3OA5A

The structure of chi1, a chitinase from yersinia entomophaga
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
515
structure length
515
Chain Sequence
KSNLIYDKDPGYVWDNKNECEGAAEETYQELNYEPSISADKLTWTPTRLAKTVFNTYEDDDDFNVLCYFTDWSQYDPRIINKEIRDTGGRSADILRLNTPDGRPFKRLIYSFGGLIGDKKYSADGNASIAVRLGVATDPDDAIANHKGKTIPVDPDGAVLASINCGFTKWEAGDANERYNQEKAKGLLGGFRLLHEADKELEFSLSIGGWSMSGLFSEIAKDEILRTNFVEGIKDFFQRFPMFSHLDIDWEYPGSIGAGNPNSPDDGANFAILIQQITDAKISNLKGISIASSADPAKIDAANIPALMDAGVTGINLMTYDFFTLGDGKLSHHTNIYRDPSDVYSKYSIDDAVTHLIDEKKVDPKAIFIGYAGYTRNAKNATITTSIPSEEALKGTYTDANQTLGSFEYSVLEWTDIICHYMDFEKGEGRNGYKLVHDKVAKADYLYSEATKVFISLDTPRSVRDKGRYVKDKGLGGLFIWSGDQDNGILTNAAHEGLKRRIKNKVIDMTPFYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chi1
publication title Structural analysis of Chi1 Chitinase from Yen-Tc: the multisubunit insecticidal ABC toxin complex of Yersinia entomophaga
pubmed doi rcsb
source organism Yersinia
molecule tags Hydrolase
total genus 187
structure length 515
sequence length 515
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3oa5A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oa5A02
1NP2A 3BAXA 3N1AA 3MSDA 2D23A 3F5KA 4CD4A 2BVTA 3BCDA 2XIBA 1W2PA 1M7XA 4MJ4A 2GUYA 1W3HA 1UD2A 1E6XM 1UOKA 3NUKA 4ATDA 1ISYA 3WF0A 2A3BA 1ZJBA 3WF1A 3B9AA 2VOTA 4F9DA 1TVPA 5LA2A 5M17A 5A3HA 7A3HA 3TP4A 4GXPA 1E71M 4D6EA 1XV8A 3RCNA 3GM8A 3VTRA 2YL5A 5IFPA 3ARXA 2J8FA 1C8QA 1W3LA 3HMCA 4NRRA 2X0HA 4YPJA 1FH9A 1UD8A 5DMYA 1FHLA 4TVCA 2BHZA 4UQAA 3ARTA 3EDKA 1R85A 2ZX9A 3IJ9A 3F4VA 3L4VA 3WELA 2WK2A 1HJQA 3WMCA 3VMOA 1H3GA 4PN2A 1XD1A 5CLWA 1CDGA 2DH2A 3W25A 4MDPA 4CN6A 2G3JA 1B3WA 2JEQA 1UKTA 2GJXB 3F5LA 3SUWA 2VZSA 1H2JA 4IISA 4TTUA 3MMWA 4BCEA 1B2YA 2YL9A 5I24A 4UQCA 5DO8A 2WNWA 4GI6A 4WSKA 4J27A 4H04A 3GXFA 1AQMA 1BG4A 3AISA 4UZSA 1KXVA 1NARA 3NSNA 4AIUA 4U5IA 1SR0A 1UH2A 3PZNA 2WWCA 1CECA 3M7SA 5IXEA 3CUJA 2VZOA 2PBGA 4D1IA 3POHA 1UR2A 1UWSA 1VJZA 3ZJ7A 1Z32X 3T2QA 3A4AA 4W5UA 2D0GA 4HP5A 1OSEA 3BLPX 5CPQA 1LF1A 3GH7A 4QP0A 4W7VA 1X1NA 1XSIA 4D6IA 1J18A 1QHZA 1XSJA 2W66A 3WENA 5EMYA 1E0XA 4AC1X 4PMOA 2ZX8A 3CTTA 4HA3A 3NJ3A 2VX7A 5JBEA 1E4LA 2EEXA 3SCVA 3MO4A 1LLOA 3VGFA 4LYPA 2XJ7A 4KH2A 5LA1A 3WQVA 4D6JA 1UD4A 4WK9A 4PEEA 4UTFA 1E6RA 3UCQA 1UHVA 2QMKA 5A6KA 3CZGA 2VCBA 3RMEA 3UG4A 1KGXA 4IPLA 3AHXA 1QBAA 5CXPA 2OWCA 1AQHA 4DM2A 1FHDA 3L4YA 1JI1A 3AXXA 3BAJA 9CGTA 2JIWA 3I3BA 2WPGA 2NSXA 1SYTA 2WSKA 2J62A 1JGIA 1E55A 3W0KA 1EQCA 5A6SA 4W8AA 1C3FA 3OZPA 4V2XA 5AYBA 1BGGA 4U3AA 5I6SA 4F9JA 1RPKA 4GZJA 1UWQA 4AD5A 1GUVA 1BG9A 4GI9A 3VGGA 3GH4A 3EMZA 8CGTA 1EQPA 4MJ2A 3UG3A 1GVIA 4ACZB 3PZQA 2OSWA 5A6BD 1V03A 4MNMA 4XV0A 2IXVA 4A3YA 4W7UA 5AC4A 1VIWA 1UYQA 1U2YA 3OLEA 2WVSA 5BROA 6A3HA 1L0PA 1MFUA 2WYSA 2RGLA 2YBTA 4S3JA 2PI6A 4TX6A 3PZ9A 2W5FA 2C0HA 3AXHA 4JFTA 1V3JA 3VUPA 3CIVA 3WDHA 5A6LA 1VEOA 4D1JA 2DT2A 3VD3A 4JKLA 5BYWA 1DWIM 1G0CA 1W1PA 1HIZA 5D9NA 4ML4A 1JDDA 4W8BA 3OBAA 3RPMA 4AISA 3FXYA 1EDQA 3W28A 1QHPA 3WUEA 5CSUA 1JIBA 2IUZA 2O9RA 2G3NA 3K8LA 1V0LA 2GJRA 3DHPA 6CGTA 2DSVA 2VQTA 4GQQA 2W4XA 1V3KA 1E0VA 1ZB5A 2Z1KA 1JZ6A 1QNSA 3AMKA 3WD0A 3OB8A 4IUGA 4BQ4A 5A95A 4GKLA 2JALA 3VOCA 1E72M 1EO7A 1WZKA 1FA2A 4HU8A 3AS1A 4S3KA 3QHNA 4TX8A 4CD8A 2GSJA 1JXKA 2V38A 1W9PA 2X2YA 3AICA 4PRWA 1XH1A 3SEPA 2W91A 3WH5A 4C7DA 1XRVA 1NWTA 1WPCA 1XC6A 2VURA 4Y7EA 1OM0A 4TVUA 1LL4A 3VD4A 4P7OA 1ZL1A 2O9TA 3CUGA 5EBAA 1N82A 1H09A 2XVLA 2GK1B 4PMZA 1B30A 2VMFA 3I3DA 4Q22A 5C8BB 2ZIDA 1W3KA 1NOWA 4DM1A 4AZCB 1TR1A 1VEMA 3WDJA 4QLLA 3VX0A 2QV4A 4JHZA 3WBAA 1EIBA 5A69A 4ZENA 2BY3A 1CPUA 2XUCA 3KL0A 2J4GA 2G4FA 4HMCA 5DEZA 4MTVA 1E70M 1KFWA 1QI0A 2OYMA 5I0DA 2DT1A 3BXWA 1R87A 3EDDA 4D72A 2NT1A 3NSMA 5BRPA 1W9DM 3U57A 1A47A 1PBGA 3BSHA 4W93A 2WANA 4AY1A 1K9EA 1GPFA 2VNCA 1GQIA 3WFZA 2CHOA 2VQUA 3VGDA 2WB5A 2EJ1A 2XVNA 1MYRA 1ODZA 1WDRA 5D9OA 3VU2A 1B3VA 1DP0A 3KWXA 3WF2A 3CH9A 7CGTA 1AMYA 3WUGA 3ARYA 5D4YA 3ZJ6A 2VVNA 3WFLA 4J3VA 2BVYA 1H4PA 1H0GA 3APGA 3SCWA 3VIJA 5E9AA 1O6IA 2YBUA 3LPPA 4UFHA 2TAAA 3IAQA 3A47A 4W89A 5GPRA 4HMEA 3SUVA 1I1WA 5F7UA 4TXEA 1JZ4A 1LG2A 2CHNA 5CGTA 1BYDA 3ZOAA 5D9PA 5I5RA 1H41A 1EH9A 3EMCA 5BXRA 2BY0A 2EPKX 1QHOA 3SCRA 2JFEX 3RIKA 1B31A 3F5JA 4UZUA 3AYRA 3ZSSA 2GJXA 4KWUA 1UUQA 4QLJA 3WIJA 1V3HA 3WNLA 1B3YA 3U7VA 5FOOA 4R27A 4M82A 1ITXA 3WEZA 3AZRA 4GI8A 8A3HA 4K68A 5A2BA 2WBKA 3W24A 4AEFA 1BAGA 2ZUTA 1F4AA 2GDUA 1QI2A 3CHDA 1EOMA 2DEPA 5BRQA 4H8HA 1TA3A 5LYRA 4UOZA 1ITCA 1V3IA 4IPNB 3VMPA 3A4XA 1LL7A 1ZU8A 1W9BM 5DT7A 1W9VA 3K8KA 2CITA 3QHOA 2GJPA 3KL5A 1JZ2A 1NOFA 5EFFA 2BV9A 3PZVA 1JL8A 4CU8A 2QLYA 4KGJA 1CBGA 2CNCA 2VO5A 1RP8A 2RGMA 4D6FA 3T08A 1WP6A 2DH3A 1UWIA 1WDSA 4AZ6A 2WAGA 3G6MA 1LL6A 3AZSA 5M3WA 2PF0A 4OKDA 3ECQA 1OT1A 3VINA 1HL8A 4FF5A 2CBJA 1W1TA 5C71A 1VJSA 3N18A 4B3KA 3SIMA 2WMHA 1WZAA 1I75A 5ABEA 3WUBA 2DQXA 1E4IA 1W3JA 2XG9A 3N04A 5A6JA 1GVYA 2J7FA 4B9ZA 1X6LA 2CKSA 2CCRA 1WNOA 3PBGA 3RDKA 2BVDA 3K8MA 5FD0A 4AD4A 4FLSA 4JL2A 4R5EA 2BNJA 2Y8VA 1SFSA 3RM8A 1P6WA 2VZTA 3VIIA 3VMNA 1DWFM 1OINA 1KB3A 2WC4A 1K9TA 1U30A 2YJQA 5CZKA 3QHMA 4N0RA 1EO5A 3VPLA 2WM0A 1NWUA 1CWYA 5HPOA 4HMDA 