3OA3A

Crystal structure of a putative deoxyribose-phosphate aldolase from coccidioides immitis
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
253
structure length
253
Chain Sequence
b'MSSLNNEEWDLLISGKKATLQYPIPLLCYPAPEVVSIAQIIDHTQLSLSATGSQIDVLCAEAKEYGFATVCVRPDYVSRAVQYLQGTQVGVTCVIGFHEGTYSTDQKVSEAKRAMQNGASELDMVMNYPWLSEKRYTDVFQDIRAVRLAAKDAILKVILETSQLTADEIIAGCVLSSLAGADYVKTSTGFNGPGASIENVSLMSAVCDSLQSETRVKASGGIRTIEDCVKMVRAGAERLGASAGVKIVNETRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aldolase
publication title Crystal structure of an unknown aldolase from Coccidioides immitis
rcsb
source organism Coccidioides immitis
molecule tags Lyase
total genus 99
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 4.1.2.4: Deoxyribose-phosphate aldolase.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01791 DeoC DeoC/LacD family aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3oa3A00
1KA9F 1L6YA 2WSRA 4O10A 2FPVA 4TMBA 2RKXA 4IMFA 3C8FA 4O28A 4BWLC 4QNEA 5FF2A 1W5PA 3MHFA 3S8HA 1OX4B 2J27A 4DQWA 1TPEA 3LTSA 4DELA 2FFCA 3CLMA 3EXRA 3KAOA 1K8ZA 4MFDA 3CWOX 4GUGA 5F4XA 2E6FA 3W86A 3PC0A 1BWLA 1I45A 1GYNA 4PA8A 3PBYA 4R7JA 3ABSA 1KBIA 4P2VA 3NPVA 5CZSA 4LVBA 1VHNA 5HUPA 1LYXA 2R94A 5LGXA 4WOQA 1HG3A 1ZAIA 1SO4A 3NPUA 3G0XA 1F73A 1W5QA 5FF3A 3I7SA 1IGSA 4UNLA 3EXTA 6TIMA 1B57A 3SY5A 4TIMA 4YXGA 1LLZA 1MZHA 1ZHAA 4BWLA 4LRSA 4PEKA 3B0UX 3TQ0A 4RXGA 1KTNA 3RK8A 3L2IA 5A5WA 1WOBA 2ATSA 4Z0JA 3UPBA 3LI0A 1VLIA 2C6QA 1VCGA 3H55A 4IXXA 3N19B 4AEOA 2PE4A 1NSJA 3NA8A 3FA5A 3CTLA 1LBFA 3EX1A 1PL9A 4LVGA 3DH7A 3W1LA 1TO3A 3O16A 3VE7A 1KFCA 2ALDA 3ATYA 2V5LA 1QOPA 4IMCA 5AC7A 5AC8A 2TRSA 4WXYA 1PHQA 3LCWA 1JJKA 1X1ZA 1Q6QA 1R46A 4JTKA 3R89A 2C15A 3LXCA 3IVTA 4A22A 3B03A 2GPTA 2VFHA 4GE8A 4EWND 2J9XA 4OQVA 4IUOA 4N9DA 3AO0A 3QW4B 3A5VA 3I68A 4O11A 3LHUA 5GVJA 5C2XA 5K4XA 4OHQA 3R8RA 3C6CA 3MP5A 4XKYA 4YWIA 3BGGA 1HO1A 3DI1A 5C5YA 1F05A 4EVZA 1DOSA 4JN6A 1Q45A 1R2RA 4M6QA 4OBTA 1PCWA 1EWEA 5K7JA 1WBJA 4UNKA 5TBOA 2WOQA 5G4WA 3IGUA 3OEXA 3LRMA 3U6WA 3GAKA 4GFSA 2A4AA 3TFXA 5D2XA 1UB3A 3FYPA 1OABA 2ZA2A 4BI6A 3W83A 3S1WA 4NJHA 3IV3A 3W87A 3B0PA 4QAIA 3KVMA 1SPQA 4EF8A 4DF2A 4U4MA 4JX6A 2VFEA 1D3GA 2CLMA 2CLKA 1XC4A 4LS1A 1TV5A 4G1KA 5G2IA 3GZ3A 4CCDA 4FNTA 5BRBA 4XZ9A 1EWDA 3LCXA 3TXVA 1Q6RA 3L0KA 1IXQA 1YPFA 4JX4A 2CZDA 1GVSA 5LZLA 4JDBA 3KXQA 2Y85A 4JS3A 5BNKA 3IEBA 5AHLA 1H7NA 1UJPA 1T8XA 3W1QA 1QMLA 5AHIA 3IVSA 2QR6A 3PWAA 1K02A 1NAL1 4O57A 3W84A 1QPOA 2D73A 3LRKA 3EWBX 1I2RA 1YTEA 3PF3A 5D2TA 3F1QA 5G1YA 1G6CA 1S5WA 3G1AA 4FXRA 3L68A 2E5CA 4IX2A 4WQ6A 5FF7A 3ZR4A 2DP3A 4AHOA 3C2RA 1VYSX 3NL3A 1XBXA 2GVLA 1H50A 3LHZA 4IMEA 3O15A 1OYBA 2H8XA 4UFMA 3FKKA 4RXFA 2VFIA 2JK2A 2ZDRA 2R8WA 3ABOA 4Y9AA 2A6LA 3QW3A 2Z2UA 4KFNA 2CZ5A 2F7FA 1V5XA 3QSTA 3BG9A 3AJXA 3CC1A 1GT8A 1TMHA 4NNCA 3KX6A 1H7OA 1W8SA 2X16A 4XBSA 3BLFA 4L4MA 4RZ6A 1TQJA 1YXDA 5HWMA 4K6AA 3WJZA 2C18A 3GDKA 2P10A 1L6WA 5DY2A 3CT7A 3L5AA 3LGEA 5C54A 2VEKA 5G2WA 4N2YA 4UMCA 3RFAA 2E6AA 3SJ3A 3W76A 2QCDB 3QEZA 5IBXC 3QMRA 1CW2A 2H8ZA 2NWRA 4X22A 3BPWA 3BW2A 3PBWA 2ZFAA 3W72A 2EAWA 1QWGA 2CLHA 3OA3A 3W07A 4NJIA 5KZEA 3N73A 3FOKA 4JTJA 2DZPA 3PB2A 5F2IA 4N9CA 1I8JA 4IWWA 2B7PA 3UWWA 4OV9A 3MBDA 1O5KA 4UTLA 3CIWA 1TQXA 1GWJA 1LRTA 3NO5A 3GDRA 3W7MA 2QUTA 5HJLA 4WZHA 3SGZA 2E5DA 3LTYA 4JTIA 4LRTA 1OJXA 3MWAA 4UTTC 2Z0IA 1TPWA 5CPOA 2BXVA 1TPFA 1HTIA 5J5DA 1R2TA 5IBXA 2Q3RA 3GXNA 5D2YA 4LU0A 2WNZA 2B4GA 3NPXA 3HG4A 3TR2A 2V9DA 3NQGA 3B4UA 3PG8A 3W1UA 1LRQA 3B04A 2ISWA 4UFHA 1TTJA 1A50A 3DKJA 2WPBA 5FI8A 4GXMA 3ELFA 2DZVA 3N34A 2EKCA 4LWWA 1CX9A 4O15A 1XKYA 1DL3A 1PIIA 3NQDA 5LKYA 1O5XA 1ICPA 3W7KA 3DHFA 3NYZA 2ZCGA 3KVJA 5KMYA 1KW1A 3EKZA 3LHTA 4K36A 3BVJA 3TSBA 4ZQPA 3SI9A 1JVNA 5CZ0A 3W2NA 1GVQA 2P1FA 1H63A 2E6DA 4UTKA 4UTMA 3HQ1A 2J6XA 3HF3A 1M6JA 4MVAA 4R53A 4EIVA 1F76A 4FNSA 2NUYA 2ZRUA 2J88A 5K9XA 4IOTA 3T78A 4MIMA 4CLMA 2V5BA 3LBCA 2YPIA 5EPDA 4PFMA 4C1LA 5AHEA 3TKFA 3W88A 3IGSA 1EA0A 1M7PA 4YLWA 4NJJA 1VCFA 3G18A 4ZQCA 3GDTA 5K9CA 3QC3A 3HPZA 5K4ZA 2ZRXA 2LLEA 3QPZA 1WDWA 1Q3NA 3W2MA 3T55A 2PRHA 1H7XA 4JYFA 2QCLA 4IXHA 4RCXA 4LNYA 3LTPA 2QCHA 5U4NA 4QM1A 3HMJG 1OVDA 3C2VA 1RVGA 3WJWA 3LDVA 1YDNA 3E0IA 2YW3A 5E1QA 5I3HA 1GZGA 1QCWA 2YFOA 2O7QA 1PV8A 1H60A 3W2JA 4DF0A 5D38A 4PODA 3JS3A 1FCBA 1RR2A 1VZWA 4O1AA 1QNVA 3LCLA 4DPQA 3MUXA 3FJLA 3MI2A 3W1RA 3DENA 2Y89A 5DELA 4LVDA 1SSGA 2A7NA 4HHPA 4O4VA 1WXJA 1H1ZA 2RH9A 4OU1A 3W7DA 3N2XA 1YXYA 1YTDA 3C2FA 2HMCA 4O4WA 3OIXA 5FEWA 1QPQA 2O7SA 2RDUA 3G1XA 4B5NA 2A0NA 1PS9A 1B4KA 3EWXA 1FWWA 3M47A 3LERA 4UC5A 5DLCA 1Z44A 5LNSA 1GVOA 3W3OA 4NX0A 4A2RA 1NVMA 2XFWA 4JR5A 1KFKA 1FXPA 1OFDA 1VLWA 5F4SA 1ZCOA 5AHMA 4O1CA 2VXNA 3P82A 3QJAA 1EP2A 2Q3OA 1TRIA 4ML9A 2ZTKA 3TSMA 3O1NA 3PSVA 2QCCA 1TPH1 3EWYA 4QQ3A 1F6KA 1T99A 2UV8G 4WUIA 3T7VA 1KM4A 4GNJA 3R2GA 2V82A 3EWWA 2YSWA 5AHFA 2A85A 5AHNA 2RHGA 3I65A 3S1UA 3CB8A 3PUDA 3UPWA 4LUJA 5AN7A 4AHPA 2QJHA 3FFSA 1KM2A 1JQVA 3KRUA 4I7UA 5EY5A 1LM1A 1WYIA 2ZRVA 4UIOA 4O50A 1LRNA 2A21A 5LNVA 4UTIA 4E2BA 3L21A 3TV8A 1TTIA 2CLLA 1TPC1 3SIZA 3UWYA 5D02A 