3OA3A

Crystal structure of a putative deoxyribose-phosphate aldolase from coccidioides immitis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
253
structure length
253
Chain Sequence
MSSLNNEEWDLLISGKKATLQYPIPLLCYPAPEVVSIAQIIDHTQLSLSATGSQIDVLCAEAKEYGFATVCVRPDYVSRAVQYLQGTQVGVTCVIGFHEGTYSTDQKVSEAKRAMQNGASELDMVMNYPWLSEKRYTDVFQDIRAVRLAAKDAILKVILETSQLTADEIIAGCVLSSLAGADYVKTSTGFNGPGASIENVSLMSAVCDSLQSETRVKASGGIRTIEDCVKMVRAGAERLGASAGVKIVNETRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aldolase
publication title Crystal structure of an unknown aldolase from Coccidioides immitis
rcsb
source organism Coccidioides immitis
molecule tags Lyase
total genus 99
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3oa3A00
1GVOA 3TAKA 3KVJA 4NNAA 2E77A 2CFFA 3KOFA 4PEKA 3LM7A 1ALDA 4MZ8A 4JGDA 1TB3A 4NUWA 5KITA 3R8RA 4DBEA 1D3GA 2VEMA 1K3UA 3LCIA 1WYIA 1S5TA 4LUJA 3STEA 1QPOA 3NQ7A 1VC4A 3QQ1A 4UCGA 3GAYA 2ABBA 4HHPA 3V75A 3C4UA 3GKAA 2C1HA 4Y9AA 1IF2A 1EP1A 1KFEA 5U7SA 3G3DA 1WBJA 4FHAA 1HO4A 1VCVA 1F5ZA 2VENA 2Z6IA 3C2FA 3PSWA 3CIXA 3HJZA 4UFMA 1UJPA 2DU2A 3W7CA 1LORA 3W1UA 4MJZA 2WKJA 5LNRA 3MP5A 3G8RA 4GC4A 4O1AA 4RZ5A 5LGXA 3ABQA 2WO5A 4EVZA 3PUDA 2QUUA 3EWUA 3KVMA 2A85A 4NJGA 1OFOA 3W7KA 4UTIA 4A2SA 1AK5A 1HTIA 5KMYA 1Q6RA 2OT0A 5CPMA 5KZMA 5CPLA 5AHIA 4A29A 3ABOA 5HMSA 2NV2A 3EWZA 3W7IA 5AN7A 4CNOA 5D09A 3ABSA 2VELA 3UPWA 1LTDA 4JTLA 2V2HA 3G1AA 3TQ0A 5KZDA 4DEFA 5CG7A 4S2BA 1JUBA 2ZCGA 5FESA 1G4PA 4KFOA 4JR5A 4RZ6A 4DO5A 4OU1A 2NLIA 4K8HA 3UNDA 1GVRA 1AL8A 3BLIA 1OVDA 4IWWA 2HSAA 3GR7A 3PG8A 3W1PA 1CX9A 2X1UA 4LS0A 3OHIA 3O8AA 1T99A 3LGEA 1VYRA 1TPDA 1QDSA 4KWVA 1H7OA 5D05A 2ZRVA 5EMUA 3EXSA 5DBUA 3W1NA 3NM1A 5AC7A 1L9WA 3W7HA 4O53A 1EEPA 3QYQA 3OBKA 1W5OA 2EAWA 2XN0A 5FI8A 1G67A 4YXGA 4JXCA 1XDLA 3F03K 1IXPA 3R89A 2PCQA 2HS8A 3ELFA 4A3UA 2V2DA 1FCVA 1KW1A 2BTMA 3NQGA 1QOPA 5GVJA 1A5AA 1DV7A 2IQTA 4FEZA 5MHBA 4AHQA 3DI0A 2I14A 3GNNA 1W54A 1I2PA 4CCEA 4HIBA 5D2TA 3BVJA 5HUOA 3STFA 2EF9A 1OJXA 1GJPA 1GT8A 4DQWA 5I3FA 1GOXA 1LBMA 1R30A 4DF0A 4IX2A 2RH9A 4ADTA 3W73A 1AG1O 4BK9A 3G22A 5K7JA 3TX9A 4O8RA 1F76A 1H7RA 2QCFA 4ORMA 3L0KA 1TQJA 7TIMA 3G0SA 3TK7A 4Z0JA 4JDYA 2FLIA 3RNDA 2FB3A 1GVFA 4N9DA 5F2LA 4LS2A 1WQ5A 2ZA2A 1PCKA 4ZQRA 1YLVA 1ZAJA 3WK1A 4JX4A 2OX1A 4EOUA 4JYEA 1IXQA 5AHEA 3W9ZA 5BMXA 3GDMA 5K9DA 4Y90A 4JTGA 1YPIA 3W1AA 5AYYA 1RVGA 4TIMA 1AW5A 1VYSX 3C2EA 5D2XA 1OYBA 3E49A 4LVDA 5D2WA 3KRSA 3QMTA 3MBFA 4LVGA 3UWYA 2R8WA 1FXPA 5CZ0A 4BF9A 2VEIA 2XN1A 2YSWA 3FA5A 4FXSA 4JTIA 3FJ6A 3PAJA 1GG1A 3IVTA 2V5BA 3LHVA 3Q2DA 3EX2A 4NT0A 3A9IA 3WK3A 5AYXA 3WJYA 2ZTJA 2Q3OA 3VE9A 3FFSA 3LI0A 2Y61A 3M5VA 3S0CA 3U8GA 5ABTA 5BNKA 1FQ0A 3WJZA 3NOEA 3DFTA 2WNQA 2C6QA 5KINA 1U83A 2A21A 3L21A 4XBSA 2G95A 3OG3A 1XL9A 3UWVA 2VFIA 1T8XA 1T0OA 3JRKA 4MY8A 4AEOA 3S1XA 2YYTA 3B8DA 3EX1A 5G1YA 1SFJA 3P74A 4TMBA 3TNOA 1VS1A 3C0JA 2TSYA 3KFTA 4JTJA 1S3HA 3W23A 4E2BA 1TTIA 4GE8A 1KFBA 4BWLA 2DZPA 4O1BA 4UTTC 3LLFA 1TIMA 3NQAA 4LC8A 2PRHA 2GJLA 2E6AA 3B0UX 3C2VA 1JQXA 1O94A 3NQVA 3TIMA 1EPXA 4MLJA 5CZSA 3LCWA 3A23A 5EYWA 1MSSA 4R33A 4JYFA 5KTLA 4IMDA 4MY1A 2CLOA 3HPXA 3O6CA 1O5KA 3CT7A 5KZEA 1XM3A 4FX6M 1VLIA 4N2YA 3HGSA 2C3ZA 3RMJA 3TJLA 2JBMA 2A6LA 3DGRA 3W70A 2E1DA 2J27A 3W88A 3NL6A 3EKLA 3MP4A 1W3NA 4LWWA 3W7OA 1XI3A 2NXHA 5D37A 2WOQA 4MZ1A 2VFEA 1FDZA 4JNMA 5DY3A 6TIMA 3M16A 3O6YX 3SJ3A 1YDNA 2H8XA 3H55A 1I2OA 4GUJA 4GUIA 1LOSA 4O15A 2ZYFA 4HKPA 4HN4A 4X3ZA 3E96A 4JX5A 1EIXA 3G1XA 2YFNA 4OV4A 4M7TA 4DPPA 3A21A 1LCOA 3L5MA 2GQ8A 3IVUA 1S5VA 3PF3A 4POCA 5HUPA 1UCWA 4RLIA 3T7VA 5F4WA 3TE9A 1ZNNA 1TO3A 4L4MA 5HULA 3I68A 3M43A 2EHHA 3W1LA 4UTTA 4PL1A 3TXVA 1KFKA 1R2TA 4UFJA 3BG5A 1QNVA 3HBLA 3UPBA 1XUZA 4GUGA 5LNVA 3O16A 3Q37A 3UQNA 1F05A 5K4ZA 3O05A 2H90A 2ABAA 3TA6A 1VJIA 4OV9A 2B7QA 3NM3A 2VKZG 1SZEA 3KVKA 3TCEA 1TRIA 3OA3A 3CU2A 4KFPA 3IGSA 3MHUA 5G2IA 5AC8A 4NJJA 5HJLA 5IBXA 1ZCOA 4HNTA 4O52A 5I3IA 1OG0A 2DZSA 3RF9A 1OYCA 1PHQA 3SECA 4MVAA 1H63A 2O7SA 1UBSA 1WAUA 3EX4A 3FJLA 4O16A 3ABRA 1PVNA 2YCEA 3GKFA 3PR2A 4HNNA 1ONRA 4O4VA 4JICA 1QWGA 1WXJA 3T4CA 1FCUA 3NO5A 4CCDA 3N9RA 2ISVA 1RQBA 3TUUA 2J9YA 2QR6A 1MEWA 1AW1A 1CW2A 3W7RA 1SW3A 1VCGA 1MXSA 3LV5A 1XBVA 1YDOA 3VE7A 4PCFA 1KBJA 2ZDRA 2R14A 4MFEA 1SZFA 5F1UA 4ORIA 3N3MA 1A50A 4WOQA 3W1RA 3JS3A 3F4NA 3BO9A 1XUUA 4UTLA 3TR2A 1V7YA 3W7PA 1TV8A 4O54A 4NX5A 2BWGA 3PC0A 5DBTA 1SZGA 1A5BA 2CLIA 4NJIA 1I2QA 3F1QA 4JX6A 1FWRA 1TPH1 3HG4A 3GVGA 3SY5A 2P1FA 4ZQPA 3BLFA 1T96A 1YADA 3I65A 1YTDA 1SO5A 2YYUA 2DZUA 1OK6A 5G4WA 4JTSA 2PURA 3NQFA 3EX6A 4Q4KA 1NF0A 4UIOA 3LHWA 4NNCA 4DF1A 5EA9A 4DF2A 1AMKA 4AHOA 5FEPA 1FX6A 2GUUA 4OGZA 2C16A 3GXPA 3TDFA 1SSGA 1VPXA 2W0UA 2BX7A 4WX2A 1H7XA 2QF7A 4LC6A 2B7OA 2JGYA 1JQVA 3WJSA 3BG3A 4DELA 4AWTA 1JCMP 1F2JA 4M6PA 1XBYA 1ML1A 4QM1A 3TXZA 2YR1A 3PS7A 3G0UA 1L6SA 4IQLA 3ZWTA 4W9TA 4NJKA 4BR1A 3FS2A 3W1XA 3GDLA 4JN6A 3TC7A 3LCHA 3O1NA 3CEPA 4HNUA 3CPRA 3W7DA 1QMLA 1YYAA 3LTYA 1SQ7A 3DKJA 1PL9A 3KRZA 3S5YA 1ZAHA 4YLWA 1OABA 4XKYA 5D32A 3G24A 2V5LA 1KLYA 1P0NA 4AMAA 1JR1A 4QIUA 1W37A 3TMLA 2DZVA 