3O9WC

Recognition of a glycolipid antigen by the inkt cell tcr
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
203
structure length
203
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title The V{alpha}14 invariant natural killer T cell TCR forces microbial glycolipids and CD1d into a conserved binding mode.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 203
sequence length 203
ec nomenclature
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o9wC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o9wC02
4Y1AA 2H9GB 3SE3C 5DS8B 1MCCA 2I25N 3LB6D 3MRQB 4X7SH 4YBQC 1S9XB 1I4FA 5GRJH 3M1BB 1MWAA 4IIQB 4QGYA 3UO1H 3LN4B 5ADPL 5I73C 5FK9A 4JDVA 1F5WA 4LNRA 3AMLA 3NTCH 4L4JA 1G7QA 3PL6D 4X9FA 2CXKA 1BD2D 2FCBA 4U1GC 4DZ8A 1P1ZA 3CMOL 2P5WA 3SE8L 4LKXA 3BD5A 3F12A 1KJ3H 3DXAE 3O8XB 4G8GD 5T1LB 1MIEH 4WV1A 5BS0B 3SDXA 4U3HA 1XCTB 3M07A 1I8LA 3IDMB 2NX5D 1C7SA 5IEHA 3TT3H 1QTYT 3U1SL 3NACL 3V7AG 4F57L 4ONGL 1G7PB 5DQ9A 4F9PC 3U36B 3NIDE 4DVBB 4XMKL 5I2IB 3CVHB 5A2FA 1HHKA 4LVEA 5JHLL 1I8IB 4OTXH 1MH5B 3EJZC 4G9FA 3WFCH 4M93C 4XXDA 5CLWA 5C3TA 3TNNA 3FL7A 4LEOB 4YDJB 4OLXL 3WMSA 4KC3B 5DMKB 3RVTD 4UDTB 3IAPA 4R4ND 3VXSE 4JGJA 3KR3L 4J4PC 3TBSA 1BJ1J 5I1LA 1DDHB 1BBJB 2H2SD 3OKNA 2JELH 2BERA 1HIML 4ELMA 1FN4A 1I7RA 3MX0A 3SGKA 2CIKB 4UV4H 4M7LT 4XPGL 1U41A 3P0VH 1IGJA 1WIPA 5I1EL 1VGKB 5HGDB 4LCCC 2R2BA 4S1SL 2ESVD 5GGSB 4NQVB 2CRYA 4LMQE 4U0RC 3B9KD 4H8WH 3SO3C 3BN9C 1NCCL 2FWOA 3RVVD 1FO0B 4GQ9H 2HH0L 5E6ID 1MQ8A 1DTUA 4P23D 3UTSB 2M1KA 1RVFL 2QADD 4CKVX 4KK8C 3MGTA 4YIQB 5GGRY 1NAKH 3RTQD 3UBXI 5C6TL 3LQZA 3QPQD 1FQ9C 4YFDB 2DJSA 5D5MF 1QEWA 2AK1L 5I74C 4M5ZH 1KBGH 1RZJL 2BCKB 4JAMA 4OZIF 4M1GH 3WDIA 1GH7A 4HH9A 2J8UE 4WWID 3CFKA 1NC2D 4U1IA 4DQOH 2R0ZH 1KJ2H 1ADQL 4LPXA 1Y0LB 5M95B 2A6DA 1WCQA 2C1OA 4U4BA 4XMLH 5A2JH 4YWGH 5DJXB 4EN3B 1FL6B 2AERT 1B9ZA 1WIOA 1MIMH 2HN7B 1X5AA 3S96B 4DKFH 2ADJB 1T7YA 2EXWC 4GW1A 3GIZH 2DQHH 5D6DA 1J10A 1JGDB 3ZTNH 3L3JA 1EEZB 3MACH 4D8PA 3MSPA 3BDYL 1GC1H 4KVCL 2R4SL 4L4TA 1F42A 1NKOA 1BQHA 1ZVSB 3WFHB 2GY5A 5K59E 2X9WA 3ISWA 3RVWD 1VGEH 2B0SH 1KUMA 2YD7A 1FBIL 3AXLB 5AYQA 3LY6A 4MZ3A 2YZ8A 3MXWL 1BX2A 2Y06L 2WM0A 1QBMH 4MAYD 1PBYA 5CEZL 1P4IH 3BPLC 4LBEA 4E42A 4HUKB 4U6HB 4NQDB 4XH2B 3IU4H 2Q76A 1IGIL 1ES0B 4QTHA 3V4VL 1A2YA 5EZJB 4NKOA 4RAVB 3IJHB 9CGTA 1TXKA 3I02A 1FN4B 3ZT5A 1CGTA 3O4OC 5JXAH 1NL0L 3LPGA 2HVKB 1CG9A 2X4QA 5EPMA 1SMAA 2ITDA 2XQYK 2ZSWB 3NCEB 3OR6A 4JCMA 4YC2C 1JNJA 3OAYH 4CVZB 1YEGL 1RU9L 5EOCJ 2E7MA 3K4AA 4KI1A 4MJIB 1VKXB 3EGSA 4LCWD 2Y6SD 3OV6A 1BD2A 4EJ1C 2CJUL 4I2XE 3RBGA 3NA4A 2B4CL 1MJ7H 1OAZH 4H1LA 5ACZB 1DQLL 4G8EA 3LMJH 4KKAD 3BQUA 3VFSA 3OKOA 3IETB 2VXSH 4Y2DC 5L6YL 3F7YA 3PJSA 1LDPL 4HH9B 1J1XH 4U1IB 5B38A 3CUPA 2NX5A 3O41A 1JZ3A 2FBJH 1IAMA 2A6DB 3QYCA 4ORGB 4YGVB 4PYGA 4XRCB 1YJDC 4D9RD 1UB5B 2Z8VC 1OAUL 1P6AB 1T2JA 3GBMH 5MI0B 2IADA 4R4BB 3EYQD 1IM9B 1FNSL 3CFEB 1YN6A 5EBWA 4IS6B 5E2TL 5HD8D 3WL9B 1G7HB 1CQYA 1QSFA 2RCSH 3MROB 4H25B 2BHUA 3HZVB 1TTUA 4NQCE 3LKQB 5HHPA 1GPOH 1EO8H 2GUOB 4IMLB 5EUOE 4EDXA 3VGHA 2DLIA 4YGAB 2N7AA 5IGXH 3AREC 1XGTB 3U4EA 4PJFE 3HUJF 1FIEA 5J3HD 1T5WB 5CJXC 5FUZH 4PJDB 2VLJA 1SVCP 1DQMH 5F7DB 4LSPL 1HDMA 4M7ZB 2R56H 4XPBH 3HTLX 4JKLA 4OCSL 4CMMA 4I0PA 2WBJA 4EOWL 1MJ8L 3N85H 5FGRA 5CIPH 4XCFL 5EBLB 4LGPB 3O81A 2WBKA 1FAIL 4KQ3L 5J7CC 3S3SA 3MLXL 1V3KA 3NGBC 2X4QB 3LEVL 1YEDB 4HIEB 4ZTPH 1A4JB 2M2DA 3UCRA 5I1CH 4U1SB 5HHNB 4ENEC 1GL4B 2EE3A 5F93C 3RWEA 5C0ND 5KBNC 4TVPD 4S1QL 2R1WB 1VHPA 1WCBB 3NIFF 3PL6B 5B39A 3VFRA 4HKJB 5KN5B 4JFFE 3BPCA 1RUPL 4JM2F 4Z7WE 4JLRB 3X11B 1QFUH 5GRVL 4MA7L 4JQIH 4LCYA 4W6XB 3LKPA 4RRPG 4G8GB 2NYYC 1YMMA 2EKSA 2CPCA 4NO3A 3RPIB 1FG2B 1T89A 1LE9A 5IEKB 3HG1D 3QSKB 3QFJD 3QEUA 5HHVL 4GXUN 2EDQA 3TO2B 3C8KA 4X7DC 4HPOH 4LRNH 1ZGLP 2E5EA 2EECA 4O2CB 4XNUL 5I15H 5KVEH 5DJYA 4YZFE 4PJHF 2GQHA 3BZDA 3VXRB 3VW3H 2DQGH 5F71A 4QNPE 1W0WB 2YEZA 4GRLA 3FB7A 1T04A 1QYGH 3HPJB 3L3DB 2APWA 4KUCF 2NY5C 4TPRL 5HHPB 5EBMB 1KIQB 4EDXB 4U1LB 4LCIH 1U3HD 4X80H 5DC0A 1E4XH 3B2UD 5F88A 4XGZB 4R4FL 3QB7C 4YBHA 1YYLH 1L9MA 5AEAA 2A2QT 3MNZB 1BOGB 2ESVB 4Y2OA 2VDOL 4ONFH 2DBJA 1NCAL 1YEFL 1QSZA 3B9KB 4U6YA 5HHXL 5ISZE 4S1DC 3GNML 4L8BB 3SOBH 4LCWA 3VFPA 2XXCB 5E6IB 3VE0A 1KNOB 4P23B 1FHGA 1EK3A 3LVEA 1MOEA 4CVXA 3RTQB 4RMRA 2ICEB 1SJHB 1FYTD 4I4WB 3DYPA 3T3MF 1HSAA 5D96B 5DMJB 4XBEH 4K3JL 1NCUA 3EYUL 1KN4L 1F02I 1TZHB 1XGPB 3MRRA 5JQHC 3ZDYF 3CDYA 4LAQH 1RZGA 1OAYH 1HI6A 4YLQT 1NC2B 1VFOA 3UDWA 1YJDH 2A77L 1KACB 2ICES 4R97C 1Q94A 5SWZA 3SJVD 1DQQA 1N5AB 3ZMRA 2AJVH 4OV6F 3ZSSA 3Q48A 1AFVL 2XWBB 1MFDH 4XBPA 2F8XC 3TPUB 1C5CL 3E8UH 2V7NB 4J3SA 5IBLC 1QA9B 2HJLB 2VL4A 3VXME 4M62L 5FF6B 1RULH 3DBXA 5DQJA 3WLWC 1CIDA 2HT2C 4TULH 3IJSA 2XPGB 1W2KT 2DIJA 4KQ4H 4MB5A 5ESAA 4FNLL 1T5XA 4POUB 3JBG7 3QEUB 2DM3A 4KI5E 4RZCA 4Y4FC 1D5IH 4MD0B 3HZMA 1UB6B 3HN3A 4PJ7B 5DJYB 4XNXH 2OK0L 3TN0B 2V5TA 1SYVA 2UVFA 1NBYB 2DB8A 3D3VA 4MAYB 1GVIA 2MPAL 2YEZB 3C2AL 1U0QA 5C07D 1R3LB 4NNPH 1I3VA 1KYOK 1P5UA 3A67H 2XN9B 1EA9C 5D1ZC 