4K8HA 5HINA 3BG3A 4AAJA 2VEIA 1KM6A 3MP3A 4Q33A 3M5ZA 1OFAA 2BSLA 4UUIA 3ZWSA 4IPJA 1XI3A 1LBMA 1S5TA 3NL5A 4LTSA 1OFOA 1JCMP 3O6CA 3C3NA 1P4CA 2ZZ1A 1G4PA 2CFFA 1DHPA 2A2IA 8TIMA 1UUMA 3UY7A 2ABAA 4K38A 3GIYA 4BR1A 3RLUA 5DN1A 2RDTA 5AYZA 3M43A 1DBTA 3S1XA 1XL9A 3GR8A 3DKLA 1T0OA 1ONRA 3UNDA 4GC4A 1KFBA 3IIZA 4JGDA 2VENA 2YYTA 1RPXA 3TW6A 2QJGA 1FWTA 4HNVA 4FXSA 4O12A 2NXIA 4AWSA 4NUWA 1B9BA 4HPJA 4DO5A 5DXYA 1TB3A 3QMSA 3G1FA 3MW7A 3NZ1A 1K03A 1M5WA 5LNUA 3TC7A 5MHBA 1K3UA 4I7VA 2YZRA 4N6EA 5LHEA 5CSRA 1K7EA 4ZZ9A 1TSIA 1NF0A 4BF9A 2YX0A 5U7SA 2NUXA 1RV8A 3NQEA 4O1DA 4HNNA 1YYAA 2DZWA 3GK0A 1DQWA 1A5AA 5FESA 4JX5A 5LHFA 2ZQ0A 4XQ6A 1TJRA 5LNWA 1VR6A 4JTLA 3UWZA 5AYYA 3IIVA 2CWNA 1EPXA 2Q8LA 4N9BA 4HNTA 3W7HA 3QRHA 4ZMGA 3PBVA 2YXGA 3NGJA 1IIHA 4RV8A 2VEMA 1H1YA 3S9YA 3TQVA 4PL2A 3NM1A 3PR2A 1O60A 3OBKA 4ALDA 1SFJA 1SUXA 1SR9A 2NXHA 1LTDA 1H7WA 4ZVJA 1FWNA 2QCFA 2I1OA 4UXDA 3N9SA 3CEPA 3HGSA 5AC6A 1X8FA 5F1UA 3CU2A 2NV2A 5C6MA 1GJPA 4CNOA 3QFEA 4UFJA 1R30A 2NWSA 3LHWA 4JXCA 4MLRA 3NDOA 1VC4A 1OG0A 3P74A 4K39A 2GUUA 2NV1A 4MZ1A 3FIGA 1W1ZA 2Y7FA 4J9JA 1OFBA 4MY9A 3OVQA 4KWWA 2GQ9A 5D32A 1KBJA 1JR1A 3W75A 4CQ8A 4JYDA 1BKSA 1QOQA 2NX9A 3HG5A 4FF7A 1FDJA 4YL2A 1DVJA 4ZL1A 3P62A 5BMWA 4X3ZA 4N4PA 1ADOA 3N3MA 3NPWA 2V2HA 3H54A 2C3ZA 4H4IA 4BI5A 4CQAA 1ME7A 1W3IA 2VELA 3GDLA 4NJKA 3QSRA 1PE1A 2X30A 1SW3A 3UWVA 1OFRA 4FNUA 4ADUA 3LXBA 5EA9A 3IIPA 2Y6ZA 1SO5A 1LCOA 3G1SA 4GUHA 1TPUA 5EL1A 1W0MA 3LV6A 2E09A 1Q6LA 1PHWA 3FYOA 4HSNA 2X1RA 4DXVA 1F5ZA 3GB6A 1XBYA 3O05A 1SO6A 3TQKA 5EKYA 2E77A 4FX7A 3G8RA 4AWUA 1DQXA 4DBDA 3DFSA 3ZWTA 4WD0A 4NQ1A 3CPRA 1FBAA 2VC6A 3NR0A 3MP4A 2FJKA 3QMTA 2VFDA 3ABRA 3BARA 4W9TA 3DBPA 4GRSA 5C55A 3S5YA 1X6UA 4JTGA 1KFJA 2FB2A 2FIQA 4FEZA 5I3IA 4RZ4A 5DY3A 1W37A 4AXKA 1L9WA 4O16A 3TXZA 4QJ1A 5HULA 1FX6A 1RD5A 3C56A 3JRKA 1TRDA 1A5CA 3GXPA 1G67A 3QZEA 2F84A 3S5NA 3O6YX 3S5OA 5E0KA 1SZFA 3DFPA 3KOFA 3THQA 3G1YA 3Q94A 1SQ7A 2EF9A 1H7PA 1TTQA 5I3FA 3EEGA 3TROA 1VRDA 2DJXA 1QPNA 1W56A 2QAPA 3ANYA 4IMGA 5I3JA 1FWRA 3C4UA 4DEFA 4DO6A 1OFEA 4AHQA 1FWSA 2CZEA 3W73A 2WSQA 1EP3A 4JNMA 3YPIA 2P0OA 5DXXA 1PCKA 1TTPA 2HS6A 1DJNA 5CPNA 3G1DA 3U2OA 2QAFA 2V81A 3CIXA 3DFTA 1XBVA 2YGYA 4LS0A 3PUEA 3W1AA 2X1UA 2QCMA 2Y7GA 2B0MA 1VGAA 1HO4A 1NF7A 1RZMA 1JCLA 3DFOA 5F2LA 3P8JA 3W7NA 7TIMA 2VFGA 4O8RA 4UMAA 4Y6GA 3W22A 3W74A 1GPWA 1LOQA 4M6PA 4LUIA 1K7FA 3LI1A 2EPHA 1A53A 1FCVA 3BO9A 3PY2A 4JTFA 4ORIA 3NQVA 3G8EA 4IMDA 1QFEA 1P0KA 2WSYA 4JDYA 1OHLA 3O06A 5F1VA 3NVTA 3TMQA 3TFCA 1TCDA 4JD4A 3HPXA 5FF0A 3P61A 4AB4A 3A23A 4RR4A 4KWVA 4OV4A 2BX7A 2YDAA 3W2LA 1XUUA 4BI7A 1UCWA 3EKLA 2FDSA 2G95A 2NUWA 2X1SA 4UTWA 4Z08A 2OJPA 1G4TA 1HFBA 3T4CA 2E68A 5F2GA 1C9DA 1U5JA 4AF0A 3W1XA 2QCEA 2TMDA 1I4NA 4N02A 1GTEA 1XM3A 2CLIA 3E02A 2J24A 3M5XA 1UASA 4XKYB 3WK1A 1JUKA 3P67A 3CWNA 1Z48A 3C2EA 4YCPA 1K8YA 2WV8A 4OWGA 5DCEA 1UUOA 4H6KA 2R91A 1ZENA 4S2CA 2G96A 3NQFA 2OT1A 1VPXA 4CQ9A 5FEPA 3S0CA 5I3GA 3W7IA 1F6PA 4NZJA 3QQ0A 2ZA3A 3TIMA 3HGRA 4RJEA 3E96A 2CLFA 3FEMA 3TJXA 3W2KA 4NJGA 5AYXA 1G69A 4C1KA 5AFDA 1GTHA 2Y88A 4FX8A 3NQ7A 4M7TA 3GDMA 2C0AA 1QAPA 3EWUA 5HNRA 2QDGA 1KV5A 3PM6A 4LOCA 3G24A 3BW3A 3LCHA 5CGQA 5IM51 3DHDA 4EF9A 3HB9A 1KTBA 1YTKA 3W7LA 3NQCA 3UYCA 3HIJA 1TV8A 4FNQA 3Q58A 3EX6A 4O19A 3RMJA 1GEQA 3B06A 4MZYA 1KFEA 5CZTA 4O0KA 3WK0A 1X7FA 3Q37A 3QQ1A 3P7YA 5FF4A 1KLYA 3F03K 1THFD 4E0CA 3G3DA 1EX5A 1ZNNA 2PCQA 2ZRWA 4NVTA 4OGZA 3N14A 3WK3A 4LW7A 4CNNA 3S1VA 2GQAA 3GKFA 4H3DA 3VCRA 4UFKA 1HUVA 3QH2A 4X9SA 5G4EA 2BTMA 1JRCA 1WAUA 1J4EA 3TSDA 1DKWA 2ZRZA 1OYCA 3EX3A 1H7RA 3M9YA 4Z1BA 4RX0A 3CQ0A 3PAJA 4Y90A 4UCGA 5D2WA 5LNRA 2CW6A 3D0CA 2ZZ4A 2OX1A 3B8DA 2DORA 3W7CA 1VCVA 4LC8A 3BW4A 3TUUA 3L65A 4NU7A 4OT7A 2YYUA 1R2SA 3BLIA 3DZ1A 4HPXA 1XBZA 4MFEA 5G1TA 4JTUA 3GXTA 1AW1A 1FUYA 5BOOA 1C29A 1N55A 2X2GA 4JEQA 4U28A 3NQMA 4LV4A 3GNDA 3L0GA 3M41A 2ZRYA 1KM3A 3NZRA 1TPDA 1SU5A 1AK5A 3HG3A 4DO4A 1LP6A 1M7OA 4HSOA 5D04C 3SECA 4GJ1A 5EBUA 2Y7DA 5LSMA 5F2MA 1QDSA 3MJYA 1U83A 3LOTA 3INPA 4IX0A 2WNQA 1D3HA 1SO3A 3ABQA 4LVAA 4YCOA 1MSSA 3STFA 1AG1O 3SSJA 3M16A 3KFTA 2R14A 2ZTJA 1LROA 5KITA 2Z6JA 2BLEA 1BWKA 1JUEA 3LHYA 4PCFA 5E93A 3F4WA 4AF0B 3TE9A 1EUAA 4BFAA 1N7KA 3TDFA 3L66A 2AGKA 2ISSA 2E1DA 3DU0A 2CZFA 1TPVA 3B05A 1S3HA 3TJLA 2OZ0A 3W1TA 5DCDA 2ZA1A 3G22A 3LHVA 2DZXA 1DORA 1SW0A 5G5IA 5D05A 4ONVA 3LLFA 3I7RA 3HOJA 4Z0SA 2DZTA 4D2JA 2FPTA 3MI6A 1XCFA 4FHAA 4GUFA 3EX2A 3K30A 1SSDA 2JBMA 3W7OA 3OG3A 5L6UA 3TX9A 3EXSA 1AW2A 1X1OA 5D30A 1QO5A 3LBMA 4JTEA 4DF1A 1WX0A 3P5YA 3NEVA 4LS2A 4RLIA 4WX2A 1ICQA 3JR2A 2E5BA 4KFPA 3L0NA 4LV9A 3DFNA 3E12A 3SFKA 3CEUA 2HTMA 1O94A 4KKXA 4IGHA 1UBSA 5D03A 4FB7A 1VJIA 3TK7A 1G4EA 3WJYA 4CCEA 1YPIA 4DBEA 5D37A 4IQLA 3P80A 4AH7A 1W5NA 1DV7A 2FB3A 3HO8A 3DFQA 3O63A 4O13A 3E49A 2EHHA 4JY9A 5TIMA 5D2VA 3NXFA 1W5OA 4JIPA 2PURA 4L4LA 1W54A 2JKEA 3P81A 4A2SA 3O8AA 2C13A 5CKSA 3QM3A 4ZQRA 2FTPA 3NOEA 3DI0A 3KRZA 1YADA 5AOUA 4PTNA 2OT0A 1W3NA 3S42A 4X2RA 4Y96A 1ZALA 4NX5A 3QPYA 5CZJA 2FLIA 4MZ8A 5K3VA 1TV7A 1ZAJA 4S2BA 3V1PA 4POCA 3THAA 1EUNA 4KFOA 3W7RA 1KM5A 3G1VA 