4RL3A 4ZE5A 2DDXA 4X9YA 2YL6A 3MSGA 2DSUA 3T09A 4F8XA 2WHLA 1MFVA 4XZWA 1ECEA 4LX4A 1L8NA 1BVNP 1HKMA 1KR1A 4M29A 4HPHA 3CUIA 3BH4A 2PWFA 1GORA 3SCSA 3BGAA 3TTSA 1CZ1A 2OLHA 2WMKA 1KQYA 2WXDM 1K9DA 2E8ZA 1V6XA 2E3ZA 2C8NA 7TAAA 3BMVA 1QNPA 3ZJ8A 4XB3A 4H8VA 1EHAA 2JEPA 4QLKA 1KXTA 2BFGA 3AIRA 3DECA 3GNOA 1UR8A 1B0IA 4LQ1A 3ZM8A 2NT0A 5C70A 2C7FA 4P8VA 2E0PA 1Q6CA 3A3HA 1E3ZA 3ALGA 2FHBA 1XH2A 2W63A 4GO9A 3MKKA 2ZWZA 3RJXA 1AQ0A 2QHAA 3RM9A 4DWSD 2WZIA 5EB8A 4P8WA 4AD1A 1DHKA 1XSKA 3EBVA 3T2PA 4NI3A 4W5ZA 5JIPA 3CZLA 1E5JA 2Q8XA 2FDMA 5CPTA 5I77A 1JXJA 4HZ8A 4JKMA 4AZ5A 1M03A 1UH4A 3FAWA 2HISA 2ZUNA 1E6ZA 2ZXDA 3DYPA 1UG6A 2JF6A 4LYQA 1Q6GA 3SUSA 2BXYA 3AIVA 4GPNA 1GQJA 5BXSA 4DUWA 4V28A 4P8UA 2WVVB 2CBIA 4JHOA 1CGWA 4CVWA 2GK1A 2YDQA 1W2VA 4CU6A 2ESCA 4UFKA 4AZ7A 1FH7A 1C8XA 1ZJAA 1OD8A 1V0NA 4EK7A 3N11A 4HZ6A 4U2ZA 1M53A 3ARSA 1HN1A 1J12A 4AZCA 3ZT6A 2OWXA 1JDAA 3AIEA 1OWQA 1TVNA 3WMSA 5JH8A 1J0YA 2WHKA 1TG7A 4FLQA 1OCQA 2V3DA 2VT0A 4B16A 3GXMA 3PZMA 3N15A 3VDHA 1EDTA 1JF5A 1CGVA 4A4AA 1CGTA 3IJ8A 2DIEA 4KMQA 1J9YA 2J7BA 3ZR5A 3PZTA 1J0HA 1UA3A 2XWEA 1VBRA 5IHSA 2PC8A 4W86A 5HOSA 3MANA 3M46A 4CCCA 5I2UA 1TMQA 3OGSA 2VC9A 1VFMA 3MV01 1TUXA 4Z2HA 3WD3A 3CPUA 1E1EA 3VIFA 3CLWA 4PUDA 3VGBA 3A6OA 4M81A 2HVMA 1XYZA 1ZBKA 2Y5EA 2VTFA 5I78A 1GHRA 2XSBA 1KR0A 5E0CA 1QNQA 4PTWA 1JAKA 3PTQA 3CHEA 3B9DA 3ARZA 1VFUA 1J11A 1OIMA 4BA0A 1GOQA 1SMDA 2F2HA 4N42A 2VX4A 3B8SA 5E6YA 3UR8A 4GZEA 5A8OA 3SURA 3FY1A 2ZX6A 4AZBA 3VDCA 2VR5A 5IHRA 3BCFA 3W26A 2ZUUA 3ARQA 1XYFA 2O9PA 2YKKA 1H0IA 4AZHA 3FAXA 2D0FA 4CD5A 1H11A 1U33A 2WW5A 4JFVA 2J7HA 3L4TA 3VIKA 2XIIA 3E1F1 1FH8A 3WDIA 1DWAM 2EO7A 1MXGA 3PZUA 1GONA 3ZIZA 1XH0A 1MW1A 4MB1A 1LG1A 2WSPA 2WLYA 5D8WA 2WWDA 2QF8A 2GVYA 2J7EA 2XWDA 3HJEA 2X05A 4U5KA 5ABFA 1UA7A 2CEQA 1JAEA 3IK2A 3WD2A 4AD0A 1G9HA 1UQYA 3AJ7A 1G5AA 1H5VA 1UWTA 1E6SM 3NCOA 3KE0A 4B9YA 2FGLA 3GYCA 1PEZA 3FN9A 4B3LA 1NWSA 4KRTA 3FW6A 2UY5A 3VVGA 1ZBVA 4AIOA 4HA4A 3CZEA 1RD6A 3W81A 4E8CA 2YOCA 1UWUA 3L2LA 1HP5A 3NIYA 4D6DA 4WSJA 3WMBA 1LQ0A 3AROA 3BLKA 1E6NA 2D20A 2J78A 3VNZA 1PIGA 3WSUA 3VKKA 2X8RA 1OB0A 4FMVA 2DPEA 4J28A 3T0DA 1BGAA 2YDSA 2D3NA 4W84A 1WE5A 1QW8A 1ZBCA 4C7FA 2XHYA 4CU7A 1W32A 3UEQA 2G3MA 2OYLA 3SCPA 2CKRA 1R7OA 1C91A 1UKQA 4ZFMA 1GOOA 1QI5A 2WCSA 1O7AA 4J3UA 2XFFA 1HP4A 2J8GA 1JNEA 3AMDA 2Y4SA 3O6AA 3L4ZA 1HJVA 1UKOA 1TCMA 2XGIA 4XZBA 1JYXA 2X0YA 2YA2A 1HX0A 1OD0A 1NWRA 1UQZA 5BCAA 3W53A 2UY3A 3LMYA 2QPSA 4L4OA 3WL1A 4F66A 1VRXA 5HXMA 1BYCA 2EBNA 3EDEA 1KWKA 1CXFA 3CUHA 3IANA 1B90A 1KXQA 5A2CA 5GQBA 1KBKA 4OBSA 5D9MA 1NH6A 4BS0A 2W62A 2D0HA 3W82A 4W87A 1XCWA 2VX6A 4J7RA 2VUYA 1E5NA 3RILA 2V5DA 3CZ8A 1QI3A 3OZOA 4JFSA 1D3CA 1W91A 3THDA 4F79A 5A6BA 1G94A 2ZUMA 5A8PA 3SCQA 3MUIA 4UFMA 3WKZA 1MW3A 3NSXA 2DT0A 3L4XA 4QCEA 1QVBA 1HVXA 4YN5A 4M8UA 3AHVA 4MB3A 1GZJA 4ATLA 2XGBA 4AZIA 1J10A 3QOKA 4MNJA 2XFYA 5FIPA 2QMJA 5ABGA 1CIUA 3FHQA 3RO8A 3BAKA 1BHGA 2G8ZA 1XD0A 2XYLA 2J77A 3I3EA 1GQKA 3GNPA 1C90A 3UERA 3K46A 2YLAA 3SUUA 2BY1A 3O2LA 3AS2A 4PTXA 4DUXA 3OG2A 1GJUA 2V5CA 3GBEA 1HNYA 3VD9A 3WNKA 3WNMA 3ZQ9A 2WVTA 1CLVA 1V6VA 2WKGA 3GDBA 5IDIA 3PTMA 1JD9A 2VRKA 4AEEA 1JG9A 3J7HA 2W67A 1H1NA 4JFUA 2EQDA 5JBFA 2WVUA 2Y2WA 4TOQA 4AIEA 3AFBA 2IXUA 4OJYA 4DWSB 3S2CA 4JCMA 1CENA 2EPOA 3DYMA 1KCKA 1HKIA 1EXPA 4PMNA 2CPUA 4J3TA 3UR7A 1C7TA 1V3MA 4QDMA 4AYSA 3A4WA 1WDPA 4XX6A 1HJUA 1Q6DA 3T2OA 4AXNA 4V27A 4FLRA 3W38A 5HDRA 1MVYA 1PZ2A 3GBDA 3GTNA 3VILA 3CGTA 3T0AA 3AHTA 4L4PA 5CGMA 4LGXA 3LPFA 1Y7VA 4D6HA 3CMGA 1R86A 3OGRA 2WHMA 5BXPA 1JI2A 3DHUA 4GQRA 1WKYA 2ZUVA 3ZO9A 3CMJA 1CXHA 1EGZA 5DF0A 1WCGA 3PZGA 1V02A 1LWJA 2XSAA 3DYOA 3WDQA 1JZ8A 1C7SA 3CZJA 1QW9A 3GXDA 3O9NA 3WNPA 2DSKA 1IZKA 3AIWA 5E70A 4ZEPA 5AC5A 3VIHA 1UH3A 1CYGA 1S46A 3AIQA 1JDCA 2YLLA 1HJWA 5A1AA 3CHCA 1E15A 3WQ4A 2ZWYA 2ZXBA 3PTKA 4RE3A 1YQ2A 4ATWA 2NW0A 5I23A 3WQWA 1C8YA 4P7NA 3TA9A 1V6UA 4WJXA 4Z2IA 4E8DA 1KQZA 3AMCA 1HJSA 1EHNA 4ACZA 4UCFA 1B3XA 1EA9C 1CGXA 4UFJA 4D6CA 5CPSA 3PN8A 4CCDA 1MXDA 3K4AA 2JF7A 2V3EA 4AMCA 1TFVA 1E40A 2XTKA 1B9ZA 3SCNA 2CESA 3G6LA 2CIPA 2PWGA 1M01A 1MQRA 3SUTA 1JZ5A 4A3HA 1JFXA 1GNXA 4AWEA 4WLCA 2D24A 3WF4A 3L2MA 5FKYA 1MW0A 1H49A 4P7QA 4H8UA 1FP9A 3AI0A 3K4DA 3FHAA 4AW7A 1D2KA 4JFWA 3WUFA 5E6ZA 5A2AA 1W1VA 4ACYA 5ABHA 3OIHA 3BC9A 2OYKA 3KZSA 3OLDA 3WY1A 3GXIA 3K1DA 1FP8A 1GW1A 4PTVA 4HU0A 4IM4A 2BHUA 1E73M 3VD7A 5GNXA 3ARWA 4PMUA 1WDQA 3WD1A 1JYVA 3L4UA 1A3HA 2J74A 2E9BA 2EPLX 1QOXA 1OBAA 1KGWA 2Y24A 3NDZA 1BVZA 5IFTA 4PCTA 2V3GA 2VZUA 3VDBA 5E0FA 1WZLA 3EMQA 5A8QA 2ZUSA 2ZICA 1Q6FA 3MUY1 3MV11 1QPKA 4OZOA 3OLIA 3POCA 1W9UA 1CXLA 2VRJA 1E6QM 1PX3A 4ZE4A 4BF7A 4PYSA 5HPCA 3EYPA 2JE8A 1CXIA 3FNDA 2FHCA 5DFAA 4URIA 2VZVA 4LXFA 1XHGA 1E1FA 1GOKA 4H41A 3HN3A 4BQ5A 3W27A 1TA3B 2BS9A 2AMGA 3KEHA 4RE4A 2YIHA 4W85A 2WMIB 3AHZA 1WB0A 1JD7A 2ZOXA 5CJ5A 5JIWA 1E3XA 3TOPA 3AHYA 2A3HA 1VFFA 1CGYA 1V0KA 1NQ6A 1V6YA 4U3CA 2QPUA 2FGZA 4W88A 1R8LA 3QGVA 1VAHA 2VRQA 4PSRA 4CGTA 1CXKA 1GCYA 3L4WA 1B3ZA 1OIFA 2CXGA 3ARUA 1OT2A 3VIOA 1CLXA 2CERA 2E40A 1Q6EA 1GQLA 2FH8A 3AXIA 4UOQA 2WZHA 3AZTA 3AMGA 2DT3A 1MQQA 5GNYA 3ZMRA 2W92A 1C93A 