4KKXA 3T55A 5BOOA 4R53A 4O13A 2E5BA 3QMSA 3KAOA 1NF7A 5FF0A 1ICQA 1LBLA 5A8GA 3A22A 1V5XA 5AHLA 3W2NA 2CLHA 3LDVA 3BLEA 2RHGA 4XKYB 5I3HA 5AC6A 4UMAA 1HFBA 3NYZA 1YDVA 5I3JA 2A1YA 3TW6A 2HMCA 3W7MA 1G7VA 3QH2A 1LRTA 2BSLA 2E5DA 3L0NA 1W31A 3M7WA 4PFMA 2V82A 4U4MA 3G3MA 1VZWA 1SO4A 3PM6A 3W3OA 4ZQMA 2Y62A 1H1YA 1L6YA 3DAQA 4EWND 4B5NA 4DBDA 1KTCA 1KBIA 2FIQA 1ZJIA 2OT1A 4FF7A 5HR6A 4JD4A 4M5PA 4JTFA 1JCXA 1Y0EA 3M0ZA 4A2RA 1ZALA 4Z1CA 1H51A 1IIHA 2G97A 4XQ6A 3P80A 4GUFA 4RKAA 3TAOA 5C5YA 3C52A 1H61A 3DHDA 5C6MA 3S42A 3S5ZA 3LRKA 4DO4A 2H8ZA 1HL2A 1YTEA 5LHEA 4X2RA 1TTJA 3B06A 3W07A 3GXNA 2VFGA 1IIGA 3ZS4A 1RPXA 3QPYA 3W7GA 1JUEA 1KM5A 4HPJA 1H7NA 3NZ1A 1I8JA 5AB3A 2FPYA 3R2GA 1F73A 4AVFA 1AL7A 5K9CA 1A5CA 5DY2A 1VLWA 1O95A 2WSRA 2QCGA 5DELA 5CZJA 3FIGA 3L0GA 1DVJA 5T26A 5FF4A 1FCBA 2ZRWA 4EF9A 5LKYA 3INPA 4N4QA 3O6DA 3NPXA 1EUAA 4GRSA 3C8FA 4MZYA 1NSJA 2X1SA 1OFPA 2WPBA 1W5NA 1ADOA 1F6PA 3A5VA 3PBVA 4LRTA 3WK2A 2X1RA 5CSRA 3L66A 1SSDA 1JRBA 1TPEA 1X1OA 3NQEA 2YXGA 4OWGA 4H6KA 1X8FA 4K7VA 2Q8LA 2R91A 5G2WA 3V1PA 1OYAA 3VKJA 3OVQA 2JK2A 1OF6A 2QCNA 1VGAA 2EKCA 3P8JA 3MW7A 4JY9A 3SR7A 3MO7A 2YX0A 1R47A 4UR8A 1GWJA 2NUXA 2OCZA 3TMQA 2QUVA 2WSYA 3M41A 4MKNA 5C55A 4LT9A 1XCFA 2CLKA 1K7EA 3NQMA 5EKYA 4O12A 4N9BA 1X6UA 4EIVA 2E68A 4UTWC 3BARA 2A2IA 1W3IA 3HGRA 3QZEA 3LCLA 4LUIA 4ZL1A 5AFDA 2JKPA 3GB6A 1W5MA 4MY9A 3FYOA 2FJKA 3EXRA 4JYDA 1J4EA 3W2KA 3MI2A 8TIMA 1VHCA 2E09A 1IXOA 1UUMA 2RKXA 1Q6QA 2B7NA 3UZJA 3O63A 3JR2A 5HWJA 1F7BA 4IGHA 5D33A 4NVTA 2X1TA 1DBTA 1SPQA 1VR6A 3QPZA 1Z48A 4UTMA 1I2RA 3NG3A 1QFEA 4YMZA 3L5AA 1GEQA 3VCRA 2B7PA 2GJNA 3B04A 3EWBX 3CWNA 1O5XA 1BEUA 2FPVA 1GTEA 4UFIA 1TMHA 1XKYA 4GJ1A 4PH6A 2CW6A 2JKAA 3DHFA 4K39A 4P2VA 1CI1A 1W8SA 3H53A 5I3GA 3B03A 3C61A 3NL5A 1TTPA 1HO1A 1B57A 2EGZA 1UUOA 4RR4A 1K02A 4JDBA 1K8XA 1R2SA 3EKZA 3HOJA 1QPNA 1OFDA 2V0TA 3KVLA 5SWUA 1YPFA 2J9ZA 2WSQA 4QAIA 4IOTA 1G7UA 3HF3A 1A53A 4WD0A 3HGOA 3P8IA 4AAJA 1WA3A 2PRMA 2CZEA 1DL3A 1FCQA 3ZR4A 1O60A 5C2XA 2YW3A 1W56A 3IIVA 3N2XA 2Y7EA 1DHPA 3W7NA 1ZAIA 3QW3A 3DKLA 4ZQCA 3PB0A 3VI2A 1MEHA 1GYLA 2Y85A 3NPWA 3STCA 2ZA3A 1VYPX 3U6WA 4OHQA 3W7JA 2GQ9A 3HMJG 2YW4A 4M6QA 4P61A 3NXFA 3GZ3A 3P5YA 4N6FA 4NNBA 2OJPA 1THFD 1GPWA 3NQ6A 4C1LA 4ONVA 1LM1A 2NX3A 2YDAA 1X1ZA 4D2JA 2G96A 3Q58A 1Q6LA 2CZFA 2H3DA 5LNUA 4UXDA 3RU6A 2Q8ZA 2DJLA 3PWAA 3SFKA 5H91A 2QKFA 4UUIA 3B0VC 4RXGA 2JKEA 2C13A 2X16A 5DCDA 3MUXA 3QC3A 3C2OA 1J2WA 1NAL1 1TTQA 4U28A 4IPIA 4CQAA 1JVNA 2QAFA 3G18A 3P7YA 1JUKA 2DZWA 1BWLA 4O14A 3NL2A 2ZRZA 3TQVA 4O28A 4Z08A 4YWIA 3NQ2A 3KXQA 3W85A 3CB8A 3W2JA 3G1FA 1TPFA 4PODA 2QEZA 4CQ8A 1Z41A 3UY8A 2CZDA 4H4IA 4OBTA 3IGUA 1MEIA 1RZMA 3LTSA 1JRCA 3A5FA 1LLZA 2BXVA 4Z1DA 1Z42A 3BK0A 1WBHA 4O10A 3NQDA 2GVJA 4WXYA 5HNRA 2BZNA 4AWSA 1JJKA 3NPVA 4XUGA 3DI1A 6ALDA 2ZTKA 3DU0A 3HG2A 4O19A 3G1DA 4UNLA 3EB2A 3EEGA 1B4KA 3LXCA 3I7SA 4QSHA 4PA8A 1F74A 1OX6A 1WV2A 3RLVA 1QCWA 3THQA 3TFCA 1TYGA 3NNTA 2PRLA 3LHTA 2Q3RA 4MUZA 3M5ZA 4K6AA 1B4EA 4Y8FA 3YPIA 4HSOA 3W7LA 4WOZA 1KTBA 4JTTA 3IIPA 2NWSA 4FX7A 4JIQA 4N9CA 2WV8A 4CCCA 1D3HA 3CIWA 4KFNA 2VXNA 4FNPA 5E0KA 5HWNA 2ZZ1A 1PCWA 5D02A 1DORA 3QFEA 2Z1BA 3QRHA 4CNPA 3I7RA 4JEQA 3N9SA 5CKSA 3M44A 1H62A 3UWWA 3LCXA 3ATYA 2Z6JA 3TV8A 2O7QA 5AHFA 1AW2A 2ZZ5A 1EB3A 5D04C 3O07A 2NUWA 3LHZA 3P81A 3WJWA 2C0AA 4FB7A 3D0CA 4S2CA 1ICSA 2QDHA 2E6YA 5FF2A 3OIXA 1C29A 3AJXA 2NUYA 3IRDA 4QISA 3MP3A 4NU7A 2ZZ7A 4JTEA 5DN1A 1SUXA 2QJGA 2TPSA 4TR9A 3LBCA 2Y70A 3G1HA 1H60A 1JCYA 5C54A 4JTHA 3LCFA 3QJAA 2GOUA 1QR7A 5HINA 3W1TA 3E02A 3W2LA 2NWRA 1XXXA 3NGJA 2JGQA 1BKSA 1LRQA 1P5BA 2F7FA 1XFBA 1DOSA 1FDYA 3W71A 4FNQA 5DXXA 3UYCA 2QJHA 1KM0A 4LOCA 3SI9A 4ICNA 4LTSA 1DKWA 5F4SA 2FB2A 1QOQA 4RK8A 3M9YA 3L5LA 5LGZA 3O06A 1OFBA 2PE4A 5AYZA 2NV1A 2J88A 3MHFA 2QCEA 3LCGA 2ATSA 4QNWA 4X22A 1TQXA 1C8VA 4N4PA 3G8EA 2AGKA 5CPOA 1HG3A 3GDKA 3LI1A 1DJQA 2GPTA 3C2RA 5HQEA 1X7FA 4LY8A 4TX9A 3NZRA 3TSDA 5EBUA 3UZ5A 3QEZA 2A7NA 1VCFA 3TKFA 3HO8A 4GXMA 2ZFAA 1B9BA 4BI5A 1H7PA 4PL2A 4AF0A 4DXVA 4XTIA 1R2RA 2A4AA 5G5IA 2VEKA 5F2MA 1KM4A 4LVAA 1L2UA 2CLFA 5CPNA 5D2YA 2F84A 4UFLA 1TSIA 2NX9A 3L2IA 2YPIA 2X30A 4G1KA 5K4XA 1N7KA 3PUOA 1K7XA 2VFFA 1S5WA 5L9FA 1KM2A 3HPSA 1M5WA 1P0KA 1SO6A 1M6JA 4AF0B 3QSRA 2HTMA 1EWEA 3B05A 3LOTA 1RQEA 1KV5A 2H6RA 3BW3A 3E12A 1EP3A 3O15A 3OEXA 2UV8G 3CC1A 2P10A 2Z0IA 3P82A 4S1FA 4N02A 1FY6A 4MYAA 5LZLA 4WJEA 3PG9A 4MPQA 1RQHA 3N34A 4LS1A 4K8EA 1LOLA 2R94A 3MMTA 4NQ1A 3DFSA 4ZQOA 4O50A 1ZENA 3WFAA 4XBKA 2QAPA 2VOMA 3N19B 3M47A 2WNNA 4I9AA 3THAA 4JTUA 4BI7A 2ISWA 3G1VA 1FWWA 4BI6A 5FEXA 3S8HA 4O4WA 4IX0A 3BPWA 3FYPA 4IMGA 1WOAA 3DH7A 3DBPA 3NPUA 3TU9A 5FF3A 3M6YA 1OFRA 1P4CA 2FQIA 5HR7A 3LRLA 3P5ZA 3BW4A 3TJXA 4QITA 1PE1A 3NQ8A 4I7WA 1OFQA 2B0MA 1GG0A 3DZ1A 3LBMA 4UFHA 5TBOA 1TPWA 4NZFA 1KFCA 1EUNA 3CEUA 3IGXA 2GQAA 3QW4B 2B4GA 1TPUA 2RDTA 1KM1A 3IVSA 3R13A 3PY2A 3GK0A 4H3DA 4TO8A 1PV8A 3F4WA 3SZ8A 3LLDA 3CWOX 1KLZA 1W5PA 1KA9F 2W79A 4N9EA 2Y63A 1YXDA 3DFNA 4ADUA 3W1MA 4Q33A 5DLCA 2NZLA 1P1XA 1K7FA 3MBDA 5F2IA 3RLUA 2CZ5A 1OX5A 3GXTA 3CLMA 1LLWA 4LRSA 