3OA5A

The structure of chi1, a chitinase from yersinia entomophaga
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
515
structure length
515
Chain Sequence
KSNLIYDKDPGYVWDNKNECEGAAEETYQELNYEPSISADKLTWTPTRLAKTVFNTYEDDDDFNVLCYFTDWSQYDPRIINKEIRDTGGRSADILRLNTPDGRPFKRLIYSFGGLIGDKKYSADGNASIAVRLGVATDPDDAIANHKGKTIPVDPDGAVLASINCGFTKWEAGDANERYNQEKAKGLLGGFRLLHEADKELEFSLSIGGWSMSGLFSEIAKDEILRTNFVEGIKDFFQRFPMFSHLDIDWEYPGSIGAGNPNSPDDGANFAILIQQITDAKISNLKGISIASSADPAKIDAANIPALMDAGVTGINLMTYDFFTLGDGKLSHHTNIYRDPSDVYSKYSIDDAVTHLIDEKKVDPKAIFIGYAGYTRNAKNATITTSIPSEEALKGTYTDANQTLGSFEYSVLEWTDIICHYMDFEKGEGRNGYKLVHDKVAKADYLYSEATKVFISLDTPRSVRDKGRYVKDKGLGGLFIWSGDQDNGILTNAAHEGLKRRIKNKVIDMTPFYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of Chi1 Chitinase from Yen-Tc: the multisubunit insecticidal ABC toxin complex of Yersinia entomophaga
pubmed doi rcsb
source organism Yersinia
molecule tags Hydrolase
molecule keywords Chi1
total genus 187
structure length 515
sequence length 515
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3oa5A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oa5A02
2OWWA 3PTKA 3GNOA 2NW0A 4FF5A 2F61A 3D3AA 3L4WA 4AIUA 2PWEA 1JZ3A 1M04A 3ZQ9A 4J3VA 4Y7EA 4GXPA 3PTQA 3SIMA 4HOWA 1RP8A 3EDEA 4GZIA 1C91A 5ABFB 4W8AA 1ISWA 1CENA 1KR0A 3N9KA 3AZRA 2J7DA 6A3HA 4UQEA 4JZ5A 5ABEA 4P7OA 3K4DA 1HKIA 5I23A 4UQCA 5AYIA 3W53A 3CHFA 3WUFA 3LPFA 1JDCA 1WPCA 1D3CA 1ISXA 5EB8A 1XSKA 2XGBA 5HNNA 1OIMA 5HDRA 3QOMA 4J3TA 3CHEA 1WZAA 3WQ6A 1UKOA 1LQ0A 1PIFA 4JFUA 1UD5A 3BGAA 5EFDA 2PI6A 2HVMA 5BXTA 1MYRA 2QLYA 5HOSA 4Q22A 3AOFA 3WEOA 2DT2A 3VIKA 1VAHA 1UR0A 3N13A 1B31A 7TAAA 4KMQA 1WZKA 1O6IA 4P8XA 3VIPA 5M03A 3BAYA 1JYVA 3KL0A 3G6LA 1PJ9A 5KZ6A 2DPEA 1E40A 2VX5A 2Y24A 1V3IA 3AXIA 4U31A 3RPMA 3VKKA 3WH8A 3AS1A 3MUZ1 4CUCA 2GJXA 2XFFA 4V27A 3UETA 1UA3A 3W4RA 5LYRA 3WF3A 1GOIA 1B3WA 3A47A 4DUXA 1VBRA 4UFMA 1UZ1A 3LPPA 4F9JA 4S3KA 2ZXQA 4HZ7A 4M80A 3RDKA 3ARQA 4WLCA 3GNPA 4QLJA 3CUIA 2IUZA 4MTVA 2QHAA 3DHUA 1S46A 4ACZB 3F5JA 4P8WA 1HKJA 4GI6A 4ATWA 3LMYA 2WLYA 4E8CA 2BY0A 2D0HA 1JG9A 4GPNA 3VX1A 1R87A 3UERA 1HKMA 4YN5A 1GQIA 7A3HA 3UG4A 5HBFA 1JZ5A 3BAKA 1Z32X 1Q6EA 5A6BA 1LL4A 4EK7A 4ML4A 1TR1A 2ZUUA 1B3XA 4QLKA 4AC1X 4LGXA 3AIUA 4H8HA 1VEPA 4D6HA 2VX7A 1NWUA 4XUYA 3THCA 3ZSSA 1V6VA 1UG6A 3ZT5A 5AY7A 4EKJA 1HJWA 4FLQA 3WQ8A 4OJYA 1JAKA 4EANA 5JBDA 3PN8A 3KEHA 5CSUA 2J25A 3ARTA 1BPLB 2CERA 3BMWA 5BYWA 1UWQA 4Z2JA 3PZQA 1V3HA 1JZ8A 1MFUA 3VGEA 1HKKA 1KQZA 2OYLA 4MNKA 1RP9A 4CVUA 1UKTA 1HVXA 4XB3A 1MXGA 1LWJA 4PMRA 3W26A 2XVKA 4QFUA 5A94A 1ODZA 3N11A 1WZLA 1JYNA 1CEOA 3SCPA 3ALGA 2YLLA 3ARRA 1BAGA 1GHRA 1OT1A 4QP0A 1H3GA 4W85A 1C90A 1JDDA 4LYPA 3VIMA 1ZBWA 1BF2A 3N17A 4B3KA 3MUAA 3WUBA 1IT0A 2VRKA 5D8ZA 3MSGA 1K9TA 2YJQA 4R27A 1HP5A 3GM8A 3O6AA 3T2PA 1BLIA 2V38A 1PX4A 4GI8A 6TAAA 4NF7A 3CZKA 1CNVA 4NZCA 4MB5A 4RE2A 1JYWA 2CXGA 3TP4A 1U30A 3WF2A 4MNJA 2FHFA 4P7QA 1CGXA 2O9OA 4PRWA 2GSJA 3AYSA 4ZENA 5JIPA 1MWOA 2D3NA 1BVZA 4FLOA 4MPKA 3MSDA 1DEDA 1DWHM 1OCQA 4AZ7A 1H5VA 2GJXB 4NRRA 2VX4A 1VJSA 1DWFM 5C71A 1GOWA 2AMGA 1CDGA 2XUCA 1EQPA 1E71M 2A3HA 4GQRA 3D5HA 2QF8A 1C8QA 3OBAA 2XYLA 3T0BA 2GDUA 1E4MM 4H41A 2E9MA 3EYPA 2ZUSA 2JE8A 2AOSA 5EFFA 1NOUA 5D9PA 1G9HA 4AIOA 4PCSA 2IXVA 3T09A 5FD0A 1IV8A 3N15A 3CZ8A 5GNZA 1AMYA 3SCTA 4IM4A 3KZSA 4LQ1A 4CD8A 1HL8A 3CH9A 4W87A 3AYRA 1LLOA 1KWGA 3POCA 5C70A 2DIEA 4AMCA 4Z2LA 3THDA 1KR1A 1KXTA 3DYMA 3MV01 3AMDA 4UZUA 3WMBA 4GKLA 1ZU8A 3G6MA 2V3GA 2WYSA 2BS9A 4TUFA 5A1AA 2BHYA 1E3ZA 3FY1A 3BMVA 3WQVA 5D4YA 4J3UA 5CPSA 4PTVA 2CCRA 1VFUA 2E9BA 3T2OA 3WELA 1E5JA 1NOFA 2YL9A 2WMHA 4BF7A 4JFSA 4UQBA 1W9UA 3VIJA 5FCZA 4AZ6A 1HF6A 1HNYA 3VM7A 1Y7VA 2HISA 1CECA 1K9FA 3PTMA 2UY5A 2GVYA 2CETA 2E3ZA 2GK1A 3FW6A 1JDAA 4PTWA 1UH4A 3WEMA 2XSAA 3VD7A 1KBBA 3QGVA 1XYZA 2CIPA 2YA1A 3GXIA 4W86A 5A6JA 3EMCA 2J75A 2J62A 4PYSA 4CGTA 3W38A 4RE3A 4ZXLA 1JD9A 5DO8A 4GO8A 1KXHA 5I6SA 4WKFA 3U7BA 2FGZA 3CGTA 3BAXA 1F4HA 4BS0A 9CGTA 1KGWA 4HPGA 3UESA 2WHJA 2WVVB 1TVNA 1UD2A 3ARPA 4A4AA 3M07A 3TTSA 2V3DA 4Z2HA 3UG5A 4PUDA 1E15A 1CXIA 3ZMRA 2VJXA 4B9YA 4PMYA 5CG0A 1WDRA 3UEQA 2WVUA 2JFEX 2VX6A 4PTMA 3W24A 2W63A 4P7LA 3WQ5A 1SYTA 3F4VA 4BZYA 2VCAA 2X1IA 4HZ6A 3L2LA 2FH8A 3L2MA 1UD4A 3SCOA 1NWSA 4H2CA 4H8UA 4PMDA 4S3JA 4BA0A 1AQHA 4HOZA 2YDSA 3ZSTA 4J3SA 4CU6A 2BVTA 3KWXA 3ARSA 4PEEA 3AS2A 2J78A 1O7AA 4F79A 3GXDA 2WWDA 3GYCA 3WH7A 2DSZA 5CQ1A 1CXLA 1KXQA 4W7VA 3CUFA 3WDHA 4UOJA 3MUY1 3AFBA 2OWXA 4W93A 1LL7A 1CLXA 4BQ3A 3AROA 1OT2A 4UFJA 1W2VA 1H2JA 4Z2GA 1B3VA 1OD8A 5I24A 2PWDA 1E70M 1PIGA 1E1EA 3VGBA 1W1VA 2WM0A 2YBTA 3CZGA 3WDPP 5FL1A 1CGVA 2D0GA 4L4PA 3HMCA 1LL6A 1LWHA 4H04A 2VO5A 2ZUTA 1V0KA 1TG7A 3SURA 3ARUA 2VZUA 2A3CA 1KWKA 2EBNA 1H0IA 5DF0A 3CZLA 1NP2A 4E4PA 4EE9A 2E9LA 4B9ZA 3EDFA 4CN6A 3NCOA 3PZ9A 3K1DA 4JIEA 5BRQA 2PWFA 1C8YA 4ZE5A 2J8GA 1ODUA 1JZ2A 3M46A 1TE1A 1KBKA 4P8UA 4W5ZA 3VIHA 3B8SA 3ZR5A 3AXHA 4UQ9A 5CLWA 3TOPA 2CBIA 3GH7A 5BROA 3K46A 5A6SA 1FH7A 4PMUA 2E4TA 4AZGA 1FH9A 2VVSA 4JFWA 4PMXA 3WH5A 1GVIA 1GQKA 1HN1A 2GK1B 4OOUA 5CPTA 2VCCA 2CHNA 4HMDA 1B1YA 3BH4A 5JUVA 3AJ7A 1DWAM 3VNYA 5LA1A 4CCEA 