1TPB1 3C2OA 2WO5A 2QCGA 3MI3A 2TPSA 4XTIA 5SWUA 3T44A 4MUZA 4TO8A 4QISA 2J9ZA 2I14A 5FEXA 3UQNA 1BEUA 3UZJA 3W2UA 1LOSA 3PS7A 3N2MA 3W70A 3W23A 4JYEA 4HKPA 5HWNA 5KSWA 2H6RA 4MYAA 4Y8FA 1MXSA 4UR7A 2Y7EA 5BW6A 1GYLA 1R47A 2WKJA 4O17A 4NZFA 4E38A 2QCDA 3UY8A 3C52A 5HUOA 3L5LA 4A29A 1G7UA 1QR7A 3L67A 1ZY9A 2ABBA 2FQIA 1AW5A 3M5YA 2QUUA 1V7YA 5EMUA 5HWJA 1SW7A 5HQEA 1FY6A 3ZS4A 2WNNA 2W0UA 2B7QA 1VYPX 2JKAA 4FNPA 4S1FA 1OK4A 3KVLA 3BV4A 5CG7A 1OYAA 4Q4KA 2ISVA 4I7WA 2DU2A 3LRLA 3UXDA 3WFAA 1LLWA 3A5FA 1LZOA 3FJ6A 4LT9A 4UTJA 3WJSA 2W6RA 1Z41A 4LC6A 3O6DA 1F74A 2JKPA 1P5BA 5CPLA 2JGQA 3VFLA 2Z6IA 5G2HA 2DJLA 3HPSA 1SZGA 2YR1A 4ADSA 4MOZA 2KZHA 3L5MA 4TR9A 2AQWA 2RFGA 3STGA 4M19A 4PC8A 4K8EA 1F7BA 2QUVA 3HJZA 1G7VA 4QSHA 1H61A 4FIQA 1NFBA 3NL2A 3RNDA 4TMCA 5LGZA 3W7EA 4N4QA 3STCA 2CLOA 1FCQA 1EB3A 3B0VC 4UFLA 3TC6A 1JQXA 4NXKA 4M7SA 1KM1A 3VE9A 5F4WA 4AMAA 4JTSA 3P8IA 1H5YA 5DBUA 5FEZA 2Y61A 3MO7A 4ZQNA 4O18A 1LBLA 1FDYA 1OK6A 2QKFA 3W7JA 3M6YA 4K7YA 4XUGA 1KLZA 4PL1A 2GVJA 3R13A 3VNDA 3W1NA 4AWTA 2Y63A 1OFPA 3DXIA 4GUIA 3LX9A 1OX6A 1QO2A 4ZQOA 2C1HA 1H51A 1TJPA 2CLEA 5KZMA 1JRBA 5T26A 3M5VA 4O0ZA 2YCEA 3U8GA 2PRMA 3A9IA 4M6VA 3KVKA 1Z42A 1IF2A 2A7PA 1JCJA 3HGOA 2ZZ7A 3MHGA 4Q32A 1JCYA 3TNOA 3L9CA 1KTCA 3M1ZA 1RQEA 2JGYA 3GR7A 3ZFHA 1SZEA 3RF9A 4OE7A 4XTDA 3W71A 4UTHA 1I2OA 4FX6M 1GOXA 3EB2A 4UTWC 3G0UA 2OCZA 1W31A 2YFNA 2FPYA 3GKAA 1GQNA 4JIQA 4MJZA 4NNBA 3MHUA 4QITA 1NEYA 1EEPA 1IXNA 5KZDA 4XWUA 5DCBA 2TYSA 1ZAHA 1MEHA 4UTUA 2ZZ2A 3IVUA 4MPQA 3NNTA 4MJMA 4NXSA 3W7QA 3HBLA 1IIGA 3GAYA 2ZYFA 1MEWA 1FCUA 5J5RA 2H3DA 4RKAA 3W9ZA 3NQ6A 3NQAA 1XDLA 3G1HA 1A5BA 1TREA 2A5HA 1L6SA 3PB0A 3UXAA 2HSAA 4NT0A 6ALDA 1N8FA 3TW7A 4BK9A 3EX4A 2B7NA 2X1TA 1JCXA 2TSYA 1DJQA 3BGJA 4LVFA 3BLEA 3CHVA 2EGZA 3UWQA 1SZNA 2QEZA 1B3OA 1ICSA 3DGRA 4R34A 4RZ5A 2A6NA 1T96A 3OVPA 4M5PA 3W1MA 1OFQA 1XDMA 2BZNA 1W3TA 2GOUA 2QDHA 3W1PA 3TCEA 4JTTA 3LM7A 3G0SA 4QIUA 2Y62A 2PC4A 4CNPA 1YDOA 2BWGA 1IXOA 3NL6A 1C8VA 4K37A 3UD6A 5CSSA 2ZBTA 2VKZG 3EWZA 3LCGA 2IQTA 1AL8A 3W85A 3P60A 1K8XA 2RDWA 5HMSA 4O52A 4TX9A 1O95A 2NZLA 5K9DA 2DZUA 4GUJA 4RK8A 2H3BA 1HL2A 5D09A 2PRLA 1PVNA 1W5MA 3H53A 1LORA 3TU9A 2OMAA 3GYEA 3GVGA 3TAOA 1XFBA 2GJNA 3NM3A 2WQPA 5KTLA 5DBTA 3Q2DA 4QNWA 2XN0A 2VEPA 4O54A 1EP1A 3RLVA 3RU6A 1K7XA 4UR8A 3HGJA 2C14A 3M7WA 4E2DA 5AB3A 3I6RA 2ZZ6A 4FIRA 1YDVA 3USBA 1TIMA 2J9YA 4JICA 3SZ8A 1ZFJA 1YLVA 3W7GA 3FS2A 4NNAA 1Q6OA 2V2CA 3QF0A 1VYRA 5K2ZA 5HR7A 2W79A 4WY0A 5L9FA 1FQ0A 1FDZA 1ML1A 3N9RA 1RQHA 2C16A 2HS8A 5ABTA 3T40A 1ME8A 2QJIA 4MY1A 4UTTA 5D33A 1AMKA 4I9AA 2ZZ3A 1YXCA 3A22A 3IIOA 3GNNA 3O07A 3W7PA 3SW6A 4O14A 5CPMA 4P61A 4IPIA 3P5ZA 3P84A 4ZQMA 2A1YA 3LB0A 2A7RA 1MEIA 2DZSA 4FO4A 1G4SA 1OX4A 3WK2A 1GG0A 3MBFA 1D9EA 3NQ8A 3MMTA 1WV2A 1WQ5A 1GG1A 4ORMA 1H62A 1O4UA 2NXGA 5TQLA 1P0NA 4LY8A 3TA6A 3V75A 3M0ZA 3A21A 2AAMA 2V2DA 2V0TA 3VKJA 3LLDA 4DPPA 3MYPA 4Z1DA 5KINA 2H90A 3PUOA 3S5ZA 4JY8A 4HNUA 3OVRA 4GWEA 1VS1A 3C61A 1LDCA 3SR7A 1ZJIA 3LV5A 2G97A 3BK0A 3M44A 4ICNA 4A21A 2CU0A 1A5SA 1CI1A 3OHIA 3PBUA 4UFIA 5EYWA 3NAVA 1KM0A 3PVFA 2WJZA 1XUZA 4MYXA 3GX9A 2QCNA 4WY0F 1OF8A 5A8GA 1QPRA 3LXAA 2GQ8A 2XN1A 3E9AA 2XN2A 3NQ2A 5H91A 5HR6A 3KRSA 2Q8ZA 3BG5A 4UMBA 3CM4A 4TU1A 3STEA 4A3UA 1TYGA 2I9EA 4IJBA 1JCNA 4HN4A 4MY8A 3UWUA 3FLUA 4XBKA 3G3MA 4WJEA 1WOAA 4PH6A 4MLJA 3MYOA 1WBHA 3IIXA 2C19A 2NX1A 4HT3A 3I7QA 1OF6A 1SFLA 3C0JA 3IRDA 3SGUA 3DAQA 2G5WA 1AL7A 3F4NA 1ALDA 3VI2A 3IGXA 3KHJA 4GBUA 4YMZA 1IXPA 1JULA 4MKNA 3LCIA 4O1BA 1GVFA 1I2PA 1I2QA 2VFFA 3ATZA 3FKRA 1VQTA 2V8ZA 4JTHA 1MO0A 1WA3A 1E51A 1GVRA 4WXZA 1I2NA 1BTMA 1JUBA 4Z1CA 1P1XA 1LOLA 1KV8A 3R5EA 3PULA 4K7VA 2Z1BA 1XXXA 3NG3A 1FXQA 2VOMA 3HG2A 4HIBA 2GVGA 3QYQA 2GJLA 3GLCA 2B7OA 3UZ5A 1VHCA 3R12A 1RQBA 2Y70A 1B4EA 3S6DA 4Z1AA 1L2UA 4AVFA 1VH7A 2E6YA 1S5VA 4FNRA 1OX5A 1ME9A 3PG9A 2ATMA 3TAKA 3TH6A 3A24A 4O53A 4EOUA 4WY0B 4N9EA 1EIXA 3PSWA 2NLIA 4R33A 4WOZA 3WJXA 5BMXA 2ZZ5A 3TMLA 1KFLA 5H2ZA 3LCFA 2V30A 4CCCA 1F2JA 1J5TA 2NX3A 4ADTA 5I3KA 2QF7A 1J2WA 4N6FA 3W6YA 1Y0EA 2YW4A
chains in the Genus database with same CATH superfamily
2EBNA 3FA3A 2FPVA 4ACZA 3C8FA 1Q7MA 4O28A 1W5PA 3S8HA 1VBGA 5LXXA 2QF8A 1Z9AA 2J27A 2O9PA 4GXWA 1GOKA 2GGEA 5F4XA 3C0LA 2E6FA 1BF6A 2DT2A 3KDOA 4PA8A 3UJEA 5J8LA 3PBYA 2OSYA 4P2VA 1RY8A 4DIAA 1V0LA 2XIJA 4MWAC 9XIAA 4HOXA 1RUSA 1LYXA 2EPNA 4D6EA 1SO4A 3NPUA 3WO8A 1PZ2A 3R4IA 4CQCA 4NI8A 3GY1A 1NM9A 3WEZA 4YXGA 1JFHA 1LLZA 1ZHAA 4IIFA 1KTNA 3RK8A 2O0TA 3BMWA 5H6HA 1WOBA 4XV0A 3UPBA 1DXIA 1VCGA 3GTNA 4P7RA 4AEOA 3K46A 2PE4A 3NA8A 1S2AA 1G5AA 2PF8A 3FA5A 5LIKX 3EX1A 3PAOA 4OFCA 2ALDA 2OWWA 1Z69A 2V5LA 4IMCA 1H49A 4GH3A 4M0XA 1FKWA 1PHQA 1O5QA 1Q6QA 4JTKA 2JIEA 2C15A 4ZODA 3V3WA 3B03A 3GUWA 2IXUA 4EWND 2WMIB 2CBUA 3TN4A 4OQVA 2HXTA 3R0KA 3GFXA 4AY8A 2Y0FA 5C2XA 5DANA 3P0WA 4AIUA 3C6CA 3BGGA 3RPTA 3PPHA 3DI1A 2PTDA 1F05A 8A3HA 4EVZA 1Q45A 4U5IA 1XIIA 3PUGA 2XSAA 3L4YA 3O2LA 2VZTA 5K7JA 5TBOA 3ZZ1A 3WLQA 1A5OC 3OEXA 3LRMA 4E5TA 1W9BM 3GAKA 4GFSA 1OABA 5E0CA 1WO2A 3WDRA 4NJHA 4KRUA 1JDFA 3FYYA 3B0PA 4QAIA 4PYSA 1WDPA 4EF8A 4YU1A 4LAOA 