5LNSA 3LXAA 1H5YA 3W2MA 2TRSA 3UWUA 1E51A 1O4UA 3W2UA 4LVFA 4RV8A 5G2HA 4ALDA 3EWWA 1GVSA 2ZBTA 4WZHA 1D9EA 1LROA 3UXDA 1EWDA 3MI6A 2I1OA 2TMDA 3N73A 4XWUA 3MHGA 1K03A 1PHWA 2Y6ZA 3W7EA 1NEYA 2OZ0A 1SU5A 2I9EA 2NXIA 4UFKA 3GNDA 4NJHA 1A5SA 1Q3NA 3HPZA 5A5WA 4O0ZA 3QQ0A 2DORA 4DO6A 3PBUA 3R5EA 3EWXA 3HG5A 2TYSA 1XBXA 2C18A 1UB3A 2GVGA 1NFBA 1EX5A 2ISSA 1SZNA 1Q45A 3L67A 2DZXA 3P67A 3T44A 5H2ZA 4N6EA 1K8ZA 2A5HA 1YXYA 3IV3A 1H50A 4FX8A 4LW7A 1SR9A 4O1DA 3UXAA 1G4EA 2V2CA 2FDSA 3G1YA 2V30A 4GBUA 4LV4A 2QCHA 2ZZ3A 3S1VA 5U4NA 1PIIA 1J5TA 3PULA 1XC4A 1XBZA 3SGUA 1LOQA 4YL2A 2E5CA 3SSJA 5DCBA 1I4NA 4LVBA 2OMAA 4AB4A 1I45A 3SIZA 4BFAA 2DZTA 3MYPA 2FPTA 2H3BA 4HSNA 3BW2A 3QMRA 4ZQNA 2QCCA 1W1ZA 2V9DA 1MZHA 2W6RA 1I2NA 4O1CA 4WY0A 2QDGA 3GYEA 2XFWA 1TPB1 2YFOA 1FUYA 2ZRXA 4MIMA 3LXBA 1SFLA 4IXXA 5J5RA 5KSWA 5EL1A 3RK8A 4RXFA 1IXNA 1FWSA 4M19A 2A6NA 1RR2A 1FBAA 1VH7A 5D30A 1JCLA 5F4XA 3CM4A 4R7JA 3MYOA 3R12A 4ZMGA 1LBFA 1JCJA 4YCOA 2DJXA 3E0IA 2GVLA 4WY0B 3GIYA 3CQ0A 5AHMA 2NX1A 3N14A 4XZ9A 2EPHA 4K36A 3NAVA 3BV4A 4MJMA 5DCEA 1HUVA 1WDWA 2VC6A 3GAKA 4BWLC 3C6CA 1G4SA 4JTKA 4CNNA 1VQTA 3GLCA 4I7UA 3ZFHA 5FEWA 3B0PA 3KHJA 4UNKA 2FFCA 5EPDA 4FXRA 4WQ6A 4ZVJA 4IPJA 4UR7A 2KZHA 1GYNA 1G69A 5BRBA 4NXSA 1QPQA 1N55A 1BWKA 4FNTA 4I7VA 4JY8A 1OHLA 3HIJA 4TMCA 3PB2A 4MYXA 3P60A 4JIPA 3CHVA 2QJIA 1L6WA 4Y96A 2P0OA 5AHNA 4ML9A 4OT7A 1JULA 4CLMA 4GWEA 1GQNA 1FDJA 1Q6OA 1JCNA 5FEZA 3W75A 1OK4A 5CZTA 4R34A 4HT3A 1FWTA 3MWAA 2A0NA 3DXIA 5J5DA 5E1QA 3HQ1A 3HGJA 3GDTA 3SW6A 1OF8A 1M7PA 4UTWA 4K37A 4UMBA 3PBYA 2C15A 5LHFA 3EX3A 5LSMA 4ADSA 1KFLA 3AO0A 2A7PA 4O0KA 1LZOA 1NVMA 2X2GA 1FWNA 2C19A 4JS3A 5K3VA 5TQLA 4Z1BA 3W86A 3HB9A 4MOZA 4LU0A 4UTJA 5CSSA 1W3TA 3TH6A 5E93A 3IIZA 3DFQA 2Z2UA 3IEBA 3GR8A 2Y7GA 3G1SA 4WXZA 3S5OA 3G0XA 4MLRA 3IIOA 4AHPA 3TW7A 3M1ZA 1PS9A 1XDMA 2Y7FA 1G6CA 3KX6A 1QPRA 3NA8A 3VFLA 3DFPA 1TPC1 2E6DA 1ICPA 4UTHA 1K8YA 1YXCA 3DFOA 4WUIA 5EY5A 3UD6A 3FEMA 2WQPA 1MO0A 3Q94A 1RV8A 2RDUA 1N8FA 4AXKA 3TROA 2CLEA 4IJBA 3L68A 5D03A 2RFGA 3TQKA 1KM3A 5DXYA 4K7YA 1QO5A 3IIXA 4A21A 4FNUA 4IMCA 4AH7A 5IBXC 3W74A 2PC4A 1TPVA 1TREA 4IMFA 3H54A 3I7QA 4PTNA 3LX9A 2ZA1A 4UTUA 3PUEA 1GZGA 3BG9A 4O11A 3TSMA 4Z1AA 3K30A 4K38A 2VFDA 3VNDA 2AQWA 1DJNA 3FKKA 4X9SA 1TV5A 3W83A 3QF0A 4IXHA 1EA0A 2ZZ4A 2CWNA 4FNRA 2V81A 4GFSA 3MJYA 2CU0A 1KFJA 3P84A 3TFXA 3BGJA 5D38A 3EXTA 3UWQA 2QUTA 1YTKA 4TU1A 2RDWA 2ZRUA 2ZRYA 1KM6A 2YGYA 2HS6A 1IGSA 4UC5A 3FLUA 2ZQ0A 4QQ3A 4GUHA 5BMWA 1ME8A 4OE7A 1SW0A 4E38A 3A24A 3S5NA 3DENA 3ANYA 2QCMA 3ATZA 3S9YA 5IM51 5I3KA 5HWMA 4E2DA 3BGGA 1FXQA 1ZFJA 3E9AA 3L9CA 3W72A 5F2GA 2XN2A 4Q32A 2D73A 2Y7DA 3PBWA 1ME7A 1OX4A 4NX0A 3U2OA 1EP2A 3W22A 4HNVA 1DQXA 1TCDA 2VEPA 4O18A 1QO2A 4RZ4A 4L4LA 4NXKA 4QNEA 1C9DA 4MFDA 4RX0A 1QAPA 2ALDA 4C1KA 1TRDA 3GX9A 2CLMA 2QCLA 2ZZ6A 3TC6A 3NDOA 1TJPA 1BTMA 2E6FA 3HG3A 3P61A 4FIQA 4EF8A 3NR0A 1OFEA 1GTHA 1OX4B 3GDRA 3LV6A 1GVQA 4KWWA 1W0MA 1B3OA 2BLEA 3OVRA 2QCDA 4YCPA 3W1QA 4O57A 3UWZA 5AOUA 3S1UA 3M5XA 4FNSA 3W76A 2Y88A 3W84A 3CTLA 3EWYA 4UMCA 2NXGA 4PC8A 1DQWA 1OFAA 3L65A 1H1ZA 3USBA 5K2ZA 2LLEA 3I6RA 3P62A 3B4UA 4DPQA 2J6XA 2A7RA 4A22A 1WOBA 2QCDB 1ZY9A 4HPXA 5BW6A 1ME9A 3OVPA 2G5WA 4QJ1A 3LHUA 2C14A 2J24A 4OQVA 4CQ9A 2J9XA 1VHNA 2Y89A 5F1VA 2WNZA 4NZJA 5K9XA 3NVTA 3STGA 1G4TA 3S6DA 2ATMA 4RJEA 3LB0A 3LHYA 4FIRA 4GNJA 2FTPA 3NL3A 1F6KA 3WJXA 3RFAA 4RCXA 1RD5A 3LERA 4IUOA 1UASA 3MI3A 4XTDA 1LP6A 5LNWA 3QM3A 1M7OA 3WK0A 2WJZA 3C3NA 4M7SA 2ZZ2A 3QSTA 3W6YA 1LYXA 1H7WA 3ZWSA 1LRNA 1W5QA 3W87A 3LRMA 4LV9A 3NEVA 4UTKA 2YZRA 4Y6GA 3TSBA 1KV8A 3W7QA 3PVFA 1KTNA 5G4EA 2AAMA 3T40A 4E0CA 1R46A 3SGZA 1SW7A 2V8ZA 1WX0A 5D2VA 3PSVA 3NQCA 5CGQA 3M5YA 4IMEA 3UY7A 5FF7A 3FOKA 1TJRA 1SO3A 4ZZ9A 3LTPA 3N2MA 2DP3A 4FO4A 4WY0F 4M6VA 5L6UA 5G1TA 3KRUA 3T78A 4Z0SA 4O17A 1VRDA 4LNYA 1LDCA 2CLLA 3FKRA 5TIMA 1TV7A 1ZHAA 2VFHA 4J9JA 4AWUA 3S1WA 1U5JA 3C56A 1Z44A
chains in the Genus database with same CATH superfamily
4C6FA 2PI6A 4JTAA 3TYAA 2E77A 4PBEA 4PEKA 3LM7A 1B90A 1O68A 4NILA 3WNMA 3R8RA 4DBEA 3WF1A 5I07A 3LCIA 4W85A 1WYIA 1CXFA 1S5TA 2XFFA 4G1NA 1C3FA 2PGRA 1OY0A 3P93A 1TVLA 2ABBA 1QNSA 3CAQA 4HHPA 4AYGA 1O1HA 4GIEA 4Y9AA 1EP1A 1KFEA 3RM8A 1A5NC 4FHAA 4F2UA 1VCVA 1E3XA 3PSWA 3PPCA 4UFMA 3AWOA 3G8RA 4GC4A 4YPJA 2I16A 2OWCA 3PUDA 4PB4A 1EDGA 2A85A 3W7KA 3OGVA 1IEWA 3LBOA 4LCSA 5AZ1A 1IEIA 2OT0A 3MDWA 4EPEC 5BXPA 3NEHA 5AHIA 2QJJA 1E70M 2QVNA 2FZ9A 5D09A 1RJQA 2VELA 1AA1B 4J1OA 4JTLA 4HPHA 3FW6A 2O0TA 2GWNA 1JUBA 1RPKA 1G4PA 4KFOA 3ZSTA 4WDXA 4JR5A 1C7TA 4DO5A 1QHOA 2QUNA 2D3NA 3BLIA 3TJ4A 3DECA 1EIBA 2HSAA 5BCAA 1XG3A 4JN7A 1AODA 2FYMA 4WDWA 3OW1A 1YMYA 1B9ZA 5D05A 2ZRVA 2IPJA 2CHOA 5AC7A 4O53A 4DXKA 1V6TA 1W5OA 2EAWA 4PMRA 4FALA 2XN0A 3W38A 2XWEA 2G37A 1IXPA 3R89A 3ELFA 3QV8A 3OOQA 1FCVA 1EJWC 1A5AA 3RO6A 4D8ZA 1JXKA 2IQTA 4FEZA 3GXDA 1L8PA 1OJXA 1GJPA 1YNQA 1R30A 1FH9A 1NQKA 2RH9A 4ADTA 1AG1O 2DSUA 1RHCA 4IF2A 1L0PA 1H7RA 2QCFA 3G0SA 1B3WA 4BA0A 2FLIA 2FB3A 1WQ5A 2A3EA 2OX1A 4EOUA 1IXQA 4CEUC 2VWTA 5BMXA 3GDMA 3T4WA 2PTZA 3H6OA 4DI8A 4HTYA 