4LXFA 8A3HA 1E9LA 3I3BA 4MJ2A 4PN2A 2NT1A 1UWIA 3PZVA 1WAWA 3QHOA 5A69A 4B16A 3IANA 5CLTA 1ZB5A 1DTUA 1C3FA 1W9PA 1XSJA 5A95A 5ECUA 1CPUA 2O92A 2J74A 3MMDA 3MU7A 1V0NA 1GOOA 1NM9A 4AY1A 3CMGA 3OZOA 3WFLA 3ECQA 1H4PA 2J7HA 4AD5A 1WDPA 4GZEA 2ZICA 3RM4A 2CEQA 2WB5A 5I78A 3KL5A 3OZPA 4QDMA 1BFNA 4KGLA 2G8ZA 2BHUA 4M24A 3QR3A 1VIWA 4AWEA 4CCDA 2G3NA 3RM8A 3KL3A 1HT6A 2JIEA 3AQUA 1RD6A 2Y8KA 1QBBA 1J0HA 3OLDA 3WENA 1L0PA 1XHGA 2Z1SA 1OD0A 3AHVA 3O2LA 3ZO9A 4CU8A 4ACZA 3NIYA 3AHXA 3HU7A 3PBGA 4TVDA 3OB8A 5AC4A 1QHZA 1N82A 4K68A 3HJEA 4AYSA 2UWFA 1EQCA 3GH5A 4WKAA 4FK9A 1W3JA 2ZE0A 4KH2A 3VDHA 5BXSA 2D24A 4JFVA 3WDJA 4ZFMA 2E40A 5EMYA 4AD3A 1HIZA 1BGGA 1XD1A 4HZ8A 2J79A 3VMOA 4HA1A 2WC4A 1E6PA 3RMEA 1TVPA 2C8NA 5DT7A 2VOTA 3NYDA 4WJXA 3EMQA 3FN9A 1FHDA 4DWSD 1C93A 3MO4A 2QMJA 1GQJA 3WD2A 4HP5A 1W91A 1JZ6A 4J3WA 1J0IA 1UR4A 2BXZA 1H0GA 2OSXA 1QNOA 4AZBA 2IXUA 5DMYA 2VNCA 2CHOA 3AZSA 1QPKA 2VZTA 1OM0A 4JL2A 2DT1A 4IPLA 4U33A 5A6KA 5CZKA 1CBGA 1E55A 3LPOA 1UWSA 4PMQA 1W9DM 2WPGA 4NI3A 5BRPA 3AIQA 1PX3A 4D1IA 3PZOA 5JIWA 1DHKA 1NP0A 2D22A 4IUGA 2TAAA 3FXYA 4YPJA 3WUEA 3TA9A 1BYCA 1J11A 2CESA 1ITCA 4M1RA 1QI5A 2WBGA 2ZUWA 4UOQA 4WSKA 4PMOA 3GBDA 1CGWA 5ABGA 1EA9C 4HTYA 3VTRA 1EXPA 6CGTA 2WC7A 2OSWA 1OGBA 1JF6A 2V5CA 2VVNA 2MANA 2VURA 4HMEA 4HA3A 3AHYA 1R7OA 3L4YA 1RH9A 3CMJA 4LX4A 2WNWA 1J0JA 4TVUA 4JHOA 3CTTA 5IDIA 1KXVA 4ATLA 3W27A 2J47A 4GINA 3OGRA 2BY1A 4AD2A 3OLGA 3F5KA 2BV9A 5A2CA 4LYRA 2XWEA 1OINA 3AMLA 2JALA 2DSUA 3EDJA 1W3KA 2CBVA 4HMCA 1I1WA 2VQUA 2DSWA 4JAWA 3E1F1 1QI3A 3NJ3A 1K6AA 2UY3A 3DC0A 2J7BA 1OGGA 2BVYA 3F5LA 5E6YA 3AMKA 3WNKA 3RILA 1L8NA 3RIKA 4AIEA 1W3LA 3CUHA 1FP9A 2XFYA 1K9EA 3A4AA 4AZHA 2PBOA 3QOKA 3SUTA 1VF8A 3EMZA 4XZBA 1GW1A 4AZ5A 5AC5A 1UR1A 4RL3A 4UFHA 1E56A 1W1PA 1J12A 3T2QA 1ISZA 4B15A 5E6ZA 1QI2A 3WDRA 3MMWA 3AMCA 2ZX9A 4IPNB 4BCEA 1UWUA 3SCQA 4U3CA 1SFSA 1AVAA 2VMFA 2XIIA 2A3AA 3ZM8A 3WDQA 2A3BA 1B3YA 3RJXA 3BAIA 2C0HA 4WIWA 3IK2A 2VC9A 2EJ1A 2G4FA 3AICA 3WD4A 1E6SM 3ZJKA 1CXHA 2V3EA 2WXDM 3VDBA 2YLAA 3WIJA 1TA3B 2D1ZA 1UOKA 4IISA 1C92A 2WMFA 1ZBCA 1X1NA 4GIAA 1NOWA 2PC8A 4TX6A 3BLPX 5JH8A 3SUSA 1R8LA 3OIHA 3SCVA 2WK2A 4XZWA 2DSVA 1M7XA 4PMVA 2WLZA 1PPIA 3NSXA 3WH9A 3ARVA 3N18A 5A6AA 2VTFA 4X9YA 4D6JA 1E3XA 4D72A 2PF0A 4W7WA 1JZ7A 4AZCA 2X8RA 1VENA 2VI0A 3VILA 1XH1A 3VIGA 1B0IA 1GONA 3WF0A 3O9NA 2XJ7A 1J0ZA 4HPHA 3B9DA 2EQDA 3FNDA 2G3MA 2PBGA 1XYFA 1G1YA 1QHPA 3WUGA 2ZUNA 1E73M 4U5KA 1QBAA 1MQRA 2XVLA 4AXNA 1VB9A 1U33A 4YHEA 3T0AA 2WAGA 3VIFA 4MB4A 1MW1A 1HL9A 5HPCA 2XVGA 3VDAA 2NSXA 2Y4SA 1ESWA 4D6EA 4CN1A 5IFTA 2WMIB 3DHPA 1LG1A 1ZJBA 3VIOA 1BYDA 2BY3A 3VNZA 5CXPA 1US3A 2DGAA 4PMZA 1GJWA 1R85A 4GI9A 1UWRA 2OSYA 4J27A 4PSRA 4U5IA 4KRTA 5JBEA 2ZWZA 3VGFA 3W25A 1XSIA 1HJQA 3WD3A 1US2A 3K8LA 1KGUA 3DECA 1UR2A 3WMCA 4MADA 4N42A 4FLSA 4J7RA 3WSUA 1MVYA 3JUGA 1CXEA 3FAXA 3VD3A 2W5FA 4W8LA 4HU8A 4FMVA 4UQAA 2WKGA 4UCFA 2YL6A 2XG9A 3WY1A 2VT0A 1HVQA 4JCMA 1EDGA 3II1A 3AHTA 4JFTA 2W62A 4V28A 2CITA 3VIIA 3BCDA 1XCXA 4UQDA 4C7GA 4KRUA 2WHKA 2QMKA 3GZAA 2WSKA 1Q6CA 2D3LA 2WC3A 1KCKA 1EHAA 5I2UA 3NDZA 4CU7A 2JIWA 5IXEA 1GNXA 1ISYA 5FKYA 1V08A 1UHVA 2WMJA 2BVDA 2XGIA 4E8DA 1JI2A 2DT0A 4J3XA 1VBUA 2WZHA 2X0HA 1R86A 1CXFA 4NRSA 4JHZA 1F4AA 2XTKA 1EO7A 1G5AA 1CGUA 3NDYA 1D7FA 2GUYA 1QVBA 4TXEA 1QNQA 4M81A 4F66A 2DQXA 1E72M 3PZUA 2XM1A 5F7UA 2RGMA 1ZBVA 3UR7A 3VOCA 3WL0A 1FA2A 2EO7A 2V3FA 2Q8XA 4J28A 3AHZA 3AS3A 4D6IA 1JYXA 1W9VA 4C7FA 5HPOA 1Q4NX 4OIFA 3QHNA 4QAWA 4AZIA 3K8MA 4AZCB 2XIBA 3W81A 1V6XA 2ZX6A 7CGTA 1ZS2A 1FP8A 4WF7A 4TVCA 2XM2A 1P6WA 1XC6A 1JIBA 3AIVA 1FFRA 3A4WA 4TTGA 1UQZA 1B3ZA 4CD4A 1G0CA 4LYQA 4DM1A 1WNOA 3PZMA 1XGZA 1HP4A 3IAPA 1TFVA 1V02A 2FGLA 4Z2IA 4MB3A 2J77A 3SUUA 3L4UA 3N12A 1CGTA 1J10A 2ZX7A 2YIHA 4V2XA 2J4GA 5LA0A 1GVYA 3OLEA 2WMIA 2OLHA 1BYBA 4JKLA 4W89A 2W67A 3OG2A 4ZEPA 2JEPA 3GH4A 2QPSA 2WCGA 2J8FA 1M03A 4C7DA 3W6LA 1SR0A 3VGDA 4WKHA 2C7FA 2D0FA 1G94A 2XVNA 1H1NA 1H41A 2GJRA 3SUVA 2GDVA 3K8KA 1TUXA 3A4XA 1B90A 1NQ6A 1E43A 1W9XA 3WD0A 2F2HA 1H49A 1LJYA 3WNNA 1E0XA 3ZJ8A 4DUWA 2ZXBA 5A8NA 3SUWA 1ISVA 3GXMA 4UOZA 1UKSA 1BG4A 3MS8A 3IJ9A 2GJPA 3WMSA 3AXXA 4QCFA 2CYGA 2W92A 3NSMA 4X0VA 1E6RA 2DEPA 1V02E 1A47A 1VFFA 2WHMA 4GO9A 4DWSA 1GZJA 1WP6A 1E5NA 3AIBA 3PZNA 3K4AA 4P7RA 1EHNA 1UD6A 2YBUA 2FHCA 3WFZA 2DT3A 3AISA 2VZSA 1WDSA 4MAZA 1NH6A 2Y8VA 1V3KA 1CGYA 4TOQA 2XHYA 4PMNA 1YHTA 1JNDA 2G3IA 4CD5A 2BHZA 3POHA 3EDKA 5DFAA 4D6FA 1V3MA 4PUEA 2WKLA 3VU2A 3SCRA 3W37A 5E0CA 4D6CA 2VL4A 3GXFA 3L4VA 1V6YA 2A3EA 2EEXA 1W2PA 3W0KA 4F8XA 3VPLA 3W6MA 1LG2A 3ALFA 4JCLA 1CTNA 3WDIA 1B9ZA 1CIUA 3VMNA 2J7CA 2NT0A 2X05A 1GCYA 3ZR6A 1JAEA 5A6LA 5E70A 1IZKA 3VX0A 4P7NA 4OZOA 3ARWA 1JZ4A 1UA7A 2XVPA 5DT5A 2E8ZA 1DWIM 3VMPA 5IHRA 2ZXDA 1HJSA 3SCUA 1V03A 1PAMA 3L4TA 4UFKA 3VINA 4DM2A 2WCAA 4PTXA 4D6GA 3UR8A 1JGIA 2ZX8A 3AIWA 3BXWA 4QLLA 2G3JA 1HJVA 3FAWA 2WZIA 3L4XA 2JEQA 1YQ2A 1HXJA 2OYMA 5FOOA 2Z1KA 1JXJA 2BFGA 3AIRA 2PB1A 4PBGA 3A3HA 4GZJA 1WZMA 1EDTA 3ZJ6A 1QI4A 1KQYA 1QNPA 1PBGA 2D2OA 4PCTA 1MQPA 3CZEA 4UZSA 3T0DA 1E0WA 1GOQA 1UKQA 5A8QA 1R7AA 1V0LA 5EBAA 2Y2WA 4MNLA 3GNRA 5CGMA 1NARA 