2XNAA 1AGBB 3LKNB 2AAVA 2XWTA 4X0KB 1D7FA 1BREA 2QBWA 1RZIB 1OGAD 1HHHB 1X5GA 3DRQB 4DGVH 5C09E 2BSRB 3IDUA 4LARL 4MAUH 4OIBA 1YMHA 4L8CA 4PGBA 3D9AL 2QR0B 4FFZL 4L9LA 4PV8A 1BIIB 4WFGD 2I5YL 1U8HB 2C3VA 1I1YB 1NGZA 2R2EB 4JN1L 1I1FB 5FYKD 4FOMA 3I50H 2O5YL 1HHGB 5IW3A 1X3DA 1AC0A 4XB8A 4OCNC 5FKAB 2FBOJ 1UJ3B 4OM0L 3DGGB 3N0PB 1MJJB 4J8RB 4JFDA 2CUHA 3KPMB 5I0DA 2LQRA 3ARVA 3CDFA 1ACZA 4QXTB 5DVNA 3EFDH 1HINL 5FHAL 1ERNA 4KRPD 3ARGC 4M6NL 1C5DB 1KXTB 1DE4A 4JKPL 3LKSA 5HGAB 4LRIA 3PF2A 4QRRE 4TOYH 1RUQL 4N0CD 5CJBA 4NUGH 4KUZL 5KSUA 3V52L 2GITB 4KKCD 3WUWB 2MQCA 4IRJC 2BXZA 4UIMA 2NY5H 1LO2H 1CD1A 4LVOC 2VLRD 4HUMB 4NQED 2OTPA 1A47A 3KXFD 4OZGF 3SKNB 4X6EB 5I66B 4PBVC 4J6RL 3WE6A 2UYLB 4U1JB 1S9YA 3U7YL 4G6AD 4LLMB 1JYVA 1EH9A 2BC4B 4MQTB 1V3MA 2F74A 1RMFH 5DSCA 3A6CH 1G9NL 2Q7YA 1ZLSH 1CICD 2XTJC 5FGCE 5GSRA 1SYVB 4NQTA 4HK0A 1MAML 2A6IB 4ZMAT 1LEIB 2DM4A 5IROA 3KNBB 3WN5C 4I8DA 3LSOA 4XP1H 2CDGB 5C0AB 1FORL 2H32B 5FM4A 3QQ4A 4X83A 3OKDA 4HZLB 12E8H 4A2LA 4HF5H 3RI5F 3WIHH 2ZSVB 2Z8RA 4DN3H 4ODTL 5DD5L 1UYWH 1EHLL 5IB2A 3DXAD 4EIZC 3DECA 5TJWK 1DQDH 1AQDA 2J3SA 3RGVD 1I1AD 4HMEA 4PRAB 4YDIH 1KLUB 3ARBD 5EUKB 4L8CB 3TVMD 3S35L 5E56A 1KXQE 1NMCB 4KDTA 5BOZG 4XVTH 3W0WD 1NGZB 5TE6L 2Z91B 5I71C 2HJKA 4HX1B 1S7XB 3C5ZC 3R06B 5E8NB 2PNDA 2AGJH 3O9WC 3QXUA 5AAMA 1FL5A 4NPYA 2MOVA 5TQ0L 4ZUWB 3RWDA 4MGXA 3MLTA 8FABB 3DUSA 3KYNA 3Q5YA 4N0YL 1FLTX 3QQ3A 5EZLA 3NABH 1PEZA 5B4MC 3OXSB 1FFOA 2XQBH 3H8NA 3HG1B 2VAJA 4P46A 3QFJB 4KROD 3GGWA 3SBWA 4JPWH 2YC1B 1B0RA 1YECL 4G6KL 4O2EA 1NAMH 2AK4E 5T1KA 1MUJA 1IEAA 3B8YA 2X1OA 2FGWH 1ED3A 3ZKNC 1T1YB 5FYLE 4UTAH 1ZHKA 4JZOA 3D0LA 3MFFA 2VRAA 1SVZA 5C07A 3IVKA 1D5BB 4X5LA 3TYGH 2R23B 4O02H 4GG6E 1Q38A 4OFIA 1LO3L 3JV6A 1XT5A 1AGDA 3RWIB 1EJOL 1OW0C 1U3HB 4DZBA 5JQ6L 3QO0B 1OGAA 5GGTA 4FMFA 2NTSP 1NMBL 3DO3A 3HAEH 4MHHG 3REWA 3D69B 1QLFB 5GISH 3MO1B 4LSDA 2X1QA 3JWDC 1PG7X 4HHAA 1KF9B 4OUUB 4NRZB 1N4XL 1G7JA 1CFVH 5GQBA 5CGYC 4M3KB 2D7MA 3ZT6A 4RGNE 4AK1A 2BNUA 2WZPD 5DJZA 3PDDA 5IW1A 1T7WA 1Z0NA 1FYTB 2WQRA 2Z31A 1BVLB 1JWSA 3MJ9H 4HPYL 3MGOA 1QSEA 2V2XA 2E9JA 4KTYA 3DJ9A 4PJ5A 4M00A 2DQDH 3QDGE 3PGFL 1AQDB 4D0BB 1IL1B 1DQJB 4JFEE 1I7UB 3TIEA 1KB9K 4G6ML 4K8RL 2P5ED 3KPQA 4XNMB 3SJVB 4HWEL 4AEIH 1JYXA 2Z93B 4DVRL 2IH3B 5DK0B 5JR1H 4FQ2H 4ETQA 1U8QA 3V0AC 3GK8H 2ED7A 3CLEL 5BMFL 5FECB 1A7PL 1WZLA 4APQD 1BLNB 4JJ5B 5FGBC 4PJCE 3VG0L 5I1JH 4AENA 1S7WB 4HWZA 4NQEA 3MLUH 5JTWA 4DCQB 1A6TB 4HS8L 4TUOA 5F7EL 1KPRB 2C7UA 2GY7B 4WHDA 4KK5D 1XGQB 3DHMA 3DNKA 1MFBL 3QP3A 4XC1H 3VCLA 5F6IB 2VXTH 4FRWA 4PJEF 1FH5H 2F54D 3VDAA 1I9RH 1T3FA 4Q6IA 1R5WA 4LIQH 1OGTA 3AM8C 5GJSH 2W91A 3RAJH 1U92A 4M3JA 2DTML 3MBXH 1T22A 3STZA 3DX8A 1AH1A 4NKDB 1YY9D 3JVGA 1KC5H 1H15A 3RWCA 4PB9H 3RVUD 2VN4A 3IVKB 4XPHH 3OAZK 1HEZA 4DZBB 5E5MA 3FN0H 2PO6D 3MRHA 2W9DH 1OGAB 3RIAF 3RU8L 1E6JL 3MUGA 3O6ML 4O58H 3DXAA 3O2DL 4ODUB 4UOW1 3NZ8A 2OLDA 2X05A 1I1AA 4RAUB 1MHCA 3L3KB 2VXUL 1A7NH 3AMKA 5GRZA 5CBEB 3K8KA 3V7AE 1S7RB 2EIDA 2J6EH 5HPOA 4I3SH 3IS0X 3D87B 1JGVL 5JLZB 4XVJL 1S5IH 3OKKA 3PQYD 1SY6H 4X5XB 4ODWA 4O4YL 2IQ9H 4JHZA 3U9PH 5CD5D 4FA8A 3ECBA 1BZ9B 5F9OL 2MKLC 3FO0L 3MGOB 3V5KA 4DEPB 5CSZB 1JPTL 1Z0MA 4BQCA 4YE4H 5LXGH 4K3HA 5DTFA 2Q1EA 5EU4A 3VXSA 5EB9A 4NQCD 2YXMA 1OTSD 1L7IL 3CSBA 2WAHA 4KRPB 3VD4A 5JUEL 5JZ7D 4UIKH 1UWGH 2JCCB 4PJ8D 1A9EB 3NCJH 1MNUH 4NWUH 5JPMA 5F1KC 5LQBL 4EVNB 1L0QA 3L3HB 2R2HB 1CU4L 1CLOH 4WHTA 3BDBA 1EBPA 5JXEA 5IT2H 4JKKA 2VLRB 3X14A 3HFML 3OJDA 3KXFB 3V6FB 35C8H 1HQ4A 3FMGH 1D5ZB 2B1HH 3QHFH 4QRUB 4RFEB 4RISH 1NCTA 2PYFA 4S10A 5CSBA 3JWDH 5ELIA 1QQDA 1DUZB 2YWZA 3RA7L 1XF4A 5J1SC 3JV4B 5ICZB 4FQXD 1A1OA 5FUCC 1KCSL 2J8UA 3AY4A 4OF3A 4IMKA 1CICB 4YBLB 5K9OB 4NJ9L 3DX8B 1A5FH 3D39D 4U33A 1IQDA 1A7RL 3QUXA 1TJHL 2YPLD 5DC9B 3SCMA 3U30B 2VJXA 5C9JA 3KLHD 5INDB 5IM7B 1YPZF 4BUGA 5IVZA 4P2YA 4XVUC 1JPFA 5E94B 1S9KC 4IDJH 1A3RL 4L1HA 4TRPH 3QIUC 2EE6A 1DLFL 1H5BB 1U8LA 4H5SA 1XF3B 2DQTL 2AXJA 3NZ8B 4NHUB 3RGVB 3ARBB 3KLDA 4K7PY 2ORBH 4X8JB 3TVMB 5C0DA 4ZFGL 2CKBA 3GRWH 4KJQD 2QLVB 2EDTA 1QR4A 3W0WB 4QRTB 3R0NA 4KVNH 4IHOB 3P4LA 1LHZA 1X4XA 2ADFH 2D9CA 3MJ6A 1P4BL 5HYIA 4LASL 2X70B 2YD3A 2O5XL 3VA6A 2XKNA 3STLB 4JM4L 2GJ6E 3WIFB 3BGMA 4HW6A 5DK2B 3UC0H 1IM3B 5EU4B 5I1GH 5EORH 2HT4C 4G8IB 4YO0B 4IOSD 4YPGA 4UQ2B 4K7PL 4P5TA 5KSVB 2BSED 4G42B 4R7NA 4M1DH 4DGIH 2FATH 3FONA 3VXUE 5ID0B 2WNGA 4XAWL 2Q6WB 3EOBA 4D0DA 4OCRL 1NGYB 2IGFL 2FJGB 3P4NA 1Z3GH 2VNCA 5DVMA 3VRLF 1RIVL 4U1HB 5DD0H 1F4WL 5F6HI 3ZL4H 5E00A 3K4ZA 2P46B 4J3VA 5JIKA 5AD0A 4I2XA 1HQ4B 2PXYD 4QRPE 3CXDH 3GBNL 4U6XB 2BVEA 2IJ0C 3H0TA 5JW3L 2ITCA 3LQAL 5TH2A 5B8CA 2GJZB 2J8UB 1KIUA 5DJCB 4WDIA 1ZGLB 5FKPA 1Z9LA 1D5XB 3ULVC 2HJFB 1L0YA 4NNXA 4O9HH 1IC4H 4Z7NE 2F8VA 3DX7B 4HUUB 3ARXA 4ZOBA 1K85A 5B21A 1C08A 5EU7C 1CFSB 2FO4B 2Q86A 2ZUUA 5FYKL 5IVZB 2P7TB 4TN9A 3GMPB 3CVHH 3VXMD 3RI5K 1J05A 4Y4HD 3ROLA 4X99A 4HS3A 4QHUA 3MLPA 3S5LA 1JNNL 3IDGA 1NLDH 2VZSA 1AP2A 4NQCA 2B1AH 3FO2B 5EUOA 3FRPA 2Y07H 2P5EB 3JWOL 5EO1A 1AIFA 1E4XI 1CTOA 4PJ8A 4MNHB 