3MY9A 1V6UA 4P8UA 1XC4A 1GW1A 2VGBA 1TV5A 2V5KA 4H7CA 4CCDA 4D72A 2GDUA 2Y24A 2Z1VA 1IXQA 1YPFA 2RDXA 4JX4A 5BRQA 1JPKA 3IEBA 2ZX6A 3GHRA 2DEPA 1SJCA 1S2CA 4J3ZA 1GZJA 3WLRA 5A94A 1IYXA 3VCNA 4QLLA 1K02A 5D4YA 4ZFMA 1S5WA 4WQ6A 3ZR4A 5HOSA 5FF7A 2DP3A 3C2RA 1VYSX 1PDYA 2GVLA 3LHZA 4IMEA 2CCRA 3O15A 1OYBA 4P7NA 4UFMA 1WKFA 2VFIA 3D3FA 1R9XA 1KCLA 1QTWA 3BLOA 1U33A 3ABOA 3K8KA 4AD4A 3QW3A 5GJMA 4REQA 4JQAA 1V5XA 3BG9A 4GZJA 4Z42C 2WWCA 1TMHA 4NNCA 2NVDA 2X16A 4Q8MA 3E2VA 4XBSA 3BLFA 4L4MA 1OIMA 1OY0A 2Z2AA 3QV9A 1PUDA 4QR6A 4S3CA 5HJYA 1PX8A 3H2OA 2C18A 3RDKA 5E9AA 2P10A 1JZ6A 4GIYA 5G1MA 3UZXA 5C54A 4TVUA 1OB0A 1BVNP 4YNGA 3QEZA 3HJEA 3EDDA 1PTDA 4YHGA 4X22A 1OBAA 3B9AA 4FALA 5ABGA 3E74A 4JTDA 3OA3A 3N73A 2Z1XA 2QMJA 3GNOA 2PDQA 2XH7A 4TVDA 1SMDA 2H9AA 1O5KA 1UG6A 2P5NA 3R6IA 4J2MA 2OOGA 4V1YA 1GWJA 3NO5A 3GDRA 1AQMA 3W7MA 5I2UA 3CB3A 2F61A 4J28A 3T2PA 2E5DA 4ICMA 1KR0A 5CPOA 4KGJA 3F2CA 2BXVA 2ZDSA 4DI8A 3FXYA 5BROA 1R2TA 4EWJA 1XSJA 3CPGA 2DIEA 3DX5A 4U10A 5D2YA 5TD4A 3R1ZA 1EYWA 4IQEA 1DIEA 4PUJA 3TR2A 1YE6A 3NQGA 1AMYA 3B4UA 3PG8A 2G8ZA 3E0WA 4I9MA 4F0RA 1A50A 4LF2A 3RAOA 4K1GA 2E25A 4QXIA 3N34A 2EKCA 1CX9A 4O15A 3W7KA 2NT0A 3KVJA 3LHTA 3KZPA 4BQ3A 5GJPA 1QW9A 1P6CA 2E6DA 4UTKA 2VL4A 2Z1WA 3SCUA 2CPUA 4FNSA 4XBJA 4XK2A 4DJDA 1U5HA 3VIPA 2IMRA 2NUYA 2ZRUA 3IJ9A 5K9XA 3WQOA 3T78A 3SRDA 2Q02A 3AQUA 2QDEA 3ISIX 1BVZA 4CLMA 2CHNA 5DRIA 5EPDA 4DYEA 3ES8A 3K1GA 5HMEA 3BAXA 4BZYA 1VPYA 4B4FA 2HE5A 5K9CA 4A05A 5A2AA 1TE1A 3HPZA 1C7TA 4IGMA 3W2MA 1FP8A 4TTGA 1R0MA 4R9XA 5U4NA 4DLFA 4QM1A 3HMJG 4FP1A 4K1WA 2DY3A 3VC6A 3LDVA 3MTWA 1CGXA 3E0IA 1IWAA 3JZUA 2YFOA 4WKFA 1ZRQA 2Y8KA 1FCBA 1VZWA 1H0GA 3RX2A 3BDKA 2HJPA 5AECA 1RA0A 3AIUA 4DJFA 7REQA 1UWAA 2CBJA 4X9YA 2CETA 4HHLA 1H1ZA 2AQVA 4NSBA 4OU1A 1VIZA 3PZMA 2X09A 3VM5A 2OKTA 4P8VA 3OIXA 4MMWA 4YS1A 4XZBA 2CITA 3M47A 3LERA 3OU8A 4UC5A 5DLCA 1K9EA 4LNCA 2MUCA 4NX0A 1VJSA 5H8PA 3TYEA 4YPJA 1FXPA 1ZCOA 5AHMA 4O1CA 4PTVA 2EJ1A 3MT1A 3UJ2A 2Q3OA 4ML9A 1AQFA 2YA2A 1W91A 4HPGA 3KOYA 2HNEA 4GNJA 1CXLA 2WMGA 3EWWA 5AHFA 1TMQA 1P1MA 2A85A 2OWXA 2RHGA 3WUFA 1R85A 3CB8A 3OLIA 4NRSA 3KRUA 1KM2A 3CUZA 1WYIA 4UIOA 1R5YA 3VM7A 1KRMA 3L21A 3F4CA 4KIEA 1OG6A 2CLLA 1HVQA 3UWYA 2X0YA 3S2NA 2E7FA 4BKNA 4ERAA 1J0KA 1DWHM 1KM6A 4Q33A 3M5ZA 1OFAA 4UUIA 4R7OA 4IPJA 1S5TA 1XSKA 1DJXA 1JCMP 3TZNA 3C3NA 5AC5A 2ZZ1A 4K38A 5GPRA 1NQ6A 3RLUA 1KRBC 5DN1A 4CNUA 2XGIA 3S1XA 1XL9A 5DRCA 3O9NA 3IIZA 2G3FA 1Q4NX 1OIFA 2VENA 1RY0A 3TW6A 4OOUA 3EAUA 1F4HA 2BVTA 4IIGA 4DNHA 4G7EA 3WH8A 1UD6A 2YKKA 1G9HA 1NDZA 3NZ1A 1E3XA 3GXMA 4JPGA 1M5WA 5LNUA 1GHSA 1QHPA 3TC7A 1A5LC 1LWHA 3WSUA 3ERPA 3NZQA 5CSRA 4ZZ9A 4GI4A 1NF0A 3C8NA 2YX0A 2VGIA 3HQNA 2NUXA 1B3WA 3H2EA 2WSKA 1UKTA 5C2CA 4JX5A 3H4XA 3NVDA 2ZQ0A 3D47A 3EOLA 1TJRA 3T0CA 3H2NA 4JTLA 3AHVA 3K8LA 1UR9A 5EGRA 3E6EA 3H6OA 4QDMA 5AYYA 3WY1A 1S1RA 4ZMGA 4AZ5A 2OG9A 3GRIA 5JUVA 2VEMA 2XIQA 1H1YA 3S9YA 4OBSA 2J25A 3OZPA 3SUSA 5CG0A 3SFWA 1YNYA 4HGXA 4ALDA 1XYMA 1SUXA 1X7IA 1GQLA 1QXLA 1LTDA 1S5MA 4WDXA 4ZVJA 3A4WA 2QS8A 3CEPA 1CGTA 3CU2A 4J1OA 5C6MA 1QHOA 1SJBA 3R0DA 3QFEA 1R30A 4B4HA 3VIKA 2GUYA 1GVYA 1E9LA 3S2MA 2FMNA 3CZEA 3P74A 4Q7IA 3EDJA 4J9JA 3LPOA 1OFBA 2GJXA 4MY9A 1EX1A 4KWWA 1JNEA 1OD8A 2XVNA 4MDPA 2GQ9A 1JR1A 4CQ8A 2E8ZA 1BKSA 3HG5A 4YL2A 3N3MA 3NPWA 2V2HA 4FK9A 2C3ZA 4CQAA 2VELA 3GDLA 1PE1A 4HA1A 2DVUA 1OFRA 4RUBA 4ADUA 4ZB2A 4H9ZA 1SO5A 5I06A 3G1SA 3RHGA 2ZUWA 2GDVA 4HZ6A 1Q8AA 1MUWA 1PHWA 4GYFA 4DXVA 2I7GA 2PCEA 1NJJA 2QZRA 4J3SA 4NL1A 4AWUA 1NWTA 3NURA 4WD0A 2R1LA 4NQ1A 5A6MA 3MP4A 4NYYA 3AMCA 1JDCA 3SBFA 4ZSUA 3WYZA 2VFDA 3ABRA 1BVWA 4W9TA 2J47A 3ANVA 4CD6A 3RPMA 3VUSA 2BASA 1C93A 4O16A 1FX6A 1IWPA 3JRKA 2WZIA 1NH6A 3GXPA 4IFKA 3QZEA 1W9PA 2F84A 3S5NA 3WQEA 4JHZA 1W1PA 2JF7A 3B8TA 3THQA 3G1YA 3PPFA 3ITOA 1WZKA 3QV7A 1EIBA 1EO7A 1W56A 3MMDA 3KOWA 3I6TA 1PCKA 3BLKA 2HS6A 1QK2A 3CIVA 2QAFA 3U2OA 3SSZA 4W8BA 5EMJA 1RD6A 3H2MA 3OQ8A 2DPEA 7XIMA 1XBVA 4RNJA 4C6FA 4LS0A 3IARA 4C6DA 4S3EA 3KDNA 1RZMA 1UMYA 1RXOB 1FWAC 4C5YA 9RUBA 4O8RA 4Y6GA 2ZVRA 2P76A 4PMQA 1UOZA 4Q4PA 4RE0A 2EPHA 1A53A 1VEPA 3N2CA 3G8EA 4CD4A 1QFEA 4JDYA 4ROQA 4U2YA 3O06A 4MF4A 2WMJA 5T9CE 3TMQA 3UA3A 4B5WA 4JD4A 1HNYA 1A3HA 3P61A 4JIIX 1CENA 4RR4A 4KWVA 2WJFA 4OV4A 2YDAA 4QG6A 1XUUA 3L2MA 1UCWA 3EKLA 2G95A 2Z4GA 3WF3A 3T4WA 5IOBA 1G4TA 4IJCA 3DYMA 3SRFA 2DFAA 3BV7A 1P0EA 1VF8A 2YBTA 2OYMA 2CLIA 3M5XA 1JUKA 3P67A 5CH9A 1S46A 3M0HA 1Z48A 3C2EA 1K8YA 2IQDA 2WV8A 2HEJA 4OWGA 1IGWA 1W32A 4CD7A 1JGIA 1VPXA 5FEPA 1NELA 5XIAA 4F48A 1K6AA 5I3DA 1XLKA 3GZAA 3GG1A 3HGRA 3DBNA 3E96A 4NILA 3FEMA 3PFMA 3AI0A 5AYXA 4OECA 3OW1A 2WC3A 3UR5A 4EE9A 3SCQA 3U7VA 3W25A 3PN8A 4FX8A 3NQ7A 1V51A 4M7TA 2VGGA 2G3NA 3PM6A 3OGSA 1G0CA 1Z32X 5CGQA 1Y7VA 3DHDA 1JF6A 3HB9A 2I5GA 3AXXA 1OWQA 2NT1A 3CPUA 1PB0A 4ZOBA 1FWDC 4O19A 3AWNA 2DZAA 3RMJA 4MZYA 3P2VA 3RR1A 3P14A 5CZTA 2CESA 3GQYA 3P7YA 1THFD 2BMBA 3G3DA 3PBGA 2PCQA 3W4RA 5HA7A 5A69A 5DT5A 2JEPA 1XYBA 4J5NA 2FYMA 3OZYA 5HATA 2BTMA 2TAAA 3K13A 2J13A 1JRCA 3SUVA 1WAUA 1J4EA 1M65A 4FXJA 2G4FA 2ZRZA 1KCZA 1I1XA 3W0KA 3MVTA 1B3XA 