5IFPA 4QCEA 1E6QM 1TZ7A 1OB0A 3AMGA 3FHQA 5GNXA 1KCLA 1EOKA 4H8VA 1HJXA 4UTFA 4OBSA 2QV4A 4XX6A 2DIJA 2J7FA 4MB1A 3VDCA 4WSJA 3IJ8A 1GHSA 2YDRA 1PEZA 2W4XA 3LPGA 1BG9A 5BXRA 3I3EA 3N1AA 5CJ5A 1A3HA 3MKKA 1H09A 2ZWYA 3VUPA 1UR8A 3SCNA 4JKKA 1QNRA 1UH3A 1JD7A 5M3WA 1QW9A 1GOKA 1BGAA 2WVTA 4W88A 5A2BA 1KGXA 3VVGA 1C7TA 1AQMA 3GDBA 3HN3A 5I3DA 4DWSB 4W84A 3CO4A 2EPKX 4M29A 5JBFA 1QI0A 1TA3A 3OGVA 4M56A 3WNPA 2BNJA 2ESCA 2GFTA 3U5YA 3APGA 3WBEA 4LPCA 5DEZA 1Q6GA 1RPKA 1ZJAA 1EOMA 3U57A 1VFOA 2EPLX 1U2YA 3CHCA 1OIFA 3VGHA 2EPOA 2J7GA 3BC9A 2VR4A 4UFIA 4FLRA 2VQTA 2XWDA 3B9AA 1KB3A 1XH0A 3ARXA 5A6BD 1XH2A 3GTNA 3BAJA 1KFWA 3OLIA 4GQQA 4DUVA 4BQ4A 1E4NA 1I75A 3FHAA 5C8BB 2CBJA 1GPFA 1BVNP 1GJUA 5BXPA 3CZJA 2DSKA 1JF5A 1E4LA 2O9RA 3WBAA 1V0MA 5A8PA 1JXKA 2VRQA 2W61A 3ZJ7A 1E4IA 2ZUVA 1JNEA 3S2CA 1WKYA 1W3HA 4HU0A 1QOXA 5KEZA 3PZGA 2E8YA 2EXOA 2WW5A 4H7VA 3MANA 1FFQA 4JKMA 1TMQA 5M5DA 1J0KA 1UQYA 4MAVA 3VO0A 2XSBA 1UZ4A 3BLKA 3EBVA 3BCFA 1MQQA 5IHSA 1X6NA 4UNIA 3BSGA 4OKDA 1OGSA 1JI1A 3TTOA 2QPUA 3WNLA 2YL5A 3CIVA 1B30A 2YOCA 2UY2A 3W28A 3VM5A 1M01A 5CSYA 4TX8A 1V6UA 1VJZA 1QHOA 2DH3A 2B31A 3S6TA 4U2YA 1I1XA 4EAMA 1BTCA 1NWRA 1C8XA 3QHMA 1E6ZA 1PX8A 3WNOA 4BQ5A 2ZIDA 3TTQA 4ZE4A 4AEEA 1XD0A 2BY2A 2EPMX 2J7EA 1GQLA 1CLVA 2CKSA 3B9EA 4W7UA 3GBEA 3N04A 1V6WA 1M53A 1J9YA 3EDDA 1MW2A 5E0FA 3CPUA 3WKZA 4NSBA 2CBUA 3I3DA 4M82A 3RJYA 4A3HA 4F9DA 1J01A 2CKRA 4UFLA 4DWSC 5ABHA 4M8UA 3VD9A 1W1TA 2WVSA 2E0PA 2JF7A 3RCNA 1GORA 5BCAA 1MFVA 3PHAA 3ZT7A 1PZ3A 2O9TA 3WF4A 1ITXA 1VEMA 5A8OA 3MUIA 1OWQA 1JFXA 1QW8A 3IJ7A 1EGZA 3DYOA 3WL1A 3CBWA 3WEZA 2X0YA 1SMAA 5TD4A 3U5UA 4CD6A 3CUGA 5D9NA 4RE4A 4D6DA 5A6MA 3VD4A 2F8QA 2FDMA 2FH6A 1GUVA 1JFHA 1EO5A 3WH6A 5BWFA 1DWJM 2WZEA 3PZTA 4ACYA 3TTYA 1BQCA 2WMKA 4BQ2A 1B2YA 2VR5A 2VRJA 5E9AA 3BSHA 1WB0A 4URIA 5I77A 4W5UA 4AEFA 4MNMA 4Z2KA 3UCQA 2JF6A 5D8WA 1C7SA 1MW0A 1WCGA 2CPUA 2DDXA 2O9PA 1FOBA 2BXYA 3RO8A 3SEPA 4U3AA 1D2KA 3ZOAA 1CZ1A 4CD7A 1UYQA 3WD1A 2UY4A 3PZIA 1OSEA 4X0NA 1EIBA 4OUEA 2ZOXA 3NSNA 2DH2A 2PWHA 2VUYA 4MDOA 1W9BM 1Q6DA 2YDQA 4XV0A 1MXDA 3DYPA 1BHGA 2FHBA 1EDQA 3AI0A 3BAWA 5A2AA 5ABFA 4UR9A 1TCMA 3CUJA 3AS0A 1UH2A 3ARYA 1X6LA 4P8VA 4AD0A 1XCWA 1V3LA 1XV8A 4CN4A 2OYKA 1XRVA 3WQ4A 1UWTA 4TTUA 4WK9A 4W8BA 2D23A 2YL8A 3IAQA 1SMDA 3ZIZA 2WHLA 2VZOA 5GQBA 2YA0A 1CXKA 3ZT6A 1AQ0A 5CGTA 4A3YA 5A3HA 4YHGA 3A6OA 5GPRA 4L4OA 2WCSA 1DWGM 2X2YA 1CYGA 1WDQA 3CHDA 3MMUA 3MV11 2WWCA 5GNYA 2ZXAA 4AW7A 1BSIA 2WBKA 3WF1A 1UUQA 1E0VA 1E6NA 1ZL1A 3SCSA 5FIPA 1GOMA 4AISA 2D20A 1UR9A 1OBAA 5I5RA 1ZBKA 4Q7NA 2WVVA 4MJ4A 4JL1A 2W66A 3OA5A 3VGGA 1E1FA 1BYAA 4E2OA 1UD3A 1J18A 3TONA 4D1JA 1VRXA 1UD8A 2XPKA 4KWUA 1LF1A 2EPNA 2VCBA 5FL0A 4HA4A 3U7VA 4AD4A 5HXMA 3KE0A 2AAAA 4N0RA 3M6DA 1J0YA 2OWCA 4B3LA 3UG3A 1E6XM 2YA2A 1H11A 3WN6A 3SCWA 1G01A 3VD5A 8CGTA 1UKPA 5I0DA 4OBRA 1FH8A 1JL8A 3WQWA 2WMGA 2G41A 3J7HA 1NWTA 3AZTA 5AYBA 2ZUMA 1CWYA 5E09A 2W91A 5A8MA 3AIEA 2CNCA 2V5DA 1IZJA 3NUKA 3M7SA 4ZXOA 3W29A 3T08A 5D9MA 5LA2A 5I79A 1MW3A 4CKQA 3W82A 1PZ2A 2RGLA 3CLWA 4KGJA 1K9DA 1W1YA 3OGSA 4AD1A 2XFRA 1QNSA 4ATDA 1VEOA 4CCCA 4OOZA 4U2ZA 2Y5EA 3L4ZA 4MDPA 4D71A 2X09A 1EH9A 3WNMA 3RM9A 1HX0A 2YKKA 1DP0A 1VFMA 4HOXA 2WANA 2WSPA 2ZX5A 4CVWA 1Q6FA 1V3JA 1FHLA 1WO2A 4R5EA 1WE5A 3ARZA 5M17A 4PSPA 2VZVA 2PWGA 5D9OA 1W32A 1ECEA 5CPQA 1HJUA
chains in the Genus database with same CATH superfamily
2OWWA 1QPFA 3E9AA 2NW0A 4FF5A 4UTLA 1DTNA 4AIUA 2PWEA 1TV7A 3NM3A 5DELA 3HA1A 1QCWA 5FJTA 1FCVA 3UPWA 3ZQ9A 4OV9A 4Q3MA 2I5GA 3LNPA 1EIXA 3PTQA 4MGGA 3EXSA 4HOWA 4HZMA 1RP8A 4GZIA 3THQA 4IIEA 3L66A 2OGYA 2ZQVA 1HKVA 4UQEA 3SGZA 4JZ5A 4UXDA 5I23A 3CHFA 3WUFA 5I3IA 1VZWA 2ZZ6A 5AYXA 3JYJA 2XGBA 1AJZA 2WNZA 3RCMA 3CYVA 2EJAA 2DJLA 4N9EA 2PI6A 2CW6A 3W1QA 4JX4A 4NXKA 3QFEA 3N13A 3TKFA 4DJFD 3LRKA 3O6YX 1WZKA 2X7VA 5M03A 2NX9A 4E6MA 4DUOA 1M6JA 2OR2A 1QOPA 3P8IA 1V3IA 3WLJA 4M6UA 3MWAA 3G0UA 3AS1A 3MUZ1 4LW7A 3UETA 1UA3A 3W4RA 3BURA 2AGTA 2HMCA 3A3WA 5EL1A 4DUXA 5KINA 1VBRA 4UFMA 1UZ1A 3LPPA 2RHGA 3IJIA 3OJGA 3RN6A 2PU1A 2ZXQA 2HROA 1GG1A 4O1AA 4UTWC 4IICA 3ARQA 4Q32A 5HNUA 4QLJA 3B05A 2QXWA 4ACZB 1S46A 3FKKA 1R3SA 3CXOA 1OEPA 4ATWA 3M5VA 3LMYA 2WLYA 3ZVHB 4E8CA 2BY0A 1JG9A 3VX1A 1K7XA 3UERA 1HKMA 1GQIA 1OFEA 1X8CA 3B4UA 1JZ5A 4HQVA 1S38A 3G0SA 5A6BA 3AIUA 1K8XA 3ANUA 4D6HA 2VX7A 1KFJA 2A2IA 2X0SA 3FX4A 3EWYA 4HCLA 1TPDA 4FHAA 4EKJA 4LUSA 4OJYA 1G4EA 1SVDA 3RX3A 4QE4A 2J25A 1BPLB 4YYFA 2NUYA 4X9SA 5BYWA 2I5QA 1KQZA 4ODMA 1UR3M 4RDVA 3EWWA 4MNKA 1RK5A 4CVUA 2HVOA 4YIWA 4L6DA 4YTQA 4JYFA 4PMRA 4XB3A 4QFUA 5A94A 3C2EA 3H55A 2P1FA 1WBHA 1XLLA 1OT1A 4QP0A 2DG3A 2E67A 4W85A 1C90A 3VZXA 3RPTA 1ICPA 2PDNA 3NNTA 1JCTA 3URQA 4TMCA 3DKLA 2ZQTA 3IRSA 3WUBA 3I4KA 3VOGA 3UCCA 3ZWTA 1HP5A 3TCZA 1KRAC 3S5YA 4WQ6A 1GQNA 1PX4A 2C16A 4N9DA 4GI8A 3B06A 4IUOA 1XYMA 1ZNNA 4H6KA 3CZKA 1DJQA 2XINA 3P3BA 4JX6A 3NG3A 4JGDA 1FVPA 2FHFA 4MMWA 3KOXA 5K4ZA 2IF4A 3P60A 2BGSA 2HVNA 3A9BA 3PWGA 4UTIA 3N73A 3EWUA 5I3GA 4NRRA 1BWLA 3E0VA 3UJSA 1DWFM 4LY4A 5C71A 1GOWA 3V16A 3E2VA 1CDGA 2XUCA 5D09A 1E71M 3MI3A 1TJ2A 4JTDA 3O6DA 1TV5A 2RJGA 2V2HA 1IR2A 5KMYA 2V5JA 