2QGHA 1KNWA 3W1AA 1AW5A 3VOCA 3E49A 1C8XA 1PZ2A 4LVDA 3B0XA 3KRSA 4LVGA 3UWYA 4PUDA 5CZ0A 3PJXA 2QDEA 3ZLGA 4FXSA 4JTIA 4UB9A 4LANA 3PAJA 3LHVA 2BOFX 3WQEA 3Q2DA 3EX2A 3CZ8A 3WJYA 3ZVHB 2VOTA 4PCNA 2YXOA 5ABTA 4ERAA 3NOEA 4LUSB 4WHBA 3WQCA 3ZQ9A 4CN6A 2DT0A 3N29A 5KINA 2A21A 3VKAA 2R1LA 1GHRA 2G95A 4XBSA 3CZKA 5I09A 4GZJA 2VFIA 4DJFC 1C8YA 1V0LA 3MDUA 3JRKA 4AEOA 4F40A 3PHAA 5XINA 3S1XA 2YYTA 1GOQA 3CAWA 4KQNA 3WD0A 4AUBA 4FAMA 3TJIA 3VCCA 1UWQA 1EOMA 4H1ZA 3IRSA 4C7GA 3P2VA 4GE8A 2G41A 1PUDA 2DZPA 2PODA 2QMKA 4UTTC 3LLFA 1TIMA 4NRSA 2PRHA 2GJLA 2PDCA 4HJFA 2PF8A 5AVNA 1TWWA 3A23A 4R33A 1CGXA 4MY1A 5A2AA 4HU4A 5I00A 3PWGA 3AYRA 4LUTA 4N2YA 3SCPA 3PANA 3GNOA 3PZQA 2PD5A 3WH5A 3W70A 1BXBA 2ANUA 3W53A 3C8NA 1XIBA 2WC7A 3W88A 3NL6A 3EKLA 3MP4A 4LWWA 3W25A 3PPGA 4AW7A 4XAGA 2UY3A 2WZEA 2VFEA 4B2DD 2YA2A 4I3GA 3M16A 4F0SA 3EMCA 3H55A 4GUIA 3LZ5A 4S39A 1KR0A 2Z24A 2CC0A 1EIXA 3G1XA 2Z7KA 1A3XA 4DPPA 1FH8A 4GLEA 4H9ZA 1XIEA 1HJQA 1TO3A 4L4MA 3F2CA 4HK6A 3M43A 3R79A 1KFKA 1DHKA 2DFAA 2PDKA 1I1XA 4UFJA 3AYVA 3HBLA 1G94A 3UQNA 5K4ZA 2ABAA 3VD3A 3TA6A 1E1FA 2F6XA 3NM3A 1HN1A 2GFTA 2YB1A 1SZEA 3KVKA 3EA3A 4Q8WA 4DBWA 1BGAA 3MHUA 4ZFMA 2HDJA 3KOZA 1SJAA 5J8LA 4J5NA 4HNTA 1Q8JA 1E9ZB 4JFUA 2E4TA 1GZ1A 3QTPA 5I3IA 1IE7C 3UXLA 2IKGA 4WJ8A 3PBMA 1E4IA 3WENA 1UHVA 1HF6A 3SURA 1UBSA 1WAUA 3EX4A 3N4AA 1J0IA 1VD6A 3ABRA 1PVNA 2YCEA 4G5DA 2PEVA 3NSXA 4O4VA 1KRCC 3KLKA 3FHQA 3UJSA 5I5RA 3N9RA 5CSUA 1AD4A 3TUUA 4QX4A 1V8EA 4JZ5A 1AW1A 1VCGA 3LV5A 2NVDA 3TQPA 1YDOA 3VE7A 2J79A 5ABGA 2PLMA 1LT8A 4MFEA 3RUBL 2V6AA 1XYMA 5F1UA 2XGBA 3N3MA 3D47A 2NQLA 1V6XA 3FXGA 2VGIA 1XUUA 1A5MC 4QG8A 2CLPA 1V7YA 4O54A 4CQCA 4NX5A 4FR6A 4FLQA 3PC0A 1EH9A 3AIVA 1I2QA 4DB7A 3WQ4A 1E5NA 5GNZA 3SY5A 2BVYA 3R10A 2P1FA 4HMDA 3CHDA 3VABA 3WEOA 1XLKA 3CZLA 1B5TA 3GE7A 2YYUA 1M7JA 2DZUA 4B2DA 3NQFA 2HBVA 3OZMA 2OYKA 3EPOA 3KZPA 3VDCA 1GOMA 3VD5A 2GUUA 1NJJA 3CL7A 4DX3A 1SSGA 3MQTA 2YCKX 3K8KA 5C7HA 2JGYA 3WJSA 3WZ0E 4DELA 3SGGA 1JCMP 1XBYA 1GVIA 4QM1A 3TXZA 1ZSXA 3PS7A 2WVTA 4G8TA 4IQLA 4W9TA 4BR1A 1F3WA 4KWUA 3TC7A 1FWHC 4FLRA 3W7DA 1YYAA 2ODOA 4Q4SA 1SQ7A 3S5YA 3WH7A 1BAGA 1ZS2A 2Y8UA 3G24A 5I78A 3K1DA 4GQRA 4GXPA 2YCIX 4GQQA 2INEA 3S9ZA 3TMLA 1GUVA 1UKQA 1QW7A 3CV6A 4H8HA 2ZXDA 2NLYA 3CV7A 5A2CA 2WC3A 3F4CA 4MHBA 4UMAA 1I0BA 5E5CA 1DJWA 4IGSA 1VBHA 3PP7A 5I3JA 1VJZA 3W7MA 1JCTA 1XX1A 3QH2A 2E5DA 3L0NA 3UJRA 1VZWA 1SO4A 3MANA 4HNCA 4L4PA 3ARPA 1KTCA 3W01A 2OT1A 4HGXA 2GLKA 4P8UA 5HR6A 3Q45A 4JD4A 4PUUA 3HZ3A 1JCXA 1ZALA 3MC5A 3G6MA 1IEVA 4CD6A 1G5AA 2G97A 4GUFA 4RKAA 3TAOA 1FHVA 1A5OC 4RZBA 3S42A 2H8ZA 1HL2A 4X2RA 1TTJA 3NO3A 4RDYA 4GZ7A 4EXAA 3SEPA 3HQNA 2XVPA 4Q8OA 4ACZA 2Z7GA 1X96A 1JIBA 1U30A 3W7GA 3WY1A 1I8JA 4DBUA 4LSBA 1AL7A 5JUVA 3TLQA 1A5CA 1JPHA 1MQRA 3S1GA 4HNLA 1VFTA 2FZBA 2WLYA 2Z2BA 3LNMA 3CMGA 3OLEA 1M01A 2QCGA 5DELA 4AIOA 4GJJA 1ITQA 5E6ZA 4HPGA 2XVKA 5T26A 3T09A 3RDKA 1B3VA 2XFRA 1K9DA 4HB7A 3W26A 4AX7A 2CNCA 4IM4A 2BY3A 3HPFA 3KTCA 4N4QA 3O6DA 1EUAA 4GRSA 3TWAA 5C9RA 1TUXA 2MUCA 1KCLA 4NZ3A 3A5VA 3WK2A 4GACA 1TPEA 1X8FA 1VFSA 4PSRA 2DSZA 3FGCB 2JK2A 1OWQA 2PA6A 4AMCA 4IICA 3EA2A 3VDGA 3VD9A 3MO7A 4QHRA 5TD4A 3WQ8A 5D9MA 1CGVA 2NUXA 4MKNA 3A64A 4HU0A 2GGJA 3NQMA 1S2UA 4GVIA 5EKYA 4ERIA 4H01A 1SR0A 4EIVA 2VHLA 2SFPA 4GNVA 3BARA 2D22A 2HK1A 3LCLA 5AFDA 2DZBA 3ITYA 3GB6A 2CPUA 2WVVA 5A6KA 3VCNA 2F6KA 3MI2A 2EPKX 4XZLX 2E09A 1UUMA 2GWGA 2VDHA 2XPKA 4WKFA 3UZJA 3WLJA 4XISA 4NYUA 1GOKA 1J18A 4I8YA 4TV5A 5XIMA 3B4YA 4Q7IA 4D8LA 1W1IE 3VUSA 1VFLA 5HNUA 3WDRA 4A35A 3PPFA 4TVCA 3VCRA 4B91A 1ISXA 2GJNA 2RAGA 3B04A 2PDBA 1V6WA 2R82A 2HQAA 1GEHA 3CWNA 3RX4A 1WZAA 4LEQA 2FPVA 3DIPA 4JKKA 2IQDA 3FA3A 4GJ1A 2CW6A 3CUHA 3RPTA 3EMQA 1CLVA 3EOOA 1FHDA 3DHFA 1UKPA 2J7HA 4L6DA 3B03A 3C61A 3UP8A 3UETA 2VMFA 3FNDA 4KBXA 4K8GA 3NZPA 3M0KA 2EGZA 5LIWX 1AQMA 3R8HA 5I24A 2XDFA 2OYMA 1QPNA 3KVLA 4QBXA 4QAIA 4L61A 3KW3A 4HOXA 3P8IA 4AAJA 1WA3A 2PRMA 3ZR4A 4C6JA 2EPLX 1U5HA 2DVTA 1DHPA 1XSKA 4B9ZA 3W7NA 3ZXWA 2VO5A 3QW3A 3CO4A 1WXYA 1MEHA 1Q2SA 2PDYA 3SCRA 3STCA 3PZIA 3U57A 4XD3A 4KW2A 5I0DA 1D8CA 2Z28A 2BGSA 2HXUA 1OCBA 1TZ9A 3P5YA 4ZXLA 1THFD 4PMVA 3NQ6A 4C1LA 2OZ3A 1NP2A 2NX3A 2YDAA 2DDXA 2ZC1A 4D2JA 2VEGA 5HK4A 1MFUA 1ITUA 4RE2A 1Q6LA 5LNUA 4UXDA 2UY2A 2OSYA 2G4FA 3D5HA 4UUIA 4RXGA 3KL3A 4PGLA 5DCDA 4A8NA 1NAL1 4KCTA 1QK2A 5LIUX 3G18A 3P7YA 1JUKA 3NL2A 1GOIA 1XGZA 5BRPA 3B8VA 4BQ5A 4M81A 3WDQA 1UD5A 3K4AA 3S3GA 4FOUA 4H9XA 3VYLA 2FMNA 4CNSA 2QEZA 1U1UA 4CQ8A 3VIGA 4H4IA 4DUWA 5HPCA 4A3QA 4Z1DA 1HVQA 4WRHA 4GQBA 3DEQA 3F2DA 2V68A 1ADDA 3DU0A 3VVGA 3LXCA 4PA8A 2PDLA 1BRLA 1WAWA 3NO1A 1QCWA 1JDCA 3E5BA 3THQA 1RUSA 1ISZA 4OIFA 3UCCA 3TFCA 2V5KA 1JPKA 1PIGA 5E6YA 2Q3RA 4MUZA 1EYWA 3ID7A 3DBNA 5FD0A 4Y8FA 4PBGA 3MKKA 2WVUA 1GZJA 1MW2A 3URNA 3P3BA 1KTBA 3VIFA 1W9XA 3BAXA 3WBAA 3IUHA 5IOBA 6XIAA 4FX7A 3UZWA 4NAFA 3VGHA 2GGIA 1EL3A 5E0KA 5HWNA 1DP0A 5FJUA 1GQIA 3I7RA 4YIWA 4IPLA 3R4IA 1H62A 1V7AA 1D2KA 1AW2A 1LJYA 5I79A 3S2LA 3LHZA 3N4EA 3P81A 1Q63A 1QASA 1UIOA 1FWFC 4S2CA 1F3XA 3VM5A 4D72A 2R1KA 1C29A 3AJXA 2NUYA 1UKOA 