2J6VA 5EMKA 3N4AA 4ZFCA 4CN1A 1BF2A 1K9FA 3ARVA 1Q8JA 2PTWA 1VCVA 3BW4A 5HQLA 3S5SA 4LCSA 4GK8A 4J3UA 2JF6A 4OT7A 2YYUA 1U30A 5EB8A 4DXKA 1R2SA 1X1NA 1XBZA 4MFEA 4HYRA 1V3IA 1TWDA 4JTUA 4C5ZA 1FUYA 5BOOA 2XFYA 3N12A 1WDRA 4GQBA 4U28A 4CKQA 1G1YA 3WN6A 3L0GA 1EQPA 1KM3A 1E5JA 4NZ5A 4HSOA 5D04C 5EBUA 5DF0A 4RNIA 4IIBA 4Q7NA 3MJYA 6REQA 4IX0A 2IKHA 3ABQA 2GYIA 3SCTA 1QNRA 3KFTA 2R14A 2ZTJA 5I00A 2CWXA 4PTXA 1BWKA 2YA0A 2NW0A 1B1YA 1VFLA 1PYMA 4XG1A 5HXMA 1LQAA 1N7KA 2WKGA 3G6LA 2BY1A 2AGKA 3DU0A 2HCVA 3SURA 1CEOA 3BMVA 3QV6A 1DWJM 5DCDA 2DZXA 3KRBA 1DORA 2Y1HA 3LLFA 4Z0SA 1UHVA 2FPTA 3FSTA 2Q8XA 2GL5A 1J6OA 3EX2A 4ZXOA 3K30A 1XIHA 2UY4A 4OBRA 4G5DA 3AWOA 1CB7B 3JW7A 3OG3A 2WBKA 5L6UA 1AW2A 1QO5A 3LBMA 4JTEA 3EPNA 4V33A 2WANA 5DEZA 1F3XA 4BQ4A 3CEUA 3IJDA 4KKXA 1ZJAA 1CLVA 1UBSA 4IPPA 1Y65A 5LIYX 5D03A 3TYZA 1GCYA 4Q8PA 1X8CA 4DBEA 2HQAA 3IJ7A 4IQLA 4AH7A 1W5NA 1DV7A 3HO8A 4MB4A 3O63A 1ZS2A 4FA3A 3GH4A 1ADSA 4JIPA 1HJWA 4WLCA 3UVAA 4M6UA 1ONEA 2CHRA 1VBJA 2Y4SA 3BE7A 3EPOA 4X63A 4PMYA 3MS8A 2J79A 4PTNA 4CVUA 4DWSB 1W3NA 1B90A 4X2RA 2PB1A 4Y96A 4PRTA 4JNYA 4NX5A 3QPYA 2WMKA 1FHUA 4QG8A 2FLIA 3VIFA 3QLDA 5K3VA 4E8DA 3LNPA 4S2BA 4BHYA 4POCA 3G1VA 3B97A 3VKDA 2IPJA 2E9MA 2WO5A 2IPFA 3PTDA 5I24A 2TPSA 3DYPA 2I14A 1M68A 3UQNA 3UZJA 3RN6A 1LOSA 3PS7A 5A6JA 3W70A 4JYEA 4KQNA 5HWNA 2A3LA 1Q7ZA 2H6RA 3CQIA 2ASHA 3UBPC 4DHGA 1RJQA 1FFRA 4O17A 1XIMA 2QCDA 1S38A 3NDYA 2OSWA 2PGFA 1QR7A 4C6PA 3FK4A 2V67A 4WDWA 3L67A 1GQJA 1RAKA 1N8IA 5CJ5A 1D7FA 3BCFA 4DBUA 1EJTC 1AW5A 5HWJA 4A8NA 4AU0A 3GTHA 1BG4A 3ME3A 1FY6A 3T2QA 2WNNA 1DJYA 4FNPA 5BYWA 5HMDA 3BV4A 4GZEA 2XGBA 4Q4KA 2PPGA 2OOFA 2ISVA 3AAMA 4I7WA 2DU2A 3FA4A 3QGVA 3SCPA 1HXJA 2D69A 1AZ1A 5JH2A 3HPAA 4NI3A 4LH8A 1R3YA 4K2SA 5LXEA 3VFLA 2JGQA 2IUZA 3L5MA 4TR9A 2RFGA 3KBNA 3Q4DA 3KBWA 2VCAA 4K8EA 3VD7A 1F7BA 2PDNA 2QUVA 1G7VA 1H61A 1OCQA 1IHIA 4EAMA 1MFUA 3RNDA 3RXZA 1MI3A 5LGZA 3WLIA 4N4QA 1FCQA 2YCKX 1M7XA 3OLDA 4M7SA 3R0UA 3VE9A 3GWQA 5FA5A 4JTSA 3P8IA 3R79A 4M56A 2R1PA 1B54A 3OO2A 4OKDA 2ZX7A 2J8TA 2NLYA 3W7JA 1V79A 4XUGA 2GVJA 3G2GA 3R13A 4AWTA 2VO5A 1S2WA 1DJHA 3GDBA 2XHYA 1QO2A 4ZQOA 2PWUA 1HT6A 2PGWA 3ZLHA 2CLEA 1TX0A 1CGUA 2YCEA 4LSBA 5CXPA 4R85A 3WQPA 1Z42A 3GC4A 4FI4A 2WCAA 2ZZ7A 2CZVA 2CEQA 1JCYA 1ADDA 4AISA 4V2XA 3PPGA 1HZYA 2EPKX 4OE7A 4L5ZA 1I2OA 4FX6M 3RLHA 4KETA 3WBEA 3WLTA 3GU1A 4UTWC 1W31A 2YFNA 3GKAA 4IL0A 3WNMA 4MJZA 5M03A 3MHUA 1UJQA 4B5VA 4QITA 4CD5A 4ENLA 1ITXA 5KZDA 4GXPA 1CDGA 5CC3A 1MEHA 4UTUA 1DWFM 3NNTA 4MJMA 2IPWA 3W7QA 3HBLA 3ZVIA 2ZYFA 4V15A 4XO6A 1XKJA 3DGBA 4RKAA 4PMNA 1MMFA 5REQA 1E4NA 3PB0A 2HSAA 1P6BA 4MNJA 2PDHA 4GPNA 4BK9A 3EX4A 4Q8VA 5I77A 1EQCA 3BGJA 2TSYA 1DJQA 4QSFA 1AJZA 3CHVA 3PTMA 3VNIA 1ICSA 3MB9A 1XRTA 4RZ5A 4DXXA 3VYLA 4M5PA 3FNDA 3FGCB 3T0AA 2YCLB 3W1MA 1XDMA 1W3TA 2QDHA 4JFTA 3TCEA 2VGFA 3CZJA 2Y62A 5FJOA 1KWKA 3NL6A 3T07A 1E6XM 1GORA 3EWDA 5CSSA 3AYSA 2BY0A 2VRJA 3UD6A 1I60A 3VVGA 3EWZA 3LCGA 3UZYA 3W85A 1VFUA 1K9TA 4IT1A 1RVKA 4TX9A 4GUJA 1FVPA 5D09A 1LORA 1ELSA 3QHMA 3GYEA 3TAOA 2GJNA 5DBTA 4QNWA 4C6EA 4H6EA 4UR8A 3GVQA 1GW9A 3I6RA 2PF0A 4FIRA 2CXEA 3VD5A 3WG6A 1TIMA 1V8EA 1MQPA 1ZFJA 1YLVA 5C9UA 3MQTA 3W7GA 4NY2A 1Q6OA 2V2CA 3QF0A 3T6CA 4YVPA 4NZ3A 1R3SA 2OKOA 1GJWA 1H1NA 1H4PA 1LJYA 1ML1A 3N9RA 1RQHA 2F6UA 3NZGA 5J04A 2HS8A 4UQDA 5ABTA 3LU2A 2VWTA 1JCTA 1MNSA 3TYAA 4H9UA 3AIRA 1ISWA 4GMEA 4I9AA 1UMLA 5E6ZA 3AIQA 3FDGA 1PTAA 2OFJA 3SW6A 1WPCA 3CV7A 3EZ4A 1EC9A 4ZQMA 5C8BB 4HB7A 2REQA 1YPXA 3NQ8A 3PNUA 4Y9OA 1P48A 6CGTA 2A79A 3C86A 3U5UA 3WBXA 3CYJA 4KGLA 1ZPTA 4Z1DA 3B9OA 2GQ3A 3A13A 4UZUA 3GG0A 2XSBA 1UROA 4H2HA 4QGCA 1N82A 2E3ZA 3ZVHB 3N1AA 3SIMA 3TTQA 1MYRA 3NSXA 2FZ8A 4PB4A 2NQ9A 1CBGA 3PBUA 4UFIA 3NAVA 4XAGA 4PGLA 3HM7A 3BURA 1XP3A 4X2PA 3F2DA 3WNNA 3NJ3A 4MYXA 1UD3A 2QCNA 5FAJA 1P7TB 4XZMX 1YIXA 4DB7A 3LXAA 4WSKA 4RDYA 3HA1A 2XN1A 3E9AA 3NQ2A 4CVWA 5RUBA 5HNNA 4OVXA 3QQWA 4UMBA 3CM4A 1XX1A 4DUVA 5BU9A 4HN4A 4FR6A 4XBKA 1KB3A 3G3MA 4JNZA 4WRHA 4Y9NA 4S3DA 2WMIA 1MUCA 4UQEA 2C19A 1SFLA 3C0JA 3GVRA 3SGUA 3APYA 1W9XA 4H7ZA 5CSUA 1XCWA 3CUXA 4GACA 3IGXA 4GBUA 5HBFA 5XIMA 1W3HA 2FHBA 4MKNA 3LCIA 4O1BA 1GVFA 3OQEA 1I2QA 2I56A 4R88A 1WA3A 4WXZA 3S9ZA 1P1XA 3I3DA 4MNLA 2Z1BA 4GNVA 4M1RA 1XXXA 5IXEA 3QV8A 3HG2A 3UEQA 1UR4A 2GVGA 1PJ9A 2GJLA 4YTQA 4MM1A 6TAAA 1RQBA 4AD3A 1B4EA 1L2UA 2YB1A 2E6YA 4GQQA 5CAHA 3ARQA 2C79A 1ME9A 3TAKA 3NCOA 3L2LA 3TH6A 1WZLA 2QIIA 1UR1A 5A8PA 2HV5A 4G8TA 4N9EA 3PSWA 4S38A 2NLIA 2XZ9A 3AZTA 1CPUA 4R33A 3WJXA 4MB5A 3U9IA 2ZZ5A 1QNPA 5CPQA 4K68A 2QF7A 1Y0EA 3URNA 3OYXA 5DMLA 1KA9F 1Q65A 2D2OA 1JYXA 3VOCA 4CGTA 3VOFA 2INEA 3MHFA 3WX7A 2UY5A 2O55A 4GLEA 3V0SA 1XRSA 4DELA 2FFCA 3EXRA 3KAOA 3B3DA 1EJWC 7ENLA 4RW3A 4GUGA 1BWLA 3OIHA 1I45A 4LYRA 4G9PA 6ENLA 2YCIX 4R7JA 2GK1A 3ABSA 8CGTA 1KBIA 1FHLA 3NPVA 4LVBA 4EXQA 1QW7A 1VHNA 5HUPA 2R94A 1XG3A 4DO7A 1UP0A 4WOQA 2FKPA 1HG3A 4ACYA 3G0XA 1F73A 2AQOA 3BL3A 3COTA 3AMKA 4I3GA 2ZE3A 4DM2A 4H2CA 2ZXAA 4XSMA 1BPLB 1W1VA 2VDHA 5TF0A 1MZHA 2Z27A 4LRSA 3ZT5A 4NZ1A 3PFRA 3CTTA 3L2IA 5C9XA 4QG9A 2ATSA 3T0DA 1VLIA 3HMCA 1JZ7A 4HMCA 2BODX 