3V5OA 3H12A 1RVGA 1ZUAX 2E9MA 2YXOA 3M41A 2ZUSA 2JE8A 2AOSA 1XLDA 2ZVIA 3BVJA 3MI2A 4MWAE 3TROA 3URBA 1C9WA 3CZ8A 1DIOA 2C1IA 3O5FA 2PV1A 4CD8A 3W7PA 4GYPC 1HL8A 4QR6A 4WXYA 4ZO9A 4LBUA 1A5MC 3N9RA 3OIXA 1J6YA 3KOYA 1HUVA 2DIEA 4Z2LA 3CPRA 2WZTA 2H90A 4UZUA 3TMLA 2YZ5A 3LCXA 2ZRUA 1AW5A 3CYJA 4GKLA 3DCPA 4G2DA 4EPEC 2WYSA 5A1AA 2RURA 2BHYA 1E3ZA 1NDWA 3BMVA 1OABA 3WQVA 4J3UA 4XVDA 2DZUA 2CCRA 1QUMA 2CLKA 1IEVA 1NOFA 4M1BA 4HHPA 3TN4A 4ZTYA 4JFSA 4GQGA 4JFIA 2HISA 4IFOA 3GB6A 1CECA 3H2AA 3DC8A 4D8AA 4MF4A 2XSAA 1S1RA 2V67A 2PRLA 4M6VA 2CIPA 4IFKB 4MWAB 5A6JA 1SJCA 2J75A 1OYBA 3SFWA 4GKTA 3ITVA 4RE3A 1N8WA 4S3BA 2F2KA 5I6SA 2FGZA 2VDIA 3BAXA 2MLZA 3UW6A 2H8XA 4HPGA 1FUYA 4OTKA 2WVVB 1TVNA 2NX3A 1OC7A 3H4GA 3I68A 2Q8LA 4C1NB 3ZMRA 2PGEA 3S2JA 3QZEA 3VCNA 4B4HA 2Y70A 2BODX 1REQA 2V81A 5D38A 4PTMA 2ANUA 3F4VA 4BZYA 1RVKA 4KQZA 3E38A 7XIMA 3SCOA 1UD4A 1Q2RA 4OT7A 4DJED 1ZJHA 5LIYX 1AQHA 1F61A 3P5YA 3ZSTA 3AUOA 5T8GA 4AF0A 3ARSA 1LDCA 3AS2A 2J78A 2Z6IA 3UG8A 3W7DA 5EBUA 1YBQB 1O7AA 1AW2A 2WWDA 3GYCA 1S2UA 4M19A 3WH7A 3S9YA 5CQ1A 4W7VA 3L12A 1M41A 1O60A 1UWAA 2X1SA 1R2SA 3NI6A 5BZAA 3QY6A 4NNRA 3BE7A 1OADA 1LL7A 4UTTC 1GZ1A 3WBXA 1OT2A 3TNOA 3JZUA 3GDRA 2CU0A 4NVTA 4KESA 4Z2GA 3GG7A 1OD8A 5G4HC 1E70M 1PIGA 3VGBA 4E2DA 3APTA 5FL1A 4ZPVR 4MY8A 3HMCA 4WX2A 1JQVA 1LL6A 1YE6A 4H04A 3QW3A 2VO5A 2FVLA 3E2RA 4LY8A 4EVZA 3SURA 3ARUA 4KIRA 1VFSA 4RV3A 4N2YA 1KWKA 3FLUA 4L9ZA 1NP2A 1TIWA 5DIUA 4EE9A 1WKFA 1DQWA 5L9FA 4JN6A 4NNCA 4IL0A 4AFYA 3NL5A 3RMJA 3VOHA 3VUSA 3R4IA 3N19B 4ZE5A 1S5MA 1KBKA 4P8UA 2Z1VA 3HG3A 4XAZA 3IV3A 3AXHA 1W8GA 3PPFA 4W5ZA 3TOPA 1XP3A 3BLLA 3K46A 2C15A 2FTPA 3UQIA 4H1ZA 3VAVA 1P5BA 2Y85A 3A22A 2I5IA 4PMUA 2E4TA 3D47A 4A35A 4JXCA 3PAJA 4AZGA 1FH9A 3QMSA 5EY5A 4LC8A 3UYIA 1GQKA 5CPTA 2GK1B 4REQB 3BH4A 1GVQA 3PWAA 3ZR4A 4Y8EA 3VNYA 2PDWA 2R91A 2A79A 4H9VA 4IIGA 4IFKA 3GXPA 5CPOA 8A3HA 3WQGA 3I3BA 3S1UA 4MJ2A 2VFEA 2NT1A 4S2CA 1LOLA 2R9RA 2A4AA 5CLTA 1DTUA 1W9PA 4MG4A 1CPUA 3W7OA 2VC6A 1FWNA 3MU7A 7ODCA 1V0NA 3OZOA 4DJFA 1ADDA 3ECQA 1H4PA 2J7HA 2E7FA 3KM8A 4LVAA 2CEQA 4RDWA 3WJYA 3TDFA 5H8PA 3D46A 4JQAA 3NO1A 4QAIA 2XIJA 1R30A 1XC4A 3GAKA 3BDKA 4Q8WA 2JIEA 1G4SA 1RD6A 1SGJA 2DZWA 2Y8KA 6TIMA 4KT2A 3IUIA 3RX4A 3NZGA 3BV4A 3CPGA 4H19A 3WENA 2H9AB 3ITTA 3K5XA 2QJIA 3W1AA 3LK6A 2G50A 3HU7A 4H8NA 2JBMA 3G1DA 5DMNA 1JPDX 4FR6A 3BLOA 2TYSA 4ODOA 5FJIA 3KWSA 4L4LA 1W3JA 3TOYA 1ZRQA 4YMZA 3VDHA 5BXSA 2QDEA 4HSNA 3S2LA 1LTDA 4NAEA 3VKAA 3L0NA 3WQFA 2ATSA 2CLPA 2FZMA 2J79A 3VMOA 3TUUA 2QUNA 1E6PA 3RMEA 3JR2A 3N2XA 4S38A 1LRTA 2ACSA 2INZA 2PDCA 4JPGA 1KV5A 3N2CA 2ALDA 3BWWA 4HP5A 4DYKA 3UA4A 1N8FA 3QPEA 3CQKA 4RW3A 3V35A 1EWDA 2OGJA 5DMYA 3AZSA 2CHOA 4JQ2A 4JL2A 5CAKA 3I7SA 2HK1A 2ODOA 5G2HA 3LV5A 1CBGA 2OQHA 2AQOA 4I90A 3KBJA 4NZ1A 4QG8A 1Q6LA 3QXBA 4FIRA 1PX3A 4DJEC 3IIVA 1DHKA 2D22A 3TZNA 5AFDA 4F0LA 4IUGA 3GNXA 2TAAA 1J4HA 1B5TA 4XWUA 3OQEA 2WBGA 5CKSA 1SO6A 3NYZA 4EPDC 3BK0A 1V8EA 4PB3A 2DORA 4EWND 1XS2A 1RHCA 2VGIA 4NJGA 6CGTA 1O12A 4RZBA 3Q2DA 2HPMA 5AC8A 4GISA 2MANA 5DBTA 3TCSA 1W3TA 4O1EA 4XO6A 3VA8A 2QUUA 5LIWX 2CLFA 2WNWA 4L65A 4HGXA 4C6LA 3CTTA 2R1MA 3W27A 4A3UA 1PCKA 3R12A 3OGRA 3VFCA 1XDMA 4AD2A 1XRFA 2BV9A 5A2CA 2XWEA 1DE5A 1H5YA 2N87A 1PYFA 1ZSXA 1NELA 2PDKA 4ORMA 4XD3A 1EGVA 3E1F1 1QI3A 4Z1CA 2YW4A 4C5ZA 1R2RA 1FCUA 3DC0A 1Q6OA 3GC5A 3PSWA 4W9QA 1JVNA 3AMKA 3WNKA 3QC3A 3W83A 3MSYA 2E6DA 3CUHA 3PB2A 1K9EA 3NQCA 4JTHA 1OFQA 2QJGA 1RA0A 2PBOA 1NDVA 3NR0A 2QZRA 2W79A 3SUTA 1KM3A 2FTWA 1N1AA 3I6TA 1GGOA 4WDTA 4UFHA 1K3UA 4H01A 4V15A 1QI2A 5FJOA 3WDRA 2Z24A 5AZ0A 4IPNB 1RK6A 1UWUA 4WHBA 1D6OA 3SCQA 1SFSA 3M0LA 1AVAA 3C86A 4UTJA 3ZM8A 3TC6A 2C0HA 4WIWA 2CFFA 4ZB5A 3IK2A 1R38A 2VC9A 1E6SM 1CXHA 2WXDM 3HQOA 1SZEA 1Q85A 4O4VA 2BOFX 3R0UA 3LEPA 1TA3B 1C92A 4R7WA 2KO7A 1X1NA 4TX6A 3NA8A 5I98A 3SCVA 2WK2A 3GHSA 4HSHA 2DW7A 2WV8A 2PDPA 1PPIA 3UP8A 1J96A 3S1WA 3PSVA 4RNFA 4D72A 4OECA 3EKGA 1KFLA 4AZCA 2IW0A 1POKA 1XH1A 2OFJA 1GONA 3WF0A 2WNNA 3B9DA 2Y7GA 3EKZA 4IT4A 6REQB 4YS1A 3A21A 3WUGA 2J6VA 2ZUNA 1E73M 4BK9A 2X41A 1KD0A 4B5UA 4LAXA 2XVLA 3OTRA 4GIEA 5DLCA 3CV6A 4AXNA 1AJ0A 5G1TA 2NX1A 3HG5A 5F2IA 3T0AA 1TPEA 1MW1A 3TE9A 3DG7A 4UMAA 1HL9A 5HPCA 2NSXA 2NVAA 4QM1A 2Y7EA 1RSCA 2GVGA 3SY8A 4QJ3B 1WXYA 4J4NA 3DHPA 3ONBA 1TIMA 1KC7A 4DRMA 2BY3A 4DJDC 3WQEA 1IHIA 4YNGA 1R85A 3EEZA 1LT7A 2AAMA 3W71A 4DJEA 2OSYA 4U5IA 1M7OA 3FXGA 5JXQA 2NQ9A 3WD3A 4ZR8A 1DL3A 3K8LA 3SO7A 5MHBA 3EX2A 3XISA 1UR2A 2I1OA 3QM3A 2FFIA 4MADA 2C18A 4OVXA 4NY2A 3H2NA 3WSUA 2QKFA 3E12A 1SZRA 3SGGA 3VD3A 1J6PA 2OZ0A 4HU8A 2POTA 4FMVA 4GIRA 2OEMA 3P7YA 3NZPA 2XG9A 4DH0A 4H9ZA 1HVQA 4GBUA 4BF8A 1EDGA 1OX5A 4US5D 1OFAA 5BOOA 1YPIA 4GCAA 3VIIA 2DVXA 2C91A 2PGFA 4QJ1A 4AEOA 4KRUA 4ZQOA 4O0ZA 2QMKA 1T96A 3NQEA 2BOEX 1Q6CA 3KABA 3MJYA 2EAWA 5I2UA 3NDZA 2JIWA 3TJIA 1Y5VA 2FFCA 3STPA 1TTIA 3W84A 1JI2A 1VBUA 1YXYA 4E3TA 1EO7A 2PF8A 2PTDA 5K4XA 5LNVA 4O14A 5BOFA 3G77A 2PGRA 1D7FA 3EOEA 4LBRA 1QR7A 1VJIA 1GKQA 5J5RA 3ABRA 4O13A 5DITA 4G9PA 4XZ9A 1OK4A 2PSNA 5K3VA 1VCGA 1SU5A 1FA2A 2EO7A 3IPWA 2V3FA 1H51A 3EPMA 4J28A 3O3RA 2GQ3A 3AS3A 2ZRXA 4C6NA 1JYXA 1OF8A 