3VXNA 1ND0B 5E08H 5HYQB 3KPLB 4PJFA 5DRXA 1Q9LA 2E9BA 4Z78A 4FP8L 3MRJB 3X3FL 1MHHA 3CC5A 4APQB 3FJTA 3I9GL 1G9ML 4JM2C 1NGXA 1KTDB 4EUPH 5GXBB 2VLME 3BW9B 3DV4B 4MJ2A 2DWEA 2P24A 3BKMH 1TVDA 1R5VA 32C2A 4P4KD 1MCFA 1JHLH 3IT8D 1RUML 5DLML 1S3KH 4OGXL 2F54B 4KPHL 3T3PF 3BE1H 1K8IA 1QFWL 3F5WA 4OLZH 3THML 5JOFB 4JCLA 2CQVA 5FHBL 1MHPL 5IFJA 3MJ7A 5C09D 3PWVA 2MHAA 2AV7B 2PW1A 1Q9WB 3GJFA 2R0LL 1G6VK 3L3OB 3HI6H 4YXLL 3FO9A 3T65A 4LDOB 5K9QI 1VCAA 1X7QA 4P2OC 4OZHE 4M6OL 4JFFA 3RWGB 1NSNL 2RFXA 4MJ4A 2JJWA 5CJQL 4I2XB 4RNRB 2PO6B 1NFIB 5F7LB 2ATKA 1T0MB 3S7GA 2IPKA 4G7YH 3MREA 5DJDA 3SDDB 3PL6C 4UNTA 5IHZA 4U7KA 2E7CA 3CZFB 4PJIB 4HFUH 3PP4H 3BJLA 1NC4B 5ESQB 3SE4A 3QNYA 5C0FA 3TYFA 4KFZC 4ELKB 5IR1A 5F9WB 3DTXA 4Z0BL 4C56D 1N6UA 3PQYB 1Z9OA 3LHPL 5CSGA 1IC1A 3KJ4C 5GGQL 3I2CH 4UQ3B 3WKML 1RZKL 3VJ6A 1J05B 4LLDB 1Q0YL 4OD3L 1A8JH 4HFWA 1DUYA 1T66D 2OQJB 2AQ1A 4M8QB 4NQCB 1SM3H 5ALCH 4YHKL 2YUXA 5DO2D 2NW3A 3MQIA 3QIWD 5DHVA 5EO1B 4PJ8B 3KLAA 3BKYH 5DRXB 8CGTA 4Z78B 4R4NC 3WS3B 3LEXA 4WGWB 2CRIA 4UUJA 3OG6B 1FFRA 4U1MA 5ISZA 4NN6B 1NGXB 3DX9A 2WWKT 4QXUL 5FUOH 1F13A 3VD7A 4P99A 1XEDA 5F1NA 1D3CA 1MPAL 5LGJB 3EYOA 4Y5VB 3V4PL 4N8CL 4HIXH 1A6UL 5IG7B 2EC8A 3RZWA 5ICXB 4XCYA 4MNGE 4JPVH 3ARTA 5E6IC 4FQXB 3UYRL 3ULVH 3CGTA 4Y7MA 5INCB 4DKAA 1JF6A 1F3DH 2ZCLL 5FO9A 3H3BC 5CJOH 1WV7T 3D39B 3PHOB 2O26U 4S1RL 1LNUA 1NEZG 5D96C 3RZCC 1LK2A 4GAFB 2YPLB 4JPKH 1X7QB 2FLRT 2NNAB 1A9BB 2RFXB 3RGHA 5MHSE 2R1XA 4J7RA 3ARQA 3KLSA 4Z7WB 4W68A 2ATKB 4KMTL 3UJIL 3RIAK 3KYOB 5HGBB 1FSKC 2WP3T 3UJTL 5IHZB 4DFHA 5IB4B 1UM6H 4FFWC 4HD9A 2R1YA 4RWYH 2XWJB 1I1CA 2XOTA 1SBSL 3L1OL 1N3NB 4GMTH 1P9MC 4QTIL 3RKPA 3FKUS 4W4OA 4LSSL 4OZFH 3DV6B 4IEFB 3BT2H 3GHBL 3GO1H 3T1FB 2D2OA 1BHGA 1CQKA 2CKBL 4X9HA 4X7CC 5I8EA 1BWWA 3Q5OA 4JFQB 2NR6C 4RFOL 1AKJD 1BEYH 5CJ5A 4OF5A 2G2RB 1UH3A 3D18B 1R3IL 3BIKB 3QRGL 4NDMB 4H0IA 2Q8AL 5KSBF 5C0GA 2EDXA 3VJ6B 4ODVH 4DWHA 4XNQA 1INQA 3G08A 1EGJH 3AAZB 1NGPL 2EXYC 3TN0C 1CLYL 1FVDA 3KJ6H 3EAKA 5IIEB 1MFAL 3C5SB 5CINL 3QUKA 4NRXB 3GBLA 3KLAB 2OX5A 3O3EB 1J8HD 1O7SA 2FRGP 3QXDA 5C09A 3GFUA 3ZHDA 1MY5A 4BH7B 1UQSA 4G6JH 4PJGB 3WFBH 4U1MB 1F58L 4R3SA 3BXNA 3PHQA 1C7TA 3P77A 1NCBH 4OIIH 4RGND 5I76B 1HH6A 3X12A 1ZHNB 3S3PA 3SE9L 2IALA 3HMWH 1MCWW 3O6FC 2PXYB 5IV2A 4OCYH 5AZ2H 1JV5A 2Y36L 1M05B 1UM5L 3L3IB 4LU5H 5D7SL 2VAAB 1FLRL 3MODL 1FZOA 3QI9A 3SKJL 1CI5A 1MJUH 1TVHB 4EUPG 1JNLL 2QHRH 5F7KC 4JFED 2ATPA 3RWJB 5L8KB 1JZ2A 5IKCA 5JHDD 2GK0A 1E4JA 4M1CC 4QRRA 4JRYE 5CS7A 1I7TB 3SKMA 1MCDA 2IAMD 1JJUA 1CXHA 4QHKJ 3QHZL 4P2QE 1ZT1B 5I19H 3OWEA 3U7WH 3VXMB 2ZG3A 3SGEI 1EO7A 1IFHL 4R2GB 4Y4HB 5E8PB 4GXUM 1E6OH 3QO1B 5KSAA 1AE6H 4MD4A 1AXTH 3TV3H 5GGVY 2IBZX 4HS6B 4U1NA 1B2WH 3GKWL 3SDXF 4YUEL 2EDWA 4Y16D 3B2VH 1JFQL 2FHBA 1F45A 2CK0H 4P3DA 3OZ9L 4XI5C 2ZG2A 4XTRC 1OPGH 2D7QA 5BO1H 2P8MA 4WEMB 2EDHA 3U6RB 4WO4D 1M71A 4RMVA 4XPFL 1XCQB 1MVFA 1NUFA 2G75A 3MCLH 3MR9A 1QD0A 3BIAX 2P1YA 4FQQA 1C8PA 5LKNA 4P57A 4QHNA 5J3HC 2DBLH 2LAGB 4HQQL 3ZKQD 3UTTD 4P4KB 3V0WH 5FDWB 3S98A 5GRUL 3BP5A 3Q1SL 2CR3A 5K9JH 1B90A 5GGVL 1N64H 2HA1A 1OT2A 5HYSG 2HVJA 4Z18A 3WLBA 4ELMF 5E99H 1EBAA 3OKMB 3UPRB 3P9MA 3VWJA 5BV7L 3NOIA 4TSBH 1IARB 3GIVA 2XI9A 3TJHD 3N1QC 4KJPD 4F7CA 1DBMH 1A14L 3WO3B 1NMCC 3U7AA 5C0NC 1AXSA 3QUZD 2E6JA 3VD9A 5DJ8A 5F7MC 5DEZA 1A1NB 3Q3GA 4YX2H 1TTGA 1WFOA 2R29L 3ZE1E 2PCPB 1NBZA 5IKCB 5ACMA 4HIIA 5T3XD 3BX7C 4C56B 1KN2H 2AK4A 4XCEA 5ITFA 4NO2B 3RIFF 1WQVT 3ESUF 1LP9E 3MYJA 2EYTA 4P4RA 1DVFA 4Z7OF 2A6JB 3GSNH 4ZSOB 1JZ7A 1GIGL 2X4PA 3TZVA 3CZJA 1IVLA 2VYRE 4FFYL 4I5BA 4PFEA 1C1EL 4XP9L 4RIRA 4GG6A 1DCLA 1HKLH 2BVOB 1ZHBA 4GKNB 5IF0B 4W4NA 2FEDC 3QG6A 5HI3D 2ARJQ 3QIWB 3DETD 3QIBC 3BSZH 4OLWH 4DKDC 4Q0XL 1U8NA 5CD3A 1VACA 3WFDL 3U2SB 3BH9A 1S7SB 4EI6B 4HCRA 1F8TL 3UEZA 1LGVA 4HG4K 2PYED 1P7KB 5FGCB 1FC1A 3B2UC 4S11A 4FQQB 4WUUE 2HT3C 1T21B 4JZJB 3QUMH 2OBGA 4NP4H 3B4NA 4OZFG 1MI5D 2BSTA 3SDAD 1I3RA 3HI1B 4TUJA 4FABL 3S37H 4BZ1L 3PHSA 5D6CB 4R96A 4JFPA 3ZDZF 3HE7D 3WLBB 1N26A 2Z4QA 3MNVA 3QDGA 1OOAA 2HKHL 4JFEA 4JR9L 4KAQL 3S8WA 1RUAH 2X10A 4FQHB 1YNTA 1FGNL 3WS6A 2FX7H 4JHAH 4TQEH 5EOTA 3TT1L 2IAMA 5IESH 2BMKA 2P8PB 1CL7L 5HPMB 5I17A 4XPTL 3LEYH 2DLTA 3SGDH 1H3TA 3GMLA 4B53A 2NLJA 4GG8B 4M48H 4PJCA 3MZTA 2BSSA 3MRCA 1BGXH 4HJGA 5GSVA 5DJ8B 1CGSH 1OCWH 2B5IB 4L3EE 1RURL 5L0QB 3D1MC 4PY7B 5CZXC 1YEKH 4PJXE 2NY1C 2QQNH 4ZAKD 1XIWA 4XX1E 1TPXB 3MOBH 3C08H 2MFNA 4HIIB 2IEPA 5ETUA 5EN2B 4HT1L 5D7LD 4WO4A 1AKJB 5D70H 4P2RE 3QXWA 4CRPA 3H9SD 1ZEAL 4GRWF 5DD6A 4HXAL 1X4YA 3CU1A 5F9AC 4ALAH 4OGAC 4CGTA 1JGUL 4PY8I 1MEXL 1JHTB 1MCHA 2F5BH 4I3RL 1UH4A 2R0KL 5EC1A 4AIZA 4C4KT 5KAQF 2DQEH 4NT6B 1HH9A 2IQAA 3P9LB 3QQNA 1J8HB 2I9LA 1U8NB 1IGML 4BSVA 4O5LL 3W2DL 1W72A 1A02N 3EOTH 1ZS8B 3ARWA 3OB0K 1T1WA 1I85A 4JVWA 4W81A 3C5JB 5DEFA 3HI5H 4WCYH 1WAAE 1GGCL 3ESVF 1KPUA 3DWTA 3Q6GH 1HSBA 3LH2H 3EZ8A 3EO9H 2BVPB 5L88L 1HZHH 4RGNB 1EFXA 4FXKB 4X98A 4TVPH 3CCHB 2VZTA 2R4RH 1CD0A 5E1AA 3S4SG 1OWWA 3NAAL 4TUJB 1G6RA 1KCUL 1IBGH 3RPKA 5DR5L 5C7XH 1KTKE 