2GGGA 4CQBA 5FSEC 5JXQA 5FJIA 3EB3A 3GE7A 1PL9A 2ZWZA 1XLMA 3W1LA 2BOFX 1VFHA 4Q8NA 3VE7A 3KM8A 1KFCA 2AOSA 3ATYA 1QOPA 1GVEA 4D6JA 4JIHA 1U1JA 3VOIA 1TWIA 2VFHA 4GE8A 3VA8A 3GW3A 1POJA 4IUOA 1XRFA 2VR4A 2HVOA 3AS2A 3VNLA 3I68A 4O11A 3LHUA 1GKQA 3R8RA 1DIDA 3MP5A 4XKYA 4YWIA 4WDTA 3R94A 2YLAA 1HO1A 3MUY1 5C5YA 3U5YA 1ENUA 1R2RA 1PCWA 1FOBA 2X1IA 1ZTVA 1EWEA 4BEQA 3MDWA 2J7HA 1JDDA 1BHGA 3SAZA 1E0VA 2A4AA 3TFXA 5D2XA 2FZDA 4BI6A 4B90A 3W87A 4X0NA 4CEXC 3LEPA 4U4MA 4JX6A 1VFSA 2VFEA 1D3GA 2CLMA 4AMCA 4JFSA 4H19A 4LUYA 3CZKA 4FNTA 4PTDA 3TXVA 3LCXA 1Q6RA 3UR8A 1X97A 1XPYA 4AIEA 5GNZA 3L4UA 5E5CA 3DECA 4GO9A 2WHMA 2PFHA 2OEJA 5BNKA 4QP0A 5AHLA 3ARXA 1YMYA 1MDRA 5A6BA 2QXWA 4EP8C 3UETA 4JKMA 1GQIA 2QR6A 3SCWA 4GCXA 1EH9A 3PWAA 1NAL1 4C1NA 5BXPA 3C0SA 1O66A 1QPOA 2D73A 4WKHA 1JYVA 3PF3A 3F1QA 4GIEA 4D1IA 3IRSA 3QXBA 3G1AA 4Q4OA 4IX2A 4PCNA 3E5BA 1DYSA 3IAQA 3LA4A 4AHOA 2GGJA 3OZOA 3AU2A 2ZC1A 3SY8A 2I17A 4AD0A 3T8LA 2CYGA 4UQAA 3VGBA 1E3ZA 2H8XA 1W1TA 4RXFA 3BWWA 4BQ5A 5HQMA 4JTQA 1TJ0A 2DW7A 1V6VA 4AG0A 2DT3A 4BCEA 1PKLA 4RDVA 3WQCA 1RBOB 4K6AA 1BYBA 2X40A 1PYFA 4XAYA 1NQKA 4S3BA 4JQ1A 4MNMA 3V4BA 3WEOA 4A4AA 3VMOA 1UP2A 3IWPA 3PNZA 5AZ1A 2VEKA 1FWHC 4L4PA 5FL1A 1L8NA 5I09A 3QMRA 3SCVA 1CW2A 4GGBA 4TUFA 3W07A 2AAAA 5LIUX 3I3BA 3PB2A 4U33A 1W3JA 4N9CA 5BZAA 1QVBA 2F9RA 4JFUA 3DEQA 1BLIA 1J2BA 1MXDA 4WZHA 1UR2A 1X96A 3LTYA 4JTIA 1OJXA 4U5KA 4ICCX 4CNSA 1GOWA 3VNKA 1TPWA 3TJIA 4ZSTA 4QAWA 3LK6A 5D8ZA 4WF7A 1SGJA 2GVYA 1V02A 4S3GA 4B16A 4HU3A 1O12A 4EPBC 3HG4A 2V9DA 3DHPA 4E2VA 1LRQA 3IPWA 3MZNA 4UFHA 4WIWA 2DSZA 3DKJA 3ARYA 3ZJ7A 4GVGA 2BVWA 3HTWA 1TE6A 4Q8TA 1PIIA 1QBBA 5LKYA 1ICPA 4XVEA 3QTPA 3TSBA 4ECLA 3SI9A 1GVQA 1AFSA 2P1FA 1H63A 1D3CA 3RCNA 4UTMA 4KS0A 3HQ1A 1NDYA 2J6XA 3VILA 1M6JA 4MVAA 3UZWA 4LEFA 2V3EA 2PDWA 4MAVA 1PZ0A 1KQYA 4WSJA 1S3TC 3MKCA 3A9BA 1XYCA 2V5BA 1GVIA 1LL7A 3I10A 1WXYA 3UCQA 1KQZA 4PFMA 4C1LA 2BXZA 5AHEA 3IGSA 1EA0A 4NZ4A 1DE6A 4YLWA 2GSHA 3RLGA 4RDZA 3NQBA 1FKXA 3QC3A 2SFPA 4IP5A 3REQB 2IW0A 2ZRXA 1UR0A 7ODCA 1H7XA 4PZVA 2QCLA 2POTA 3LTPA 4Q4RA 2QPXA 2JIWA 1M53A 2YW3A 2QJJA 4UWMA 3LN3A 1DIOA 1UWUA 4ML4A 4TVCA 2EXOA 4QS6A 1Q85A 4HMEA 4MB3A 4LEQA 1UH2A 2Y89A 5DELA 4LVDA 9XIMA 1SSGA 3W7DA 5FEWA 2YDQA 1P0BA 1QPQA 4W88A 3D3AA 4Q8QA 1B4KA 4UOQA 3EWXA 1FWWA 3WUGA 4GG9A 2PWVA 3VGHA 3L4ZA 1UIOA 1XQLA 3ID7A 1NVMA 2XFWA 1JPMA 4JR5A 3AIBA 1C7SA 5F4SA 2WCSA 1EJRC 3P3BA 3MSDA 2VXNA 4U2ZA 3QJAA 2VZVA 2OSXA 4IUGA 2ZTKA 3LUTA 3XISA 2XUCA 2QCCA 7TAAA 1UKOA 1Z3NA 3HQOA 2V82A 5CJNA 5H8UA 3XINA 2ANUA 3SY1A 3I65A 3S1UA 1PZ3A 3PUDA 4AHPA 1PZ1A 2QJHA 3FFSA 3S46A 4KERA 2ZRVA 3T42A 1LRNA 2WC7A 5LNVA 4E2BA 1ISYA 1E4LA 3G6MA 3TCSA 3H4WA 3G1RA 4UNIA 4QJ3B 4UOJA 4GX9A 3QZ6A 5D02A 1Q2SA 4I8YA 4H1ZA 2P8CA 4WDUA 3KS5A 1ZJBA 4LBRA 5GNXA 4XD6A 2BSLA 3LZ3A 1LL4A 1I0DA 5C9WA 4LTSA 3AUJA 4LALA 3O6CA 4CUCA 2CFFA 2YDSA 2VD8A 2A2IA 4EPDC 1TX2A 2DSWA 2OU4A 3GUGA 2VX6A 4AX6A 4JAWA 1AD4A 5LIXX 3M43A 4PMVA 4HPHA 3TYCA 3GR8A 1YE4A 1T0OA 1KKRA 1J0YA 1HX0A 1PSCA 3GTIA 2X0SA 1YEYA 2ZXBA 2QJGA 3F5JA 4O12A 4S3AA 4XIMA 3WF4A 3CAQA 1B9BA 5DXYA 1E5NA 3MW7A 1K03A 1US2A 4YTRA 3JZEA 3UG8A 2F2KA 1JD9A 5A6LA 4US5A 3W26A 4JZ5A 5FJRA 1WUEA 2D2HA 1K7EA 3N18A 1TSIA 1OEPA 3TTSA 5CGMA 2DT1A 2DZWA 2V5JA 5LHFA 4BS0A 4XQ6A 4A8RA 3WMSA 4Y9MA 1K70A 1R3RA 4Q4SA 3MZ2A 2Q8LA 1PKMA 5FSDC 2Y5EA 3QRHA 1GHRA 2WW5A 1EJSC 2XG9A 2QGHA 1O1ZA 2DH3A 4E4PA 5I5RA 1V93A 1J5SA 3NM1A 2QVNA 3PR2A 5D9OA 2J7CA 4F0HA 4XUYA 1RJPA 3MC5A 2QCFA 4D6DA 1E72M 1RH9A 3N9SA 5AC6A 1X8FA 4HP5A 2NV2A 4CNOA 1MZRA 2WHLA 2NWSA 3N2TA 2PDXA 3NDOA 1PWMA 3BH4A 4S39A 2PDPA 4MB1A 3ZJ6A 2Y7FA 1UPPA 1B3VA 4JHMA 5HJXA 3TLLA 1E6PA 3SN1A 3SRHA 1YDYA 1W1IE 5D32A 1KBJA 3HFTA 3EMCA 1Z6KA 4FPSA 1WUFA 3SUUA 1EXBA 3CMGA 1ADOA 2BVDA 1VFFA 4GIRA 3H54A 4BI5A 4NJKA 3UWVA 1KCXA 1UKQA 2W5FA 5EA9A 2VC7A 4GUHA 1TPUA 2FGZA 1XF0A 1W0MA 1VFTA 3LV6A 3Q65A 5E09A 2JEQA 5EKYA 2W67A 3A3HA 3W24A 4F0KA 3QHOA 1DQXA 4DBDA 4J2PA 4MWAD 2CLPA 2PBGA 2O9OA 4WVXA 1J9YA 3MUIA 4GRSA 1HJUA 1X6UA 5CPTA 4JTGA 5H1WA 1JDEA 2R24A 4FEZA 1NOWA 1W37A 4ZTXA 5EU9A 3K8MA 1EOMA 5A8MA 1RD5A 1A5CA 4A8LA 1G67A 3IK2A 3O6YX 1J0JA 1TJ2A 5E0KA 1QHZA 3DFPA 3KOFA 5JIWA 1EZWA 1SQ7A 3MSYA 4A3RA 5I3FA 4LX4A 4QDWA 2FHCA 1T40A 3EEGA 3SUWA 3TROA 1VRDA 1HGWA 1JZ5A 5B7YA 5I3JA 3UERA 3C4UA 3EA1A 3QC0A 2PP0A 4ATWA 2RJHA 3APTA 3W73A 4EXAA 2WC4A 5CJMA 1EP3A 3CGTA 3YPIA 3V18A 2BB0A 5CPNA 2V81A 3DHUA 3W1AA 1LT8A 2QCMA 2ZUNA 1VGAA 1IR2A 4NYUA 3T1GA 5F2LA 3P8JA 1UC4A 3E38A 3PZUA 4ZE4A 4PRWA 1QATA 3W74A 3VDGA 3U4FA 1K7FA 3BO9A 4JTFA 4IMDA 4L56A 2P3EA 2WSYA 2OZ3A 2QMKA 4H9TA 2F38A 5F1VA 4XD3A 2MNRA 2WSPA 2C1GA 2DQWA 4I9TA 2G4JA 3HPXA 5C7HA 3EDFA 4AB4A 3A23A 3UXIA 3QFWA 1UQYA 2BX7A 2OEKA 3W2LA 4BI7A 1NWRA 5T91A 2OJPA 1MWOA 1UYQA 1YBQA 1EA9C 2C91A 2O56A 3HURA 2TMDA 1I4NA 4R9OA 1O68A 4ZO9A 3CWNA 3QKEA 4GQRA 4I5UA 3URAA 1W8GA 3CK5A 1PIFA 4H6KA 1R86A 1RCOB 2W91A 3SRKA 2OT1A 5T9BG 4CQ9A 4A8IA 1ODZA 1IEXA 1EGMA 3TQPA 1F6PA 1JPIA 3C5QA 1EJVC 3CAKA 4DWDA 4HYWA 1U1UA 4RJEA 4ASTA 2CLFA 3TJXA 3MKKA 5FL0A 1D7KA 3H2FA 2HNHA 3M0VA 4DN1A 3XIMA 5G4HC 4YTSA 2C0AA 