5G2WA 1Q4NX 3QHNA 2YCIX 4FX7A 2ZDSA 3W81A 3DN5A 4GJ1A 3V1HA 1JQXA 4Z0JA 4TVCA 1XC6A 6REQA 1RLCL 3W3OA 2ZRVA 3H70A 1UQZA 2BOGX 1B3ZA 4UR7A 1AH4A 4KWVA 1NSJA 3TV8A 4LYQA 4HB7A 2ZTJA 1XGZA 1HP4A 3IAPA 5FF3A 4Z2IA 3L4UA 3N12A 1AJ2A 2ZX7A 3LNMA 2YIHA 4TMBA 2J4GA 4O12A 5LA0A 4X3ZA 1BYBA 3WLMA 3L21A 1NF7A 4KCWA 4LALA 3OG2A 1H60A 3TYZA 1F9CA 2JEPA 1WV2A 1IX5A 3GH4A 1GEHA 1GYNA 4FXRA 3N6QA 1JPMA 4WKHA 3CUZA 5LIXX 2C7FA 3P5ZA 2PP0A 1H41A 3SUVA 1I2QA 3IGHX 1EJTC 4KFNA 1QO2A 3LBCA 3WD0A 4A29A 3WNNA 4HN8A 4BI6A 2O0TA 3ZJ8A 1Q6RA 4DUWA 4JS3A 5FEZA 3OOBA 3KCJA 3HPZA 3OP2A 1BG4A 4L61A 4JYDA 2QJJA 2W92A 1E6RA 4O15A 3ES8A 4Z1AA 3P84A 1VFFA 1GZJA 1VD6A 3IVUA 1OG6A 3AIBA 2VEKA 3K4AA 4P7RA 1EHNA 3ZVIA 3VNLA 1ZAJA 2VZSA 1XLJA 1FKGA 3TC7A 1NH6A 4IG2A 3MCMA 1KTNA 1V3KA 1P43A 4BWLC 2VD9A 4GC4A 1XRSA 2IQDA 3ITXA 2XGZA 2A3LA 5GPGA 2V2DA 3LXCA 3KACA 3NQFA 1YNYA 4DAFA 2P50A 1OFRA 1FY6A 1V3MA 3SCRA 5KSWA 3QY8A 2FJKA 3GXFA 4LB4A 1W2PA 1HFBA 5ECVA 2XN0A 4NKCA 1LG2A 4D8LA 1E44A 4JCLA 1CIUA 1H1YA 4BF9A 3SGUA 2J7CA 4MUPA 2PA6A 4AY7A 5LNUA 1UZHA 1OFPA 1UA7A 2XVPA 1NTHA 2E8ZA 1DWIM 4MZYA 1EJ7L 4IP5A 1Z9AA 3T0CA 4DZHA 4UFKA 2GVLA 4WRHA 1JGIA 4UMBA 2ZX8A 3AIWA 1DJHA 1EGMA 4QLLA 2G3JA 3HM7A 3L4XA 3U6WA 1YQ2A 3RG6A 4C6OA 4DRHA 2E5CA 3UZ5A 3O5IA 4V1XA 4LAZA 1EL3A 5TQLA 4PBGA 3A3HA 4GLEA 3QSTA 1RBOB 1WZMA 1IXOA 1NY1A 2F4EA 4UTHA 1QNPA 3AYVA 4GJIA 2D2OA 1KBJA 3W72A 3G1YA 1FAPA 2UBPC 4GX8A 3T0DA 3C0SA 2O55A 5F1VA 3LOTA 3OO2A 4HBEA 3WZ0E 3GNRA 3CGNA 1NARA 5IFPA 2C1GA 2A0NA 1TZ7A 4L4MA 5C9ZA 3ZZ1A 1SPQA 4GNVA 2YSWA 4DX3A 1HJXA 4XUGA 2QV4A 2YW3A 1PWLA 1Q6HA 5G2IA 3FGCA 1EFZA 3VDCA 4IT6A 4A3RA 3CV1A 5I02A 4I9TA 3N1AA 4B92A 3SB0A 1Q1CA 1OZQA 3QV8A 4QSHA 4WY0B 3LERA 2CC0A 1AQMA 5I3DA 3OYZA 3BO9A 4W84A 1YXCA 4M0XA 4ZOEA 2EPKX 4M29A 3ATZA 3TN5A 1QI0A 2ZC1A 3UXIA 2XFWA 4TR9A 3UWVA 1TJ0A 2IKHA 4M56A 1A50A 2E25A 2P10A 3CO8A 4LPCA 4LC6A 1KFBA 5C2XA 1Q6GA 4IHCA 1ZJAA 4Q8TA 3QMRA 3C56A 1NDYA 3RLVA 3NXFA 1VFOA 1TPVA 3CHCA 4HCHA 4C6JA 4BKNA 3MWCA 3AYTA 3O5GA 3W70A 4MJMA 4NX5A 2YR1A 3GO2A 3KCOA 3PK7A 3QZ6A 2VQTA 3B9AA 4HARA 1KB3A 3ARXA 4KEVA 3GTNA 1F5ZA 3EWCA 1EB3A 1VP5A 4J2MA 1I2PA 1DVJA 2I57A 2CLIA 1F74A 3FHAA 1GPFA 1BVNP 3KDOA 3DBNA 4N9BA 1JF5A 1DJNA 2HNHA 2VRQA 2W61A 1MNSA 3L65A 3ZJ7A 4S23A 2ZUVA 1JR1A 2PD9A 1WKYA 2CZVA 7REQA 2MNRA 2E8YA 2EXOA 4F0KA 3MANA 3R13A 3H22A 1FFQA 4PC8A 4RV8A 4MAVA 3VO0A 3A12A 3EBVA 3BCFA 2SFPA 3W7NA 4A22A 5IHSA 1JCYA 1BRLB 3PS7A 2DJXA 1OGSA 4L9XA 3LN3A 3HFTA 3C3UA 4BHYA 3YPIA 5M2FX 2OOGA 2X42A 1THFD 3VM5A 5C55A 3MP5A 5CH9A 1LQ2A 2DVTA 4PRTA 3W7KA 2HTMA 4JTQA 1P0KA 3HGOA 3QPYA 3LLXA 4YL2A 2GPTA 3KCEA 2VEFA 3TWBA 1PUDA 1E6ZA 3WK3A 4AMAA 3BCJA 3TTQA 3L5AA 3MT1A 4ZE4A 2IKGA 3A5FA 4US5A 5FAJA 3B9EA 4W7UA 1V6WA 4YVVA 3P62A 1HQTA 4ADSA 1CCWB 4O0QA 1LLZA 2OX1A 5CZJA 2CBUA 5ABTA 3RJYA 3GG1A 3STCA 4CNOA 2ZR4A 1J01A 3LCFA 2Z4GA 4M8UA 4DZ2A 2WVSA 3RCNA 1MXSA 3KOZA 4TNSA 5B7ZA 5BCAA 3ZT7A 4HPJA 1IEQA 2X1UA 4N6FA 1ITXA 1VEMA 5A8OA 4S3EA 1B9BA 3MUIA 1OWQA 1QW8A 3P82A 3R8RA 1KRCC 4B5XA 4IXXA 3CBWA 1IZCA 4BI7A 4CD6A 5D9NA 4RE4A 2C0AA 3CL7A 4W9TA 1Z42A 2FH6A 1GUVA 1JFHA 1EO5A 2WZEA 4YCPA 4GGBA 1BQCA 4BQ2A 4KETA 3KTCA 1KM0A 2VR5A 4JHMA 2PRHA 2E5BA 3MZ2A 1HXVA 1A4LA 3EPNA 4IH3A 1XJBA 5I77A 4Z2KA 5D8WA 1E1CA 3M4HA 4DAIA 3KBMA 2GQAA 2BXYA 3IK4A 1CZ1A 2R6OA 3FA5A 1ZY9A 3DX5A 1ZAHA 3BLDA 2F6UA 2I9UA 1TRIA 5AHNA 1H7PA 2DH2A 4I7UA 2VUYA 4GGHA 4AQLA 3LDVA 4MDOA 3GK0A 1W9BM 2QUTA 2GL5A 1MSSA 3DYPA 4F48A 4ORIA 3CWOX 1BHGA 4FSAA 1YDVA 2FKEA 4UR9A 5HANA 2BSLA 5JU6A 3ARYA 3GTXA 2PURA 3KP1A 1X6LA 4LH8A 1XLGA 1XCWA 3LLDA 1V3LA 2OYKA 4PUWA 3WQ4A 1AK5A 2QYGA 3W02A 1JRBA 1UWTA 5TF0A 4TTUA 1W3NA 2VFHA 2D23A 3O63A 1OQFA 5CGTA 4OGZA 3GU0A 5A3HA 4ADUA 4F2BA 1GTHA 3W7QA 4L4OA 2X2YA 1GWJA 1WDQA 1J4RA 3MMUA 4B5WA 4LFYA 4GY1A 4MY1A 3LQGA 2WBKA 4LSBA 1UUQA 1ZL1A 1V4YA 2G0WA 1GOMA 2HWGA 1IT7A 1UR9A 1OBAA 2WOQA 3QJAA 1VRDA 4R9OA 5HR6A 1ZGDA 4Q7NA 3T8LA 4HIBA 4JL1A 2W66A 1FJDA 3N2TA 4IXHA 4RW5A 2XPKA 2EPNA 2VCBA 8RUCA 3BJTA 3U7VA 4I7WA 1REQB 3R8HA 5EMKA 4N0RA 1N7KA 1K02A 2OWCA 4ZO7A 2VOMA 3AU2A 1E6XM 4LUTB 1H11A 3VE7A 3G3DA 4CEUC 3TA6A 8CGTA 3EGJA 1P5QA 1MEIA 1RD5A 1XLFA 2ZQ0A 3L0KA 4MKNA 2B81A 1NFBA 1XXXA 4XO7A 4AF0B 4DVOA 1LRNA 5D32A 3TYBA 4LAOA 3TYCA 1JVWA 3QR1A 4ZXOA 1RBAA 2OU4A 3PPCA 2P0IA 5LA2A 3IHZA 2IKJA 3E96A 5I3HA 4GMEA 3IARA 1XYLA 2VM8A 1K9DA 3LCGA 1BQGA 3RGCA 5BRBA 3DDMA 4TX0A 1OX4B 4U2ZA 3L4ZA 4LAMA 4MUZA 5I7GA 4E4FA 2ON3A 1HX0A 2YKKA 1FKFA 1VFMA 2WSPA 2GGGA 4CVWA 1ZAIA 1Q6FA 3LHZA 3V5CA 4FF7A 1WE5A 2Z1BA 4IQDA 3ARZA 2OEJA 4G8TA 5D9OA 2INEA 2NQHA 3WLRA 1ECEA 5CPQA 1UC4A 1HJUA 4QROA 1KM1A 2PTXA 2F61A 1EJWC 1O5XA 5JMUA 2PDXA 3WLKX 3LA4A 4EAYA 3CQIA 3TC5A 3STEA 2ZC8A 2AL2B 3EDEA 5D37A 4ZVJA 1C91A 1KRMA 3B7XA 1CB7B 1WA3A 5ABFB 1QU4A 1CENA 3AZRA 4JEQA 1TSIA 5XIMA 4P7OA 5HNTA 3K4DA 4UIOA 3TYAA 3W53A 2R82A 1WPCA 1D3CA 4WDWA 3PULA 3FKRA 5EB8A 5HNNA 4B3ZA 5M1TA 3SY5A 4MWAD 3O5KA 3QOMA 4C6KA 1FKRA 1WZAA 3WK2A 1LQ0A 5GVJA 3S3GA 3BGAA 2Y8UA 1F6PA 3C2YA 4Q7IA 5BXTA 3P2VA 3CAQA 2QDGA 3VIKA 3VKDA 1UR0A 4KMQA 3LD5A 4LAKA 1L6FA 4P8XA 3BAYA 1RLDA 3OOQA 3PRAA 2QCEA 3KL0A 1PJ9A 2VX5A 