2ZZ7A 5DN1A 4JEJA 2TPSA 1TUFA 2Y70A 3MKVA 3H22A 1H60A 2GOUA 1MXGA 1J96A 3VKBA 3W2LA 5JU6A 2CIPA 1RP8A 2JGQA 4LGXA 1BKSA 1LRQA 2V3GA 1P5BA 3T2QA 1XFBA 2AL2A 5IHRA 3CS2A 5DXXA 2QJHA 6XIMA 3SI9A 1X8CA 4LTSA 1TV2A 1MNSA 4RK8A 3ZR5A 7ODCA 1A49A 2PE4A 5AYZA 2J88A 3CQIA 3MHFA 2FDMA 3VNIA 2OKTA 3MVTA 4X22A 4YN5A 1TVPA 2AGKA 1HG3A 5EBAA 2ZIDA 2VX4A 3NZRA 4XD5A 2ZX6A 4US5D 3TKFA 1CPUA 1MWOA 2GSEA 3HO8A 4UOQA 1JZ7A 3AROA 1B9BA 6ENLA 1ZBWA 4JOMA 4PL2A 2PB1A 1D7FA 4AF0A 1L2QA 3QZAA 4F4RA 1R2RA 1LL7A 2VEKA 4IUGA 1QTWA 3V7PA 1EGMA 4AEFA 4LVAA 7REQA 1L2UA 5EMJA 3RM4A 2YPIA 2W62A 4YHGA 4HYRA 3WMCA 3ZVIA 2VFFA 1AJZA 4IGMA 1P0KA 1SO6A 3QLLA 2YDQA 2XM2A 1WDSA 4XKMA 1EKOA 1RQEA 2DSVA 1JDAA 3CV2A 3OP2A 1CXLA 1MZRA 2W9MA 4S1FA 4QE4A 4MYAA 4WJEA 4QXIA 4MPQA 4K8EA 4D9PA 4ATLA 2TODA 3MMTA 4NQ1A 1LG1A 2BNJA 2VGGA 2CESA 2WW5A 4R7WA 1GQJA 4Q4PA 2PLCA 3R1ZA 3KOYA 1W2PA 3IACA 2ISWA 2ISDA 4JIEA 1LL6A 1Q85A 4MADA 1JEZA 1OADA 3DH7A 3CQKA 3NPUA 5FF3A 3M6YA 5E0FA 5HR7A 1V03A 3P5ZA 1UUQA 5A1AA 3A3HA 3VIIA 1XD1A 1KFCA 2DSKA 3PJTA 3IGXA 2GQAA 3V0UA 3ZLFA 2RDTA 3F4WA 3LLDA 1CDGA 3CWOX 2ACSA 2P50A 1TX0A 1HZYA 4XSLA 3DFNA 3B9OA 4ADUA 4UQCA 3QV6A 1AVAA 4CQDA 4JHOA 2NZLA 1E9IA 3LPPA 3PZ9A 2Z4GA 3Q67A 3MBDA 1WKYA 2CZ5A 4I6VA 5IXEA 2ZWYA 1LLWA 3CLMA 3W2MA 1VFUA 3MSYA 1UP0A 1DJZA 2ZBTA 3Q65A 3WD4A 4JTCA 3VAVA 5A6BA 3UXDA 1JDEA 3MHGA 5M17A 3ZT5A 4OBRA 1K03A 1PHWA 4PE8A 4PULA 4GYPA 2Y6ZA 1NEYA 2OZ0A 3BTNA 2NXIA 4ZOEA 5BXTA 3H2EA 1KWGA 2WQDA 4US5A 3GW3A 3MU7A 4O0ZA 3QQ0A 3R5EA 3EWXA 4KETA 3HG5A 1PPIA 2GVGA 4ZR8A 4UQ9A 1CECA 8A3HA 1EX5A 5H1WA 1SZNA 1Q45A 3GTXA 1T7LA 2DZXA 3BMXA 4GGBA 3OGSA 3G6LA 4N6EA 3FVDA 2D2HA 1CXEA 3BOLA 1H50A 4LW7A 1ZP3A 2ZVRA 1BWVA 1G4EA 1HP5A 4LYPA 2FDSA 3G1YA 2ZZ3A 1B31A 5U4NA 3S1VA 1P6WA 3LMZA 4GI6A 3A47A 3CZJA 3PULA 5CC3A 1LOQA 4IISA 1OD0A 4Y8EA 4YL2A 4QRNA 1RA0A 2OMAA 4AB4A 3TLLA 1X7IA 3FXYA 5HQMA 1W6TA 4HSNA 3QMRA 4PCSA 2V9DA 1MZHA 2WSKA 4AZGA 3WBYA 2QDGA 4HD5A 1E71M 1M3UA 1FUYA 2YFOA 2D23A 1IYXA 1XLHA 1SFSA 1G0CA 1U33A 1FBAA 3HFTA 1VH7A 3VINA 4HCDA 4NZ5A 3R12A 4YCOA 2DJXA 4Y9PA 3CQ0A 3N14A 4AFYA 4K36A 3BV4A 5DCEA 1WDWA 1W1B1 1VQTA 3FX4A 4M0XA 5CZKA 4E4PA 3ES8A 4MUPA 4UNKA 5EPDA 1EJSC 4FXRA 3SRKA 1NTHA 1ODUA 4IG2B 2O9TA 4GX8A 4IPJA 1Z69A 5FIPA 4LY4A 3RCYA 1KR1A 1O6IA 1XCXA 1G69A 1R38A 1XISA 4G56A 4B92A 1YIXA 5BU9A 4F2BA 4MYXA 4JIPA 2QJIA 2O9RA 4B5VA 4CN1A 4IIHA 5D4YA 1E4NA 4ML9A 1JULA 2CITA 1JCNA 4M1RA 4KT2A 8RUCA 1MW3A 4HT3A 1FWTA 2B81A 4C7DA 5D8ZA 4NASA 3SW6A 1U1HA 2R9RA 4H6RA 2IW0A 3V5CA 4ECLA 1CT5A 2PAJA 4ZB2A 2A7PA 5KZ6A 5MKGB 1UR2A 2C19A 5K3VA 2EJ1A 4Z1BA 3W86A 2L5HA 1JYXA 1F07A 1OCQA 4UTJA 1W3TA 1UA3A 5JH1A 2HK0A 2ZUUA 3IEBA 3LS9A 4WXZA 4B5XA 5I02A 3APYA 5I23A 4GQ0A 4AHPA 1J10A 3SUTA 1PS9A 1V6YA 2PP1A 1QPRA 3E6EA 3DFPA 3ARQA 3MZNA 2GDQA 2NV9A 3JW7A 4U2ZA 5EY5A 1UWRA 2F9RA 3UD6A 3Q94A 4OZOA 4QLLA 3NSNA 2RDUA 4AXKA 3TROA 5DFAA 1QWKA 2CLEA 1A80A 1FWIC 5FSDC 1CYGA 1ADSA 1V6VA 4NIRA 2XM1A 4NF7A 4K7YA 2HRWA 4MKSA 3IIXA 1Q7QA 4D1IA 4AH7A 4AZ6A 2PC4A 1TPVA 1UKSA 1TREA 3U9IA 1OGGA 3H54A 1KCZA 3I7QA 4R5EA 5C9UA 3VMOA 1RY0A 3PUEA 4HA4A 3TSMA 3K30A 3TN4A 1ENUA 3K8LA 2AQWA 3QHNA 3GC5A 5A6JA 1VRXA 4AX6A 4HP5A 3W83A 1EA0A 4GI8A 1UPPA 1PJ9A 4FNRA 2RJHA 2CU0A 3BGJA 5D38A 3EXTA 4TU1A 2RDWA 3WDHA 4PZVA 3N25A 2C8NA 3TZNA 3AMDA 3ARSA 3OVGA 2X40A 2ZQ0A 4QQ3A 1W1VA 4XG1A 3K1GA 3PK7A 2CKRA 3ATZA 3SY1A 5I3KA 3AHZA 3B8TA 1NWTA 1RVKA 4OOUA 3OLIA 3R8GA 1OM0A 3VOFA 1XIGA 3SN1A 4Q32A 2XSAA 4BQ3A 2Y24A 3PZMA 1BTCA 1UPMB 3T0AA 3WLLA 1Q2RA 2VEPA 1TCDA 3VGGA 4NXKA 4YYCA 4QNEA 1C9DA 3TWBA 4RX0A 1QAPA 2ALDA 3FY1A 3GX9A 4ZO9A 3TC6A 4EP8C 4DZHA 2E6FA 1M04A 4XIMA 1S1PA 3MUIA 1OFEA 4KWWA 1OT2A 1W3KA 4JPGA 3GC4A 1JPMA 2XUCA 3EMZA 2XH4A 3W76A 2Y88A 3IV8A 3ZJ6A 3RJYA 3A9BA 4TX6A 2FJUB 1DTNA 2OO6A 3I6RA 2R1MA 1TWSA 4A22A 3HFYA 4AY8A 3QZ6A 5BW6A 3I3DA 3LHUA 3PPHA 4DLFA 1JFHA 1Z6KA 3HQOA 4NKCA 1VHNA 5F1VA 4AD3A 3ICJA 3MJMA 1C93A 4NZJA 5K9XA 4D6DA 3ZO9A 1XLEA 3S6DA 2ATMA 3UZYA 3PZOA 1I1WA 2BG5A 4AZCB 1HKIA 3LERA 3QM3A 4PCTA 1NARA 3WK0A 3ABXA 2BV9A 4P7QA 4QDPA 3D3FA 3DESA 4M7SA 2ZZ2A 3QSTA 1W5QA 1WDDA 3H2CA 4LV9A 4UTKA 3M0MA 1KV8A 3KP1A 3W7QA 3PVFA 3GH7A 1W9VA 1E73M 1KTNA 1QJWA 1R6WA 3S2JA 2AAAA 1VBJA 4C6KA 3PN8A 1E6PA 3SGZA 1FVPA 2V8ZA 3WYZA 3AISA 2WBGA 5D2VA 1OC6A 3GWQA 2ZUMA 3UY7A 3WQDA 1W2VA 3VIMA 3R43A 3DFHA 3L12A 2YOCA 1LL4A 3COTA 4ENLA 5HJYA 2Y5SA 4IFKA 1HW6A 5G1TA 5DMNA 4Z0SA 1LDCA 2DVUA 5CH9A 3EOLA 4J9JA 3REQB 1C90A 2BODX 3FN9A 3SY8A 1Z44A 1GVOA 3FSUA 3KVJA 1PTDA 2CFFA 1V79A 3KOFA 4BF5A 1DYSA 4MZ8A 5REQA 1ZP4A 3VM7A 3H2MA 3IK4A 2G3FA 2Q09A 2DIEA 1D3GA 2VEMA 4IH3A 3AWNA 3VIOA 5CJNA 2GSHA 5DF0A 3STEA 2VURA 1RXOB 4Q4QA 4E8DA 3GAYA 1J9YA 1ZQ5A 4WIWA 2VT0A 2GVEA 3C4UA 4DWSA 3TTQA 3H23A 1D8WA 2C1HA 1IF2A 2BHZA 3GUWA 3T0DA 3I10A 2VJXA 5H8MA 1CB2A 3W1UA 1UMYA 4DM1A 3ONBA 4MJZA 2YCJA 5AC5A 2WKJA 5LNRA 1FRBA 3MP5A 3AC0A 4JKMA 4YVXA 2NQ5A 3KVMA 2EO7A 2CBIA 1DWFM 3UR5A 5HMSA 4C1NA 3EWZA 1EOKA 4RE0A 3V5FA 4CNOA 4MKVA 3UPWA 2V2HA 4DJDD 1R3SA 3TQ0A 3PZNA 3CZGA 4DEFA 3WNLA 4S2BA 1SMDA 1G9HA 4K8HA 3UNDA 3MWCA 1GVRA 1AL8A 