTX 3GMNB 5DQ9B 4FTVD 1K3IA 3BH9A 2ZUSA 3B83A 2NZIA 4O9HH 2PW1A 3O45B 3BX7C 2VWEC 1S9YB 1D5IH 1TJIH 3TEUA 3UYRL 4MNGA 4YDJB 4LCCC 1NFKA 4UV4L 3G6JA 4MXVE 1U3ZA 2D31A 3QUZD 4GMTL 1BMGA 1JPSL 4MQ7B 1ZA6B 2F5BH 3RZCC 3V9FA 2EZ0C 1T20A 5ID0A 4E0RB 1Z9LA 1T89A 2CQVA 1QBBA 3JBG7 1IZJA 3OKNB 2LVEA 3T65A 3HRPA 1EO5A 5TE6H 2QKIA 4D0BB 4OFDA 5BQ7A 5A2IH 1D9KD 4KU1A 4OLWH 4URTB 3I50L 3S37X 1DBKH 4P2OC 3DUUB 1RK1B 2E9WA 3BWAA 4HZLB 5GHWH 5IMKA 5IROA 1A3QA 2CJUL 5FYLH 4L4TE 3E0GA 1X5FA 4MNHA 4P4KA 4R4NC 4GG8B 1M4KA 5E8OB 4X9HA 2BJML 3CSBA 1YZZA 4L8CA 3SGEH 2AXHA 4QRQB 4M1CC 3IXAA 4PYGA 4OLYH 5C0FB 3U9UA 2IQAB 1OSPH 2X6MA 3EUUA 3OPZL 1IAMA 3LH2H 4QRPD 4QEGA 2ENSA 5GGVL 3U0TB 3DXAA 5IFHL 5JNYA 5IV2A 2ATPB 3GKWL 2VR9A 3N1FC 1U8JA 1H3GA 4XP4H 3GJFK 5C08E 5IGXH 1BBJB 4UOW1 5F88B 4OCNC 3OSKA 4KDVA 1KB5A 5EU5A 5EBGA 3MOAH 1K4DB 2GJ6A 3B9KC 1FAIH 2LE9A 5FCUL 3BIKB 4LIQH 2Q7NA 2EDLA 2BVYA 1J0KA 2PR4H 1NGYB 4KHTL 4WO4C 3LB6C 1INDH 1ODAA 2ZNXA 5CBEA 1YNLH 1EXUB 4H8WC 4JHWH 5B8CA 3PV6A 2NY5H 5F9WC 1K5NB 4L9LB 3VXPB 3VJ6A 3TN0C 1LO5A 4PJCF 5INDB 2EDJA 5JHDD 1CFQA 1MH5B 1F3JA 4XT1C 1H3XA 1EJOL 1ETZA 3BKCH 3V6ZA 4M7LT 3VXRB 3HKFA 4LNVA 3MV01 5EO0A 1KIQB 4RFEB 2VAJA 4E9LA 3SGKC 1ZXQA 4IHOA 4NC1C 4K9EH 4ZOAA 5I1DB 1CG9A 1AJ7H 4PJGB 3IAPA 3T0VA 1JV5A 3RA7H 2ARJQ 5F7HA 4JFFD 5MEQA 5FYJL 1JWMB 4P2RB 1VFAB 3Q5TA 4ZQKB 5GIRB 2H9GA 2L7JA 4M43H 3WS3A 3WNOA 3QDJE 4FMFA 1A4JB 4KV5E 5DJ6A 3AB0B 4ENEC 4G3YH 4Q58C 1EEQA 4RCAA 5MENB 4FFZL 1CD0A 1AGFB 2J12B 1JGDB 3EIFA 5EN2B 5JXEA 3U4EA 2RR3A 3D5OF 4JB9L 3G5VB 2BRRL 5IFJA 1VACB 2AK1L 5DS8A 3F12B 1G7PB 5IW1B 5ID1A 1RIUH 3GI8H 3C60C 1QO3A 1LD9B 4Z6AT 1ZHBB 4PGBB 4YXKL 3LRGA 1KSRA 3ARED 3QPQC 1NANH 1P84K 3O11B 1R0AL 4UTBH 1FFNB 4FQIL 3WE6B 5IF0A 1CF8L 4JZNB 2VDKH 2OK0H 5IB1B 2CGRH 4RMWA 