4H00A 3THUA 4U31A 3RPMA 3D3FA 3VKKA 3WH8A 4LANA 2V63A 1ZP3A 2ZZ5A 1PL9A 4CUCA 2XFFA 1MI3A 3UWZA 2FPVA 3NDOA 1GTEA 2J8TA 2J66A 3A47A 2PDFA 1L6YA 4C5YA 4S3KA 1M68A 1Z3NA 1ALDA 1Q6IA 2G37A 3S47A 3MDYB 2H9AA 4WLCA 3GNPA 2GJNA 3N14A 1GRJA 3S42A 3CUIA 4MTVA 3DHUA 3PG9A 3CC1A 3F5JA 5I03A 3SI9A 3M0ZA 2PDYA 2EHHA 3S2NA 2IS7A 4U84A 2Z26A 3IEBA 3H9RB 4K37A 4QEEA 4JTEA 4KS0A 5CZSA 3W73A 3TW6A 3L7RA 3E2QA 1Z32X 1Q6EA 1XLEA 4WDXA 4QLKA 4AC1X 1QPRA 4H8HA 4POCA 1VEPA 3O5DA 1NDZA 3QGAC 4XUYA 5LXXA 3OA3A 3ZSSA 1V6VA 3XINA 3W2UA 5AY7A 2REQB 3GR4A 3WQ8A 4UTKA 1JAKA 3LU2A 3ARTA 2CERA 2GVJA 1UWQA 2AGKA 1QASA 4Z2JA 3PZQA 1JZ8A 3NTYA 1HKKA 5HWBA 2OYLA 1L2UA 1FHVA 3AWNA 1RP9A 3FYPA 3GAYA 2ADAA 5F4WA 1UKTA 1MXGA 2XVKA 3N11A 1JYNA 5TIMA 1GKPA 3ALGA 3ARRA 1BAGA 2QW5A 2RSEA 3TK7A 4LRTA 1H3GA 2H6RA 2HQAA 2NVDA 3OPSA 1U5VA 5FESA 3KADA 3IKGA 1FWEC 4NYYA 4S3CA 2FIQA 3N17A 2PTYA 4B3KA 2XH4A 1ZTVA 1W26A 5MKGA 2GYIA 3NURA 3ABQA 2V5LA 4O1BA 4E3VA 2KI3A 2XH0A 3GM8A 1BLIA 2OJPA 3H7VA 2V38A 3V5FA 4M6QA 2B7NA 3LM7A 3UF8A 1XIDA 3HF3A 3JS3A 3NRKA 3FVMA 1YYAA 2CXGA 1AD1A 1JCHB 2E6AA 3HMJG 4YU1A 4LCQA 4MIMA 4Q8NA 2GSJA 1VBGA 3COTA 1FWDC 4LNCA 5JIPA 1XIFA 5DRCA 4MZ8A 4LJ3A 4MPKA 1QK2A 3P93A 1OCQA 3UXLA 4ZTXA 1YX1A 1H5VA 2GJXB 2VX4A 1VJSA 3ODKA 5HT1A 2OCZA 3NAVA 2A3HA 2QF8A 1PV8A 1C8QA 4S39A 4PUJA 3JW7A 1ZCCA 5AHLA 4Y90A 4HTBA 3C0LA 1DBTA 3BGJA 5DXXA 4WVXA 2PC4A 3CQJA 3GIQA 4JD4A 1NOUA 3KAHA 3LLFA 1G9HA 3L9CA 4AIOA 2BASA 2IXVA 3HV9A 1T8QA 4QX4A 3N15A 5DXYA 4HSOA 3CASA 3O7UA 4C6QA 2HE5A 3SCTA 4IM4A 1YRRA 3FVDA 3M64A 1QPQA 3VI2A 4W87A 2QV5A 3AYRA 2KAUC 1X38A 4AMCA 3THDA 3DYMA 3MV01 2WSRA 2YCLA 3C2OA 3G6MA 2Y7FA 3M5ZA 2BS9A 2XN2A 5KZMA 3O8AA 4ZOAA 5CPSA 5HK4A 4N4PA 1VFUA 3T2OA 1E5JA 1SQ7A 4KCUA 3UZYA 1EA0A 3A64A 2WMHA 3CV2A 4GHRA 4XTIA 4BF7A 3VIJA 5FCZA 4TW7A 3ZLHA 5D05A 4J3ZA 2GVYA 5D75A 2CETA 2E3ZA 4XK2A 4PTWA 3NQ8A 1K03A 5J6EA 1XYZA 2YA1A 1S1PA 2J62A 4GGQA 4PYSA 4UWMA 3W38A 1Y0OA 3TQVA 4FNSA 4GO8A 1S5NA 1IWAA 3PPGA 4WKFA 4A3QA 2VC7A 4FP1A 3H7RA 1F4HA 1FKBA 1FWBC 3GX9A 4BF5A 1YEYA 3GE7A 2OELA 3USZA 7TIMA 4A4AA 4GCXA 3M07A 1US0A 3TTSA 4ODKA 2V3DA 2VJXA 3EB4A 4B9YA 4F0MA 4BJHA 5CG0A 3N34A 2WVUA 3R11A 3BQ6A 1KKOA 2VX6A 3T9PA 3L68A 3W24A 4LV9A 2W63A 2X1IA 4KWWA 2UZ5A 4HZ6A 2Q02A 2PS2A 3GUWA 1GZGA 3KOWA 1X97A 1NWSA 4H2CA 4H8UA 4PMDA 4BA0A 4H3DA 4HOZA 1R9HA 2YDSA 3UI5A 4CU6A 3W7LA 4GVFA 3ICJA 4PUNA 1EJRC 2Z29A 3LI0A 2GGIA 4LU0A 4DO5A 2DSZA 1FX6A 3UI6A 3DGRA 2OWXA 1NF0A 2Z2UA 3GFXA 4XG1A 4IT1A 4UFJA 2DU2A 3C5QA 5I24A 2ZCGA 1QTWA 4HHLA 5H91A 3GS6A 2ZRWA 4R34A 2D0GA 4QZVB 3QN3A 3H4WA 4QDPA 1LWHA 4IMEA 5IM51 1VYPX 1ADOA 3NQ7A 4RK8A 4FS9A 1V0KA 3PRDA 2VZUA 2EBNA 1H0IA 5DF0A 1K4HA 3FEQA 2PFHA 2Y89A 4B9ZA 4O4WA 4CN6A 3OZYA 4JIEA 2PWFA 1AQFA 3EWXA 1JZ2A 2Y88A 4UQ9A 3CWHA 5BROA 3NZ1A 1EWEA 1V79A 1SJAA 3EXTA 1UPMB 3KZPA 1F3TA 4JFWA 2PN0A 1W5OA 3L5LA 3WH5A 1GVIA 4DIAA 5E5CA 3UNTA 2CHNA 2QJNA 1D8CA 3U8GA 4F3HA 1F8AB 3BTNA 3PJUA 1SFJA 4AC7C 1RCQA 1GVRA 3N4EA 4MWAA 2OEKA 4S3DA 2KX9A 1Z41A 1D7KA 5C7HA 3IANA 4ASTA 1PKNA 3I6EA 4JTJA 2C79A 1XSJA 5A95A 1V7YA 4Q7BA 2HS6A 3MY9A 2CLMA 4Y9PA 3WFLA 1JCLA 4AD5A 1WDPA 3UWWA 2ZICA 2NWSA 3RM4A 3VE9A 1ZCNA 3CAKA 4L1WA 1TUFA 5I78A 4UTWA 3Q4DA 5HMEA 3SECA 3LYEA 1F2JA 1BFNA 1RCOB 4ROQA 3LV6A 4AX6A 4WOQA 2IQTA 4ZBCA 1HT6A 4Q6XA 4RE0A 4WDUA 3AQUA 3H2OA 3BG5A 1NMWA 4HCDA 1L0PA 1XHGA 1MUMA 1XW8A 3O2LA 3ZO9A 3UR2A 2YZRA 4ACZA 3NIYA 3AHXA 3STGA 2NXIA 4JTAA 3OB8A 4X63A 1NJJA 3W1NA 3HJEA 3QV7A 4PMJA 3ZVHA 1EQCA 4JIPA 4DYJA 4FK9A 2E1DA 1GT8A 1FKKA 2PV3A 3WQDA 4GA8A 4JICA 4FA3A 1OF6A 1BXCA 4PBFA 1A5CA 5LSMA 5HWNA 5EMYA 3UCDA 2Z1WA 1BGGA 2OVLA 4JFKA 2O56A 2TMDA 4IPXA 3O06A 1P0NA 3NYDA 4WJXA 3FN9A 3M5YA 1FHDA 4DWSD 1C93A 3MO4A 4O8AA 2WPBA 3DG6A 1F3XA 1EJXC 4L80A 1JZ6A 4J3WA 1QPNA 2VNCA 1QPKA 3G1FA 1OM0A 1YTKA 1JCMP 1Z48A 3HQ1A 4IG2B 5HR7A 5CZKA 3IIPA 5EMLA 1YTEA 3LPOA 3T6CA 2OZTA 1U1JA 1W9DM 1PE1A 4FR1A 3WYZA 3E6EA 5BRPA 3KHDA 1X1ZA 5H6HA 5HUPA 1NP0A 1KLZA 4MKVA 3TZFA 1BL4A 4ZQRA 1HW6A 4NAFA 4H6RA 3HPXA 1G69A 2Z6JA 1BYCA 2CESA 1QI5A 3PTDA 5E9XA 2ZUWA 4UOQA 3IGSA 2MLXA 3NVTA 3FJNA 1CGWA 5ABGA 3OZMA 4XQ6A 4HTYA 4YYCA 1I8JA 2R1PA 4KRZA 4DQWA 2BP1A 2OSWA 4IIBA 2ISSA 3KVMA 3GYEA 1DJYA 2VURA 4HMEA 4IX0A 4HA3A 1YPFA 1ML1A 4N9CA 4DLFA 3GDLA 1R7OA 3L4YA 1MEHA 5EKYA 4ODRA 1T40A 4TU1A 4O17A 3ZWSA 4TVUA 3NQ2A 4NJHA 2P0OA 3M16A 1MZRA 3RGTA 2E68A 3PY2A 4J9JA 2BY1A 2PPOA 1EYEA 4KWOA 3OLGA 3F5KA 1XQKA 2IPWA 2D2GA 1B6CA 2PPGA 1OINA 3HPAA 1EBGA 2VFDA 5HAOA 5F4XA 1QAPA 3ONCA 1XFBA 3LTSA 1GYMA 2YCJA 4IMCA 3SR7A 3B0VC 4H9XA 3KBWA 2UY3A 3HG4A 1Q3NA 2BVYA 3F5LA 2HZGA 3SM0A 4OFCA 1L8NA 2QCNA 2XP8A 5HMFA 2CWNA 4AIEA 1W3LA 5CSRA 3R6IA 1FP9A 2XFYA 3LUOA 3C8NA 1FWGC 1TV2A 1DKWA 5HWMA 1RALA 5HMSA 3DGBA 1VF8A 1O94A 1A5OC 3EMZA 1GW1A 1D3GA 5AC5A 1X96A 4DBEA 4LS0A 1ISZA 3I10A 3GKFA 4I5UA 4BCEA 2RUCA 1X98A 1DORA 1TPB1 2OT0A 2ZTKA 2A3AA 2K8IA 1KLYA 3H26A 3BAIA 4AVNA 3QH2A 1DV7A 3FAPA 2EJ1A 3AICA 3WD4A 3DAQA 3BGGA 3EAUA 2YLAA 4XSLA 3WIJA 3ZXWA 4JIQA 1UOKA 4IISA 3B9OA 4GIAA 3RF9A 1AL8A 3SY1A 2PC8A 5JH8A 1F3EA 4BI5A 2DSVA 4GIYA 3QF0A 3ZYZA 3UWQA 5E93A 2OZ8A 4GYFA 2A7NA 3HFYA 4N6EA 