2QV5A 3WF1A 2QDGA 3BAYA 1D8WA 2QPSA 4EK7A 1QNOA 3CMJA 4EF9A 3JUGA 4M24A 2WJDA 2PAJA 2RUSA 1CXHA 1UWQA 3HIJA 4FNQA 1E4MM 3Q58A 3ONCA 1UZDA 3EX6A 4FR1A 1VJZA 2PA6A 1SJAA 1GNXA 1GEQA 2INFA 2QT3A 3B06A 2WVSA 3IS4A 2ZUVA 5C7VA 3MVIA 3WK0A 1X7FA 3Q37A 3QQ1A 1HP5A 2ZRWA 4H04A 2DGAA 3BSGA 4DWSA 2PP3A 2IKIA 5JBFA 2GQAA 3KZSA 1POKA 4H3DA 3VCRA 4EPEC 4UFKA 1X6NA 4PFHA 1CXKA 1HUVA 4GZIA 3QH2A 4X9SA 4REQB 1P0DA 1EYEA 1DKWA 3EX3A 1OYCA 4Z1BA 1H7RA 1ISXA 1Q63A 2RGMA 3PAJA 3VGEA 2YA1A 4Y90A 4UCGA 4LAKA 5D2WA 2CW6A 3D0CA 2OX1A 2DORA 2QYGA 3TUUA 3RCYA 1HJQA 2XFRA 1BQCA 2R1MA 2XDFA 3BLIA 1BGAA 5I23A 5G1TA 1AW1A 1N55A 4W8AA 1HVXA 3M41A 1F3EA 2A3BA 1SU5A 1AK5A 4DO4A 1LP6A 4AYGA 1UQZA 1GKRA 1E70M 2H9AB 1FHVA 4GJ1A 5D8WA 1J10A 3GBDA 5F2MA 1QDSA 1U83A 1ONWA 2WNQA 1SO3A 2BG5A 4YCOA 4LVAA 3STFA 2UBPC 1AG1O 1C91A 2QVHA 4BA0A 4FMVA 1LROA 1AH4A 1JUEA 3AMGA 4PCFA 2ZUTA 3UU0A 5E93A 4RPQA 2HPIA 4AF0B 1ZJHA 1EUAA 1EEXA 2GWGA 3TDFA 2P3ZA 1KWGA 2ISSA 2E1DA 2BXYA 4RNHA 3B05A 2HPMA 2XSXA 1Q6FA 2C8NA 2WZHA 1S3HA 3TJLA 3WELA 1J96A 3W1TA 3LHVA 3WD3A 8RUCA 1SW0A 4LUTB 3I7RA 3HOJA 2WBGA 4GKLA 1I1WA 4D2JA 2DDXA 4DJFD 1AH0A 2GSEA 3AISA 2JBMA 2OX4A 3TX9A 3EYPA 3UT0A 3BLLA 2YB4A 1G94A 4QJ4B 3AALA 3NEVA 3K4AA 4BF7A 4HHMA 2P50A 2HZGA 3L0NA 4LV9A 1XSIA 1EJUC 3SFKA 2D0HA 2YDRA 4IGHA 4MSSA 3LGDA 1JPHA 1U2YA 5CBBA 1IV8A 4YHEA 4ZBCA 4MAZA 1YPIA 4H9MA 3P80A 2FB3A 2G37A 1M04A 3E49A 3ARSA 2EHHA 2ZICA 4JY9A 3VD4A 3W01A 3WUEA 1GQKA 3BXWA 4L4LA 4A2SA 3R11A 5CKSA 5LIWX 3AHTA 3H21A 3QBUA 3DI0A 3TWBA 4I8DA 5CPSA 1TV2A 2VUNA 2QW5A 3WNLA 3LBOA 1OZMA 5B80A 1V6TA 2J66A 1E43A 5CZJA 3QGKC 4LYQA 1QNQA 2OR2A 3CH9A 3W7RA 4K8GA 1KM5A 3C2OA 5KETA 4GVHA 1PDZA 1A47A 1SFSA 5SWUA 3M0KA 4TO8A 4QISA 5I03A 5FEXA 1BEUA 5IDIA 4KCVA 3W2UA 4KBXA 3N2MA 1FWIC 2D3NA 7REQB 3EOUA 4UR7A 1GYLA 3KBVA 2WKJA 4QLKA 3L5LA 4A29A 2R1KA 4DJEC 1FFQA 3VO0A 1OM0A 3FY1A 1UH4A 1CXFA 3M5YA 2VX7A 1V7YA 3N9KA 1SFTA 4LJ3A 5HQEA 4C60A 3VIIA 4MWAA 3ZS4A 1S1PA 2OXNA 2B7QA 1VYPX 4S1FA 4KPLA 2FTYA 3KVLA 3VIMA 5D9PA 3OG2A 3ZLGA 3E0VA 1LQ0A 1OYAA 4MHBA 4GYJA 3UXDA 4H6RA 4MTVA 3D46A 3EDEA 3A5FA 1LZOA 1JF5A 5ABFB 3CL7A 1F74A 2CNCA 1P5BA 3AJ7A 5MKGB 2HXUA 3IAPA 3HPSA 3S2CA 2YR1A 4ADSA 2KZHA 1NY1A 4DJEA 1RSCA 2CHOA 4N0RA 5CGTA 4F2TA 3KCJA 3POCA 4FIQA 1IR1A 2FHFA 3DYOA 5I7GA 3TTEA 1UWSA 1M41A 1DTNA 3BSHA 2DT0A 3STCA 3B8UA 1EB3A 4D6CA 5IRPA 1JQXA 4I90A 4NXKA 4LCQA 5F4WA 4AMAA 1GK8A 4ZQNA 4O18A 1CECA 3PZ9A 1N8WA 1LBLA 3CUJA 3B4YA 1KLZA 4AVNA 4AEFA 1KCKA 1RCXB 2PGRA 4A3HA 3EKGA 1XLGA 4GIAA 4KRTA 2C1HA 1H51A 1KO0A 5T26A 3U8GA 4M6VA 1XLEA 4G7EB 1IF2A 1JCJA 3GVWA 3TN3A 4TV5A 1B3ZA 4EXBA 4LQ1A 3RMEA 4OZOA 4H6QA 1UA7A 2DW6A 1KTCA 4AX7A 1W2VA 2VQUA 1RQEA 3GC2A 2D0GA 3H22A 3KBJA 3ZFHA 4AC7C 4A6GA 2YL5A 3WH7A 4UTHA 1DP0A 1ZBVA 1YKWA 1EGZA 4IIHA 3ZVHA 1NEYA 3CH0A 3A4AA 4XWUA 2TYSA 4MPQA 1CGYA 1EDGA 4NXSA 1R7OA 1RJRA 1US3A 3OB8A 2P88A 3FAXA 4HA3A 2ACRA 2H3DA 1P7TA 3L4TA 1A5BA 3GIQA 4Q8UA 2CBIA 1KKOA 1GUVA 3TW7A 4LVFA 3BLEA 3S6OA 3UWQA 4F0SA 1XCXA 4C91A 4QDPA 3DGRA 2A6NA 1T96A 3VMNA 4L1XA 2BZNA 4ZTYA 1NDVA 1TG7A 3S47A 2F2HA 4IM4A 3GNXA 3ZT7A 3UXLA 2AKMA 4JTTA 3MPGA 2PC4A 2GZXA 1C8VA 4YWSA 1VKFA 4JIRA 4DUWA 1HKIA 2VKZG 1AL8A 4QE5A 2PUZA 4QROA 4Q4QA 1K8XA 3GBEA 1QWKA 1ZCCA 3RILA 2NZLA 3E2RA 2WCGA 1W5MA 4UQCA 2VMFA 3VNJA 5DFAA 1XFBA 3NM3A 4HOWA 2VEPA 4O54A 1EP1A 1K7XA 2QGYA 2ZXQA 5AB3A 2BNJA 2D24A 3USBA 2J9YA 1OCJA 1F3WA 3I3EA 3L4VA 3SN0A 3FS2A 3WDJA 4AUBA 1TMLA 1HW6A 4BEUA 1EXPA 1NFPA 1NARA 1DJWA 5L9FA 5A6KA 2X7VA 1A4LA 1MW0A 1TUFA 4GFIA 5BXSA 3T40A 1QI3A 1VFOA 5D33A 3POHA 2BGNE 4NG3A 3IIOA 3GNNA 3WD4A 4LYKA 3FEQA 2UY3A 4O14A 3AICA 4KESA 1EL3A 3N15A 3P84A 2Z28A 4AZ7A 1D9EA 1W9DM 1WV2A 4M1BA 3UZZA 5HNUA 2NXGA 5TQLA 1A3XA 2XIBA 3V75A 2AAMA 1C90A 2V2DA 1UP3A 2V0TA 4D8AA 1CCWB 2Y5SA 3VKJA 2GJPA 4DPPA 5AZ0A 3HU7A 3T05A 1F61A 3ORWA 5MF5A 3PUOA 5GNYA 4GWEA 1VS1A 2CKRA 4LB4A 3PJTA 5EMMA 2G97A 3BK0A 4ICNA 3W6LA 1DXFA 3CT2A 3D5HA 4AY7A 1XH1A 3OHIA 5TNVA 3WLLA 3E5PA 1EBHA 2WKLA 5EYWA 1C8XA 1FWFC 4IQDA 3BAJA 1K1DA 3LQGA 1KM0A 2WJZA 1RBLA 2YLLA 4O8AA 1QPRA 2XH2A 5H91A 4RE2A 3BG5A 4HJFA 4TU1A 1V0KA 4IJBA 4JN8A 2WYSA 4C6CA 3WBYA 2VX5A 1Y8BA 3BJTA 4WJEA 4PH6A 2D20A 3NO1A 2C1IA 4HT3A 2GUBA 1BQGA 4PE8A 1AL7A 3ZT6A 3VI2A 4L1GA 3L4WA 3KHJA 4DBWA 1SJDA 3GM8A 3WQGA 4TX8A 1G01A 3FKRA 1Q5MA 1VQTA 2DVTA 4GY0A 1C9WA 1JUBA 3HQPA 4Y8EA 1KV8A 4IHCA 1EDQA 4K7VA 4AD1A 4C6LA 3PBMA 2HWGA 2YOCA 3QYQA 1JXKA 2B7OA 3OP2A 3UZ5A 3A3XA 3R12A 4D71A 3S6DA 4L4OA 5I02A 4FNRA 1OX5A 4JTRA 2ALRA 2UWFA 1U22A 3R25A 2DSUA 5JBDA 3U2CA 1MQRA 3GU2A 2XH4A 4IG2A 1VB9A 2Z1KA 3MANA 3OTRA 2OQYA 4C6BA 2PTXA 1TFVA 3ZIZA 1SVDA 3TMLA 3LCFA 2V30A 1F2JA 2NX3A 3NWRA 4HK6A 2VURA 3NZPA 3FAWA 1REQB 3W6YA 3KBSA 2YW4A 1R87A 2WSRA 4Q7BA 4PMDA 2WMHA 2RKXA 3WH6A 4IMFA 2VZSA 4Y2WA 4AEEA 5FF2A 4XD4A 5AKQA 1OX4B 1HIZA 1TPEA 1A5KC 3LTSA 3WDPP 3CLMA 4W5UA 4CU8A 3CWOX 1UKSA 3LS9A 3UGRA 1B9ZA 3ITGA 1OCBA 2Q6ZA 1E9ZB 3ABZA 1L2QA 3QTGA 3KWXA 5BOEA 5CZSA 4NHVA 4GKTA 4KCUA 4QS5A 3I7SA 3UXKA 4YTUA 5A3HA 2L5HA 1CZ1A 3N04A 2PTYA 1NOFA 4Q22A 6TIMA 3B9DA 4F66A 4TIMA 3BLPX 4PEKA 4RXGA 5A5WA 