3QUZA 5I18H 2G9HB 4K2UH 4K9EL 4IJ3C 3LKOB 5KG9B 1RHHA 1E4WH 4M6AA 4NOBA 3HE6A 2CD0A 4NCC2 2VTFA 5CMAA 5D2LB 1CE1H 2EYSA 1OSZA 5JHDB 5TE4L 4U6VH 3QFDA 5FAAA 4OV5A 1ZTXH 3UTOA 4AEHH 4KRPC 2VQ1B 3GMLB 3L7EA 1I9IH 1V7NL 1MFCL 5E2VH 5HYJA 2JJSC 3MNWA 1S7QB 3RJDA 5BZDA 2VLMD 3ETBF 4Z7UE 3V4UL 2KDGA 3JV0A 3RNQA 3VDBA 3B8SA 3JZ7A 3BO8A 2OR7A 4AH2A 1ZT4B 4Y16B 1VPOH 1A6ZB 3NCCB 1F4YL 2NMSA 1CT8A 2FD6H 1MQKL 5I8OL 4LLYA 3MRMA 4POZD 3QNZA 2HMID 2Q3AA 2VB5A 1U93A 3W39B 5CEYA 2V7HB 3QXVA 1QBAA 1QZ1A 3EFFB 3F7VB 3MV9A 3GSXB 3HC0B 3UTTB 2FR4B 3NFPA 4YDKH 5TPWL 4OSUH 1KCRL 4JQXC 4BH8A 4F15B 1DEEB 3HNTH 4OZIA 3B9EA 1CFQA 1XH3B 1OVZA 4JVPA 3P0YL 4RQQB 4XWGL 2DQJH 4Y5XC 4BSVB 1CDBA 1QPPA 1ZLWK 3VI4F 4Y4KA 3RUGE 3VRJB 1PVHA 2PR4H 5E03A 2WINB 5HDOA 2K3TA 2P42B 2EH8H 4UT7H 3REVA 1JUFB 4BQ9A 1H5BC 3QDHA 4UTBL 1D9KA 5BCAA 2G5RA 1AJ7H 3MV7E 4OD2B 1QNZH 1EHXA 4HEME 5EU6E 4X98B 1PYWB 3RGVC 5JOEA 5EFIA 1RIUH 2ADIA 4GUPB 1AD0A 5EIIA 2LVEA 1KJMA 2GJ6A 2WIIA 2V2TB 3QUZB 3CXHK 5LGHL 3NPSB 5KVFH 4K7FA 4BFIB 3CX5J 4JFYB 2VZUA 15C8H 4HKZB 4R0LB 4WW2C 4I18B 5C08E 3MRLA 4KV5F 1CLZL 1OSZB 4A6YB 1AO7E 2P43B 4YXHL 5DWUH 4JZNB 4P48A 5ERWB 3HPLA 4OV5B 4LLVB 2I07A 2PW2B 2EIZB 1FL3A 4JG1H 4RX4A 3VXUA 4XPAH 1O7VA 1QACA 4NM4H 5AZEL 3AVEA 5GRVK 2VSDA 3SDYH 3QA3B 3FOLA 2B2XH 3R4DA 4P5MB 2BVUA 5FYLL 5BZDB 1WT5C 1HOCA 4NZRH 3G5XA 2YBRA 4M7KL 5HHOE 4UINH 3G9AB 2EDYA 3JUYA 3FT2B 5CKAA 3MMEB 3VFGH 4P5KA 3CMGA 4EEEA 4QRPA 1T4KB 5DFVD 1T20B 2WMPA 1G7LA 3KYKL 4DN4H 1RFDH 4NHCH 5EC2A 2IF7A 5GIRB 5HDBF 1NCWH 2NXZD 3AS3A 3HC4H 3WSQH 2F5AH 5EO0B 2PYEB 2XZAH 3TP4A 5CEYB 4HKBA 3WUWG 1FZKB 5FYJE 5D7KE 1RJLB 1N6VA 3BRDA 2YA1A 4HCRL 5DUPH 5IW6B 4YBQD 3FQRB 4YQXH 4FQIH 3G6JE 3EYVB 4ERSL 1JTPA 2FSEB 1MI5B 5MHSD 3FQTA 3SDAB 4H88L 5BW7A 4EIGB 1QLRA 1JF1A 1OARH 4EBQL 4Y19E 3LS4H 1UCBL 3HE7B 4OF7A 3NMEA 4Z5RB 2UUDK 4WNQB 2NW2A 1A6AA 3WXVL 3GSUB 2I60H 3DSFL 2DICA 3V8CA 1NLBH 4EDWL 1QKZH 3ARDC 1Y6KR 1JGLL 2IFGA 4MLIA 1P2CB 3ULSA 5I30L 1NUNB 2I24N 4WW1B 1DANU 1JZ8A 4JFXA 3O2VH 3PGCA 5F7NC 5HYFA 3T4YA 5E2WH 1T1XA 2A6KB 2ZP0T 3LS5H 4HH8A 4HUWB 4KJYB 1ONQB 3EJZD 4ZAKB 3HUJA 4GS7C 1TQCC 1RZ7H 1CFTA 5FA3B 2HFTA 5E6ZA 4OUOA 5BRZB 2E9WA 1FE8H 2A83B 1F4AA 1PD6A 4MCZA 5D7LB 1CBVL 1GOGA 2H8PB 4J4PD 1XGUA 5EIVA 5GZOC 3RIFK 3H9SB 1Y6MR 3UTZB 3CFIC 4GH7B 1PEWA 2J4WH 5ILTH 1JP5A 3CDCA 1AGEB 1B6DA 3OJVC 3NH7L 5AAWA 1G1CA 3QDMA 5DUMH 43CAA 1WFUA 2NY0C 5SV4A 4PRHA 1C12B 2QSCL 4RRPA 4N9GB 2LU7A 3BN9D 4NM8H 4ISVA 2VXQL 3CH8A 4AT6A 3M17B 3ILPB 1RJYB 2DD8L 4XP6L 1MRDL 3B9VA 3NPZB 3G9VA 4ONHB 4KK8D 3NCYP 3QCUH 4PB0H 2WUCL 4HKBB 1IAIL 1Q1JH 1W72L 4HKXB 4PREA 5KVDL 2YD1A 2N7BA 3TCLB 4K07A 3SDDC 3LCYA 2BVTA 4JRYD 3VFWB 2J8OA 1AGCA 5HGHA 1GZQB 4UV7L 3QEQE 1QLRB 3ZYJA 5ID1B 3MUZ1 3TH3T 5CHNB 1TZGL 4I48A 3BZEA 1IEBA 1U8KB 5FEBA 1S5HB 1G6RL 2E7LC 3MCKB 2ZKHL 5CD5C 2EXWD 1DL7L 1M7XA 1MVUB 5KS9B 1EFQA 2F53A 2GTZA 4JO2L 4KDVA 4UDUB 2DWDA 2BNRE 1U9KA 2ZCKL 5D7IB 5TDPB 2CMRL 1YEEH 5DDHA 1OTSC 4A6YL 4N1HB 4CU6A 1FDLH 2YN5A 4X6DE 3L6FA 3TBWA 4JFXB 2WUBH 3O0RL 1CGXA 1UH2A 1YC7A 3S34H 2D31B 4Y5YB 4KZEH 1FIGL 5T3ZE 3OJMB 3QUYA 4M7LH 5CP7A 3EOYG 1ORQB 4FQJL 4NN7B 1D6EB 3L5WA 2DI7A 1JPGB 3G04A 4ONGH 4LEXL 4XMKH 1K3ZA 3BZFB 4URTB 1XR9B 4LSTL 1LEKA 4OQTA 4MNGA 4JRXD 3ZE0F 2FECI 1F6FB 3VI3E 4QT5B 2BXYA 4Y5VC 2Y7QA 3L9RB 1SEBA 3ULUL 3BH8A 2AI0L 4HBCL 3MRNA 3KR3H 2AJ3B 3TO4C 2EICA 1EERB 5DMGC 2QSQA 2XICA 4OZHB 5TGBA 3KS0H 3MRIA 4F9LC 1J1PL 2VN7A 4XPGH 1V8HA 4JB9L 4L8DB 2OI9C 3VH8G 5JORA 4X6FA 4S1SH 5H35B 3EO0B 1E4KC 5JIIA 3WHE0 4EKXA 4UT6L 1A64A 1MELA 5K33A 4MB4A 4O2FA 4ZFZA 1NCCH 2BOCA 1CS6A 4FQCH 5F7WC 5FA4B 4ZXBA 1YNLH 2CIIB 2HH0H 5E7BA 3S37X 3HR5A 3S36L 4N8VA 2PTTA 1RVFH 1OF2B 2DQCH 4GKSB 3IRPX 2V2WA 4Y2DD 5SX5K 3BYYA 1PX3A 2AK1H 1LO0L 4HDIB 3SN6N 2VL5B 3LRHA 4PIRF 2VWEC 4HGWB 1IEBB 1KJ2B 5BS0E 4P59L 5BZWB 4LLWB 1ADQH 4XHJD 1YQVL 2OM5A 2ED8A 5D1XD 3T2NH 4PTUB 4OJFL 1U95B 1OM3L 1QLEL 1I8MA 5C0EB 1G0YR 5FOJA 3W82A 2DL9A 3U46B 2UWEB 4TUKH 2F15A 3L6FB 4LGRB 4XVSL 5TFSH 3ARED 3N06B 2YSSB 4WUUD 3VXQA 4NZDA 3GSQB 3CFJA 4XZUA 5FV2A 3X3GH 4LCCA 4MYWB 3ES6B 3L5WB 1NDGA 3W9DA 1R24B 4Y0GA 3W11D 5CBAA 3H7BA 1CIUA 1AR2A 3TLRA 1JRHH 1N8ZB 4GRMA 2NXZB 2VDPL 1A7OH 1BOYA 4LVNC 1GZPB 5CEZH 1INEH 4C59B 1HHJA 4HMDA 1ZA3B 1WBXA 4O51B 3QH3A 1IGIH 2GSGB 5FUCE 3UTSE 25C8L 1I3GL 1QFWM 3LN5A 3ZKXB 1NL0H 4P2QA 4ENED 5EWIL 5DRNB 2LTQC 5H8DA 3WCYA 4X7SL 4YHYC 4FFVD 1YEGH 3OHXB 3WHXB 3UO1L 5F72S 3N9GH 1NMAL 2A0LC 3D25A 3SGKC 1G0XA 4L3ED 2DMCA 4UNVA 4UI2A 4Y8DC 4WY7H 3IGAB 2CJUH 1FPTH 1J5OH 2VISA 3NTCL 4Y4HC 4R2GC 2B4CH 4WU7B 2NYYD 5E8EB 5JNYA 4JDZB 1DQLH 3GEWB 3BMWA 3EZJB 3TNMB 2AXGA 3NIDF 4P2RD 3HNSL 5D72L 4MWFA 3OGOE 1KJ3L 3T0EA 5KZCD 1MIEL 4M4PA 2QKIA 1FVEA 3QWOB 4UAOB 4F58L 3I75B 4M93B 2C1PB 3TT3L 3BUTA 3IDJA 1FGVH 1CDJA 4FTVB 1OAUH 4CU8A 3NN8A 3FQWA 3MRFB 5IB3B 3TIDA 4P4KC 3P4OA 4YHIB 4IOIB 4Z8FL 4OTXL 5IK3B 2YD6A 3WFCL 2NY2B 2FZ3A 2JIXA 1G0DA 2XZQL 3AFLA 3FN3A 4V2BA 4FQLL 1DSFL 2KZWA 4RCAA 5J6HB 2DF3A 3O6LL 2UZIL 3FN9A 1DN0B 2ICCA 1I75A 2OJZL 4PR5B 3QQ9C 4L5FH 