1UOKA 3S6OA 4LF1A 3BWWA 3GR7A 1VBRA 3PG8A 3W1PA 5JBEA 2X1UA 4LBSA 3U4FA 4R9XA 3VD7A 3R0UA 1I75A 1WPCA 3O8AA 4R88A 3LGEA 1Q8AA 1VYRA 1NWUA 1QDSA 4KWVA 1UR1A 2X8RA 1H7OA 1EJUC 4FI4A 1LF1A 1I9CB 3W1NA 3NM1A 1L9WA 3W7HA 1EEPA 3KLLA 4I9JA 4GBDA 4U3CA 4DHGA 5FI8A 1PKNA 4YXGA 4JXCA 1XDLA 2HZGA 2O9OA 3F03K 2V2DA 2BTMA 5BYWA 5GVJA 1MW1A 3AS3A 4I5RA 3DI0A 3ME3A 4GISA 4HIBA 1VEPA 1UR4A 3BVJA 1DQUA 2OB3A 2EF9A 1V6UA 1GT8A 1I6NA 2ZDSA 3WX7A 3TX9A 4O8RA 3QY6A 2QMJA 7TIMA 4LAMA 1XYLA 4N7QA 3OLGA 1P1MA 3N6QA 4LS2A 1PCKA 3VILA 1YLVA 4S3GA 4UZUA 2BDQA 3ARXA 2OOFA 4JX4A 1R3VA 3NIYA 4PMZA 2WMKA 1MRAA 4JIHA 5AHEA 3SQLA 1JFXA 2E0PA 4PUWA 1POKA 3CQJA 1VPQA 4RNHA 4EKJA 2V67A 2UBPC 2UZ9A 4HSHA 1EYEA 2CYGA 3WSUA 3E0FA 3GHTA 3GG7A 3TTEA 5D2XA 2QULA 1OYBA 8XIMA 4MWAD 1AH3A 3LSBA 5D2WA 3QMTA 2WMJA 1EA9C 1YX1A 3HM7A 1VKFA 1E0TA 2FVKA 3GQYA 2JALA 5G4HC 3MMUA 3UT0A 3IVTA 1MYRA 3I3EA 4TXEA 1B1YA 3BE7A 3WK3A 5AYXA 1S1RA 3WUEA 4U3AA 2Y61A 3M5VA 4CNTA 3U8GA 4U31A 1F8IA 1TMLA 1D7KA 4MB4A 3SCSA 2HISA 2WNQA 2C6QA 1U83A 3L21A 1MQQA 1DXEA 4PUNA 1HT6A 1XL9A 1Q7ZA 3UWVA 1VAHA 2QJNA 3DG3A 4ZCWA 2ICSA 4TQTA 3EX1A 1VFHA 5G1YA 3H26A 2ISFA 2IXUA 4JQAA 3P74A 3TNOA 1XGEA 2TSYA 2YCLA 3IS4A 3TYBA 2Q6ZA 1TTIA 5AKQA 4O1BA 5EMYA 4LCRA 1CXKA 2QVHA 2E6AA 3AIUA 1XR2A 1DWIM 1JQXA 2J6VA 2DIJA 4HHLA 3TIMA 4FS9A 1EPXA 3GTFA 1MSSA 2J75A 3WEMA 4DM2A 4UNIA 1QPKA 1NH6A 5FJTA 1FKXA 3GXFA 4A8IA 4E5TA 2FKPA 1S2CA 3HGSA 2C3ZA 3DX5A 3WNKA 3TJLA 3VUPA 3QGKC 2J7GA 1EF3A 5E9XA 3DGRA 2XH7A 3LZ3A 3C0LA 4FXJA 2G3NA 1AZ1A 1UP3A 2E1DA 3PZTA 3N9KA 1EX1A 1E0XA 1WZMA 2PUZA 3W7OA 4LUTB 5D37A 2WOQA 3OU8A 1GPFA 4LB3A 4JNMA 6TIMA 1FWGC 3SJ3A 1YDNA 5I06A 4LALA 1TR1A 4GUJA 4O15A 3W27A 6CGTA 4JX5A 3AIEA 1VPYA 4OV4A 4M7TA 5GNYA 1V3LA 2GQ8A 3NSMA 5C7VA 1OSEA 3O3RA 5G1MA 1RCXB 1XH1A 4ATWA 3T7VA 5F4WA 1ZNNA 5HULA 3I68A 4M82A 3W1LA 4UTTA 2OZ8A 3WLSA 3TXVA 4IP4A 4ES4A 3T9PA 3UCQA 3T8LA 5CJMA 3KUMA 3DFYA 3VIHA 1XUZA 3MCNA 3K2GA 4Q4MA 4IGNA 4GOAA 3Q37A 1DWAM 2OEKA 2A3AA 4S3EA 3TA9A 1OT1A 4OV9A 2B7QA 2VKZG 3OA3A 3CU2A 4KFPA 5HAOA 5C8BB 1XLIA 2PTYA 3BAWA 4NJJA 1CGUA 4MB3A 5CC6A 1U1JA 2XVLA 3LN3A 4Y2WA 5C2GA 1L6FA 1QNPA 3V0TA 2WMGA 4A3RA 3M0LA 5T8GA 1OG0A 2DZSA 5E09A 2XSXA 1PHQA 1KXHA 2I7GA 3CPGA 1A47A 2OOGA 1H63A 1CBGA 3IJDA 4O16A 3GKFA 4HNNA 4JICA 1QWGA 3BQ6A 5JQ9A 3T4CA 1FCUA 4M3PA 3OLDA 4KMQA 2ISVA 3PJUA 2DT3A 3KBWA 3IUIA 4J3TA 3UVAA 3NFUA 4D8AA 5ABHA 1SW3A 3KE0A 5JIPA 1BHGA 4PCFA 1YE6A 1KBJA 3LENA 2R14A 3ITVA 2WM0A 1MQPA 1SZFA 4ORIA 2QZRA 3MB9A 3GSMA 2Z26A 1JZ4A 2WWCA 1HXJA 1X97A 3GBDA 3AI0A 3F4DA 1TV8A 4RPQA 1XIMA 5DBTA 1SZGA 2CLIA 4GNKB 4YHEA 3LNPA 2WMFA 4JX6A 1NDWA 2BY2A 1TPH1 3HG4A 1UD2A 3WD1A 3BSMA 4EACA 1V02A 2ZOXA 4ZQPA 3BLFA 2OYLA 1YADA 1NP0A 2D0GA 4MAVA 3I65A 4LUYA 4H04A 4CVUA 4W87A 3GIPA 2FHFA 5G4WA 4JTSA 2R1NA 4QEEA 3RPDA 2HJPA 1PKLA 1VB9A 1U2YA 4DF1A 3IUDA 5HJXA 4HTBA 1G01A 4DF2A 3VNMA 1R3WA 1IEXA 2ONEA 1XD0A 5FEPA 3UA3A 1W91A 2C16A 2IKHA 2W0UA 4EX4A 4LC6A 2B7OA 3AXHA 2PLKA 3H8AA 1QI0A 4AWTA 4DUOA 1F2JA 4A8LA 1QUMA 4BZYA 5A69A 3ZWTA 3FS2A 4JN6A 3LCHA 3O1NA 1GGOA 2P5NA 2QS8A 3H7RA 2OZTA 1WE5A 3IWPA 4K2SA 3KRZA 5HPOA 4YLWA 3VNLA 2ACUA 4XKYA 5H6HA 5BU6A 5JVLA 1JR1A 1EJRC 2DIKA 1ISYA 1BF6A 3QGAC 1W37A 3H21A 2DZVA 4KKXA 3NJ3A 3T55A 4O13A 3QMSA 4GYPC 1ICQA 2BASA 7ENLA 3A22A 5AHLA 2CLHA 3GTIA 3M4HA 5AC6A 3SSZA 3KBJA 4GKTA 1BYAA 3GVRA 4IIFA 2DV0A 3GS6A 2A3LA 3NYZA 4MDPA 1OCJA 2B31A 1G7VA 5FJPA 5H8PA 2BOGX 3M7WA 2V82A 1XLFA 4IPPA 3PM6A 3W3OA 3A3XA 4ZQMA 1L6YA 2HV5A 4S3CA 3DAQA 1XSJA 4DBDA 1IHIA 4HCHA 2FIQA 1ZJIA 4L80A 3VA8A 2EXOA 2WHLA 1KD0A 4WKAA 4M5PA 1J01A 2PU1A 1Y0EA 3AYTA 4Z1CA 3E2QA 3B8SA 4J3VA 2J25A 2BBFA 1EHNA 1JI1A 1XJBA 4P8WA 5CGMA 2F6UA 5C5YA 3DHDA 4MJ4A 5C6MA 3S5ZA 4DO4A 4UZSA 1YTEA 5LHEA 1WKDA 3GXNA 2VFGA 4I6KA 4XV0A 4PSPA 5JIWA 1IIGA 5HA7A 1RPXA 4PMOA 4W7UA 3S6TA 1RLDA 3QPYA 5CXPA 1H7NA 3NZ1A 4NZCA 4JTQA 4TOQA 2PP3A 3ZLHA 1H49A 5KETA 3CUJA 3RM9A 2WSRA 2DZAA 3MMDA 4FA3A 2X05A 3FIGA 3QR3A 4ACZB 3FA4A 3RN6A 1F61A 4IL0A 4V27A 2GGEA 2ZRWA 3UZXA 5LKYA 3CB3A 3P0WA 3E0WA 4S3JA 4NYYA 1ITXA 4MB1A 1NSJA 4HK7A 1OFPA 1P7TA 1MI3A 5I6SA 1JD9A 3PBVA 3L66A 5D9OA 3NQEA 4OWGA 4H6KA 5G2WA 3VKJA 4M24A 3WQVA 3WL0A 1UWIA 1VGAA 3SCUA 3IARA 4WDTA 4JBRA 2VDIA 4KEVA 3S5SA 4HJWA 2YX0A 4HN8A 4WSHA 1GWJA 1OIFA 2QUVA 4GH1A 5C55A 1OG6A 2CLKA 3TEVA 4DUXA 2CETA 3GIQA 4O12A 4NZ4A 2E68A 3QV7A 2A2IA 3QZEA 4LUIA 4ZL1A 3GRIA 4QG9A 1IT0A 5M5DA 1HKKA 1XF0A 4MY9A 3FYOA 3TYUA 2FJKA 4JYDA 4MTVA 8TIMA 3HTWA 3WDIA 3LQGA 3VOJA 3U2EA 2RKXA 1Q6QA 1XGDA 3FDKA 4XAZA 4L1GA 3E0LA 3H4WA 1XINA 3AHYA 1E1EA 6REQA 1E0UA 1F7BA 2X2YA 4NRRA 2PTXA 3WLMA 1SPQA 2DUZA 2WVVB 4WCJA 2IPFA 3N17A 2ZUNA 1Z89A 3EWBX 1O5XA 1BEUA 3BLOA 3SAZA 4IFOA 1R9ZA 2F2KA 1H0GA 5D9NA 3P6LA 2GSJA 4LAKA 3C0QA 3O2LA 3R11A 1W8SA 3OBEA 1EZ2A 3H53A 4TX8A 4G7EA 3AUJA 4FPSA 3NL5A 4LAOA 3LD5A 3ABZA 2QGYA 4HOZA 3SRDA 1TTPA 4X60A 1K02A 4JDBA 5SWUA 2J9ZA 2WSQA 3V35A 1JD7A 2F38A 4W7VA 3R0DA 4X0VA 2CZEA 5HNTA 1EF2A 2A3BA 1O60A 3URBA 1W56A 3NDYA 3IIVA 3N2XA 4WR3A 3ZJ7A 1ZAIA 3CL8A 4ZQCA 3PB0A 3VI2A 2HBXA 3DYMA 3NPWA 2VX7A 2VD8A 