4OB5L 1XGRB 1NBZA 1JMZA 3BAEL 4YO0B 3SDAD 2OZ4A 2VRAA 4Z76B 4UT7L 3ALWA 1CU4H 4UQ3B 4G8EB 1LHZA 3HMXH 4Z18A 5E8PB 2GSIB 3T8XA 2XXMB 2PXYD 3LCYA 1JPGA 4QOKA 1LO4H 3WO4C 3PGCA 2BOBA 4DVBA 5AZ2L 1V3LA 1WZMA 2HN7A 4OSUL 4JRXE 5DZNA 3KS0H 4GRLB 3QUML 3UYOD 1NSNL 4HS8H 4I5BA 3WLWC 3M45A 4LGRB 5B39B 4C56B 3TO4C 1NCDH 4KH2A 3GBLA 3GRWL 5DK0B 3G5YA 3F7VB 1QRNE 3MJGX 3SGEI 2F58H 3JUYA 3SCMC 1FZMA 1KN2L 3W0WA 4ODVH 1XR8B 1I7TB 3O0RL 4NQCB 3V4VL 4ZD3H 1RD6A 1PEZA 4OM1L 1CGTA 2CO6B 1HH9A 5DJZA 3EFDL 3LPWA 4F7TA 1UJTA 1NEUA 1NCAL 3PWUA 4P57A 4JFDB 3X3FH 2EIZA 2CUHA 2HKHH 3QSKB 1T3FA 5C0GA 1QLFA 2GJZA 2Z4QA 3JV4B 3LEYL 1B2WH 3VXOB 3KYOB 3X13B 5EB9A 5T33L 1HHHA 3SBWC 2YUWA 5FYJU 4X6CB 3H7LA 3QIUC 2V2WB 3FB8B 5E94A 2HJLA 2FR4A 2GI7A 4I0PA 4JDTH 1KIPB 2VDRH 4YUEH 1CGSL 2AKRB 2P5EB 1G7MA 1QD0A 4IJ3C 3H9SA 4Y16D 5I8KH 1LO3L 5HHOE 2LAAA 5JW5B 2WBJC 3S37H 1VCAA 3UTPE 4U1HB 1YECH 1J1OL 3CFEA 3CU7A 2XTLA 1UWGL 4GQ9L 4CVZA 3QXUA 3IDUA 3P11L 2IANB 3BP7B 1EUTA 4X0KB 3EJZD 3SDCA 3VXUB 1W8OA 1KELH 1JWUA 2GTZA 3PGFH 3CMOL 5ICXA 4FXGB 2BK8A 3T3ME 5FYLE 3WNNA 5L2KA 5F1SA 4QHMA 1L9MA 1X4ZA 4KJQD 1ZHNB 2V2XA 1V7NH 1CIUA 4NOBA 3FHQA 3W9DA 4XMPH 4YDVA 2X9WA 3BWUC 3FOLA 1F4XH 1C5BH 3O9WB 1U3JA 2P5WB 2VAAB 4MCYB 5C0EB 4BSVB 3C08H 4YHPA 3PHQA 4NOFA 3TPKA 2O61B 2HH0H 1N0LA 4XAWH 5AD0A 3MBEA 1JMXA 4RAHA 4ZUTA 2VZ1A 3G6DH 4KJYB 5DXWA 3WUWA 5IJKC 4JR9H 4PJ8A 1ERNA 1CDCA 2DI9A 3BI9X 4U49A 3MOBH 3IJYA 1NCCH 2YKLH 4G6AD 3MACL 2C1OA 4KI5C 1NANI 1HOCA 1G6RA 2IMMA 5DJ2A 1UJ3B 2E8ZA 4TOYH 2WIIB 3K8LA 3PL6B 4M8QB 4WDIA 1OQOA 3WBDA 4W6WB 5FO8B 3IF1B 2ZUVA 3KJ6L 3ZKNC 4LRNL 4NO0A 4P46B 4R2GB 2E3VA 2YK1L 4WFGD 1G7JB 2W9LA 2DQGH 3OKMB 3S34H 3RUGE 3UDWA 1AO7B 3N0PB 3RY6C 5C71A 5F7EL 3P0GB 1RV6X 1XR9B 4FQXC 1CTOA 1BZQK 2XTJD 3E2HC 3C8KB 2P7TB