5E09A 1KBBA 1V6WA 5CG0A 2PB1A 3VO0A 4Z2KA 3WN6A 1EOKA 3WQ8A 4HOXA 1AVAA 4TTGA 4OIFA 1VBUA 4Q7NA 2OSYA 1PIFA 2X09A 3BAIA 2WC3A 1SMAA 4UOJA 2ZX5A 1WAWA 2CYGA 4FLOA 2Y8KA 4WF7A 3T0BA 2UY4A 4BQ3A 1HF6A 3PHAA 4M56A 3EDJA 3WH7A 5A6MA 1IV8A 2J75A 1HT6A 4GO8A 2Z1SA 2D22A 4PSPA 3WQ6A 4U2YA 4JKKA 4MNKA 4TUFA 4W7WA 2J79A 3AIUA 1V0MA 3AQUA 4RE2A 2WMFA 2ZXAA 3VX1A 4YHGA 1E9LA 3MS8A 3PZOA 1EDGA 3THCA 3HU7A 3AS3A 3WDRA 3ZT7A 4M24A 5CLTA 4WKFA 4Z2LA 1MQPA 1FFRA 1FFQA 1UZ4A 3BSGA 4GZIA 1CNVA 4PBGA 5JUVA 3VD5A 1BF2A 1VEPA 4UNIA 3VIMA 3U7BA 2J7CA 1ISZA 5HNNA 5CSYA 4U33A 1DWJM 4J3WA 4PMRA 4WKAA 2CBVA 1HJXA 3WBEA 3GH5A 2O92A 4UFIA 5GNZA 3MMUA 4CD6A 4DUVA 2EPMX 3WH8A 4BQ2A 2XVPA 1BYBA 1NOUA 3WEMA 1BPLB 3UG5A 1ESWA 4P7LA 1BSIA 1UKPA 3N12A 1HKKA 2VL4A 4Z2JA 3BAYA 1K6AA 2WMJA 4PMQA 4D71A 3QR3A 1R7AA 2DIJA 3UETA 4NZCA 4GIAA 2O9OA 1KGUA 4NSBA 1HXJA 1UD3A 3RM4A 2EXOA 2JIEA 3SCOA 3WNNA 3ZJKA 3ZT5A 1OGBA 2A3CA 5JBDA 2E4TA 3U5YA 4C7GA 2FHFA 4PUEA 1YHTA 5AYIA 1JZ7A 1NM9A 1W1YA 2VR4A 1HVQA 4KGLA 1IT0A 3CBWA 3W6MA 1VENA 5KZ6A 4DWSA 4AD2A 1UZ1A 3WD4A 1PAMA 3WQ5A 4BZYA 1NP0A 3ARRA 4UFLA 3SCUA 5FL0A 1QI4A 1J0JA 1KCLA 2PBOA 1ISVA 1V02E 1XGZA 4P7RA 2ZE0A 2XFRA 5A94A 2E9MA 1BYAA 1IZJA 2XVKA 3IAPA 3WL0A 4PTMA 2OSXA 3B9EA 1US2A 3BMWA 1J01A 1I1XA 4EE9A 2DSWA 2W61A 3VIPA 1D7FA 2E9LA 2YL8A 2UY2A 2FH6A 4M1RA 3AOFA 3ARVA 4CN1A 1CTNA 4CKQA 1DEDA 4P8XA 4QCFA 5A6AA 3TONA 3CHFA 3WF3A 4B15A 3M07A 1BLIA 3VIGA 1F4HA 5HBFA 1DWHM 2XVGA 3AYSA 4NRSA 2AAAA 4U31A 5EFDA 1QNOA 3SCTA 4QFUA 3QOMA 1JF6A 2PWDA 2DGAA 2PWEA 4JCLA 4W8LA 1RP9A 1PPIA 1FOBA 2WMGA 6TAAA 5FCZA 4PMXA 4MPKA 2D2OA 3CZKA 2YA0A 3LPGA 3N17A 4X0VA 3VNYA 3CUFA 2VI0A 3EDFA 3MUZ1 1ZS2A 1UD5A 1UWRA 4E2OA 5LA0A 3ZSTA 4KRUA 3S6TA 4GINA 3N9KA 2X1IA 1C92A 2F8QA 3VDAA 4TVDA 2BXZA 2VCAA 5D8ZA 5TD4A 1PJ9A 4XUYA 2G3IA 1PX4A 4CN4A 1CXEA 1GOMA 2J25A 1TE1A 3D5HA 4DWSC 2BY2A 1BTCA 3VGHA 1GOIA 1ZBWA 1BQCA 4QAWA 3U5UA 1ISXA 4MB5A 4WKHA 2WKLA 1E56A 3AS0A 4M80A 3VGEA 4Z2GA 3OLGA 3WEOA 3WDPP 3ARPA 2YA1A 2CETA 1ISWA 5DT5A 3N13A 1XCXA 1UKSA 1VF8A 1OGSA 1E0WA 4OUEA 1G01A 4WIWA 3WNOA 1CGUA 1UR4A 4H2CA 4OOZA 1VFOA 1PZ3A 4EKJA 2A3AA 2E8YA 4OBRA 3NDYA 2WBGA 3CO4A 4J3SA 4X0NA 2V3FA 3W37A 4LYRA 3W6LA 4UR9A 3AMLA 1UR0A 1LWHA 1LJYA 4AZGA 3AIBA 4JIEA 4H7VA 1J0IA 3ZR6A 2EPNA 1UR1A 5CQ1A 4OOUA 4HOWA 3D3AA 2G41A 5M5DA 4MAZA 3GNRA 2MANA 4EAMA 1GJWA 1M04A 3WH9A 2DSZA 4UQDA 3DC0A 1JFHA 3VM5A 3M6DA 2CBUA 1JZ3A 1VB9A 5ABFB 1KWGA 1V08A 2ZUWA 1J0ZA 4AD3A 1JNDA 1DTUA 3WH6A 2WLZA 2XM2A 3PZIA 1X6NA 3BAWA 4HZ7A 4LPCA 3TTOA 3GZAA 4HA1A 1OGGA 1B1YA 1WZMA 2B31A 3KL3A 4JZ5A 1UR9A 2XM1A 1JYNA 2GFTA 2VX5A 4MAVA 4MADA 4E4PA 4EANA 1ODUA 1V3LA 4D6GA 2UWFA 3MU7A 4MB4A 2WC7A 4PMDA 4MDOA 4PCSA 3JUGA 4HPGA 3VM7A 4J3XA 2GDVA 1HKJA 2J47A 4CVUA 1WO2A 3W29A 5BWFA 2WMIA 1E43A 1E4MM 3NYDA 1CEOA 2WVVA 1E6PA 1BFNA 1Q4NX 3II1A 1US3A 1E4NA 1UD6A 4PMVA 1W9XA 1MW2A 5M03A 4ZXLA 3TTYA 4MNLA 4HOZA 4CCEA 4HTYA 4CD7A 5A8NA 1QNRA 4UQEA 2XPKA 2J7GA 3MUAA 4CUCA 4JL1A 2ZXQA 2WCAA 3MMDA 1K9FA 1J0KA 2J7DA 2AOSA 3LPOA 5FL1A 4NF7A 3OA5A 1QBBA 3RJYA 2D3LA 1KXHA 3ALFA 5I79A 2BHYA 3UESA 4YHEA 1HL9A 3IJ7A 5I3DA 2VJXA 3OGVA 2VVSA 3TTQA 4JAWA 2WHJA 5BXTA 2ZX7A 2A3EA 1MWOA 4ZXOA 2OWWA 4UQBA 2WZEA 5AY7A 4UQ9A 2WCGA 1DWGM 1G1YA 1PX8A 2PWHA 5ECUA 4PMYA 3W4RA 4FK9A 1GOWA 2YDRA 1JYWA 1RH9A 2F61A 1TZ7A 1GHSA 2D1ZA 5A8MA 2VCCA 5KEZA
chains in the Genus database with same CATH superfamily
3R13A 5T26A 5FJPA 1NP2A 3N1AA 3F5KA 4XKYB 2WZMA 3VKAA 1SFLA 3SDOA 1UD2A 2PPGA 2OT1A 5C7HA 3CV1A 1ZJBA 3WF1A 4CQDA 2VOTA 2QCMA 4F9DA 1TVPA 5A3HA 1BQGA 4H9YA 4TW8A 1GG0A 3PFMA 4K3ZA 5D32A 3VTRA 2ZZ4A 4MY8A 3PRBA 1W3LA 4NRRA 3H2EA 4YPJA 3M16A 4MJMA 1DJHA 4UQAA 3EDKA 1EX5A 1E9IA 2DORA 5HUAA 2ZX9A 3O07A 3IJ9A 4DJED 2RURA 2B81A 3F4VA 3L4VA 3WELA 3PNUA 3WMCA 4PN2A 5CLWA 3GK0A 4RNFA 4DROA 1LLWA 3W25A 2G3JA 2OQHA 2I16A 3MB9A 1UKTA 2GJXB 2VZSA 3NDOA 4X63A 1KV8A 3ITYA 2WNWA 4GI6A 4WSKA 4J27A 1TUFA 2OFNA 1AQMA 3AISA 3BPWA 1NARA 3NSNA 1SR0A 3PZNA 2W0UA 2YCLA 4W9TA 3S2NA 4D1IA 4AVOA 1UR2A 3KBVA 4GGHA 3ZJ7A 1W8GA 4JYSA 4KWSA 1IXNA 3BLLA 2D0GA 4HP5A 4ICCX 1OSEA 1QFEA 4HNUA 3H2CA 5CPQA 1LF1A 3GH7A 4OQVA 4D6IA 3GTHA 2QDHA 4HHMA 3WZ0E 2DZBA 3WENA 5EMYA 1E0XA 2PSNA 4J4OA 4AC1X 4PMOA 2Y62A 3JZEA 4YWSA 3SB0A 4DUOA 2PDMA 3SAZA 3SCVA 4KESA 4YIWA 2TODA 1J2BA 1FWCC 2RJHA 3NZRA 5DMMA 4UTFA 2A79A 1D8WA 3BQ6A 1OZQA 3CB3A 3UCQA 3KOZA 2PDBA 1U5VA 3STGA 3M0IA 3HGJA 2QMKA 3MHFA 2VCBA 1KGXA 3PAOA 1J93A 2JKEA 2PPNA 1LP6A 2VGBA 5CXPA 1FHDA 2E7FA 1EWDA 3WLTA 1JDFA 1RLDA 2I56A 1OHLA 1RALA 2ZZ1A 3WH0A 2Y61A 2NSXA 2J62A 2W9MA 1E55A 3W0KA 1EB3A 3W7NA 5A6SA 1TE6A 4L80A 1ZGDA 3NPXA 1NSGA 1AJZA 4Q8NA 4U3AA 5I6SA 4GZJA 1NY1A 1UWQA 2DZPA 3UXAA 3P0XA 3EMZA 2V8ZA 8CGTA 4MJ2A 2G50A 4FX7A 4FX8A 4ACZB 1NIUA 3EOOA 3COTA 4V33A 2AGKA 4MYXA 1VH7A 1EXBA 5A6BD 3UP8A 4UMAA 4Q32A 4A3YA 2Z1XA 4AYGA 4QZVB 1VIWA 4PFMA 1LQ2A 3GG1A 1UIPA 3W1TA 3TU9A 3A24A 3AXHA 4JFTA 3HPAA 4IT6A 1I9CB 3LA4A 4PRTA 4NZ4A 4REQB 2QJIA 4FI4A 2X41A 4ZFCA 1Q6QA 4JS3A 4NI8A 2NWSA 4J35A 3KCEA 4WXZA 1JDDA 2IS7A 4W8BA 4XBSA 4W9OA 4AISA 4WSHA 3FXYA 2VWTA 3ME3A 2WJDA 2AAMA 3VCRA 1KO0A 1XYLA 3UJFA 2G3NA 