4XIAA 3N18A 1EEPA 4X9YA 4I9AA 4D6JA 5DX7A 4AIBA 1W1A1 3BJSA 2ZDRA 3TSMA 1VENA 3T05A 5XINA 1V77A 4QRNA 3VIGA 1B0IA 1R2TA 3B40A 4YVPA 1J0ZA 1VHCA 3UXDA 3W2NA 4GWEA 5C9XA 3GNNA 1LBMA 3W7GA 3WLPA 1VB9A 4U28A 3O5EA 1MO0A 4G5DA 5TNVA 1U33A 4YHEA 3VIFA 4MB4A 5FSDC 4EIVA 3VDAA 4C1NA 3SW6A 4NZ5A 4M7SA 3JYMA 4Y2WA 3B3DA 2BG5A 3BLIA 2WQDA 5IFTA 5FSEC 2C14A 3VIOA 1A0CA 3A23A 1VLIA 1AL7A 3DENA 5HATA 4GI9A 3E2SA 4J27A 4PSRA 1XIMA 5JBEA 3RLUA 3W25A 4RZ5A 3M43A 3GQYA 1B57A 3GRIA 4BWLA 2PP3A 1PZ1A 3WMCA 3FOKA 4X2RA 4FLSA 2Y7DA 4WGHA 4C90A 3FAXA 2BVWA 4W8LA 5DIVA 2BGQA 3KCLA 2ISWA 1IIGA 2GQ8A 3BQ5A 3TEVA 1TREA 2XP6A 3AHTA 3S6OA 3AAMA 2F9RA 4V28A 1YE4A 3BCDA 1XCXA 4Z42C 1S3TC 3REQA 1P0BA 4FALA 2Y62A 1J4EA 3KAOA 3GZAA 4AU0A 4DXVA 4JFMA 5IXEA 1ISYA 1DJGA 3IWPA 5FKYA 1V08A 3BJFA 3VC6A 1UHVA 2BVDA 1RZMA 2DT0A 4J3XA 1XLIA 4JY9A 1R86A 1CXFA 3C52A 4NRSA 4JHZA 3ITGA 4W4QA 2XTKA 4ZCWA 4FNQA 1TWDA 2EGZA 1CGUA 3UQAA 4WUIA 4W9PA 2C1HA 5FEPA 4JR5A 4X61A 1PIIA 2DQXA 1AW1A 4CEXC 4GZ7A 5F7UA 4IQLA 1SSGA 5DANA 2R1KA 2HBVA 1ZBVA 4ICCX 1MZHA 3VOCA 1PCWA 4J35A 5F1UA 4JFLA 3PBMA 4DHGA 2KR7A 3URNA 5HPOA 1VCFA 2XIBA 3C2RA 2ZX6A 7CGTA 3EX6A 4IGSA 2XM2A 2ZKMX 1UOZA 3A4WA 1R3RA 2VWSA 3KW3A 1EC9A 1OFDA 4G56A 1G0CA 4DM1A 1XISA 3HZ3A 1F05A 3HQPA 1TFVA 1V02A 2FGLA 2BB0A 2OOFA 4TW8A 3SUUA 4QJ5B 4GUGA 1H50A 3WFAA 3ABSA 2RQSA 4JKLA 4I6KA 1VCVA 5AECA 3V4BA 4NXSA 3UA3A 1WOAA 1H61A 2QPSA 2YFOA 3FA3A 4IJRA 2PWUA 3MHFA 4B5NA 1TRDA 4AUBA 4JFJA 2OO6A 2D0FA 1UBPC 3PC0A 3PNUA 1Z6KA 2GDVA 1SSDA 1TKKA 5DN1A 1QRQA 3W2MA 1A5AA 3IUHA 2VYOA 5B7YA 2F2HA 3UXKA 1LWIA 5AHIA 5FF4A 3FGCB 4FX6M 3LCHA 3K2GA 1W31A 1BEUA 2B7PA 3GXMA 3W9ZA 3MS8A 5LNRA 2GJPA 2HSAA 3AXXA 2V5BA 4QIUA 2DEPA 4NJIA 2WHMA 3TSDA 3CLMA 4GO9A 4A6GA 3NZQA 4DWSA 4HU4A 1O5RA 1WP6A 1E5NA 2RUSA 3RFAA 3EKLA 2GVEA 2R94A 5JVLA 4HU3A 5BOEA 4XKMA 5H2ZA 4ODQA 1J2WA 1T7LA 3IGUA 4PODA 3N3TA 1GYLA 2FHCA 3WFZA 3DFQA 3MQTA 4GNKB 1GOXA 1WDSA 4MAZA 2FZNA 4ES4A 4FNTA 3QTPA 4PMNA 3QTGA 1YHTA 2DUZA 4I9JA 3DEQA 3MC5A 2WKLA 3VU2A 3LHVA 4NAFB 4PUUA 3LCIA 4D6CA 2A3EA 2XN1A 4GQ0A 2EEXA 4FXSA 4BEUA 5F4SA 4F8XA 3VPLA 4KPLA 3W6MA 1UW9A 3ALFA 2ZYFA 4NX0A 2XDFA 4RKAA 1L6WA 4LT9A 2NT0A 2CZFA 3PNZA 5A6LA 1IZKA 2QULA 3VX0A 4P7NA 4OZOA 3DZ1A 2CZ5A 2J6XA 2ABBA 1D7JA 3VMPA 1HJSA 3JVAA 4DPQA 3IVSA 3GG0A 3BOFA 4C1LA 3OQ8A 5J5DA 1AA1B 3L4TA 7REQB 2DV0A 3LTYA 1Y8BA 1Y5XA 3NGFA 3FAWA 4R88A 2NQJA 2AL2A 5HUAA 1HXJA 2OYMA 2Z1KA 4DZ3A 1VLWA 3PFRA 4MGVA 2DZAA 5DY2A 3TDBA 3GVGA 1QI4A 1R3QA 4ONVA 3BARA 1IGSA 1IXQA 3QBUA 2VFIA 4UZSA 5T9CE 3L2IA 5A8QA 4GY7A 5CBIA 4A2RA 2Y2WA 5CGMA 4QCEA 1E6QM 4PH6A 3AMGA 3SFKA 1KCLA 1EOKA 4CNTA 4EXQA 4EOUA 4XX6A 5D2YA 1WUFA 4WSJA 2BWGA 1DXFA 2CWXA 1BG9A 5BXRA 3PB0A 3I3EA 5CJ5A 3GR7A 3MKKA 2P8CA 1KFEA 4JKKA 3S4TA 4HK7A 4Y6GA 1GOKA 4IL2A 4ICMA 4ZQPA 4XIMA 4BR1A 1KGXA 3GDBA 2CZEA 4DWSB 5U4NA 1P0EA 5JBFA 4G2PA 1C8VA 3TX9A 1TA3A 1XLBA 2IQ0A 2IPFA 4K8HA 3CL8A 2BNJA 3RUBL 3U5YA 1EJUC 3A13A 3HBLA 1RPKA 4XTDA 1EOMA 3GTHA 2Y63A 3WLNA 2PDGA 3HOJA 4JTKA 4XZIA 1ONWA 2VELA 1OIFA 4ERIA 2EPOA 2VR4A 4UFIA 4FLRA 3WLSA 2F84A 4FAPA 2CHRA 2AKMA 4DUVA 1Q7MA 4BQ4A 3HGSA 2Z28A 4FI4A 2YB1A 2ZQUA 4L6OA 1LROA 5BXPA 3FCPA 5AVHA 4ERGA 1S39A 1E4LA 1V0MA 5A8PA 1JXKA 2FMOA 1E4IA 1JNEA 5CC5A 1RR2A 4HU0A 4GI4A 1Q2SA 3PR9A 5KEZA 2HNEA 4H7VA 3CL6A 4JKMA 4C02B 2FJUB 5D04C 4DF1A 2MUCA 4MSSA 4H83A 2NQ5A 3WNLA 3CIVA 1ZP4A 4NL1A 4PL1A 3LHTA 2W27A 5C9WA 4NT0A 3ZS4A 1S3HA 1V6UA 3PANA 4E38A 2R14A 1N8IA 2DIKA 3M6YA 2B31A 3S6TA 4U2YA 7ENLA 1BTCA 1NWRA 3QHMA 4RNJA 1PX8A 3ISIX 4GH3A 1WKDA 3F4CA 3TXZA 3UZZA 3AO0A 4IGHA 1ECQA 3QMTA 1XDLA 2WKJA 3KVJA 2OKOA 4R7OA 1J9YA 3EDDA 4MYAA 3ITCA 4LUTA 2VWTA 1MW2A 2V69A 4YTSA 4M82A 2RUQA 1XQLA 3V75A 2YBVA 1UCWA 2JZVA 2CKRA 2A85A 4DWSC 2R1LA 1W1TA 2JF7A 1KM4A 1MFVA 2O7QA 3PHAA 3WF4A 3B8TA 2XH7A 4O57A 1AH3A 5DCBA 3W87A 1JFXA 3IJ7A 4Q4OA 3DYOA 3EB2A 3MP3A 1X6UA 1SMAA 1W1B1 4D8ZA 2QCDA 3EB3A 1I0BA 3PZTA 4R3UA 2PGWA 3GW3A 3AUJA 1B2YA 5HINA 3GG8A 4ZA0A 5E9AA 4YTTA 4URIA 4MHBA 4W5UA 4AEFA 4MNMA 4ODNA 1A5LC 3B8DA 4GNJA 4V33A 4UR8A 1XI3A 2O9PA 2GSEA 4LUIA 3SEPA 3RO8A 1D2KA 3GDMA 1FRBA 1UYQA 3O0FA 3PZIA 1OSEA 3H21A 2ZOXA 2JKAA 3NSNA 3WJWA 5GJNA 4GIVA 4AHQA 3TCEA 4ODPA 1MXDA 3CV7A 2Q01A 3VYLA 2Z00A 2FZDA 3CUJA 4C60A 3AS0A 3EOOA 2GWNA 1M5WA 3W1PA 2ZADA 2FAPA 1N55A 1Z44A 5IBXA 2X1RA 3E3HA 4O1CA 4W8BA 3EWDA 5FF7A 3NQGA 4PRRA 1SMDA 3ZIZA 2GGEA 2VZOA 3FIGA 3QYSA 2YA0A 3AC0A 3ZT6A 4DY1A 1AQ0A 4A3YA 2TRSA 4YHGA 1EC8A 9XIAA 3I65A 2WCSA 2HS8A 1CYGA 1HTIA 4AW7A 5GNYA 3BV7A 3VC5A 5H8UA 4ALDA 3SCSA 4AISA 2WJZA 5I5RA 4UBPC 1ZBKA 2WVVA 2OFNA 2ZR5A 3RXZA 3OA5A 3I6CA 3VGGA 1E1FA 1TWWA 2BXVA 1XLCA 3TONA 4D1JA 4HJFA 1PHQA 4KWUA 4ZMGA 1P6BA 4AD4A 4BY3A 2O7SA 1O5QA 1J93A 3UG3A 2YA2A 3SCWA 4HYRA 4XAKA 3VD5A 3DBPA 4ODLA 3DOPA 3CS2A 4KBXA 3WQWA 2G41A 4AVFA 1JDFA 3AZTA 4KWSA 3U0HA 2CZDA 1NQKA 1H7WA 1FD9A 2PDQA 4Y9OA 4HBKA 2B5UB 4UDMA 1ZHAA 2CNCA 2OQLA 3AIEA 2OMAA 1FKDA 3F2BA 1IYXA 3M7SA 2INFA 4KEZA 5D9MA 4V1YA 4R9XA 5I79A 4CKQA 3W82A 3VNKA 2RGLA 3Q94A 1EKOA 1M7JA 1P1XA 4EXBA 2EKCA 3W1LA 4L56A 4I5RA 4AD1A 2XFRA 4ROPA 1IWPA 2YCEA 1VEOA 1EP2A 1QWGA 1FHUA 2ZZ7A 4D71A 2X09A 