3AAMA 3KZSA 1JDDA 4R27A 3TOYA 2REQA 4P61A 3NXFA 3GZ3A 4PMJA 1MFVA 1P43A 1RP9A 4CGTA 1NU5A 4ONVA 1LM1A 3V18A 2G96A 4MNLA 3GDBA 2G0WA 2H3DA 3V3WA 3WIJA 4IP5A 1J79A 3WELA 2OR2A 3QHMA 1E9LA 2Q8ZA 4YNGA 2DJLA 4J28A 3SFKA 1RY8A 2JKEA 3GG1A 1TR9A 3C2OA 4CQAA 3S46A 1TFVA 3WCZA 4O14A 1T5AA 2ZRZA 4I8DA 4Z08A 4YWIA 3KXQA 2J13A 4C6OA 3CB8A 3W2JA 2YLAA 1XW8A 4HMCA 3RLHA 1VFOA 5LYRA 3UY8A 1QT1A 2CZDA 3IGUA 3WLHA 5C9WA 3LTSA 3NUKA 5FJIA 1LLZA 2BXVA 1VEMA 4WLCA 1DJXA 3NQDA 2VRKA 2GVJA 4AISA 4WXYA 2XH2A 5HNRA 3SN4A 3WD2A 1Q13A 1JJKA 4MAZA 4O19A 2EG6A 3AHXA 4C91A 4UNLA 3EB2A 3EEGA 3PUGA 1B4KA 4QSHA 1F74A 2BY1A 3AHVA 2VRQA 3RLVA 2V3FA 3NNTA 2OXNA 3LHTA 1B54A 1E56A 4K6AA 4QJ3B 1B4EA 1TJ0A 2E1WA 4HSOA 1PWMA 1NDVA 4LYRA 2HNEA 4XVDA 3P0XA 3AOFA 2NWSA 1AZ2A 1BRLB 1E5JA 3N3TA 5GJPA 3WMLA 4CCCA 3CASA 4UQBA 1YHTA 4GG9A 2ZZ1A 4M6UA 1UROA 5D02A 1JZ2A 3QFEA 2OGJA 2Z1BA 4B16A 4UCFA 3SBFA 5AY7A 1GVYA 2VQTA 2O7QA 2P8CA 2XISA 5D04C 1R5YA 4NAFB 1ICSA 2QDHA 1DE5A 3BXWA 5FF2A 1QVBA 3KS5A 3G5EA 4QISA 3MP3A 4RNJA 1N8IA 1SUXA 2WCSA 4TR9A 3UXKA 1JCYA 5HNNA 1QR7A 4FP1A 1P48A 3W1TA 4E2OA 1OCNA 1R7OA 4S3BA 4AEEA 4A8RA 1PX3A 1FDYA 3W71A 5J04A 1KM0A 4CEXC 2J78A 4ICNA 1DKWA 3AUOA 2J74A 4RDWA 3L5LA 5LGZA 1Z7AA 1QNOA 3O06A 1YQ2A 1CCWB 2QCEA 2ATSA 4U2YA 4E8CA 1C8VA 4N4PA 3MO4A 5CPOA 3GDKA 3LI1A 1DJQA 2AL2B 2GPTA 1X7FA 3GHSA 2WYSA 3GW0A 3UZ5A 3QEZA 2A7NA 3ISIX 1VCFA 2OGYA 2EG8A 4W88A 1H7PA 1E6NA 4XTIA 2A4AA 5F2MA 3URQA 1KM4A 3EZ4A 3CMFA 3QR0A 2CLFA 4UFLA 3BLLA 2WJFA 3OBAA 1N7KA 3PUOA 1S5WA 4DWSC 2WCGA 3PFMA 3LYEA 3CAKA 4YVPA 2PDIA 4AF0B 1T41A 4F0LA 2W92A 2H6RA 3BAIA 3BW3A 3FK4A 5CPQA 7REQB 3OEXA 4WDUA 1ZBCA 3CC1A 4EPBC 3P82A 4KIEA 4N02A 1FY6A 3PG9A 3N34A 4ROQA 1LOLA 2R94A 2VCCA 5ABFA 3B8IA 3VZZA 2E7FA 2OQLA 3URAA 1ZENA 3WFAA 4KCWA 2OWXA 4KF1A 4JCMA 3ZSSA 4U10A 3RRXA 4WGXA 6A3HA 2IPGA 2QW5A 1OGBA 3POCA 4BI7A 3G1VA 4BI6A 4ZE4A 3S8HA 3OIHA 1JYWA 9XIMA 1F6YA 3KWSA 3VU2A 2ACRA 4ZO8A 3DBPA 3LRLA 3BW4A 3TJXA 4QITA 3NQ8A 1OFQA 3OTRA 3ZT6A 4PMNA 3LBMA 4UFHA 5TBOA 1TPWA 3QXBA 4C6QA 4C6CA 1EUNA 3CEUA 1VBGA 1KM1A 3R13A 3KCLA 3ZYZA 1PV8A 4RE3A 3VX1A 3ARUA 1KLZA 1W5PA 1S2VA 3AQUA 4HMEA 2OSWA 3M07A 1K7FA 1QOXA 3EPNA 4LRSA 5LNSA 3THUA 2I57A 2TRSA 1O4UA 3QGVA 4MGGA 1ONXA 4QG6A 1IQ8A 3GH4A 4Y9OA 5G2HA 3DN5A 1GVSA 1PAMA 2X0HA 1D9EA 3HPAA 3EDJA 4BKNA 4A3HA 3SCTA 1AH0A 1W9DM 4I9TA 4ZB0A 5A5WA 1A5SA 3HPZA 1JAKA 4ZSUA 4B3LA 3UGRA 3V0SA 4I90A 3VNZA 3PBUA 1UB3A 1NFBA 1ZB5A 1FKWA 2BMBA 3GU1A 2QIWA 3NURA 3WH6A 3T44A 1XS2A 1E4LA 1HKJA 4S38A 3WL1A 5H2ZA 1PTAA 2HXTA 3CWHA 4XSMA 2EBNA 4PRRA 1IGWA 4EWJA 2A5HA 4FK9A 3IV3A 1SR9A 3BLDA 1Y8BA 2V2CA 4Y9MA 1XLMA 1YRRA 1PIIA 3N6JA 1QI2A 2IUZA 1V02E 4KRZA 3SSJA 1Z32X 3RMEA 3TYZA 3SIZA 3VXGA 3H2AA 4DJFD 2JEPA 4CU8A 2H3BA 2QCCA 1W1ZA 2I17A 2W6RA 1I2NA 4O1CA 5CLTA 2PDPA 2GOKA 1A3WA 1VF8A 4MIMA 4QCEA 1IZCA 4FR1A 4IXXA 5J5RA 5KSWA 4RXFA 2O4MA 1IXNA 1FWSA 1RR2A 2PLJA 3UR8A 1HJXA 3CM4A 4R7JA 5CC7A 1Q6DA 1LBFA 1JCJA 2GGHA 3GIYA 5AHMA 2AOSA 4XZ9A 2E40A 4ZFCA 1MMFA 3N2BA 1HUVA 4DJED 5IFTA 1G4SA 4JTKA 2AQVA 5E70A 3B0PA 3OB8A 4D6CA 4Q22A 4UR7A 3UG8A 1CGTA 4HYWA 5BRBA 4H00A 1QPQA 1ZJBA 2WWDA 4FNTA 4I7VA 4ZE5A 1OHLA 4BCEA 3HIJA 3ITGA 3P60A 4PB5A 2PZ0A 3MVIA 3RRAA 1HGWA 3SCNA 2W63A 3M0HA 3P14A 4A6GA 3EB3A 3WUFA 5CG0A 1P6BA 2YDSA 4R34A 1ZUAX 2DQXA 2HVMA 2PGWA 1J2BA 2QYGA 2YA0A 7A3HA 3GDTA 3DC8A 4V15A 4YYFA 4UTWA 3PBYA 4NP7A 5LHFA 2PWGA 4ADSA 1KFLA 1NVMA 4JS3A 4QS6A 5TQLA 2GK1A 4LU0A 2XU2A 1REQA 3VDAA 5M03A 5E93A 2ADAA 1KBBA 2D2JA 4OBSA 1JYNA 1HVXA 4MLRA 3IIOA 1DIOA 3AXKA 3QFWA 4J2PA 3NVDA 1XLBA 4KH2A 4OOZA 1QI3A 2YBUA 2E6DA 1JZ5A 1UZHA 5AECA 4QDMA 4ROPA 3NGFA 3VDHA 1BPLB 3DDMA 1N8FA 2HE5A 5M1TA 4ZSTA 2ZXBA 4IJBA 5I77A 1M7XA 2BFGA 1KM3A 5DXYA 1QO5A 4A21A 4FNUA 5ABEA 3ENLA 2YBTA 5CCZA 4IMFA 3TTYA 3ZR6A 1SJBA 3HJEA 4PTNA 3D6NA 2ZA1A 2HE8A 1LUCA 3SB0A 3LG3A 4H6QA 3UJEA 2WLZA 4I5UA 4K38A 2VFDA 1V0KA 1HJSA 4QLJA 1KXVA 1DJNA 3T08A 1J5SA 1TV5A 3BMVA 3KOWA 4W84A 2ZZ4A 2CWNA 5DMLA 2V81A 4GFSA 4NHVA 1KFJA 2O4QA 4KRUA 1BYDA 3A12A 4DJEA 2QUTA 1YTKA 1C7SA 3MCOA 3VO0A 2ZRYA 2PGEA 5A6SA 4D6FA 2BXYA 1H11A 4UC5A 4GUHA 4V2XA 5BMWA 2OLSA 4S23A 1SW0A 2IQ0A 4E38A 2HCVA 1E15A 3ANYA 5IM51 4XVEA 1GJUA 1EQCA 5HWMA 1F3EA 4E2DA 3E9AA 1PYFA 3BJTA 2WM1A 5F2GA 5B80A 1SFTA 1XP3A 2D73A 4C6NA 4Q6XA 3PBWA 2WPGA 1RK5A 3U2OA 3W22A 4FLSA 1M65A 4HA3A 4NI8A 3EBVA 3QYSA 3RO8A 1X6LA 1YBQA 1MDLA 3BAJA 4HU8A 1QU4A 1BTMA 2XH0A 3L4XA 3LY0A 4Q7NA 4EF8A 2AGTA 3GDRA 4UQAA 3LV6A 2VM8A 3M0YA 2VC7A 1XQKA 3OVRA 4QTGA 3N11A 4GKLA 3EWYA 1Q5MA 1H1NA 1GHSA 4DAIA 3UU0A 1OFAA 2PTWA 3PNUA 3USBA 3SO7A 5K2ZA 4AY1A 3N2CA 4DPQA 1ME9A 1NWSA 2G5WA 4QJ1A 2C14A 3JUGA 2Z1SA 2WK2A 4OQVA 2Y89A 1H2JA 1G4TA 4XD4A 3LHYA 4FIRA 1E1CA 1S38A 1F6KA 4KIRA 3U4AA 3LPOA 1RD5A 4IUOA 3MI3A 4PRWA 1XIFA 1M7OA 3GFZA 1AQHA 2UY5A 1NDZA 1Q6GA 3KTXA 2POTA 3F7JA 2WJZA 3C3NA 3SQSA 3W6YA 3NTYA 4XIAA 1J0ZA 1LRNA 3QKZA 1ODZA 3NEVA 1E9YB 3M6DA 2YZRA 4MB5A 5A8MA 2VCAA 1TG7A 3DG6A 4GX9A 4Q8QA 4QJ5B 1CENA 1ZBVA 2YB4A 1UH4A 3U0HA 1WX0A 3FDGA 4H19A 2WBKA 5CGQA 4IMEA 5FF7A 1O12A 4ZZ9A 3WQ5A 3MS8A 4AVNA 3LTPA 