7REQA 3K8LA 1FAPA 3N29A 2W6RA 1O1ZA 3PB0A 1NMVA 1TV7A 1TTPA 3UJSA 3WLQA 5LIWX 5EMJA 3A9BA 1EO7A 1NF0A 1VJIA 1GVFA 1FA2A 2ZTKA 1XF0A 1TCOC 4PULA 1XRFA 4CD8A 6XIMA 4BI5A 2GSJA 1CLKA 2V38A 2X2YA 3AICA 3SEPA 2W91A 3P0WA 4HCHA 2OEJA 3KOYA 4P7OA 1XQKA 4IOTA 1US0A 3CUGA 3MP3A 2YCEA 1XKYA 1E0UA 3CQIA 5DBTA 1GVSA 2ZIDA 2HEJA 5D2TA 3MY9A 5K4XA 2Z24A 1VEMA 4QLLA 5HMDA 2QV4A 3VXGA 1S2CA 3UZ5A 4I9AA 3OP2A 3IIPA 2Z2BA 4TW6A 1PYMA 2C3ZA 2LGOA 2VM8A 4GNKB 2G4FA 4DELA 4Q4QA 4AU0A 4HMCA 4MTVA 3AU2A 3OQ8A 5DCEA 4G7FA 4X3ZA 4A22A 1P0NA 5D33A 3C2RA 2DT1A 3S5OA 3KTCA 3EDDA 3OJGA 4D72A 3LXAA 2WOQA 1M41A 4JTCA 3QQ0A 3U57A 4D8ZA 1PBGA 3RITA 4W93A 5GJPA 1P0KA 4IXHA 1HGYA 4RR4A 4RV3A 2YYTA 2XIMA 1F8AB 3QSRA 3H9RB 2CHOA 2VQUA 1KM2A 2WB5A 3KVMA 1AK5A 4S3BA 4K7YA 3ZWSA 1NU5A 4CQ9A 1DP0A 5AECA 4LB3A 4Q7IA 4TW7A 3RCYA 4UTMA 1XPGA 4M5PA 1AMYA 3ARYA 2JQXA 1ICPA 2VVNA 4GUHA 3W7LA 1QPNA 3SQLA 1TRDA 5J6EA 2E1DA 3Q2DA 1QR7A 3SCWA 1UIOA 3CAQA 2BOGX 1O6IA 2NX3A 4GFSA 3IAQA 3A47A 5TNVA 1OEPA 4W89A 4HMEA 1VZWA 3C0SA 3O5KA 1L9WA 3W1XA 1TWWA 2CHNA 3K1GA 3ZOAA 1H41A 1EH9A 1JQVA 3B4UA 3EMCA 2BY0A 1PWMA 4IMDA 3GVQA 4IWWA 1XDJA 3F5JA 1XG3A 2XU2A 1UUQA 3PSWA 2NV1A 3GB6A 5FOOA 5H6HA 2Z2UA 5G2WA 5HQMA 1Z7AA 4MF4A 4R27A 2PDHA 3GIQA 5AHMA 3K13A 4KR0B 1RK5A 3URNA 2V68A 4N4PA 1Y5VA 2WBKA 3QYQA 3BJTA 1I4NA 2ZUTA 1RQEA 1F4AA 2GDUA 2OJPA 4WZHA 3C0LA 4ZOBA 3LTPA 3U2EA 3E0WA 5LYRA 1V3IA 3VMPA 3W1MA 4TMCA 1LL7A 3M0MA 1Q85A 3K8KA 3WLRA 2JKPA 3ENLA 2RAGA 4KGJA 4ZOCA 2VO5A 1RP8A 5BOEA 2RGMA 3FGCA 2BODX 3T08A 3CV2A 3O5GA 3OOQA 1OYBA 3GR8A 3LRMA 3VCCA 1WDSA 3I6EA 4WGXA 4CEUC 1ONXA 3ZVHB 1TELA 4IT1A 2V6AA 4KERA 5HA7A 1H1ZA 4YLWA 1G67A 3PWAA 4QQ3A 3Q65A 2R94A 4ES4A 5F2IA 4O8AA 4HTBA 3I65A 4DF1A 1SO5A 2HXUA 1HW6A 4BFAA 1T7LA 4B9ZA 3FCPA 3LBOA 1FTXA 2GUUA 3PUDA 1VC4A 4QEHA 4UTWC 5FD0A 4DF2A 3BK0A 4DH0A 4RNIA 2C71A 3W2JA 4S3CA 2VZTA 3UWEA 5HWNA 4YMZA 3VIIA 4UNKA 4DZ3A 4QJ3B 2PV2A 1T8QA 3TLQA 2WC4A 1K9TA 3OYXA 5EL1A 1H7RA 3QHMA 4LOCA 3UF9A 5G1TA 1UBPC 1L6FA 1NWUA 3R4IA 2Y63A 1RPXA 1YDVA 3GTIA 1IT7A 1GK8A 1Q8JA 3F1QA 1ADOA 1FCBA 4M29A 3BH4A 2QNEA 1C29A 1W3NA 2E67A 1CZ1A 5T91A 3O5LA 1HFBA 4QM1A 2XP5A 1B54A 3L23A 2P0IA 3AAMA 1RUSA 1I0BA 4Y90A 2OXNA 4Y9OA 1G7UA 4H8VA 5HQLA 5I07A 4IJCA 1DJWA 2PFHA 1B0IA 4KWWA 4LQ1A 4ITZA 4ODNA 1XKJA 2X1RA 4UTJA 3CT7A 2E0PA 1Q6CA 1FD9A 3BGGA 1LBMA 4H6EA 7PTDA 1E3ZA 4A2RA 2W63A 2ZWZA 1TV5A 3JYMA 4LV9A 3W1UA 1TR9A 4AD1A 1XSKA 3T2PA 4NI3A 1PKNA 5JIPA 1SVDA 2Q8XA 3MYOA 1G4TA 5I77A 1NF7A 2W27A 4JYEA 4H7CA 4DJFA 3DYPA 1UG6A 2GQAA 5E5CA 4LYQA 1XFBA 3SUSA 2QDGA 5H8UA 4PGLA 4X22A 4O16A 3DOPA 3SFWA 5BXSA 2C1HA 2VN1A 1ME7A 3CXOA 3T4CA 2Y5SA 4IQ2A 3W02A 8XIMA 2YDQA 1W2VA 1HL2A 2R1MA 3OO2A 4AZ7A 2QUTA 3RPDA 3W07A 1FH7A 2Y85A 4WDWA 1WUFA 4HZ6A 1Q6IA 1J4EA 2RDTA 1M53A 1EF3A 3H4WA 1V77A 3DESA 4AZCA 4QG8A 4V1YA 4IQDA 1P4CA 2OWXA 1KBIA 3PA7A 1J6OA 2XFWA 4C5YA 5JH8A 1J0YA 2WHKA 1KD0A 4L9XA 2V3DA 2Z6JA 4B16A 2VD8A 3PZMA 4GNVA 1JF5A 3P5ZA 4XTDA 3TLLA 1CGTA 1N1AA 2DIEA 1QOPA 3E49A 2J7BA 1JCYA 1OX4A 2Z1VA 2I1OA 4GJIA 1XP3A 2XWEA 5IHSA 4W86A 4UB9A 4US6A 1TMQA 4WY0A 4FALA 4Z2HA 2PEVA 3SFKA 1E1EA 3SSJA 4MIMA 3VIFA 3GDMA 3L66A 4ICMA 4XAYA 1A0EA 1GPWA 4XISA 4KEVA 5BMWA 4WJ8A 1ZBKA 3FAPA 2VTFA 5LNRA 2PDQA 2XSBA 3SRHA 3S5SA 2BXVA 3G22A 1GVOA 3E0FA 1REQA 4JYFA 3AXMA 1K4HA 1BSLA 1JAKA 4IFRA 1Q5MA 3CHEA 1VFUA 2ZZ5A 1OIMA 3WBXA 2Z29A 4MMWA 1GVRA 2YXXA 3DFYA 3GC2A 3SURA 3FEQA 3ITVA 4ILSA 5TQLA 4AZBA 3VDCA 1OFPA 2VR5A 1VBJA 1XYFA 2YKKA 4HD5A 5G1YA 1ML1A 5D03A 3ES7A 4CD5A 1P0DA 4Q7BA 1H11A 2WW5A 4JFVA 3CUXA 4L72B 9RUBA 3VIKA 3E1F1 4LAOA 2XP6A 2EO7A 1T5AA 3ZIZA 2AQOA 5D8WA 3B7XA 1F3WA 4US5D 2P5NA 2E6FA 3PPGA 4U5KA 1UA7A 6ALDA 2A4AA 1R3YA 1G9HA 1UQYA 2OQYA 3ERPA 2ASHA 3NCOA 4ZO9A 2V9DA 4A3QA 1H60A 4B3LA 5GVJA 1W5QA 3H21A 1PYFA 3V3WA 2XN1A 4DBUA 3PB2A 2YOCA 4TV5A 4FEZA 3L2LA 1KFBA 3CPRA 4C1NB 3ELFA 3AROA 2D20A 3VOGA 1G4PA 2CW6A 4EPBC 1OB0A 3W7RA 2DPEA 6PTDA 4J28A 4N02A 3KUMA 3T0DA 2YDSA 4KBXA 4GIYA 3UPBA 3VNLA 5CBJA 1DJQA 1PWLA 2NV2A 1K1DA 5HULA 2PODA 2XHYA 3WQGA 5MKGB 1A7XA 1NDVA 3F4DA 2WNZA 1JRBA 3WLKX 3HGSA 1XLJA 1EUNA 2NV9A 1C91A 1UKQA 2PCQA 2Y89A 4ZFMA 1GOOA 3IWPA 5HTGA 2F38A 3KHJA 3VKDA 1DOSA 3GPKA 3WJZA 1O7AA 2XFFA 4KKXA 3EKGA 1ZJIA 3KWSA 4J9JA 4QIBA 4JR5A 2HDJA 4JQAA 4DJEC 4UTTC 1XLAA 2VDGA 4H7ZA 1UKOA 3TNBA 2YA2A 3W7GA 1NWRA 5BCAA 3W53A 2UY3A 3HG3A 1R46A 3PJWA 2ZZ6A 1VRXA 3LGGA 2EBNA 1KWKA 4LEQA 2HROA 3CUHA 3IANA 4JX5A 1B90A 1KXQA 4CNNA 5GQBA 2VEGA 3TYUA 1XCWA 3IGXA 3AYTA 4J7RA 1E5NA 3GVRA 4ORMA 5AKQA 4C6CA 4M19A 1QCWA 2OPJA 3KBWA 2WQDA 3OZOA 1L6SA 4JFSA 1W91A 1DVJA 2F2KA 3S0CA 1G94A 3AC0A 4C65A 3SCQA 1TPEA 2TSYA 4UFMA 4ECLA 3WKZA 4QCEA 1O1HA 1X6UA 1XIDA 3AHVA 3NPWA 1ZZMA 4DO4A 3G2GA 4MNJA 4IQCA 1V4YA 2OMAA 4PR4A 5ABGA 1FWAC 2NVDA 1CIUA 2G8ZA 2ODOA 2XYLA 2HBXA 3GNPA 1C90A 3KCJA 3UERA 2ZQ0A 4FXRA 2DJXA 1VQTA 3LCIA 4Z08A 3EIPA 3OG2A 3VD9A 4OHQA 4PB4A 4PB3A 1DQWA 1WDDA 1WV2A 1CLVA 2ZZ7A 5CAHA 1LCOA 2R14A 3WQDA 3U0HA 3CAKA 3B0PA 3SY8A 1M3UA 2GJLA 4FB7A 4N19A 3VOJA 3KBMA 4O52A 4EIVA 5EKYA 1XBYA 2IXUA 3C2VA 2HNEA 3DYMA 4HB7A 5FF4A 3PUEA 2HV5A 3W85A 4PMNA 4I7UA 5TIMA 3UR7A 1V3MA 1XUUA 