5LJYH 2ENYA 3KWWA 3SGDI 4Q97A 4U0RB 2FNBA 2JELL 5DXWA 4S1DD 3SO3B 4LQ1A 4UV4L 5D2NC 5J12C 4LSPH 5EA0H 2P4AB 3EO1A 1GGBL 4MQXC 5I1AB 1FVCB 5SX4H 1KSRA 3KPNB 5BQ7A 4MJ6B 4OCSH 5DRWA 4MJIE 2J8UF 4BQ8A 5CIPB 4KQ3H 1MF2H 5J1AB 3MLXH 4JRYB 4KXZH 3H7LA 4LHUG 4OGZA 3ULVE 2VKWA 1R5IB 2YPVL 1IE5A 3UZVB 4M5ZL 1KBGL 4GMSH 3GM8A 5C0IB 3DURB 3MXVL 4NO0A 5EU7E 3FQNB 1MWAH 3NVQA 4DQOL 2IPUG 2R0ZL 4S1QH 1KJ2L 3ARSA 5DMYA 5IBLD 4XMLL 4YWGL 3ZYZA 3PXJA 1VFBB 5K59F 4R6UA 1FZJB 3WLWD 2HT2D 1S7TA 4YHZL 1MIML 2RAMA 4F7EA 1A1MA 4CADB 3EHBC 4MNQA 4MMXC 3SKOB 1F6AB 3T0BA 4XCNA 3GIZL 5IWLC 2DQHL 3QIWC 2DLGA 3FAWA 1I3UA 4Z7QE 1GC1L 3EJYC 3RWHA 4YHPB 2EYRA 3GSOB 1INDH 1UZ6E 4JY4B 3BQUC 2B0SL 1A4KB 4XNUH 2YPKB 5IJVA 5T33H 1W8NA 2YUWA 5D1QB 3BVNA 3K7UA 3OX8A 1CR9L 3NN8B 1KTLA 1U6AL 1J0YA 4JRXB 1HILB 1YNKH 1S9VA 3IDNB 5AWNL 1GHFL 4OQTL 4S2SA 5L8LB 1Z5LA 1TVBB 4TPRH 5C1MB 2Y72A 3O4OB 2D3VA 4JN2A 3R1GL 2G60L 4U05A 1EUTA 2DLFL 2QJDA 3IU4L 3KDMB 4LOUC 5JXAL 1NFDA 2GFBA 4KKNA 2VDOH 3PNWB 2AKRA 1YEFH 5HHXH 2APTA 3B9DA 4L3EA 3L95B 5I75C 2LABA 3FB6A 1HXMB 4PJXA 5T1MA 4V1DD 5C08D 3QXAB 1IAOA 4Y2DB 5DZOA 3QEHA 4WTZA 4S0SD 3GSWA 2CLRA 2EDFA 1RJZB 2B5IC 3K8MA 5L0QC 1K6QH 1LP9B 1XGRA 1KIPA 5HJ3A 2KZ1B 3EYUH 2UY6A 3ARGD 3G5ZA 4MCYB 5IBTH 5IHBA 4M02A 2QQLH 3RX5A 4XXCA 4QHMA 4JY6A 4PTTA 3ZHKA 5HHOD 4WI4A 5FM5O 5A3IC 1BFOB 5D1XB 3B43A 2FBJL 4MS8C 3AROA 5EUOF 2V9QA 4L4VD 1ORSA 4MA8H 3ILQC 2PETA 1PZ5B 4P3WA 3ZDYE 4NKIL 4UU9A 1OAXL 1S78C 4PJFF 1Y18A 3RWFB 3VXRE 1KJVB 3T08A 5KVMC 5L2JB 3ZT7A 2ICWJ 3HC3H 3G6DH 2ZUQC 3AREB 4AM0B 4WUUB 3QJHB 1K4CB 2RCSL 1QRNB 5L8JB 1G9EA 4G43A 5BJTA 1EO8L 2XTJD 3TBVA 3L5IA 4QHLB 1T2QH 1BPVA 5IGXL 1IJ9A 2OK0H 3L5HA 5F3HB 4Y19D 1H0DA 5TDNA 1T1ZA 4OAWA 3IXTA 4J3TA 2ESVE 3C6LB 1NEUA 2R69H 2MPAH 5F1SA 1H3GA 1S9VB 3OR7B 1MAKA 5IJKC 4JREC 3HS0B 1K5NB 4PLOB 4HV8A 2UVEA 5J6GA 3VMPA 2D7TL 1CDGA 3IFPB 4MA3A 3N1FC 1J9CT 2FYYB 4R8WH 3MTRA 4LLQA 4ZTOL 1S8DB 2HLFC 2YA0A 4Z7UA 4QO1A 5KANI 2EH7L 3RY6C 4WHYH 4PUBH 3C5ZD 4LCUB 4RBPK 1RZ8B 3LQMA 1OLZA 4AQ1B 4JN1H 4RMTA 1JWUA 1WGOA 3T2OA 2D7NA 3TA3B 5C0CE 2X4SA 1KXVC 6CGTA 3RVXC 3O3AB 4E9LA 3C87A 4PRBA 3SQOH 2A73B 4P2RB 1BJ1H 1QFUL 4Y16C 4H1LH 4YZFF 3MRBB 1JPST 4QRSA 1JK8A 3G5ZB 4Y4FA 4F7MB 5C0RH 5FHAH 5KZCB 2ADGA 4QNPF 2DYPA 2VE6A 1IAKB 4NSKA 4JKPH 4OFDA 2AJZB 3ZKND 2VC2H 1RUQH 4PLKC 2NTFA 2GSIA 2BDNH 2KH2B 4HPOL 4OLYH 2DRUA 1AD9A 5KVEL 1R3KB 3HHRB 1VFMA 5D1ZA 5F3BA 3MLZH 4F15C 4Y89A 1PKQB 2QQKH 2P8LA 3RUGA 1KELL 4M61A 5DFWH 4N0FA 1QYGL 1U8IB 5IBUG 1YPZA 2NCMA 1CD9B 1QR1B 2X9YA 1G84A 5IMLB 3B6SB 3U7YH 3WFZA 2XN9E 5C6WH 3MV7A 3IKCA 3FZUC 5EU6A 1LK3H 4X80L 1FFPA 1YY8B 2A74A 3GUTB 3FT3A 2FJHA 1TZIA 5CGYD 4M43L 4UB0H 1IGFH 5CUSL 2DQFB 1VADB 5IMMA 5C70A 1U8MA 3U9UB 5SX5H 1NDMB 5C08A 2ICWA 2XRAH 5BVPL 1AO7A 1T7ZA 3NPSC 3C60A 5J6GB 4RWHA 3GSRB 3GMOB 3PWUB 3OPZL 3HCVA 1EHLH 4I18C 4R97B 4LLQB 4YHMH 1FNAA 2DS4A 4XBEL 1I8KB 3I3BA 5DQDH 3S35H 5T5NG 3PWJB 3G6AB 5HHOA 1BM3H 5ABDE 1YJDL 3CLFL 2VDNH 2X89D 5I1DA 1ZHLA 4IRJA 5TE6H 2FO1A 4FZEL 1HKFA 5MEOB 4D9RE 2X4SB 5E2UL 4W70A 5TQ0H 4KI5F 3E8UL 4PBXA 4L9LC 4PJBE 4PRBB 2X4TB 3VFOA 5IP4A 4NZTL 5K9KB 3ARPA 1JTOA 3U0TB 2EEBA 1EAPB 5F8RC 1BMGA 2X4UB 1EEYA 2C3GA 4TULL 3NCYS 3LZFH 3MRDB 2VLLA 1NGWA 1CFNA 1KLGA 1MRCH 2NPLX 3CSYB 4NSKB 4KQ4L 1U8OB 1NAMB 4RA0C 5GS1B 4ODXB 2NTFB 5EOCH 4U7MA 1D5IL 3WN5A 4L8SA 3CDGB 4Y19A 3UBXG 3FFCA 5EU3A 4XNXL 1MHEA 4OFYD 5ESVB 1GGYA 3SDAC 5ENWB 3RUGB 4HUVB 1OAKH 3IYLW 1LO3H 4M61B 5BVJB 1P4LA 2L7JA 4QRQA 3QNXA 2ZCHH 5HVFB 5C0AE 3A67L 2OTWA 3HE7C 3IDXH 5IHUH 1S7UB 2VABA 3HAEB 5DUBA 1H3VA 2MMXA 4DGVL 3Q6FA 5C3LD 3NFNB 5BS0D 4MAUL 3O9WA 3IFOB 4I9WE 4KHXL 5TQ2H 4EQ2A 3CU7A 2C4XA 1SY6A 1QRKA 4V1DB 4TVPE 5C08B 1BQHG 1FZMA 3LOWA 3CPLB 3IXAA 5CWSB 4Z0XA 4HPYH 4ZPTB 3VFNB 4OD1L 3VXTA 1J1OL 5I6XC 4ZFOA 3ARGB 4G8FB 4TTDD 2OZ4A 3PGFH 4HLZG 3CFDB 4NGHH 3E3QC 4G6MH 4K8RH 4HWEH 1UVQA 3FQUA 3HG1E 3QZWB 5HYEA 3IU3B 4BSWA 1R3JB 4Z7VB 3WEXA 1KIRA 2VLKB 3KPSD 4M6MH 3PABA 4L4VB 4TOYL 5IVXB 5FB8B 3OJ2C 1A7PH 4NUGL 1XR8B 3RL1A 4NRYB 3VG0H 2GT9A 5EZOH 4KDTC 1OW0A 1KEMH 3VFOB 3VFVA 3MLYL 4HS8H 5F7EH 4WJ5B 5CEXA 2NY5L 2J8HA 2W0FA 3VXOB 1LO2L 4WHYG 5HHQB 4HIJB 3SGJA 2O61A 1EEYB 3GZKA 3HLAB 1Q9OA 3TC9A 1KPVB 1MFBH 3PWPA 4J1UB 3QJFB 3G6JB 3WIIL 2XTJB 1EDQA 1UWEH 3LKRB 4BSJA 3MA7B 2GAZA 2D0HA 3QEQA 1DJSA 1KB5B 4PGEA 4NZUH 3MA9H 2EO9A 4JFOA 1RMFL 1F4XH 1ZLVH 5D9SA 4H1LG 3T2QA 1ZLSL 1T7XA 1KG0A 43C9A 5BOPA 2C4FT 1KGCD 5GGUB 3T77A 2ZWLT 1HHIB 3QIUD 5ADOH 1MLBA 4JKMA 1MLCB 5B38G 4MLSA 2BNRA 5DEGA 1ZV5A 2VABB 12E8L 3BJ91 3MRGB 1WWBX 3MBED 4RMWA 4DK6A 1FYTE 1X44A 4HUXA 4HF5L 4X6DA 1GGTA 5F7FA 4KRLB 3A6BL 2XG5A 5D4QA 3P4MB 3P40A 1WBZA 5I71B 4NKMB 7FABL 4QOKA 1DQDL 3C5ZB 3GRWA 4IRSA 4YDIL 3TFKC 2X89A 5AYUL 5FGBA 5DRZA 4XVTL 4K3GA 3DX6B 3M8OL 4ZO7A 3HKFA 5LBSH 2LE9A 3I3EA 5F9OH 2AGJL 4ZUSA 3FO0H 1IGTA 2HT4D 3BKCH 3DVGB 1NEZA 3GJEA 3EYSH 1F90L 1GYAA 2JB5L 3AM8A 4DAGH 1EMTH 3KYMB 4YXKH 2XQBL 3UYPA 5LCVH 3FFDA 4GG6F 5TF1L 2H9GA 1IZKA 3JWOC 1WC7B 4JPWL 5DS8A 3C9NB 5FYJU 3MRQA 1S9XA 4MXQC 2X4RB 4B50A 