1P43A 2EPMX 4Z0JA 3LI0A 1C3FA 2GDQA 1UWIA 1PO9A 3TYUA 3UW6A 1HJXA 1LBFA 5I6SA 4LVGA 2CXGA 3DH7A 5EFDA 1TO3A 2XPKA 3ARPA 2OTDA 1ITUA 4LAZA 1LUCB 2Q71A 3GHTA 5AC7A 5AC8A 4GHRA 5LA0A 3LCWA 2WJEA 4R7WA 1JJKA 1X1ZA 1R46A 3LXCA 3H7UA 3IVTA 2GPTA 4JN7A 2EQDA 3FHQA 4L9XA 2E8YA 3PJXA 4N9DA 4YVVA 3A5VA 1OT1A 3V0UA 4OUEA 5GVJA 1GGOA 1KGUA 4OHQA 4F2BA 3ZM8A 4LY4A 1MRAA 4PMJA 4D9PA 1J6PA 4B3ZA 4JN6A 1UD2A 3B9NA 4M6QA 4OBTA 3OHMB 4EANA 3AXMA 4MNKA 4XISA 1WCGA 2DSKA 4JFWA 4WCJA 3NXLA 3U6WA 2PWGA 1UB3A 2IXVA 1E9IA 3S1WA 4AIOA 3IV3A 4W7UA 1MW2A 1SPQA 3MV01 4FOUA 2ZUSA 1CGVA 2PDGA 4A3QA 5G2IA 4IZGA 3W02A 5BRBA 4XZ9A 1EWDA 1J11A 3H24A 3IK4A 3OYZA 5LZLA 3SEPA 4DZIA 2D3LA 4JS3A 1A5MC 3EB4A 1T8XA 4LF1A 3FN9A 1TWWA 3TEVA 1JL8A 2D0FA 5JMUA 1QMLA 4GYKA 2R9RA 5EBAA 3VGGA 4LB3A 4E8CA 4Q6JA 4O57A 1YTEA 5D2TA 3QPEA 5G1YA 2VP8A 3L68A 2E5CA 4KF1A 1T5AA 3H2AA 2WZMA 1XBXA 3EA3A 3MUZ1 5C0QA 3LZ5A 1EGVA 2D1ZA 4E2OA 3FKKA 4XD5A 4J4KA 3N29A 4Y9AA 2A6LA 4ATDA 2CZ5A 2F7FA 4PUNA 3QSTA 4GO8A 1W8SA 4RZ6A 4HSHA 4V27A 4PMUA 1E40A 5C71A 4FF5A 4NZCA 2GOKA 4B3KA 3CT7A 3L5AA 1ZQ5A 4G1NA 1B5TA 4UMCA 3RFAA 3W76A 3SJ3A 1CT5A 2QCDB 5IBXC 3VNYA 1BRLB 2H8ZA 2FGLA 4UCFA 1FTXA 1E56A 3BPWA 2XIOA 4ZB5A 2NV9A 5CC7A 1OGGA 2ZFAA 5E0FA 1TJ1A 2EAWA 2CLHA 1HN1A 1QRQA 5KZEA 1NWUA 1GKPA 2DZPA 4Q3MA 5F2IA 1TA3B 2ZWYA 2XVLA 3CUIA 3U3HA 3UWWA 4OV9A 3MBDA 4UTLA 3CIWA 3PZIA 2YZ5A 3MCNA 1TQXA 3DUGA 1LRTA 3WLJA 2CKSA 4C6MA 2HBXA 3GU9A 4LRTA 1BWVA 4C6JA 3DERA 2QQ6A 3GVVA 3VDAA 4UTTC 2Z0IA 1A3WA 5EMYA 1TPFA 1HTIA 2FZNA 5IBXA 3ZMRA 2DIKA 3LMZA 2Q3RA 2ZIDA 3LGGA 1BXBA 4LU0A 2WNZA 2B4GA 2G41A 3NPXA 2WM1A 4L6OA 2W63A 3W1UA 2E4TA 1TTJA 1F4AA 4GXMA 3L7RA 1PX4A 2DZVA 2YCJA 4LWWA 1CIUA 5FJJA 1DL3A 2FH6A 1O5XA 4RL3A 3DHFA 3NYZA 2ZCGA 5KMYA 3UP8A 2IKJA 4K36A 4ZQPA 1JVNA 5CZ0A 3GIPA 2YL6A 3BQ6A 2A3AA 3HF3A 3F4DA 3VDBA 4EIVA 1EF2A 1UD8A 1WDDA 3TN6A 1IZKA 2DVXA 3URQA 1ISVA 3UVIA 3U57A 4HMDA 4P7OA 2FZMA 4MIMA 5A2BA 3B8WA 3EGJA 2WZEA 2VR2A 3LPPA 3ECQA 3WLOA 4GNKB 1M7PA 2VJXA 4IFOA 4NJJA 1VCFA 4DM1A 4LFYA 3G18A 4ZQCA 3GDTA 4WEVX 5K4ZA 2LLEA 1WDWA 1Q3NA 3AOFA 5HPCA 4CU7A 4JYFA 2QNEA 3VIOA 4IXHA 2CC0A 1LG1A 1J01A 3QR3A 2QHAA 1RVGA 3WJWA 2WNWA 5I3HA 4ZENA 3VABA 1QCWA 2W3ZA 2O7QA 1E6SM 4NF7A 5ABHA 1H60A 1QJWA 4DF0A 3ITXA 5M2FX 4FZIA 4PODA 3JS3A 3EPMA 3OGRA 3RM9A 3MCOA 3GS6A 1QNVA 3LCLA 3EMQA 4DPQA 4IGSA 3MUXA 1UIPA 3W1RA 1HGYA 3DENA 3FCPA 4DZHA 4HHPA 1AJ0A 1I75A 3N2XA 1UBPC 1YTDA 3C2FA 2HMCA 4MUPA 2GGIA 4HA0A 2WLZA 4B5NA 3QY8A 4RPPA 3QN3A 4HD5A 3THCA 2G50A 5C9RA 3TTOA 1ZLPA 4RZBA 3IACA 3M64A 1Z44A 1GVOA 3W3OA 4A2RA 4C7DA 4GABA 1ESWA 3RJXA 1KFKA 1VLWA 2YXOA 3OZMA 2ZADA 2JALA 4DZAA 1EP2A 4R5EA 2PGEA 1TPH1 3MUAA 3ICJA 4QQ3A 4ZGYA 1F6KA 2ZE0A 1T99A 2UV8G 3T7VA 3R2GA 3EEZA 2YSWA 2C0HA 1PWLA 4HNLA 3MKVA 4L1WA 3UPWA 5AN7A 5EY5A 1JQVA 2PDYA 1LM1A 2WHJA 3D6NA 2RAGA 4O50A 4HN8A 4ZA0A 1V4YA 4W93A 1E6QM 3OLEA 1XICA 4UR9A 1TPC1 1XYLA 5CLTA 5HINA 3BG3A 1DWAM 3ZWSA 1XI3A 1LBMA 3NL5A 3F4VA 2XVPA 1DHPA 3T09A 4ERIA 3DG6A 1UUMA 4UB9A 1AD1A 3UG3A 4BR1A 3WZ0E 2RDTA 4Y7EA 4IF2A 1DBTA 4XZNX 3DKLA 4I5XA 1ONRA 3UNDA 4GC4A 2XIMA 3WLHA 1TZZA 4HZ7A 3EDKA 3W29A 2YYTA 5HPOA 4S3KA 1R9YA 2REQB 3V5FA 3ALFA 4P5UA 4HNVA 1E0XA 4FXSA 4AWSA 4NUWA 1BFNA 4DO5A 4B91A 1TB3A 4WR3A 3SQLA 4B5XA 4PB3A 3ONBA 1T41A 1AODA 5HDRA 1DJZA 3HZ3A 2J77A 5I79A 2OB3A 4KEUA 2OELA 1RV8A 2BOEX 4HNNA 4XIAA 3GK0A 1DQWA 1A5AA 1VD6A 2QDDA 1XS2A 1VR6A 2AMXA 3IIVA 3TOPA 2BHUA 1ECEA 3FV9A 1EPXA 4N9BA 4HNTA 3FHAA 2V6AA 4HU0A 3UG5A 3IGHX 3CJPA 2YXGA 3NGJA 3B40A 1IIHA 1UPMB 3TQVA 2PTZA 4PL2A 3ITVA 2VCBA 1O60A 3OBKA 4QCFA 1PIGA 1UA3A 1SFJA 1SR9A 1FWNA 1GONA 5M3WA 3B8VA 3HGSA 4V28A 5F1UA 5B7ZA 4R27A 3LHWA 4JXCA 2E28A 1VC4A 1WB0A 1OG0A 1DIKA 3IV8A 2NV1A 1BG9A 1XIBA 1W1ZA 3FIGA 1VEMA 3AS1A 1HKKA 3OVQA 3W28A 3AYTA 1H41A 2O9TA 4L64A 4JYDA 4FF7A 1M7JA 1DVJA 3AS3A 3DN5A 2HVMA 3P62A 1X39A 4X3ZA 4JIEA 4H00A 7A3HA 2ACSA 3GFYA 4H4IA 1M01A 1SR0A 1ME7A 1W3IA 3RM8A 1OQFA 4WSHA 1RP9A 1SW3A 4GJIA 4AW7A 4FNUA 2GLKA 4HA4A 3IIPA 2Y6ZA 1W2PA 5EFFA 1LCOA 1JD7A 3VC5A 4TXEA 4LUSA 3WMLA 1Q6LA 5IFPA 1FH9A 1F5ZA 1GOIA 1XBYA 3O05A 4ZO8A 3TQKA 2E77A 4FX7A 3G8RA 4M8UA 1FBAA 3FVMA 2X05A 2FJKA 3GO2A 3CASA 3ARZA 3S5YA 4AFYA 3M0LA 2FIQA 5DY3A 1L9WA 3TXZA 4US6A 1TRDA 3U0HA 3A4JA 1XGZA 4GI6A 3CZLA 1LF1A 3S5OA 1Z8AA 4QEHA 3Q94A 4JBRA 1H7PA 1TTQA 3K5XA 2VYOA 2DJXA 4PUDA 4XSLA 3ANYA 3OJGA 2XIIA 4IMGA 5D9NA 1FWRA 4ATLA 6A3HA 2I57A 4DO6A 1F9CA 1OFEA 2BV9A 2BBFA 2CZEA 4KCWA 3KEHA 1Q6CA 2GK1B 1IT0A 4GI8A 1R9ZA 2P0OA 5DXXA 8XIAA 3G1DA 1PXGA 3RJYA 1TV3A 3CIXA 2YGYA 1E1EA 2X1UA 1IQ8A 2B0MA 3WDQA 1HO4A 3DFOA 3O6AA 4FS9A 1OGSA 3W7NA 4UMAA 3E1F1 3W22A 3HV8A 3DOPA 1JZ4A 1QK0A 3LI1A 3WQDA 4JQ3A 3TR9A 1FCVA 5FJPA 4PSRA 2Y5JA 3BUVA 1JG9A 4ORIA 5A6BD 1CLKA 4J40A 3SGGA 3N11A 3NVTA 4L80A 4IJRA 5FJTA 5FF0A 1O1HA 4KMQA 4ERGA 3QR0A 3V1HA 3N6QA 4E6MA 3WQ6A 1XIJA 5A6SA 2NUWA 4UTWA 1MNZA 4Z08A 1HFBA 5F2GA 4AF0A 2QCEA 5AC4A 4N02A 4CU6A 4GC3A 2J24A 4XKYB 3NIYA 3WK1A 4GJJA 4E3TA 1CB2A 2WK2A 1ZENA 2PDCA 4S2CA 2G96A 3NQFA 4DJDC 4LUTA 1V03A 4RE4A 3S0CA 5I3GA 1NTHA 1W6TA 4NZJA 2XH0A 3TIMA 1XPGA 1E0UA 4NAEB