3EOEA 1YXCA 4XX6A 1T11A 1V93A 4V27A 3QFEA 4FLRA 3K30A 3EB2A 3N4EA 1TSIA 2VENA 3GTNA 3H2NA 3VILA 3M0YA 5CGMA 5C2GA 4AAJA 1FKJA 2R1LA 1FWHC 3IIOA 1JI2A 3DHUA 1E51A 2Y8UA 4GQRA 3LUTA 4GIRA 2FAPA 4GJJA 1DJZA 1EGZA 5DF0A 1MDRA 3DHFA 3O3RA 3ANUA 5JQ9A 5AVHA 3CZJA 1OZMA 1W6TA 3O9NA 1QK2A 3TH6A 2C1GA 3IV3A 3QZEA 5E70A 3TOYA 2WNQA 1Q4WA 1ENUA 1XQLA 2OT0A 1CYGA 3UQBA 3R58A 4XZNX 1L6GA 5A1AA 2ZYFA 4WDUA 3UXKA 3W72A 3ITXA 1R0MA 1UPPA 1EX1A 3IUIA 1EQ3A 3KRZA 5KSWA 1C8YA 1PIIA 5CZ0A 4C6NA 1PCKA 3RCMA 2I5GA 3EEZA 4Z2IA 4E8DA 3O63A 3KRBA 1MDLA 2VP8A 2GQ9A 2QEZA 4UFJA 4D6CA 3TJIA 5G4HC 1LLZA 4CCDA 1FKKA 3P62A 5I98A 3LMZA 3GHSA 3N2XA 4X2RA 1PS9A 4OV9A 2Y1HA 4JTRA 2OTDA 4MJZA 4ADUA 4X61A 2B7OA 1TZZA 3G6LA 3NL5A 4RKAA 1JFXA 4GOAA 1GNXA 2IF4A 2ZDSA 3OYZA 4WLCA 2ZQTA 2EAWA 2MLXA 1H49A 4P7QA 1TPFA 4H8UA 3SY1A 1QASA 3HPFA 4L4MA 4AW7A 1QPLA 1D2KA 5E6ZA 3RXZA 5A2AA 4ACYA 2RDWA 3BC9A 3IJIA 1YTKA 3JS3A 3WY1A 4Q8TA 3JRKA 2Y88A 2GWGA 4C6KA 4XKMA 4CQ8A 4IM4A 4YTSA 2BHUA 1E73M 4RUBA 3BMBA 2UV8G 5CCZA 4K36A 1DIKA 2CZFA 4GRSA 3AUJA 2E9BA 2OFJA 2PP3A 3I68A 2FZDA 4UCGA 1BVZA 3UQAA 1SFJA 1AUSL 1ITUA 2IKHA 3PPHA 3MUY1 4OZOA 4JNYA 4I9TA 3NXFA 3ABXA 3NVTA 4QS5A 4IMCA 1TWIA 1U1UA 4LV4A 2C18A 5H8PA 2A3LA 1Z9AA 2OR2A 1FKDA 4NXSA 4ZQOA 1FCVA 2WJEA 4RDZA 2J13A 4ZTYA 1GOKA 1ZJHA 2BS9A 2G96A 3MTWA 4W85A 4NXKA 5CJ5A 3DC8A 3HO8A 4WD0A 1VFFA 4NU7A 2QCGA 3KBJA 3UZZA 3TCEA 3DG3A 3NNTA 5CG7A 2VRQA 3A3WA 3LHVA 3UR2A 4K1WA 1A80A 3S2LA 3MVIA 3L4WA 1B3ZA 3OPSA 4KCVA 2CXGA 3R5EA 3ARUA 1OT2A 1CLXA 3KADA 1NEYA 2E40A 3UWZA 2RSEA 1IGSA 5DQPA 3HQ1A 3AMGA 1MQQA 5EMMA 5GNYA 5D38A 1MNSA 2AQWA 1JQXA 2X42A 4GC3A 4K8EA 3CGNA 4O13A 4HOXA 3WQ8A 1AVAA 4OIFA 4JX6A 4Q7NA 1DJXA 4TNSA 3SGUA 3TW6A 3B0XA 3JW7A 4DZHA 4AC7C 2ZC8A 5A8GA 4M56A 5A6MA 1HT6A 3WLHA 1RQHA 4JKKA 3N6QA 1EGMA 4MVAA 2GQ8A 3AIUA 2FJUB 3AU6A 1K6WA 2IMRA 2ZXAA 3VX1A 4LF2A 2IW0A 1BXCA 3PZOA 1EDGA 3AS3A 1DYSA 3ITTA 4WKFA 1EEXA 1MQPA 4GZIA 1CNVA 4MWAA 2WM1A 2BWGA 5JUVA 4LCSA 5I3KA 1RJPA 3U7BA 2C0AA 2J7CA 4GQ0A 2F21A 4U33A 2ABAA 5C2CA 1F76A 1DWJM 4J3WA 3RF9A 4WKAA 3MMUA 3NQFA 4DUVA 1QK0A 1M5WA 3WH8A 1NOUA 4ODRA 1ESWA 1BSIA 3NL2A 4Z2JA 2DVXA 1RR2A 4PMQA 4D71A 3UETA 1R7AA 2O9OA 3R0UA 5M2FX 2VUNA 3F4NA 1UD3A 3SCOA 3ZT5A 3NZPA 4R9OA 2A3CA 5HW7A 4IH3A 3WO8A 2LLEA 4ZOAA 2MNRA 1EC7A 1FHUA 1DJGA 3KP0A 4L6OA 4C7GA 2FHFA 1YHTA 1JZ7A 1R9ZA 4I9MA 4P5UA 1W1YA 3V75A 1HVQA 4KGLA 1VRDA 4H9UA 3IRSA 3GG0A 3DKJA 3O8AA 3N2TA 3CBWA 4AD2A 4ZB5A 3WQ5A 3VE7A 4RW5A 3RGTA 3UWYA 4LALA 5FL0A 1J0JA 3QY7A 4U85A 1ZAHA 3ISIX 3NQDA 1HKWA 3G3MA 2ZE0A 3UCCA 2XFRA 3WJXA 1BYAA 3IAPA 1TTQA 4PTMA 1US2A 4J2MA 1U22A 4C1LA 2P88A 2X7WA 5C7VA 5G2HA 2I5QA 2E9LA 1TV2A 5BXJA 3AOFA 1CTNA 4CKQA 5LKYA 2HVNA 4QCFA 3IHZA 5AHFA 3TONA 3WF3A 4B15A 2REQB 1DWHM 5EFDA 3SCTA 5DMLA 3QOMA 3WK3A 4QGCA 4XBJA 3EWDA 4OE7A 4NZ5A 3TYBA 1RP9A 3MMTA 5FCZA 4MPKA 4RLIA 3N17A 3GR7A 1QXLA 4DYEA 1EJSC 2VI0A 3I6RA 4FOJA 3S5YA 3EDFA 3CUZA 2INZA 5C0QA 4KRUA 4GINA 1XLMA 3LN3A 4XAFA 4Q8MA 4KT2A 1AFSA 2BXZA 3FSUA 2VCAA 5MHBA 5TD4A 1PJ9A 3M64A 2A7NA 1T8XA 1FWEC 2V2HA 4I9JA 1QOQA 1EGVA 4NJIA 5GPGA 3TTEA 1GOMA 2J25A 3F2CA 3FKKA 1TE1A 3D5HA 1ADDA 5HT1A 1BTCA 4Q33A 1O66A 1ZBWA 3U5UA 1ISXA 4WKHA 1E56A 2QCCA 3WEOA 1ZCNA 2CETA 1M7OA 5D75A 4WJEA 4O10A 1UKSA 3RRAA 1XFCA 1VF8A 3O5IA 2HE8A 1OGSA 1X1ZA 4WIWA 1UR4A 4OOZA 1VFOA 3S6OA 1DKWA 1ONEA 4GG9A 3B8DA 3TWAA 3RN6A 1AW1A 2W79A 4RNJA 1VBGA 3ZR6A 4QXIA 2EPNA 3B8IA 3GS6A 3AUOA 4NJJA 5CQ1A 2G41A 3N3TA 5M5DA 4IIHA 4GD0A 1UMLA 4EAMA 4PTDA 7REQB 3DC0A 3NTPA 4CNPA 2CBUA 5HMFA 1KCZA 2ZUWA 2Q6ZA 3KAOA 3STFA 3F4CA 3BLEA 2Y7FA 1EJWC 3FJ4A 4HA1A 1OGGA 3KW3A 1WZMA 1AODA 4Q4PA 4DBSA 3LV5A 1ZNNA 5FJIA 4ZSTA 4O57A 4MAVA 2FIQA 1YYAA 1ODUA 1THFD 4D6GA 1FX6A 4MB4A 5HJXA 4DJFD 3RLGA 4PMDA 2GGEA 4PCSA 4DZIA 2PDUA 3URAA 1YPFA 2C16A 5C9WA 1MUMA 3W7IA 1E4MM 3NYDA 1SW0A 2WKJA 5CPOA 3W76A 2IPGA 2PE4A 4Z0SA 5C6MA 1BFNA 4WHBA 1E4NA 1O95A 3QKZA 1UD6A 2NSOA 1MW2A 4ZXLA 3TTYA 4AWTA 4CCEA 4HTYA 2JZVA 3WQEA 1WXZA 4AX7A 4HHHA 3E3HA 4I8DA 2WCAA 3W1AA 2X7VA 4LW7A 4JFKA 1J0KA 2AOSA 1EPVA 1UBSA 3ABZA 5F2GA 5DITA 3LOTA 3PBMA 1QBBA 3PVFA 5D37A 4GQGA 3G1RA 3S1VA 4XO7A 2QAPA 4QEEA 2VVSA 5BXTA 2ZX7A 1I2QA 2A3EA 3GZ3A 3WLIA 4UQBA 3TXZA 3C86A 2WZEA 4EOUA 2UZ9A 3WLSA 3APTA 4JTUA 5AHNA 2PWHA 1AZ2A 3WJYA 1RCXB 3I7QA 4YTTA 3W3OA 4FK9A 5DX7A 1BVWA 1SZFA 1JYWA 1NDZA 1RH9A 4YTUA 1W37A 1TZ7A 3AXKA 4MGGA 4QE4A 5A8MA 2O4QA 4MWAE 5KEZA 4IMFA 1D6OA 4NAEB 3P8JA 3N2CA 1H7XA 1SR9A 3PG8A 3OHMB 3BAXA 1XPYA 3GUGA 4F0RA 4MJ4A 1P43A 1X8FA 1UP2A 4B3ZA 1UOKA 1N8WA 4ZS6A 3W7HA 1UC5A 1YBQA 2Z6IA 2FVMA 3BW2A 3U2OA 1A50A 4NHVA 5M17A 1XLIA 5JH1A 3O5RA 1A5NC 7A3HA 3KAFA 2FZ9A 3NQ6A 3FJNA 2F9RA 3R43A 3BV4A 1XV8A 1HO4A 4S23A 3BG3A 3ARXA 2TYSA 1TREA 4H6RA 2X0HA 1FH9A 2V69A 4TVCA 4DRHA 3USBA 1S2VA 2M2AA 4O1EA 4L9YA 1HJQA 1JULA 2CLFA 1CDGA 5HNRA 1M5YA 2DH2A 4MDPA 4CN6A 2AL2A 1B3WA 1P7TA 2E77A 3F5LA 3KXQA 1GKRA 1H2JA 4WRHA 4BCEA 4UMCA 3O5PA 1ZCCA 5DO8A 4JFIA 3FYPA 2D2GA 3VFCA 4UZSA 1KXVA 2B7NA 3IKDA 1C9WA 4AIUA 1SO4A 3HB9A 1UH2A 4Y96A 3V1HA 3L21A 4PCNA 3MCMA 1VJZA 1F6PA 1Z32X 1VCGA 3A4AA 4W5UA 3CWHA 2OB3A 3BLPX 4PBEA 2NVAA 3UG8A 