3M1BA 4OFYA 4IIQA 2VZ3A 2HKFL 1DN2A 4UTAL 2Y5TB 2MJWA 3LN4A 3HFMH 2VZ1A 4GBXB 3TYGL 1GAFH 1CN4A 1U3JA 2F19H 2BP3A 3BMVA 4GAGH 5SWSD 5L7XH 3RA7H 3ULVD 1KCSH 3H3KA 3O8XA 2FX9H 2JTDA 5T1LA 5BS0A 2OMBA 3OXRB 1A7RH 3VXPB 3SKUD 1AHWC 3IDMA 5FOBB 1CFVL 2B7DT 5DA0B 4F2MB 4WFGE 1ZVYA 3T77B 2VR4A 1ZSDB 3K1DA 5FXCH 4N0UE 3GJFK 3U36A 3BP6A 1MCQA 4DVBA 5I2IA 3JVGC 3CVHA 3ALXA 5FCUL 1MH5A 3DO7B 1DLFH 3MJ9L 5EIQA 4ACPA 2IWGA 4ZG1A 4LEOA 3BD4A 4YDJA 1AC6A 1TETH 1G7MB 4G5ZH 1WBZB 5DMKA 4HC1H 4PJCF 4UDTA 3D2UD 4U1KB 4XB7A 1DDHA 2XKSA 1BBJA 3GMRB 4JM2D 4PRPB 4AEIL 2JCCE 1F3DJ 3UZQA 2NY3D 4LQFH 1P4BH 2CIKA 4LASH 4FQ2L 2O5XH 3GK8L 2I27N 1VGKA 5HGDA 2H26B 3JWNC 1RK0B 5GGSA 4NQVA 1A0QH 1IGTB 1OQOA 1HE7A 4NN5C 1FNEB 1NEZB 5I1JL 1RZFL 5DFVC 2VLRE 3MLUL 2DM2A 4C58B 2EDRA 1FO0A 2QQQA 3KXFE 5FYJL 3UTSA 1FCGA 3W9EB 3CJJA 3HNVH 4XC1L 4YIQA 5HDQH 2VXTL 3FFDB 4K7PH 1FH5L 1BBDH 1I9RL 4XC3H 5AUMB 4I77H 4D0CB 3VD3A 5GJSL 2BCKA 3RAJL 2SEBB 4HMCA 4P2OD 4KUCD 3MBXL 3OTTA 1RIVH 3ZKXC 1KCVL 2JJTA 1KC5L 2APVA 4ZODA 3DUHA 1Y0LA 5DJXA 4EN3A 1C16B 1FL6A 1PQZB 3GBNH 2HN7A 5JXEC 1JNHB 4YR6B 3S96A 2ADJA 3FN0L 5D7JB 3RY5A 5GGTH 1JGDA 2XT1B 1EEZA 1IAIM 1DBKL 2C3XA 4N1CA 1IILE 1ZVSA 3WFHA 4Z77A 4OZ4B 4GQPH 3O3BB 3RHWF 4OLVH 4I3SL 4X6BB 3AY4C 3W0WE 3AXLA 5D5MB 4CNIB 1S5IL 1FCCA 3BP6B 3JTTA 1SY6L 1VFUA 1MFEL 2IH1B 2YKLH 5F7YC 2IQ9L 4UAOC 3U9PL 3SCMC 3VXRD 2AEWA 1NUGA 1JNNH 3ARUA 3ARRA 3MGAA 2X44D 4ZFOL 5LXGL 4U6HA 3JWOH 5H2BB 1OWRM 4NQDA 2OZ4L 4XH2A 1L7TL 2CDFB 1ES0A 1N7ML 2NY2C 4UIKL 4H0HB 5EZJA 5J1TC 1UWGL 4RAVA 1RHFA 1CLCA 3IJHA 4Z76B 3KPSB 1IT9L 4OI7A 2HVKA 2X4OB 4QKXB 4X8XA 2ZSWA 1G9MH 5K93A 4EUPB 1AY1H 1HYSC 1CLOL 4CVZA 4JPIB 2GCYB 3ULUF 1JN6B 4MJIA 1VKXA 3CIQA 3IJYB 1RUMH 4WFEE 3TGXA 5DLMH 3AB0C 3K46A 4H26B 4LDEB 35C8L 3HMXA 4KPHH 3FMGL 3QHFL 4OCWL 2V6HA 5IB1B 4RISL 5ACZA 5C2BH 1PY9A 3RZCD 4JJHA 3IETA 1BZ7B 4ZYKB 4QLRA 4RFNC 5JW4N 4YXLH 4NZJA 4TSAH 2EDNA 1ZE3C 4P5TC 4IM8A 4M6OH 4PV9B 4OBRA 4ORGA 4YFLF 4YGVA 2WLZA 3QIUB 4XRCA 5C2UB 5C0CD 2NXYC 1UB5A 1BF2A 4FFWD 4ZUVB 3X13B 1MSPA 3MBEB 1YDPB 5EO9B 4X4YB 4R4BA 3ZHLA 5F96L 1IM9A 3CFEA 4IDJL 4ZUTB 4IS6A 4HLJA 2W60B 3B3IB 3WL9A 1G7HA 3GMQB 3MROA 2VQUA 4H25A 3HZVA 5ICYB 3LKQA 2NR6D 4HWUA 4Z77B 2GUOA 2ORBL 4IMLA 5T3ZL 4LSQL 1J86A 2P5EE 2MCPH 4Z0BH 3DMMD 3GRWL 5B8CC 5HYSB 3C8DA 1AI1H 1XGTA 4PJ9C 3S35X 5F1IB 1T5WA 3ZDXF 2VQTA 3JTTB 4UBDC 4PJDA 4YHNA 5MP6L 3WKMH 2EXYD 3KGRA 3TN0D 3ZE2F 4OD3H 5F7DA 1ZT7B 2JF1A 4TSCH 4ZUUB 5D1QC 1NJ9B 3UC0L 4YHKH 4WRLA 1Z6JT 4G9DB 5EBLA 2XN9D 5EORL 5AG8A 1PG7H 2ID5A 1LWRA 1GGUA 2F54E 3VA2C 3MJ8B 1WISA 3GMMB 1KLFA 5DD1L 4P2OA 4M1DL 1YEDA 4HIEA 2FATL 1TTFA 4ZNEA 1VA9A 2DQUL 1A4JA 4N0RA 1SHMA 3O6FD 4U1SA 5HHNA 3H42H 5I0ZA 1VSCA 2R1WA 1MPAH 1WCBA 3PL6A 4HKJA 5KN5A 3V4PH 3U0WL 4Z7NF 5SWSB 3BAEH 3BP4B 4JLRA 3X11A 4K3EH 4WWKD 3ZKMC 1OB1B 4KRNA 4LPTA 3VU2A 1GGIH 4M1CD 4G8GA 2ZCLH 2OSLB 3RPIA 1FG2A 4PJIE 1KEGH 3UYOD 1OD9A 5IEKA 2MQ0A 4O9HL 3TO2A 4E0RB 4P9ML 1F00I 1H3PH 5BV7C 1X5YA 1TLKA 3PQYE 4O2CA 4XHJC 4FZ8L 5GGSY 3UJIH 1SQ2N 5HI4C 4OB5H 3VXRA 5D1XC 3UJTH 3CVHL 4CVWA 2CLZB 1W0WA 4KK9C 3H9YA 4GW4B 3HPJA 1SBSH 4XI5D 3L1OH 3L3DA 4XTRD 1ZLUH 3D2UB 4OZFB 2B1AL 3U4BL 5EBMA 1KIQA 4FS0A 3GHBH 4U1LA 1P6FA 2CKBH 1DFBH 4JM2B 2I26N 3RP1A 5GJTH 5IMKB 2ZOLB 4GAYB 2NY3B 3IAGC 5E4EC 2GHWB 3OKEB 4RFOH 1TJGL 4XGZA 2DI8A 4OF6A 4TNWK 3MNZA 1JMXA 1BOGA 5FIEA 4YHNB 2HYMA 3E6FB 2ESVA 1CWVA 3P11H 4F33B 3QG7L 4WEUD 3B9KA 4YHLL 3W11C 1HQRA 4L8BA 4XNZC 4MZ2A 5E6IA 4I3GA 4X4ZA 2AJXL 5CINH 1KNOA 4P23A 1D5MB 5C0AD 1JHLL 3C6LC 2DAVA 3RTQA 1FO0L 4CVUA 2ICEA 1SJHA 4I4WA 1BJMA 2G5BB 3NA9L 2F9BT 3BE1L 4OLZL 5KSBE 4P2OB 1XGPA 1TZHA 1F58H 5DJ2A 1NC2A 1XF2B 1BZQK 4I9WD 3D39E 3PUCA 5TE7H 1N5AA 1T0NB 4GW5B 2YPLE 2AEPH 1H9VA 5C0JB 1J8KA 4FFVC 3FO1B 2XWBA 4HJ0C 3EYFB 3TPUA 2Y36H 3OB8A 2VDRL 1CDIA 2MQ3A 3I6LD 5FO7B 5D7SH 2V7NA 1QA9A 2HJLA 4PG9B 1FLRH 3ARFD 3MODH 2NY6D 3FT4B 3WJJA 5FF6A 4PGDB 3SKJH 4O00A 3TA3C 4N90D 2XPGA 4NIKB 3MCG1 4HFUL 3PP4L 3KJ4B 2VWEE 4LSUH 3NIGF 4ONOA 2FL5B 5MEPB 4MD0A 1J0JA 3QHZH 1UB6A 4PJ7A 5E70A 5L9DL 3OGCB 2HFEB 3F62A 1K8DB 3TN0A 4WTWA 1NBYA 2FEDD 3I2CL 3MOQA 5F9DC 4MAYA 3QIBD 4WI8A 1S7VB 1R3LA 4NQXB 2V5MA 3V6ZB 1A3QA 1A6VH 2XN9A 1IQWH 1AGBA 3LKNA 3O6KH 4L3CB 1LO4H 4DOHE 4X0KA 3S4SB 3OZ9H 4NUJB 1RZIA 1HHHA 5E5UB 3DRQA 4QYOB 4XPFH 2HT3D 3LRSB 1DZBA 3D5OF 2BSRA 5ITBH 2WWKO 4PJGE 4N8PA 2RHEA 2QR0A 3K1KC 4HQQH 3D6GA 1HQRB 4ODHH 5GRUH 1BIIA 4X5WB 1U8HA 2R2EA 1I1YA 2Q87A 1I1FA 5IVOA 1VB9A 5GGVH 4NKQB 5IB5B 4Q9QL 1HHGA 2AXFB 3PDOB 3IKKA 2YD9A 1UM4L 5FKAA 2Q3ZA 1UJ3A 3EKCA 3CH1B 4KHTL 3RZCB 3DGGA 3HMXL 1EX0A 1MJJA 5D8JL 4J8RA 5CZKA 4JPVL 3KPMA 5MERB 3ULVL 5JIHA 2YOCA 4QXTA 4XCCH 5DJ2B 1N0LA 3GJFH 5CJOL 5BV7H 1C5DA 5HGAA 4MD5B 1FSKB 1ROWA 5C0CB 4JPKL 3W81A 3C6SB 1A14H 1PX4A 3K4DA 5DGRA 1P5VA 2GITA 1IC5H 4PJBA 3WUWA 5J89A 2WP3O 5CILL 5CZXD 1KT2B 2NY1D 3ME0A 4JO1L 4P2CG 2JK5B 1UM6L 3SKNA 4X6EA 5I66A 3P2TA 4GMTL 4G7VL 1T83A 2QEJA 2UYLA 4U1JA 4HAGA 3DMMB 4LLMA 1VDGA 2H2PC 1MCJA 4MJ5B 2BC4A 3BT2L 3GO1L 5DK3A 3RHWK 4ZQKA 4OGAD 