3RM9A 4HOXA 1X8FA 2ZX5A 2HXTA 1OFOA 3PPHA 1MNZA 4LUSB 5K2ZA 1WO2A 1F8IA 1XKYA 1TX0A 2Y0FA 4PSPA 2VZVA 1U22A 1R5YA 4PB5A 3TYEA 3S8HA 3GNOA 1VIZA 4EP8C 3D3AA 3L4WA 3VNMA 4DIPA 4J3VA 4DJFC 3LHYA 3IJDA 3HTWA 4Y7EA 3CT7A 5I3KA 1S5VA 1QK0A 3U48A 2P3ZA 1ZLPA 3R94A 3MCNA 4W8AA 1ISWA 1KR0A 4JN8A 3D6NA 3M44A 3R0KA 1UB3A 4LTSA 2J7DA 3TFCA 1SJBA 2RDXA 5AZ1A 5ABEA 2VGBA 3IV8A 5AYIA 5AHEA 3V36A 3LPFA 1ISXA 3GSMA 3MHGA 3VNDA 4RXFA 4HNCA 3SZ8A 4PB4A 2A7PA 4J3TA 3CHEA 3WQ6A 1UKOA 4GC3A 5AHMA 4IIFA 4JFUA 1UD5A 5EFDA 2W0UA 1XYBA 4AHPA 1KBLA 4Q22A 3AOFA 3D0CA 2DT2A 1B31A 2XIMA 7TAAA 3R5EA 5CC7A 1TTJA 3DXIA 1T8XA 3KS6A 1JYVA 3T7VA 4IMDA 3G6LA 3OG3A 2DPEA 1E40A 3AXIA 4PE8A 2Z0IA 1XF0A 3MJMA 4KERA 5A6TC 1EXBA 4NQ1A 4QSFA 2I16A 4E4UA 3BUVA 4J2PA 5BU6A 5LYRA 1GOIA 3BOXA 3QW4B 4F9JA 2RDWA 1XBZA 1GVOA 3CTLA 3GIYA 2ASHA 4HZ7A 3S1VA 4M80A 4ZQMA 3V3WA 3RDKA 1L8PA 1G6CA 4U10A 1FKXA 4LB3A 1QNVA 3B0PA 4QNEA 2W6RA 1IGWA 1VHNA 1J2BA 3PUGA 2C13A 1HKJA 4GI6A 1R3VA 5FAGA 4JX5A 1P48A 3UQBA 2D0HA 4ZQNA 4GPNA 3UZWA 1RQHA 1FTXA 1B3OA 3FDGA 3MBDA 5HBFA 3KP0A 1TYGA 5CPMA 3U2OA 1YTDA 4EK7A 1OC6A 1TR1A 1A0DA 2ZUUA 4XZNX 1UASA 1NWUA 3IUDA 5D2VA 1Q63A 1UG6A 1XINA 4WZHA 5G4EA 4FLQA 3NWRA 3B8IA 1XFCA 3PN8A 3KEHA 3W01A 1TO3A 2CXEA 1IXNA 1I45A 3HGJA 1XIJA 4RLIA 5REQA 3VGEA 3MUXA 1KM2A 1PSCA 4IIDA 3QC0A 4QG6A 2IPJA 3Q65A 1MDRA 1HVXA 1UP3A 3W26A 1NFPA 3UNDA 1ODZA 3R2GA 1WZLA 1CEOA 2DG4A 2NLYA 3LCLA 1E0UA 1O1HA 9RUBA 4MFDA 1OCNA 3GHRA 1G7UA 3Q37A 3NPXA 1JDDA 4TX9A 4GD0A 3PFMA 3VIMA 1ZBWA 1BF2A 4IX2A 3MUAA 2NQZA 1IT0A 4ZO6A 4C65A 2EULA 3MSGA 1UMYA 1OYAA 1V51A 2YJQA 3LGDA 4F40A 2VEPA 3QRHA 3O6AA 3T2PA 1OFBA 1MRQA 6TAAA 1EP3A 4RJEA 5EU9A 2C19A 1CNVA 4MB5A 3IJQA 4IQ2A 2QCCA 1U30A 3WF2A 4P61A 4GFIA 1I6NA 1DIDA 2O9OA 3DFHA 3AYSA 4ZENA 2ABAA 2MLYA 2D3NA 1BVZA 1UC5A 2PUZA 1DEDA 3N2MA 1W1ZA 3LSBA 4AZ7A 4H7ZA 3O5JA 4EX4A 3WLTA 3N3MA 3V1PA 4GQRA 3D5HA 2PCEA 1RPXA 3OBAA 2XYLA 3U2ZA 5A8GA 4DXXA 4JTRA 2QJHA 3W07A 3H53A 3EYPA 2DW6A 3LS9A 3PG8A 1PINA 3C2FA 4P5UA 3WMLA 1TV3A 4PCSA 1A5UA 5FD0A 1IV8A 3CK5A 5L6UA 3EZ4A 3QQWA 1IE7C 4W9OA 4K36A 4JYSA 3DFTA 3KZSA 4LQ1A 4XKYA 4A05A 3W6YA 3CH9A 3TU9A 3PBUA 4IOTA 1KWGA 1LOSA 5U7SA 1F6KA 1KR1A 1KXTA 4ZQCA 3AMDA 1PTGA 3GC4A 3WMBA 3EOSA 4JTGA 2W9MA 1YDYA 4O52A 3C2VA 1ZU8A 4N4QA 3UT0A 2ZA2A 4JTIA 4TUFA 3BW2A 1Q6QA 2REQA 1GKRA 4CQAA 4LNYA 2P5NA 4XAPA 1AZ2A 2ATMA 2E9BA 3WELA 2F7FA 4A21A 2YL9A 2VDHA 3M0VA 2QDHA 4NG3A 4UQBA 3VXGA 3ABOA 1TV8A 2I9EA 3WQPA 4AZ6A 1HNYA 2POZA 1EZ2A 1Y7VA 2DZXA 3GNDA 4ZSTA 2UY5A 4JOMA 4EF8A 2GK1A 4AWUA 3FW6A 4REQA 1JDAA 3B0UX 1FWHC 3WEMA 2RKXA 1A5KC 4MSPA 3VD7A 1KBBA 2Q09A 1W54A 4MWAC 4W86A 3SBFA 3FDKA 4C6IA 4CGTA 3EA2A 4DF0A 2YYUA 1KXHA 3F1QA 3W1RA 3GFZA 3WJZA 3FJLA 3CGTA 3V0UA 2FZBA 4A8LA 2OODA 9CGTA 4C6MA 3DFSA 4R85A 2WHJA 3AXKA 1ME7A 1DJXA 1VPXA 1UD2A 3ARPA 3R8GA 4PCPA 2B7OA 4JTCA 4LRSA 4PUDA 1E15A 4XD5A 3H2MA 3UY8A 2HK0A 3UEQA 3R89A 5HJYA 1XPGA 1K7FA 2VEMA 4P7LA 2WSYA 3G2GA 3DI0A 3L2MA 3NL3A 2ACQA 2ZR6A 4O16A 4S3JA 1WDDA 4IPJA 2BVTA 3GXDA 4JNMA 2HCVA 1I2RA 4UOJA 4XAYA 4DRIA 3PA7A 3G0XA 3PBWA 3AROA 5AHFA 4BQ3A 4F2TA 2IMRA 3H2EA 5CZTA 1FXQA 3EWZA 3MB9A 3MW7A 2QGYA 3M47A 1W1VA 5BXJA 2WM0A 2YBTA 3UJEA 3CZGA 1B4EA 3KLKA 4L4PA 4O28A 1POJA 1Z8AA 2ZUTA 2FTYA 3RO6A 1PZ0A 2A3CA 2D73A 4Q4SA 3CZLA 3GLCA 4DBUA 1Y5WA 5AN7A 1AZ1A 2BBFA 4HK6A 5C9RA 3EDFA 1XRTA 1YIXA 1C8YA 1T41A 2J9XA 3Q67A 1EC7A 2J8GA 1ODUA 4ZB2A 1TE1A 2HV5A 4PFMA 2X40A 2YXGA 1PXGA 4UNKA 1EQ3A 3GFYA 3VIHA 3MVTA 4K2SA 1TV4A 2CBIA 1TWZA 4IP7A 4FZIA 2AWGA 4Z1BA 5ENLA 3MPGA 5A6SA 1FH7A 4YVXA 2GLKA 4YLWA 6ALDA 1R9ZA 5HNRA 3S0CA 5AYYA 2ISFA 5IOBA 4HA0A 2I56A 2P88A 1QZ2A 3EX4A 1S2WA 1HN1A 4OOUA 3NQ6A 3ELFA 3KXQA 3L23A 4WY0F 4HMDA 5CEWA 4U4MA 4XZMX 3E5BA 1IXPA 1DWAM 5LA1A 3FSTA 4CCEA 3A24A 4LXFA 1FDJA 4IMAA 1T6MA 1E9LA 5B80A 4PN2A 1UWIA 1F07A 3DHFA 2Z1XA 4UB9A 5D02A 1C3FA 5IBXC 4H9MA 2Z7KA 5ECUA 2O92A 4IZGA 2J74A 1JUBA 3B04A 4L7ZA 1SO4A 3MMDA 4GYJA 1XUZA 1GW9A 3WLOA 4DRKA 4RX0A 1ZENA 4PUMA 4NP7A 2PZ0A 1VYRA 3O07A 4JIHA 4YJ5A 4G7FA 3HGRA 3KL5A 3DU0A 3OZPA 1W3IA 4IMFA 4QDMA 2F23A 1AH0A 3G1SA 2G8ZA 3VAWA 2BHUA 4M24A 4AWEA 4CCDA 4GXWA 3RM8A 3GHUA 3KL3A 4Q4PA 2GUUA 5E0KA 3UF9A 4KEMA 3LM3A 3OLDA 2Z1SA 1OD0A 3G1RA 4JTSA 1YBQA 4TVDA 3SIZA 1I2OA 4AH7A 4UTMA 3SJ3A 4HT3A 3ME3A 1F40A 1W17A 4OBTA 1QHZA 1N82A 3SSZA 2UV8G 4KR0B 2Y6ZA 2UWFA 4UTTA 3GH5A 4WKAA 3H24A 1YW5A 4H2HA 4PTDA 2ZE0A 4C1KA 1O1ZA 1P0DA 3MDWA 1FWJC 2Q71A 3WDJA 2A6NA 1UIPA 4AD3A 3C8FA 1L9WA 3LG3A 1U5HA 2L2SA 3G8EA 4H9UA 1KFCA 1TVPA 2C8NA 4QDWA 3U4AA 5DT7A 2VOTA 2Y5SA 1C29A 4JYEA 1W91A 3GVQA 2F6XA 2DQWA 2XIOA 3DFOA 1UR4A 2NV2A 2OSXA 2V8ZA 2IXUA 3Q45A 1E9IA 4RXGA 3S5SA 3IGXA 2DT1A 3ENLA 3M1ZA 1A49A 3I4EA 4TIMA 4PUKA 3MHUA 1E55A 1BF6A 3K1GA 4CQBA 1UWSA 2NSOA 2WPGA 1WAUA 3A9IA 4QBXA 3PZOA 4ZODA 1W5PA 3NOEA 1OZMA 1DE6A 1PKLA 2PDJA 3RR1A 4YPJA 3FFSA 1YADA 1EX1A 1J11A 2E6FA 4EPKA 4JNZA 4WJ8A 2ICSA 4Q4QA 2HE8A 4GQBA 3GBDA 1EA9C 2RAGA 3W85A 5DBUA 4Q6JA 1TJRA 1EXPA 4HNVA 2WC7A 2AL1A 2FB3A 1OGBA 4DT4A 4E5TA 4K8GA 4O18A 4EF9A 4I9MA 4DI8A 3P14A 3UZJA 4LX4A 5C2CA 1EX5A 3BMXA 4JHOA 2YDAA 3IJ6A 1KXVA 5CJNA 3OVQA 4PZVA 1TPH1