4PCFA 3NQAA 4LC6A 4F0LA 2CZVA 5I3GA 1KRCC 2E1WA 1XSIA 6ENLA 4JIIX 1XSJA 3PM6A 1LZOA 2EGZA 3FGCB 1WBHA 4HKPA 5TAOA 5FSDC 2YXOA 4HA3A 4FO4A 1PTGA 3NJ3A 1ZSXA 2V81A 3MO4A 3TW9A 2DW7A 3O6CA 4LYPA 1C9HA 3KACA 4I90A 3MDYB 4G7EB 3WQVA 3VNMA 3TW7A 3W23A 4WK9A 3TIMA 3IGUA 2DZXA 2ZR5A 2IQDA 5A6KA 3CZGA 4C91A 3UG4A 3AHXA 3AALA 3NA8A 1AH4A 1SO6A 3AXXA 3BAJA 3DFQA 3PTDA 5ABTA 2WPGA 1JNSA 4IGNA 3DZ1A 4BEQA 1C3FA 2BX7A 2XH7A 5EU9A 4KF1A 2HS6A 2F2DA 1LYXA 5AYBA 1BGGA 3HV9A 4OFCA 2D69A 3MBFA 4GI9A 1PO9A 2YCIX 3O06A 2R82A 4K1GA 5HMSA 3PZQA 4O2TA 3TZFA 3PSVA 2A6NA 3K2GA 5KTLA 4MNMA 1J8VA 2KO7A 4XV0A 4GACA 1RVGA 3TFCA 2ADAA 3TSMA 4LS0A 5BROA 2RGLA 1BKFA 3AYVA 3HJZA 1T40A 2W5FA 2C0HA 5LSMA 4LFYA 3G3DA 2GQ3A 1FWWA 1VEOA 3VD3A 1EJTC 1I2RA 2PDGA 1G0CA 1I2PA 2FTPA 4H83A 5LGXA 2NQHA 2ETNA 4EVZA 4IG2A 1W5OA 3RPMA 3W28A 4JQ1A 4QT2A 3WUEA 1IXQA 5CSUA 4UTTA 1F3XA 2QCLA 2QDEA 3KDOA 3W86A 2O9RA 4MFEA 4H9ZA 2GJRA 3OZYA 2R1PA 6CGTA 2DSVA 1UOZA 4HHLA 4S2CA 2QAFA 1GGOA 2W4XA 1V3KA 4XZHA 1JNTA 2VFDA 4I8YA 2A7RA 3M0XA 1SM9A 1JZ6A 3PRDA 3LZ5A 1VYSX 2O55A 3OB8A 1W1A1 3R94A 1J4RA 4IXXA 3SR7A 4BQ4A 3VOCA 4GHRA 2GGGA 2GLKA 1WZKA 1L6WA 4ZSUA 1Q63A 2QJMA 4ZB0A 4U10A 4MUZA 1JXKA 1W9PA 2NUXA 4NZ1A 3SN0A 4PRWA 3FIGA 1XH1A 1UJPA 4C7DA 2EKGA 2PDLA 4S2BA 1XRVA 1WPCA 4Y7EA 1HZYA 3SGZA 3VD4A 4ZZ9A 1N82A 1B30A 3M4HA 4DJDA 1KCXA 5FJOA 4S1FA 4Z1BA 3WJWA 4Z1AA 4JTDA 3UNDA 1XM3A 4AZCB 1FDYA 2QT3A 3WDJA 3OG3A 4D2JA 4LC8A 1EUAA 4O18A 3GDRA 4JHZA 3WBAA 3RPTA 3W7QA 4ZENA 3EA1A 3CEPA 2XP9A 4EAYA 2A2IA 4ODLA 1YPIA 3W00A 3TKFA 4K39A 3MA8A 2BSLA 5DEZA 5LNSA 1PINA 1FXPA 1RJRA 2GGHA 4Q4OA 3RMJA 3DKLA 1FDJA 3BXWA 3IJ6A 3WLOA 4WY0B 2NT1A 3QMSA 3WBWA 1W9DM 4Z1YA 1A47A 2HNHA 3TA6A 2ZQSA 1DL3A 1X39A 1TRIA 4LCRA 3IPWA 5I09A 1M9HA 4AY1A 1X8CA 4I5RA 5DY2A 1QW7A 4DX3A 1REQB 3ABOA 2X1TA 4ONVA 4QT3A 2XVNA 3CB8A 3U9IA 3KWXA 3WF2A 1G69A 5D2WA 3WUGA 1W17A 2UBPC 4HIBA 4IX2A 1LUCA 3APGA 5CZTA 2DFAA 1H7WA 2PP0A 3LPPA 3EXRA 2TAAA 4UFHA 5HR6A 3ABSA 3W1NA 5GPRA 3SUVA 5F7UA 1JPIA 1JZ4A 4L7ZA 5CGTA 1L2QA 1P6CA 1QO2A 2MLYA 1XLBA 3GFYA 2ZA3A 4A21A 1QHOA 1S3HA 3TC5A 2JFEX 3RIKA 2QYGA 2J66A 1TQXA 4C6IA 5AZ1A 2QUUA 3ZLGA 4QLJA 4FNPA 4GWEA 5K4ZA 4DI9A 3U7VA 4IJBA 3TQVA 4DNHA 4UC5A 3TAKA 4HNOA 1UMYA 4GI8A 1N8FA 4CNOA 4GYFA 5E9XA 1XG4A 1U1JA 2PWUA 4AEFA 4JTAA 2YW4A 4ALDA 1QI2A 2DEPA 4H8HA 4WCJA 1TA3A 4IPNB 3A4XA 1IIHA 3DG7A 4XO6A 2OGJA 1ZU8A 1TJ1A 4Q8OA 3QHOA 2O0TA 3KL5A 1JZ2A 3LGEA 1JL8A 4Q8QA 3SJ3A 2ACQA 2CNCA 1MI3A 3EX6A 3I7RA 4GY0A 1YDOA 3RHGA 3MHGA 3NR0A 2A85A 3BZJA 2QV5A 3E2RA 1YX1A 2DH3A 1Z48A 1QWGA 4Q6JA 1UWIA 4AZ6A 4HK5A 4DLFA 5L9FA 4HK6A 4GI4A 2PF0A 4OKDA 1KFJA 3ECQA 3T40A 1NFGA 1K3UA 2CBJA 1W1TA 5C71A 5RUBA 4OV4A 2Z7KA 4Q4SA 4TMBA 2WMHA 4X2PA 4ROQA 1S5WA 1VKFA 1RK6A 1B3OA 3FEMA 3PK7A 3DU0A 4YL2A 5A6JA 1NMWA 1BXNA 1X6LA 2C15A 3R12A 3RGCA 1VCVA 2P76A 3NEVA 2BVDA 3K8MA 1XIMA 2BASA 3OTRA 2E25A 4HGXA 4FLSA 3VA8A 2Y8VA 4A35A 1A49A 4IQEA 1P6WA 3ORWA 2MUCA 3EWCA 3UPWA 3TMQA 4A8NA 1QPQA 4C1KA 3I6CA 3BCJA 1OG0A 2RHGA 3DDMA 2YJQA 1ICQA 3TMLA 4QAIA 1UCWA 1EO5A 3UJEA 3WMLA 2Z1BA 2YL6A 3D3FA 1EJUC 2DSUA 3T09A 4NJGA 4MWAD 3NM1A 4PE8A 4HN8A 4L61A 1ECEA 3IS4A 1XYMA 2ZADA 1BVNP 4GVIA 2Y7GA 1FWIC 3SO7A 2BG5A 2VFIA 3W1QA 3YPIA 2ACSA 4B5WA 2ISWA 2PWFA 3DFSA 4KCTA 3SM0A 4DBDA 2OLHA 3W71A 2FFCA 5EMUA 1QRQA 1K9DA 1OFEA 4J4KA 5CPLA 2YCKX 2E3ZA 2P1FA 7TAAA 3BMVA 4NASA 4XB3A 4DBWA 3TNOA 1GZGA 4PZVA 4JPGA 1KXTA 3AIRA 3GNOA 2PCEA 5HUOA 5DRIA 4FZIA 1XINA 1EL3A 1UW9A 3WLNA 4HMNA 4DRKA 3NVDA 3RJXA 1AQ0A 4DXVA 1BWLA 3EBVA 4NAFA 1E5JA 3U2ZA 4O4WA 5CPTA 4ADTA 4AZ5A 1UH4A 3FAWA 2ZUNA 4LUSA 5H8MA 3PBVA 2GSEA 2YX0A 1TMHA 3PR2A 3SECA 4GPNA 1EZ2A 2FZBA 2O7QA 3VKJA 2XISA 4NYYA 1LROA 2CBIA 1K7XA 3LCGA 1QAPA 4JHOA 3C2FA 4CVWA 4CU6A 1YKWA 3MP5A 2ESCA 3O5JA 1A4LA 4PC8A 1ZJAA 1OD8A 1V0NA 3N11A 4XD5A 2NX1A 3ARSA 3KVLA 3F2DA 3L67A 2PA6A 5C9XA 3ZT6A 3R8HA 4G1NA 3AIEA 4RE0A 2PGEA 1ZQ5A 3O5DA 1OWQA 4B91A 4UBPC 3N2MA 1MUWA 1TG7A 2VT0A 3M5ZA 1IR1A 3KTSA 1CGVA 2WV8A 1KRBC 4QBXA 3HURA 2FTYA 2G0WA 1CI1A 2FZ8A 3PZTA 4AXKA 1W31A 2CWXA 3MANA 3KS5A 3M46A 4CCCA 3OBKA 3KP1A 1VFMA 3LV6A 2MF9A 3UJRA 1K7FA 3CPUA 4QG6A 4J40A 3CLWA 4PUDA 5BNKA 3A6OA 1KKOA 4WDXA 3LNMA 4M81A 2Y5EA 1Q7MA 1KR0A 1S3TC 4FHAA 3P93A 7XIMA 4ORIA 3GO2A 5E0CA 2AMXA 1JCMP 4HK7A 1XDLA 1QNQA 4XK2A 4PTWA 4DJFC 1PDYA 1YTEA 3B9DA 3ARZA 1BL4A 2NX9A 3WYZA 1DBTA 4E2VA 3FYOA 4BA0A 1GOQA 1SMDA 3PBWA 2F2HA 1VPXA 4K2SA 4N42A 4NVTA 5E6YA 3T42A 5MF5A 2IPWA 3IEBA 3JZUA 5FEZA 4GUIA 4F2TA 3P5YA 1XYBA 3L9CA 3QYSA 4DIPA 4PB5A 4JIQA 3BMXA 1Q45A 3HG5A 1L6YA 2OZ8A 1XLCA 1H0IA 4XD4A 3G0SA 1MZHA 5DO2A 3W7MA 2EHHA 2J7HA 3M0ZA 1YNYA 2PDWA 1Q2RA 2WSRA 3HM7A 3WDIA 3SQMA 4MB1A 2WLYA 4DIAA 5E0KA 1PE1A 2QF8A 2GVYA 5CGQA 2J7EA 4CNSA 3B40A 2XP7A 5ABFA 4G50A 1J4HA 2CEQA 3QGAC 3IK2A 3WD2A 4EPKA 3OOBA 5C9UA 3QRHA 1GW9A 1UWTA 4JFJA 1TPB1 2FGLA 1PEZA 5D2XA 3PF3A 1NWSA 4KRTA 4JDYA 3VVGA 3T07A 1ZBVA 1RQBA 1G4SA 4PUWA 3B8UA 1J79A 3W81A 1CX9A 4KEMA 1NDYA 4DXKA 3NIYA 1KFCA 1XBZA 1PKYA 3GU1A 1P1MA 3GW0A 1E6NA 2J78A 4Z42C 3VNZA 1PIGA 5FA5A 2NWRA 4GBUA 4AQLA 1BGAA 3MCOA 2ZZ2A 3V36A 2D3NA 4W84A 1WA3A 1WE5A 3DCPA 3W1PA 1ZBCA 1M65A 