5GS0C 2AQ2A 3GSNB 1E27B 1BEYL 3I6KB 5GS1C 2A6IA 4BZ2L 4XP9H 1LEIA 2A9MH 2L4OA 1U8JB 3KNBA 5A40E 3L5XH 1U91B 3F8UB 2CDGA 5C0AA 2H32A 4HZLA 3KJ6L 5KSAC 4NOFA 4Q0XH 3O2DA 4PRNB 3WFDH 1VFAB 2BJMH 2IG2H 4JDTL 5F97E 5DHVH 2ZSVA 4Z7OE 4F7PA 3WYRA 3IFNH 1MCRA 3DI3B 4OZGB 4PRAA 5EUKA 1KLUA 4K7PX 4G6JL 3O6FB 3WFBL 3HRZB 3QUMB 3TF7C 4ZO8A 5D2NE 5JPNB 1QG3A 2Z91A 1NCBL 1P7QB 1RSFA 4HX1A 1S7XA 3R06A 4FABH 2H6PA 2R8SH 1OY3B 1ZA6B 5E8NA 3T4AB 2HTKC 3HMWL 1IEHA 3DVNB 2ZZUT 4ZUWA 4WWKB 4PD4J 2DLHA 8FABA 2HKHH 1M4KA 1UACL 2PF6A 4JR9H 5JA9A 4KAQH 1HWGB 1MJUL 3OXSA 1PG7W 3HG1A 3QFJA 5LWYL 4OKVB 2KBGA 2YC1A 1CL7H 3VFMB 4JQVC 4AZ8A 3AC0A 4XPTH 3ROOB 4C56E 1XF5B 4RGOH 3SPVB 4QXWA 3VWJC 1T1YA 4PJBB 1IKFL 4ZSOE 3U7WL 3I6GB 1D5BA 1E6OL 2C26A 1AE6L 3TV3L 2R23A 5I9QC 2DJ4A 4NQUA 4AG4H 3K74B 1UXSB 2K7QA 3RWIA 1Q0XL 1U3HA 3QO0A 2ZUWA 4B7IA 4M5YH 1A3LH 3QDJB 4JO4H 4W6YB 4ZQKB 1OPGL 3D69A 1QLFA 3MO1A 2JJUA 1ZEAH 3DRTB 4S0TD 3IRZA 2UZXB 4OUUA 4NRZA 1JI2A 3KPRE 3JTSB 1YEJH 1QHOA 3PGDB 1WBYB 3MCLL 3KVQA 5J11C 5DZLA 4I3RH 1FNGB 4CMHC 5HVHC 3V0WL 1DVFC 4QCIB 4BFGA 1LD9B 1FFNB 3V0VB 3O11B 1P84J 1FYTA 1BVLA 1ZOXA 1ITCA 2ZPKL 3W2DH 4F7PB 4YNYB 3J8F7 5GPRA 5E99L 1GGCH 3BWAB 4D0BA 1IL1A 1ITBB 1DQJA 4NO5B 1I7UA 1QSFE 2WV3A 3PV6B 3ZTJH 5I1HL 2R9HC 4KTEL 2EIEA 4XNMA 4LKCB 3FTGB 3SJVA 2Z93A 2IH3A 5DK0A 4XMPH 1OAQL 1EJ6A 3ZE1F 4TSBL 2GIYA 4BQ6A 3FRPG 3DROA 2H6PB 1DBML 5FECA 3PIQB 1BLNA 3ARFB 4JJ5A 2NY6B 3MLVH 1S7WA 1XAUA 4KU1A 1LVEA 4DCQA 1ACYL 1MCPL 4MSWB 1A6TA 2CDEB 1KPRA 1XGQA 1RK1B 1N6QL 4ZO6A 5GS0H 2FIKB 2XFXB 2H45A 5HVGB 5TE4H 1CGWA 5SWQA 4M7JH 4OBSA 2O93L 4XWOC 3AGVA 1KN2L 3OSKA 1X5KA 4BM7A 4BYHA 1V7NH 1MFCH 2ZUYA 4NKDA 3L3GB 3QIBB 3SGEH 3DI2B 4WFED 1HKLL 2J5LB 1F4YH 4LHUD 4PLJD 1XGYL 5K9QG 2VH5H 3BSZL 3P30L 5I8OH 4OLWL 4GBXC 3RL2B 1J8HE 4ODUA 5EDXA 1XIWC 1UXWB 4RAUA 1ZMYA 3L3KA 4BELD 3WNOA 5CBEA 2FJFB 1F11B 1S7RA 1N0XH 4PJEB 2H3NB 4N0UA 5JLZA 1TJIL 1B4JL 4NP4L 4GAJL 4X5XA 1G7IB 2EDDA 4XWGH 1I9EA 3FHQA 1DBAL 1BZ9A 5CSZA 3QWRD 3CX5K 3ARDD 2AJSL 3WDHA 1NFDF 4JY5L 3FRUB 3QAZB 1CGUA 5D2LE 4WU5A 3N1MC 4WGVB 4GXVH 5JHDE 1EPFA 5HHMD 2JCCA 1A9EA 2JJSA 1I85C 1F3RB 3MOAL 4PJXF 4TQEL 4JHAL 4LF3B 5KW9H 3C09B 1CF8L 4EVNA 3DROB 3L3HA 2R2HA 3LEYL 4JFHE 1HXYB 4IOFC 4RMUA 1CYGA 1A6WL 4TNVF 2NY1B 5LGHH 2VLRA 4X4XB 3AU1B 1BGXL 3KXFA 4CJ0A 1OCWL 3V6FA 2HLAB 1CLZH 3O2WH 1BWMA 1D5ZA 1YEKL 4QRUA 4RFEA 1QFWI 1Q8MA 5GZOD 3VH8B 3MOBL 3C08L 3MUY1 4XBGB 1DUZA 5SWQB 3UPAA 4PPTA 3JV4A 5ICZA 4HK3J 2X9XA 5AZEH 1KB5H 1CICA 1NBVL 1ZXQA 3MV8B 4WI3A 5K9OA 5FYLH 2NY0D 1M6OA 4KV5E 2DDQH 5GHWH 3TJEH 3CNKA 5DC4B 5H94A 1XZ0B 3UTTE 4LK4A 1WAAF 4C4KO 4FQ1L 5INDA 2F5BL 4ZS6C 5IM7A 3KYKH 5E94A 2VR5A 3INUH 3ELAT 1IGYB 3FB5B 5CEZD 1H5BA 3SDDD 5ANMB 1XF3A 1EXUB 1WWCA 3EOTL 4NHUA 5GZNC 3G5YA 3RGVA 3QHTC 4HCRH 3ARBA 3TVMA 3FOMB 4X8JA 1UZ8A 3B83A 2A1WH 5D7JC 2UY7A 2XA3A 1JI1A 4NQSB 4WFHE 1NC4D 3ULUC 3MC0A 3Q6GL 3W0WA 3EOAB 4QRTA 4N0UB 3EO9L 4DGYL 3QT2A 5FO8A 2Q7NA 4IJ3B 4IHOA 4H88H 3EIFA 3H3PL 4KDWA 4TVPL 1Q9KB 2IANE 2X70A 2R4RL 4EBQH 4WW2A 2EDKA 3STLA 2PUQT 5GS2H 3U4AA 5EZIH 3WIFA 4QY8B 5C7XL 5I18L 4PRID 1BQLH 5DK2A 3U0PB 1IM3A 3WV0A 3WXVH 1E4WL 5DJ0B 5DVOA 4NFBA 4Z7UF 4G8IA 4YO0A 3B5GA 4AL8H 1TCRB 4WU5B 4NBXB 4CW1B 3S6CA 1CK0H 4TTDC 5I30H 5T3XE 1I7ZB 1P69B 4UQ2A 2BOBB 4Y4KC 5KSVA 5I16B 4G42A 3I85A 4XAKD 1ZTXL 4AJ0A 1R6VA 2ZNWA 5ACLA 5ID0A 2Q6WA 2ZUTA 2R0WH 5J9PB 1NGYA 2FJGA 1I9IL 4LMQI 5E2VL 3RNKB 1JVKA 4U1HA 1OL0A 2YR3A 3ZTJG 1BVKB 4ZNCD 1RUKL 1DEDA 4GJTB 2AV1B 4U6XA 3VFUB 3IF1B 2CGRH 3CX2A 3TO4D 1U58B 2GJZA 5DMGD 3W5MA 2EO1A 2PYEE 5DJCA 1ZGLA 5CJ8A 1YUHB 1UJTA 1D5XA 5F89B 2HJFA 1M6OB 3WJLA 3D0VB 3DX7A 4HUUA 3NH7H 1IKNA 1KFAH 2M26A 3RUGF 5H94B 4Y5XB 3UROR 1UKQA 1OP5K 1JL8A 4YDKL 1CFSA 2QSCH 3CD4A 2FO4A 1MI5E 3HNTL 2VXQH 2P7TA 1KCLA 4D9LH 1VESA 3GMPA 3QWRA 1MRDH 3GKZA 2WUCH 3NZHH 5DT1L 5FYKU 5L2KD 1LE5B 1FV1B 3BP7B 3G5YB 1W72H 5KVDH 1UA6L 3FO2A 2OR9H 3MBEC 1UZ8B 2PR4L 2P5EA 2DKMA 5H37H 4KY1H 4UT7L 2EH8L 4MNHA 1ND0A 5HYQA 1YEHH 3KPLA 2PKDA 4PGZA 1QUNA 5FO8B 1AJ7L 4EZMA 2X5PA 1QNZL 4NWTL 2XQYG 3MRJA 3QPXH 2CO7B 5EOQL 1RIUL 4APQA 1QVOB 4WW2B 3HAEG 2IMMA 3MRPB 1KTDA 3BW9A 4MDJB 3DV4A 5KVFL 3QCTL 4ODBD 5BW7C 1BQSA 2ZKHH 4RGMB 4U2ZA 1WJ3A 3TBYB 3MV01 2F54A 2ZCKH 2PTUA 3CK0H 5BRZE 2CMRH 3KPPB 3E3QE 1EHNA 5JOFA 5DWUL 5MEQB 5D7LE 5BXFB 2W59A 2AV7A 2P5WD 1FIGH 1Q9WA 4XPAL 3H9SE 4NM4L 4JHBA 3L3OA 2WWMC 2ZOKB 4JANB 3SDYL 4PGCB 3PWLB 4NZRL 3WXWH 5HI5C 4LEXH 3MRKB 5HGGS 5C0BB 2COQA 4UINL 3RWGA 4LHUB 1QHPA 4RNRA 2X1WL 2PO6A 3VFGL 1NFIA 2DLEA 1IMHC 1T0MA 2BNQE 3QZWG 2XY1A 3DUUA 3H9HA 3LV3B 3O4LB 4OFVA 1OSPL 4L3AA 3SDDA 2XZCL 4DN4L 4OLUH 4G9FD 4K94L 3CZFA 1NCNA 1YN7B 3WSQL 3ULUH 4PJIA 3V6OC 2AI0H 1N59B 2W0LA 2XZAL 4LLUB 4PG2A 1NC4A 5ESQA 5CZVH 4ELKA 2VUYA 3ZYOA 1R3HB 1J1PH 5IMOB 3PQYA 4KKBC 2VUOA 4KK6C 3TBTB 3WNPA 4JB9H 4NYLB 1J12A 2A0LD 1RIHH 2E7LA 1AGFB 3AS2A 3DPBA 5E95B 4BA8A 5I8CB 4UQ3A 1OARL 5TDOB 1AR1C 4LLDA 4R2GD 4UT9H 3ARDB 3HZKB 3DLQR 1MCOH 3LS4L 4C83B 2OQJA 5JO5B 4M8QA 3OL2A 2I60L 5HHMB 5KS9E 2DIBA 1NLBL 2OXGA 1QKZL 