2C7FA 2VZTA 1UOZA 4WY0F 2CBVA 4HYVA 4M6VA 1EJVC 5GQBA 1VRDA 2CLLA 3AJ7A 5TIMA 1ZHAA 1JGIA 2CKSA 5FOOA 3ES7A 4HA0A 1NOFA 4AVOA 1JXJA 1XC6A 3GD6A 4NNAA 3FEQA 1OQFA 5DEZA 1ALDA 1EGZA 2JE8A 4IFKB 4QCFA 2CWXA 2V5JA 4GGHA 1TB3A 5KITA 2NT1A 1K3UA 4U5IA 4H9TA 4LUJA 4JNYA 3NQ7A 3DGBA 1XICA 4P7NA 4UCGA 4KESA 1UR9A 2DQWA 3V75A 4IMAA 4F2TA 1PSCA 3KCJA 5U7SA 3R6IA 3G3DA 4FF5A 1WBJA 1HO4A 1PKMA 3PJWA 5REQB 1XRTA 3WLQA 2WAGA 3CIXA 4RW5A 1E6XM 3M64A 1UJPA 2WCAA 3UERA 3W7CA 3VOIA 5TNVA 2PBGA 4RZ5A 1E55A 3ABQA 4EVZA 3QBUA 2QUUA 3EWUA 3BV7A 4NJGA 4YWSA 1OFOA 4DWSB 1BXNA 1AK5A 4AZIA 5KMYA 1V4YA 3B8UA 3UJFA 5CPMA 1KQZA 4XZWA 5CPLA 4D6IA 3ARWA 4A29A 3ABOA 4HCLA 1EHAA 2GDVA 4E3VA 4J3XA 4FXFA 3W7IA 4Z2JA 3ABSA 1LTDA 2WSPA 2YKKA 4Q8UA 3W4RA 3O7UA 4XBJA 3W37A 1LWIA 5FESA 1H4PA 1XLJA 4RZ6A 5FJJA 4OU1A 1R0MA 4AC1X 1K4GA 1Q4NX 1T6MA 2VR4A 4HOWA 3ITCA 4PTDA 3XISA 4C1NB 1CX9A 2HPIA 1R8LA 4REQA 4LS0A 3OHIA 4QQUA 1C8QA 1ZL1A 3CUFA 1C92A 3EDKA 3AYSA 4ZTYA 5EMUA 5HATA 5DBUA 4GVHA 4TTUA 3OBKA 1B30A 3UNTA 2V63A 2OG9A 3WDPP 1CLXA 1IWBA 4QR6A 4FSAA 1A4MA 4F8XA 2FZMA 2PCQA 2HS8A 4GMEA 3QLDA 3U2CA 5A94A 3NQGA 3THCA 3VFCA 1VIZA 4L65A 5DRCA 1CZ1A 3DERA 4R85A 3T05A 1BLIA 1W54A 1I2PA 2I56A 4CCEA 3T1GA 1W17A 5BZAA 5EB8A 3LM3A 2C0HA 4YU1A 1J6OA 4DQWA 1J8VA 3NZQA 1FWCC 5I7GA 5I3FA 4IX2A 4HZ6A 4TVDA 4JAWA 2CBJA 3WQOA 3WLRA 1F76A 3IJIA 4ORMA 2ZUSA 4V28A 4Z0JA 3RNDA 2EKGA 3DHUA 4N9DA 3GM8A 2ZA2A 4ZQRA 2IXVA 3WK1A 1RH9A 4HU3A 2J7FA 5K9DA 4Y90A 4J40A 1Y7VA 1YPIA 1VYSX 1BKHA 3C2EA 4S3FA 4LJ3A 4H83A 4GVFA 4FLOA 2WKGA 4QEHA 2HPMA 3GFXA 5EU9A 1X38A 1FXPA 4FZIA 2P3EA 4J3UA 2VEIA 2YSWA 2YZ5A 2ZUTA 5EMMA 2V5BA 3CNYA 4JFVA 5BXSA 4ZO7A 3A9IA 4CU6A 4F79A 2Q3OA 3VE9A 3LI0A 5IRPA 3S0CA 5BNKA 3GXIA 3DFTA 2OODA 1H5VA 3N12A 3EOUA 3OG3A 3U48A 2QDDA 1T8XA 1T0OA 4MY8A 4LYKA 2P53A 1TMQA 4HBKA 2DY3A 2PDJA 1TWIA 4NAEA 3ZM8A 1SFJA 3FSTA 1HQTA 4RV3A 3IAQA 4TMBA 2OO0A 1VS1A 3C0JA 3KFTA 3W23A 3PTDA 4U33A 1YW1A 4C6IA 1KB3A 2ZUWA 2NQHA 1UWTA 2IS7A 1DEDA 3NQAA 4P8VA 3B0UX 5C9XA 3C2VA 4PYSA 1OGSA 1O94A 2X0SA 1FWDC 3LCWA 5KTLA 5CAHA 1TE6A 4IMDA 2YCLB 1JPDX 2CLOA 3HPXA 1Q65A 1O5KA 1GKQA 5KZEA 3TTSA 3VKDA 5CBBA 1VLIA 4PEEA 4HQVA 1GVEA 3CUXA 2FZNA 1XYFA 2A6LA 4RL3A 3A4AA 3UW6A 3K13A 4HHHA 2ZXAA 1RD6A 1W3NA 2NXHA 5GPRA 1S3TC 3PZUA 8CGTA 1XLAA 4BQ4A 5DY3A 3T07A 1BSIA 3C5QA 4EAMA 2H8XA 3RJXA 2ACQA 1HKVA 1LOSA 2ZYFA 3NWRA 3NDZA 2YFNA 5EMLA 3A21A 3SRFA 3IVUA 2OLAA 1E6QM 2RJGA 3PF3A 5HUPA 4RLIA 2EHHA 1TA3A 4PL1A 3E1F1 1HKMA 4H9UA 5HXMA 1R2TA 3RCMA 2Q02A 2VC5A 1X39A 4JCLA 1QATA 5BXRA 5KEZA 5LNVA 2BP1A 5HDRA 3ZZ1A 1YEYA 3ZIZA 1F05A 4UQDA 2H90A 3AIRA 2GDUA 3GYCA 3MY9A 4QFUA 5EGRA 3LSCA 4OTKA 3SN0A 4CUCA 1XPYA 3IGSA 5A6TC 4IFRA 5AC8A 5HJLA 1R3RA 1CWYA 3MSDA 4IP7A 2R24A 2AQOA 4O52A 4LB4A 1SM9A 2XVNA 3MUAA 2R1PA 4L9ZA 3SDOA 2VVSA 5DMYA 1OYCA 3O9NA 2FHCA 5PTDA 3T0TA 5BOEA 3L4VA 4JHMA 3SECA 1PKYA 2O7SA 1ECEA 3RITA 4L56A 1L6GA 5EMKA 3GVWA 3PR2A 4LCQA 4GABA 1BVWA 3NO5A 4I5XA 4DI9A 1QXLA 2QR6A 4TV6A 3S4TA 1UJQA 1CW2A 4DAFA 1IT8A 4Q3MA 2W3ZA 1A0DA 4HZ8A 1HX0A 5FJOA 4EXBA 2WANA 2C1GA 4V33A 1A50A 2W67A 3W1RA 1K9EA 3JS3A 3F4NA 3BO9A 2BGNE 4HA1A 4UTLA 3SIMA 3TR2A 3WF0A 3W7PA 2BWGA 2VR5A 2I5QA 3RYSA 1A5BA 4NJIA 3F1QA 1D3CA 1K8CA 3GVGA 4QDWA 3ERPA 5C70A 1WCGA 3TOPA 2XIOA 1OK6A 1KC7A 4DBSA 4Q4KA 3B8WA 3LHWA 3DHPA 1NDYA 4KGJA 1AMKA 4AHOA 3I3BA 2W66A 4OGZA 1AUSL 1V3JA 1O66A 2BX7A 4ML4A 4QE5A 1BQGA 2E67A 4PB3A 2O56A 2QF7A 3WLOA 1HP4A 4NY2A 3BG3A 3KOXA 3WBXA 3UESA 4LXFA 1A3HA 4A3YA 3G0UA 1L6SA 3FV9A 4K1GA 3TN5A 3W1XA 3GDLA 3KWXA 2FVMA 5CJ5A 3CEPA 4W89A 1I0DA 3WD3A 3UBPC 1QMLA 3LTYA 5D8WA 1V93A 1XSIA 1ZAHA 3OG2A 3ZJ8A 5A95A 2VX5A 5D32A 5JH2A 5HMEA 1KLYA 2Q71A 3BANA 4AMAA 4QIUA 4EXQA 4O1FA 2E5BA 1NF7A 5FF0A 1LBLA 5A8GA 3A4JA 1V5XA 3W2NA 4JTRA 3BLEA 2NQ9A 2NQZA 4BQ2A 2RHGA 4XKYB 2XJ7A 3LEPA 1FHLA 1HFBA 1Q7MA 2FGZA 3NYDA 2A1YA 3TW6A 2HMCA 2VX6A 3AZTA 4QS5A 3EAUA 1LRTA 2BSLA 1W31A 4PFMA 1XIIA 1VBUA 3G3MA 4D1JA 4GY1A 5I2UA 4LAUA 2Y62A 1H1YA 2EJAA 4HMNA 2XWDA 4B5NA 1WDPA 1KBIA 4FF7A 1RJRA 3CUIA 4JTFA 2JIWA 3M0ZA 4A2RA 1TVNA 4MJ2A 3CIVA 3KBMA 4XQ6A 3P80A 3C52A 2NSXA 3BCJA 1H61A 2E25A 3OGRA 3W07A 3CV1A 1R85A 4YTUA 4A05A 1FP8A 1LWJA 1RLCL 1KM5A 4HPJA 2JF6A 4L64A 5EFDA 2F2HA 2FPYA 3R2GA 1F73A 3AIBA 2ESCA 4AVFA 1Q4WA 5FL0A 1RCQA 3CQHA 4KGLA 2CHNA 3VD4A 3ARZA 4DN1A 3B9EA 1NOWA 3ANVA 3L0GA 1DVJA 1FCBA 2RGMA 3BCFA 4XAFA 1EDTA 4EF9A 3CYVA 1J93A 3NPXA 4EAYA 3C8FA 4X2PA 3V1HA 5CBIA 2X1SA 1HJVA 2WPBA 5DT7A 1W5NA 5IHSA 2X1RA 2D69A 1XLDA 1X1OA 2YXGA 4LX4A 3VZXA 4K7VA 2Q8LA 5LIKX 3V1PA 3OVQA 5CGTA 2POZA 4LFYA 2QCNA 1R9XA 3WLNA 5EFFA 4US6A 3R7MA 3PTMA 3AIQA 3CLWA 1EPVA 1P7TB 1R47A 4UR8A 3LLXA 3ONCA 4W86A 3RAOA 4JTDA 2J47A 4LT9A 1XCFA 3R94A 1UD4A 1K7EA 3UYIA 4G6CA 1GNXA 4N9BA 2XYLA 1X6UA 1DTUA 4UTWC 4M1BA 1W3IA 3HGRA 3NXLA 3AXMA 2JKPA 2I5GA 3QKEA 2QPUA 3EXRA 3NOYA 3W2KA 5FL1A 3RXZA 1C9WA 3UG3A 1VHCA 3APTA 1IXOA 4AD2A 1ONWA 4NSBA 1W1A1 3LU2A 2IPWA 1B3XA 1GKRA 2J8GA 5BROA 3CT2A 5E0CA 5D33A 4NVTA 4JQ4A 3GVQA 4HZMA 1VR6A 4C5ZA 1Y5WA 1Z48A 3AZRA 3QPZA 4HK5A 1I2RA 3NG3A 1QFEA 1W1YA 3L5AA 1GEQA