3QC0A 1CCWB 4LBSA 4CU7A 3UEQA 4R0XA 1FWJC 5CKSA 2G3MA 3SCPA 3W6YA 1R7OA 3AJXA 1Q1CA 3R0DA 2V63A 4WR3A 1KV5A 3EWBX 4J3UA 2J8GA 4E3VA 5F4SA 3MPGA 3O6AA 2EF9A 3FS2A 3BLDA 2XGIA 5DIVA 4XZBA 3OQEA 1XC4A 3BUVA 3C2OA 3NZ1A 1RXOB 1UQZA 1ZAJA 4HU3A 2GZXA 3LMYA 3KAGA 3HV8A 2CU0A 3WL1A 4F66A 4M51A 2E6DA 3M6YA 1NH6A 4BS0A 2W62A 2D0HA 2P4VA 4XKYA 5DRCA 3W7PA 4GNJA 4HNLA 4JX4A 3LS9A 1ZK6A 1J6PA 3RILA 4HYVA 3UY7A 2PDNA 1PTAA 2JBMA 3THDA 3GR4A 3RG6A 3MUIA 4K8GA 4BJHA 4GYPA 1UASA 1IXOA 3NSXA 9XIAA 1QVBA 4NUWA 1IGWA 1TPDA 3QSTA 5HWBA 4YN5A 1NJJA 4DAIA 4N6FA 3IGHX 4ATLA 2XGBA 1J10A 3QOKA 2XFYA 3ABQA 2QMJA 5D05A 1R2SA 3O6YX 1YE4A 2RJGA 3PC0A 4BEUA 1BHGA 1NAL1 2J77A 3I3EA 4F0MA 4LF1A 1TV4A 2YLAA 3K5XA 4C6BA 4IL0A 4LY8A 4PTXA 2ZQUA 3GBEA 2G3FA 2ZRZA 3WK1A 2CZEA 4XSMA 3H70A 4N4QA 3WNMA 3ZQ9A 1V51A 2P8CA 1DXIA 2HBVA 1JD9A 2FVLA 3MHUA 1L2UA 2W67A 4UTKA 1H1NA 4JFUA 2EQDA 2OCZA 4HYWA 2Y2WA 1LRQA 3N19B 4K37A 4OJYA 3S2CA 3WFAA 5K9XA 1YXYA 4L1WA 1CENA 2EPOA 3VFLA 4Y6GA 3VE9A 1LM1A 1HKIA 1EXPA 2HSAA 1PSCA 2PLMA 1B9BA 1KTBA 1C7TA 4QDMA 4JN8A 4E2BA 1HJUA 3F2BA 1Q6DA 3P61A 4ZB2A 1MVYA 1JPHA 2ACUA 4J1OA 3DH7A 8RUCA 3GBDA 1DJIA 3H8AA 4L3NA 3T0AA 3G8EA 2BTMA 4LGXA 3LPFA 3GIPA 4YJ5A 2WHMA 5BXPA 4JFMA 1FHVA 3A4JA 4QTGA 4IIGA 3P6LA 3ZO9A 1GYLA 3CMJA 1UP3A 4R7OA 1X7FA 1R2RA 1R3WA 1V02A 3PZGA 4R7WA 3RX2A 1LWJA 4YS1A 4IMAA 2XSAA 3DYOA 2HK0A 1FWSA 2DG3A 1L1PA 2YBVA 3IKGA 1OFAA 1IZKA 4ZEPA 5AC5A 2V2CA 4LAZA 4UNLA 4L6DA 1D7KA 3E2QA 3GU0A 2Z00A 4HNVA 1DQXA 2YLLA 3CHCA 3EPNA 2ZWYA 2ZXBA 4RE3A 2OX1A 4FR6A 4FXFA 4ATWA 4Q8UA 5I23A 4FXSA 3FYYA 4NILA 3ZYZA 3FVDA 4FSAA 1KQZA 1Z41A 3L5AA 3KZ7A 3NZQA 4XTIA 4ACZA 3GU9A 3GDTA 1EA9C 1CGXA 3U4AA 2J9XA 4IIFA 5HMEA 3STEA 3PN8A 4GABA 5E93A 3K4AA 2V3EA 4JY9A 1E40A 2XTKA 1IEIA 4TYOA 1QWKA 2CIPA 4A3HA 1GTEA 4H6KA 5FJUA 1F7BA 1MW0A 4DXXA 1FP9A 1QDSA 5A6TC 4JFWA 4RZ5A 2OYKA 3KZSA 1KM5A 3N4FA 1FP8A 3NPVA 1LRNA 3F4WA 4HU0A 2VC5A 3VD7A 3EPMA 1R9YA 4TIMA 3ARWA 5GNXA 4HARA 3CLMA 4E8GA 1WDQA 3VNKA 1JYVA 1J5SA 3L4UA 3BSMA 2DJLA 3SIZA 4Y9PA 4LT9A 3N6HA 3W74A 5IFTA 2FKPA 2PGFA 4XZMX 1J5TA 2PTXA 3L0GA 1OC7A 3OLIA 1Z69A 1W9UA 3UBPC 5CAKA 5HPCA 1CXIA 4XZIA 5DFAA 2LKNA 4A8LA 1H62A 2GGJA 3PG9A 4RZ6A 1E1FA 3QLDA 3VNJA 1FCUA 2OX4A 4F0KA 4H41A 2EJAA 4BQ5A 4NNRA 1I2NA 4B5XA 3UJ2A 2NQLA 3KEHA 1KLYA 3TC6A 2WQPA 2QCDA 1CGYA 1V0KA 4S3EA 1NQ6A 4U3CA 7ODCA 4DJDD 4IIDA 1H7PA 4R53A 3QGVA 3I7SA 3U2CA 4IX0A 2BZNA 1VAHA 3PPFA 2QQ6A 1GT8A 1CXKA 4LTSA 4DB7A 1OIFA 5IRPA 3VIOA 3UZJA 1Q6EA 5C2XA 3LX9A 4LBUA 3E6EA 4G9PA 3APYA 4O12A 4JNZA 1KBBA 1V6WA 3D47A 3DI1A 3VO0A 4MSSA 1P0EA 1VBUA 5H1WA 1A0CA 1UWAA 2QVNA 3GKAA 3BAIA 5KETA 3LBCA 1SMAA 4MY9A 1WAWA 1W5NA 2CYGA 3O6DA 4QE1A 2Y8KA 4WF7A 4KEUA 2BVWA 3TYEA 4BQ3A 3T81A 3GQYA 1HF6A 3PHAA 1IV8A 2PZ0A 4O53A 5D2YA 2Z1SA 4PSPA 3FJ6A 4U2YA 4MNKA 1R3RA 4OWGA 4TUFA 1WKFA 5EPDA 5KZEA 4W7WA 1YEYA 2INEA 5KZMA 4GY7A 2E5BA 4RE2A 1YBQB 2WMFA 4DRMA 1E1CB 3LLFA 4YHGA 3WLPA 5ECVA 3THCA 3ZT7A 3O7UA 4QNWA 1G4EA 3T4WA 2RDUA 1V8EA 2CFFA 3WLLA 3SN4A 4Z2LA 3BSGA 2Z4GA 4HNTA 3H22A 3WBYA 4PBGA 4XAPA 1EBGA 1GKPA 1AG1O 2A0NA 3IARA 4C6JA 3IIZA 5CSYA 3SADA 3O5QA 4EP8C 2D2HA 4PMRA 3H4GA 3WBEA 3GH5A 4KFOA 2RDXA 4UFIA 3S47A 1M6JA 1RLCL 2Y6ZA 1BPLB 3UG5A 4V15A 1OQFA 2VL4A 5TF0A 1XIBA 3V16A 1K6AA 4ERIA 4C02B 2WMJA 2AL2B 3KOWA 2WO5A 4Z1CA 4GIAA 3VNDA 1HXJA 3RM4A 2EXOA 3STPA 1F2JA 1OGBA 5FAGA 1EEPA 2NQ5A 1EJVC 2E4TA 4AX6A 5D2VA 3MWCA 3U5YA 3C52A 4QR6A 3C6CA 4S3GA 3UFYA 1X38A 2PD5A 2VR4A 4DZ5A 3DBNA 5KZ6A 3W6MA 4DWSA 1IEXA 1TB3A 3WD4A 2YSWA 3KVKA 4BZYA 1NP0A 1RVKA 3G1AA 1KM6A 1W1IE 4RK8A 2VGGA 1VFSA 1V02E 2PDKA 2GJNA 1XLFA 3M0LA 3PULA 2FGBA 3QPYA 5A94A 3MKVA 1A3WA 3P3BA 3WL0A 3B9EA 3DHDA 4EE9A 4JQ2A 3VIPA 2UY2A 3SW6A 5EY5A 4M1BA 3ARVA 4MWAC 4CN1A 4V1XA 3Q37A 1DEDA 3KVJA 3CQJA 2QUNA 1BLIA 4EF8A 1K03A 2RQSA 1F4HA 5HBFA 2XVGA 3AYSA 2AAAA 4U31A 1EIXA 3D0CA 4JCLA 4W8LA 4TQTA 4LVDA 2ZRXA 1PPIA 2XIQA 3LPGA 4MOZA 1FVPA 3CUFA 3QMTA 2Z0IA 4FNQA 3MUZ1 1ZS2A 1UD5A 3TC7A 5LA0A 3ZSTA 3QR1A 1W5PA 3N9KA 3LLDA 1C92A 1NTHA 1Y0EA 4TVDA 2ALDA 3MWAA 3GW3A 3DFNA 2OO6A 1PX4A 4CN4A 4RZ4A 2X1UA 1M7JA 2BY2A 3MI6A 4B5VA 3QTGA 2GYIA 4KQZA 3MO7A 1BQCA 3ANVA 4AWSA 2GL5A 2HQAA 4MB5A 2WKLA 1AW2A 3AS0A 1GQNA 2FLIA 2P0OA 2YGYA 3MSRA 3WDPP 3KOXA 2YA1A 4KFNA 3TV8A 1FWRA 1V7AA 3L0NA 1RCQA 3KLLA 3UI4A 4ERAA 3G5EA 4OUEA 2PLJA 1RA5A 2HRWA 4H2CA 5G1MA 1FBAA 1PZ3A 3UXDA 3G1YA 3T05A 1AMKA 2E8YA 3NDYA 2WBGA 3CO4A 1OFDA 3SRFA 2V3FA 2HS8A 3W84A 3AMLA 1UR0A 3A64A 4ZTXA 3C3UA 1LJYA 4B5NA 4H7VA 3UGRA 1UR1A 3P2VA 3CYVA 1XR2A 2CLOA 4O19A 4YVXA 1SQ7A 3B9NA 1XUZA 3NEHA 3N9SA 4MG4A 2DSZA 4IP7A 3UCDA 3VM5A 2X40A 1JZ3A 3LXBA 1J0ZA 4AD3A 1S5NA 3P82A 2Y0FA 2EG6A 5FF2A 2QULA 1HKVA 4H2HA 2XZ9A 1B1YA 2VFGA 3KL3A 4JZ5A 3S83A 5AOUA 5DN1A 2VX5A 4E4PA 4EANA 4KS0A 5LXEA 3MU7A 4ZQRA 3SQSA 2DW6A 4MDOA 1P48A 3WCZA 3JUGA 5LIUX 2ZC1A 2GDVA 1HKJA 4NG3A 1XDMA 4QROA 2XIOA 3KDNA 4ZODA 5FEPA 1CEOA 3S5NA 1US3A 3DGRA 3GNXA 1W9XA 1UROA 4L64A 5HR7A 4YCOA 4H01A 4AVNA 4EXQA 1Z6KA 1JCNA 1DPMA 2AKMA 2H3BA 3FJLA 3LUOA 4CUCA 2J8TA 3LQLA 2Z28A 1WKDA 2J7DA 4E2DA 3LPOA 5FL1A 1LBFA 5HQEA 4HN4A 5I79A 1Q7ZA 3VNIA 3GG8A 4S3DA 2VJXA 4JAWA 