2YRPA 4KMLB 2W65B 3BGFB 1KV3A 1W0VB 2FDBP 2V5SA 5D7IE 3WS3A 3UTQB 2VDQL 1REIA 3GI9H 1XFPA 3O2VL 3TESA 4H20L 4P59H 4GS7B 3PV7A 1TQCB 2ZJSH 2NY3C 4N68A 1YQVH 3LS5L 2RGSA 3T8XB 3UAJC 1IGCH 5LGJA 3P73B 2VITB 1LILA 3QEGH 4Y5VA 1OM3H 2VDKH 1YEIH 4LSRL 4MVBC 3V9FA 1UEYA 1RZ7L 2AEQL 2HWZH 5IG7A 5ICXA 3QWQB 3I84A 4P3CH 1DQTA 3S88L 1FE8L 3D85B 4FQXA 5INCA 5C6PB 4F9LA 3QQ9D 1LO5B 3D39A 2NY0B 3PHOA 4Q2ZB 4PJ5E 4PJAE 4L4TD 1ZANH 1NGQL 1YC8A 2YPLA 2NNAA 1A9BA 4F3FB 1SJEB 2F8OA 3BRGC 1X5IA 5DUML 3G5VA 4MQXD 5JW4M 2YD4A 3QBTB 3QUYC 4Z7WA 5FCSH 3DUUB 3H9HB 4L29B 1W8OA 3KYOA 5CFHA 5HGBA 5F9JB 2AABL 4I13B 5IB4A 3VFTB 2HFGH 2DTSA 2XWJA 3SEPA 5I1IL 3QCUL 4E5XB 1N3NA 3FB8B 1FP5A 1NANI 2HG5B 3DV6A 25C8H 2YK1H 3T1FA 2Q8BL 5EWIH 4JFQA 4ZDHB 3OKLA 4ORZC 2G2RA 3V5HA 3DIFB 3D18A 4EI5B 5KTEL 4Q58C 3LPFA 3BIKA 4NDMA 2GTWB 1UC6A 4PRIB 1NMAH 1R0AL 4X6DF 4PBWD 2HTLD 2WBWB 3AAZA 3GSVB 4MDIB 3BYTA 3EHBD 5IIEA 3C5SA 4FN0A 4J23A 3PWNB 4IRZH 4NRXA 3QCVH 3O3EA 4J2XA 4ZXBC 2APXA 1V7MH 3EJYD 3HNSH 5D72H 2UWEE 4NNYB 2DIAA 1YEEL 4QF1A 4NFCA 4BH7A 1FDLL 1VEOA 3BQUD 4PJGA 3KPRD 1SMOA 2WUBL 4YAQB 3BRFA 3S34L 4TNVK 3IDIB 4KZEL 3VI3F 2OYPA 2OP4L 4M7LL 4F58H 5I76A 5A16B 1ZHNA 5H37G 2QSVA 1K2DA 3V95A 2PXYA 1BVZA 1M05A 1MCWM 1F3JB 3L3IA 1TENA 4Z8FH 3GMNB 2GK2A 4HJJL 2NQCA 4U6TA 3WHE1 2CK2A 3TO4B 5KSBB 2VAAA 2XZQH 4MX7B 1TVHA 3RDTC 1T6VN 4FQLH 1DSFH 1DLHB 3RWJA 1QSFD 4LOUD 2X09A 3O6LH 2OI9B 2UZIH 2OJZH 1CL7I 1C5BL 1JWMB 4ODSH 4UILH 1I7TA 3G5VB 5FM8A 1ZT1A 5IOPB 1OD7A 2WANA 4JGUA 4IBLT 5DYOB 2FX8L 3VXMA 4Y4HA 5E8PA 1GGBH 2VLJD 1JBJA 3QO1A 4HWBA 2D4FA 5L2KB 4HS6A 2I9TA 4N9OB 5DMIH 4FQCL 2ZUXA 1EVUA 1YNLL 1PZUB 3BEVA 3KPOB 1W0YT 5HY9B 4I0PD 2WBJD 1SJXA 2D9QB 2DQCL 3UBXA 4JVUA 5A1AA 1ZWIB 4CDHA 4Y1AB 2FH8A 2YPVH 3U6RA 1MREH 3OKLB 1TMCB 5A3ID 3N50A 3V5HB 1I4FB 1XCQA 3MXVH 4QGTA 3DMMC 1MWAB 5IBUB 4MS8D 5ALBL 3ILQD 4P4KA 5FDWA 5FK9B 4JDVB 4LNRB 1S78D 4DOHB 4Y88A 4HAFA 1G7QB 3BI9X 5DHYA 3SDCC 3T2NL 1FNFA 4YHZH 4FTVE 5T1DH 3ALWA 4HK3N 2DI9A 3GHEH 4LVHC 4DZ8B 5JMOC 4D3CH 4TUKL 1P1ZB 4QF1B 2P5WB 3O3UN 3F12B 4LKXB 3OKMA 4WV1B 3SDXB 1YMMD 3OAZH 5TFSL 3UPRA 1EAJA 5D2NA 1EZVY 3X3GL 2J2ZA 5IEHB 1IC7H 1PKOA 3UJJL 3V2AR 4LVNB 5I8KL 2QTEA 1K2DB 5DQ9B 3T0EC 1CR9H 1U6AH 2WIMA 4OFKA 4WHCA 1B0WA 1HHKB 1PY4A 4X7EC 3HR6A 3OAUH 2GYSA 1JRHL 3TWCH 4G9FB 5AWNH 1GHFH 4OQTH 4XXDB 3KHQA 5E8DL 1A7OL 3TNNB 2JJVA 1A1NA 1CDCA 4GRLD 2E6PA 1INEL 4WWKC 4QXGL 2PCPA 3R1GH 2G60H 2HLFD 2LTQB 1A22B 3UX9B 2DLFH 3TBSB 2KPNA 4YHYB 5I1KH 5I1LB 2AJYH 4OQ1A 3NBNA 4C56A 2J88L 3OKNB 4K71C 1A7QH 4NO2A 4ELMB 1I7RB 1B4RA 4JFHD 1Q72H 1IGJB 2A6JA 3BKJL 4JFZH 4ZSOA 5CCKH 2R2BB 1LDSA 4R7DA 3RVXD 3N9GL 2I9TB 3LD8B 2BVOA 2VZOA 2FWOB 4GKNA 4DUVA 1OP3K 5IF0A 3BEVB 5IWLA 3QIWA 4WY7L 1J5OL 1FPTL 2EZ0C 2FEEL 3UBXB 3MGTB 4KJWC 3U2SA 3LQZB 1N2RA 4FG6C 2VDMH 1S7SA 3WD5L 4EI6A 1QEWB 1P7KA 2JLLA 3KPRA 4JAMB 2YHGA 4AEFA 4PLKD 5GRXG 4K8RD 4LPWA 3CFKB 5EH1A 1T21A 4JZJA 4YHOH 5SWZD 2C1OB 5DHYB 1JZ4A 3HI1A 3T2PA 4OCXH 1FGVL 2QL1A 4NKIH 1OAXH 5DVKA 4JRXE 5D6CA 5T5FH 3F58L 4GW1B 4LGSB 3L3JB 2Z92A 3FZUD 4WI9A 3GI8H 4D8PB 1PSKH 1OP5H 4L4TB 1MCKA 3EDEA 4FQHA 4RSVA 1BQHB 4WFHD 3QXTA 4Z9KB 5D2NB 2YD8A 2YZ1A 5J12B 1MY7A 2P8PA 1QFHA 4L5FL 5HPMA 3EBAA 2IAND 4LSVL 4KZDH 4GG8A 3Q5TA 2C3HA 4X9BA 3ULVF 1BX2B 1ETZA 3WFEH 4DUXA 5EA0L 2QHLA 3D3VD 4PY7A 4L1DA 1PFCA 4LBEB 4E42B 3ARFC 2NY6C 2V17H 5M7QA 1JPSH 2D7TH 2Q76B 1MF2L 5EN2A 4QTHB 1A2YB 1CFBA 1EUUA 2RBLA 4ZTOH 4NKOB 4ZD3H 1AKJA 3I02B 4G3YH 1CG9B 5EPMB 2EH7H 2ITDB 3OR6B 2IPTH 4GMSL 5D71H 4R7DB 1X6LA 4JGMA 1M7IA 1MWAL 1JHTA 4Z7QF 2XXMB 3EGSB 3MLSH 3VWKC 1BD2B 1UZ6F 4D9QD 2NY7H 4NT6A 2FB4L 3P9LA 1J8HA 1N2RB 4H1LB 4G8EB 5E9DE 2J5LC 2F58H 1ZS8A 3BQUB 3VFSB 1WWWX 3HA0A 3OKOB 1V5JA 3C5JA 4JFDD 4F37F 3KPRB 4QHKI 4PJDF 3F7YB 4LLAA 3PJSB 1CE6A 4X9IA 1UT9A 5B38B 3CUPB 1QRNE 2NX5B 2BVPA 1INDL 3LIZH 3O41B 5E8OA 4FXKA 2BY0A 3CCHA 3Q2CA 4XXCC 1B6UA 5T33L 4GRWB 5IJKA 4NJAH 2G9HA 2IADB 3T0VA 3LKOA 5J4MA 1YN6B 5KG9A 4OI8A 1KELH 5EBWB 1YNKL 2Z92B 1K4DA 5D2LA 1QSFB 1JGEA 4YH6A 5JHDA 2OCFD 3RY6A 1OTUD 2LU3A 4R26H 1QFPA 2RQ8A 2XA8L 3RKDC 4CN4A 3U4EB 3QAZC 4JHWH 5I75B 4M43H 2VQ1A 5IQ7H 5CUSH 2VLJB 1S7QA 1JHKL 3UP1A 3MYZA 1ETZB 1HDMB 1TITA 2WK2A 3C09C 2IC2A 5DD3L 4ZOAA 2ED9A 4X6CE 4HWBL 5BVPH 1ZT4A 4I0PB 2WBJB 4Y16A 4CMMB 1A6ZA 2AS5M 3BN3B 2QADB 3BOVA 4U2YA 3MLRH 5BRZD 1FRGL 1F97A 3OPZH 5J56B 3S36X 3MLWH 1OP9A 1K6QL 3W39A 2VKXA 2V7HA 4F8TA 4GKOA 2X42A 5IBTL 1BQUA 3E6HA 3EFFA 2QQLL 3F7VA 3CLFH 2CUIA 3GSXA 3HC0A 1QBLH 3UTTA 2FR4A 3RWEB 2X6MA 1M7IB 3CFCH 4FZEH 3V8OA 3AUVA 2FGZA 4OCMC 4Q9BA 1DEEA 5B39B 5E2UH 3VFRB 4C54A 2EE2A 1WWAX 3RRQA 5KVGH 2BNQD 1XH3A 2ZUQB 5GRWA 4MA8L 3BPCB 4RQQA 4FHBD 2K7PA 4NZTH 3ALPA 1IAII 1D6VH 4LCYB 4HEPG 1PKQE 2OL3H 3LKPB 3OG4B 3VRJA 3K2UH 1YMMB 2EKSB 3HC3L 3G6DL 4NO3B 2WINA 4HBQA 1CE6B 1HNFA 1JUFA 1LE9B 4WEBL 4P46D 3ARYA 5IFAH 4OD2A 5E8OB 1OLLA 3C8KB 1PYWA 4UNUA 2IANA 4KKLC 4N8VG 5CLTA 1NBQA 2KUTA 3F7PC 1T2QL 4CAGA 4GUPA 4MXVE 5T1KD 1BAFL 3DHJA 2V2TA 1SEQH 1YA5A 4JREB 4BFIA 2R69L 4JFYA 4GRLB 3FB7B 1T04B 4HKZA