2WHJA 2FZNA 4N9EA 1MWOA 3LCXA 1NFBA 4Q8VA 3GX9A 3IVSA 3SRDA 5IDZA 2WCGA 3NFUA 1G1YA 2FTWA 2ISFA 1POJA 3UU0A 1TJRA 3QXBA 3W01A 4Q6XA 3DFTA 3QEZA 3RLHA 1TWDA 1GHSA 2D1ZA 1D7HA 3V0UA 1JVNA 4ZO6A 3FA3A 4L1GA 1OF8A 2C6QA 1OABA 3RNDA 5M1TA 2D23A 1IZCA 4CD4A 1PZ0A 4TX9A 1IWPA 2BVTA 3BCDA 1MZRA 2WJZA 5CC7A 1M7XA 3JVAA 1O94A 2GUYA 1W3HA 1I8JA 2OODA 1B5TA 4JBRA 2A3BA 3B9AA 5LA2A 1TX2A 5AFDA 1NSJA 3CK5A 3PPCA 4QG9A 3EXTA 4PFHA 2QIIA 5C54A 2GWNA 1PCWA 3RCNA 3GM8A 4LUJA 4X9SA 2YL5A 5IFPA 2J8FA 1C8QA 4LVBA 3G1FA 4O17A 1XLEA 3BLOA 1UD8A 3EOUA 4H00A 5DMYA 1FHLA 3OEXA 1GKQA 1R85A 2Q3RA 3TQ0A 2WK2A 3XINA 3VMOA 1XD1A 2C1IA 4CQBA 1PKLA 4KIEA 1Q6RA 4LEFA 4MSPA 2Z1WA 4ML9A 2JEQA 1DTNA 3KHDA 2B0MA 5BOFA 1T99A 4IISA 3MMWA 5D02A 2KI3A 5I24A 1RBLA 2YFNA 5BRBA 2IKJA 3GXFA 4RW3A 1TVLA 2W3ZA 3BWWA 4FS9A 2O7SA 1CECA 4EPEC 1SU5A 3DENA 3M7SA 5IXEA 4ZQCA 4LAYA 3POHA 1H61A 1UWSA 3RU6A 3T2QA 1P1XA 3CL8A 3H2OA 3TQPA 4C1NA 1FWGC 1B6CA 4QP0A 2VOMA 4LUTB 2ZA2A 3G0UA 2DZAA 5C9ZA 1J18A 1FKXA 1QHZA 3B8WA 4F48A 1HXVA 1O4UA 2W66A 3ZXWA 4DZAA 3C2EA 2OG9A 1VPQA 3TR2A 1ZAIA 3N3MA 4MZYA 5BU6A 4DEFA 2VX7A 4RX0A 1RCOB 3MDUA 5JBEA 1W3IA 1E4LA 3IVUA 1LLOA 3VGFA 1UZHA 1J4IA 4OGZA 2VEKA 2PRMA 5LA1A 1EPXA 1RY0A 1UD4A 1XJBA 1FWBC 4GZ7A 4PEEA 1Y8BA 1E6RA 4ODMA 2Z26A 1UHVA 5BW6A 3N2BA 1AQHA 4DM2A 4OT7A 2ZRUA 9CGTA 1RY8A 2JIWA 1JRCA 3DERA 4QHRA 2ZR6A 1O60A 2VDIA 4FIQA 2WSKA 1EQCA 4W8AA 2FPYA 4I5XA 4M3PA 2XINA 4IF2A 3BGJA 3GHRA 3D46A 2PWVA 3HQNA 3KM8A 1RPKA 4AD5A 1BG9A 3GH4A 1EQPA 1XGEA 3UG3A 1GVIA 1MRQA 4RDYA 3FXGA 3H2AA 1X98A 2LJ4A 4W7UA 5AC4A 5I3HA 1UYQA 3OLEA 3VOIA 4F0SA 2AKZA 1N2VA 1X97A 1MEWA 2WVSA 1L0PA 4MFDA 2YBTA 1AL7A 4TX6A 3PZ9A 1V3JA 3VUPA 3HGOA 3WDHA 1WQ5A 1MUCA 5A6LA 3VZZA 1MMFA 4JKLA 1F5ZA 1W3TA 4M7SA 1DWIM 3AWOA 4YXGA 3JU2A 3DXIA 4JEJA 1A5MC 3V18A 4UTHA 3OU8A 4WGHA 4FN2A 4E3TA 4ZQNA 1GYNA 1F9CA 1FRBA 1ME8A 1AD4A 3EOLA 2EG7A 3O5MA 1V0LA 2PN0A 2AGTA 3ZVIA 4AEOA 3LTSA 1W1B1 1IYXA 2VQTA 4GQQA 4JICA 4LAWA 4GX8A 3L65A 2FMNA 2Z1KA 4IFKA 5JMUA 3LHWA 2SFPA 4UIOA 1E72M 1YMYA 4EF9A 3E2SA 4HU8A 1G7VA 3CO8A 3GAKA 4LUSB 2YW3A 4TX8A 4FNUA 3LI0A 3CHVA 5JXQA 1XIFA 2Z25A 1I60A 3REQA 3WH5A 1Q66A 3LQGA 5I06A 1NWTA 1XC6A 3ZWTA 2HJPA 1OM0A 3LHYA 3U3HA 3FK4A 2WPBA 5EBAA 3IJQA 1H09A 2R9RA 4G2PA 4PMZA 3CV6A 3R0KA 4HPNA 2VMFA 4Q22A 4ZPTR 1VLIA 2XGZA 5U7SA 1W3KA 4YVVA 3V4BA 3B0YA 1WYIA 1SW3A 2DUXA 4QNEA 4PTNA 3LERA 3QLLA 3VX0A 5IBXC 1AH0A 3V7PA 1QJWA 1R3SA 3CIWA 3FKRA 1CPUA 4N9DA 3AO0A 5LZLA 4HZMA 1O5XA 3CYJA 4FXJA 1D8CA 4GFIA 1QI0A 2B5UB 1KM3A 3CNYA 4UUIA 4RDVA 5B7ZA 1H50A 3VC5A 3F03K 4HCDA 5DELA 3W75A 2B7PA 4U84A 1I45A 2WANA 2PF8A 4ZOEA 2HCVA 3BL3A 1DE5A 3WK0A 2Y5JA 4F3HA 4PUKA 1K9EA 2AQVA 3HZ3A 4EXBA 1GPFA 4G6CA 1GQIA 3N25A 3OZMA 1DXFA 3VGDA 2EJ1A 1MYRA 1WDRA 5GJMA 1I6NA 1B3VA 4O50A 2E6YA 2K8IA 7CGTA 1P5QA 1XW8A 4J3VA 3EY6A 2A5HA 2BVYA 1H4PA 1T6MA 4DJDC 3VIJA 2JGYA 4AF0A 1NQKA 1AJ2A 4WY0F 2QCEA 4AHOA 3BURA 2E28A 1I1WA 4TXEA 3ODKA 1BYDA 5C9RA 4EXAA 3G1VA 2Q71A 5CZJA 1E9YB 2RFGA 1VP5A 5G4WA 3SCRA 3NG3A 4LB4A 3S3GA 3AYRA 5CC3A 3WIJA 1K8YA 3MCNA 4B5TA 1JR1A 3WNLA 1B3YA 1FWTA 4M82A 4RDWA 4C6FA 1ITXA 4BR1A 3TQKA 4GBDA 4K68A 4B90A 5A2BA 3L5LA 3T1GA 3W24A 4H6QA 3GYEA 3S5ZA 2J6VA 1W54A 3KAHA 5CPMA 4GVFA 3EB4A 3E0IA 4RZBA 2ALRA 3UD6A 4DY1A 4B92A 3CHDA 4GUGA 4UOZA 5E1QA 1ITCA 4IL2A 1FJDA 3WK2A 3JXVA 1KFLA 3FA5A 3GXNA 1W9VA 1J2WA 3CEUA 4JTFA 2GJPA 1WBJA 3IVTA 3PZVA 2DUAA 4CU8A 3TROA 5DCBA 4ZL1A 4W9QA 5BOOA 4HCLA 1Q3NA 2VEPA 5XIMA 4D9PA 4RPPA 3W7OA 3FLUA 5KITA 2E68A 2WAGA 2Q3OA 3ONBA 5G5IA 5F2LA 1OT1A 3IK8A 1H63A 4FF5A 2DU2A 1VJSA 1ZY9A 1XRTA 2BGQA 4B3KA 1QT1A 1WZAA 3QZ6A 1SFTA 1KKRA 2DQXA 3E38A 4I7WA 1W3JA 3S9ZA 5JU6A 1A5AA 4DBEA 2J7FA 2CCRA 1Z44A 1WNOA 3PANA 3LK6A 4JIRA 4JXCA 4R9XA 3RDKA 3C4UA 4JL2A 1F3EA 2BNJA 1SFSA 1XCFA 3RM8A 4DQWA 3VMNA 1DWFM 3NQ7A 3M1ZA 4GCXA 3M43A 5CZKA 4PUMA 1S39A 2QXWA 4HMDA 4ZE5A 5CH9A 5CSRA 1S1RA 3MSGA 5CSSA 3RR1A 3LBMA 2WHLA 1TIMA 2HMCA 4LX4A 4DNMA 5HNTA 1HKMA 3RLUA 2PTWA 3HG2A 4HPHA 3CUIA 1IR2A 2X2GA 3ZLHA 3R6IA 1GORA 4LJ3A 3BGAA 4IPIA 3BANA 3TTSA 1TV3A 1TCDA 4C6MA 1MO0A 4N9BA 3EWZA 2WMKA 4EWJA 4GVGA 2OZ3A 2E8ZA 5I00A 5ENLA 1U83A 1FWDC 2C8NA 1QNPA 2IKIA 2ANUA 3G1XA 1EHAA 1Y0OA 4QLKA 2BFGA 1FKWA 3DECA 4GK8A 4JTJA 1UR8A 4QIUA 1UUOA 5C70A 2C7FA 2XH2A 3KLKA 4P8VA 3A3HA 2P50A 5AHEA 3ALGA 3BO9A 2FHBA 3R11A 3UI6A 1H7NA 2WSQA 1HGWA 1IXPA 3UWUA 1EJXC 1VFLA 3W70A 3E5PA 4DWSD 5EB8A 1DHKA 1SJAA 1BRLA 2HPMA 2GPTA 2V30A 1EZWA 1M03A 4BK9A 1W8SA 3Q94A 4E5TA 3EAUA 3AIVA 5CZSA 3W7DA 1GQJA 3U48A 4O0QA 1A5OC 3PJTA 3O0KA 4V28A 2PMQA 2XN0A 4FIRA 1PHWA 2WVVB 3CAWA 4AY7A 1A5LC 4KWOA 3OHIA 1TJ2A 1CGWA 2GK1A 2PLCA 4UFKA 1C8XA 2REQA 4BY3A 1IEVA 2QW5A 3OVGA 1J12A 4POCA 3C2YA 4CCZA 4GKTA 1TVNA 3WMSA 1EYMA 2XP8A 3TSDA 1NVMA 3K4WA 3USZA 5HJLA 4XAKA 1IWBA 3Q58A 3GXMA 2HTMA 3VDHA 3N15A 1EDTA 1RJQA 3KAIA 5FACA 4ZPWR 3IJ8A 4KMQA 2PUZA 1J9YA 3ZR5A 3B97A 5AB3A 2PC8A 2G37A 4AH7A 2QF7A 4HJFA 5I2UA 3OGSA 2VC9A 3MV01 2VC7A 3W2KA 4IZGA 3VGBA 1XLGA 3ES8A 2HVMA 4M0XA 2OKTA 3E96A 4JYDA 5C5YA 5FJTA 5DY3A 3QPZA 4QX4A 4EX4A 3PP7A 1R38A 4QISA 3PTQA 1V79A 1J11A 3B8SA 3GNDA 4GZEA 3HIJA 1D3GA 3T7VA 1