3OA5A

The structure of chi1, a chitinase from yersinia entomophaga
Total Genus 187
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
187
sequence length
515
structure length
515
Chain Sequence
KSNLIYDKDPGYVWDNKNECEGAAEETYQELNYEPSISADKLTWTPTRLAKTVFNTYEDDDDFNVLCYFTDWSQYDPRIINKEIRDTGGRSADILRLNTPDGRPFKRLIYSFGGLIGDKKYSADGNASIAVRLGVATDPDDAIANHKGKTIPVDPDGAVLASINCGFTKWEAGDANERYNQEKAKGLLGGFRLLHEADKELEFSLSIGGWSMSGLFSEIAKDEILRTNFVEGIKDFFQRFPMFSHLDIDWEYPGSIGAGNPNSPDDGANFAILIQQITDAKISNLKGISIASSADPAKIDAANIPALMDAGVTGINLMTYDFFTLGDGKLSHHTNIYRDPSDVYSKYSIDDAVTHLIDEKKVDPKAIFIGYAGYTRNAKNATITTSIPSEEALKGTYTDANQTLGSFEYSVLEWTDIICHYMDFEKGEGRNGYKLVHDKVAKADYLYSEATKVFISLDTPRSVRDKGRYVKDKGLGGLFIWSGDQDNGILTNAAHEGLKRRIKNKVIDMTPFYLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural analysis of Chi1 Chitinase from Yen-Tc: the multisubunit insecticidal ABC toxin complex of Yersinia entomophaga
pubmed doi rcsb
source organism Yersinia
molecule tags Hydrolase
molecule keywords Chi1
total genus 187
structure length 515
sequence length 515
chains with identical sequence B
ec nomenclature ec 3.2.1.14: Chitinase.
pdb deposition date 2010-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00704 Glyco_hydro_18 Glycosyl hydrolases family 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.50.10 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 3oa5A01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3oa5A02
1A3HA 3AIQA 1LQ0A 4WKFA 2VZOA 1GPFA 4J3XA 1EH9A 4PMQA 5CPSA 4JHOA 2VC9A 3AISA 3A47A 2WHMA 1RP9A 1XCXA 3LPFA 4W7WA 3F4VA 4FF5A 3G6MA 2BXZA 1KQZA 4JKLA 2GDUA 3SCTA 1VJZA 2UY4A 4UZSA 3VIJA 3BSHA 1DEDA 1S46A 3W28A 3AMKA 1ITXA 3AIVA 2WNWA 5D9MA 3KEHA 5A3HA 3RIKA 4CVUA 2BVTA 1UH3A 4JL1A 3MSGA 1JZ3A 3PHAA 1E3ZA 3CZEA 2WLYA 2CBJA 3VGEA 1QI2A 4ACZA 1AVAA 2BVDA 3K4DA 3IAPA 3RJYA 1X6NA 1VBUA 1BFNA 2X0HA 3U7BA 4JIEA 1UOKA 1TZ7A 1EOMA 1OIMA 3F5KA 1KR1A 4W7VA 4H2CA 1H2JA 3ZT7A 3ARPA 3KE0A 1Q6GA 1MW0A 5A94A 4CD4A 3VGDA 4TTUA 2YBTA 3BAWA 2W67A 1QI5A 4F9DA 1WZKA 1B3ZA 1CPUA 2NT1A 3N12A 1E56A 5CSYA 2Y24A 3VGGA 4MDPA 2YKKA 5E6ZA 2WCSA 3NIYA 4HMEA 5I78A 1TCMA 2BY2A 1GOOA 2WMKA 3EDKA 1UR1A 2Z1KA 2RGLA 4GI8A 2WSPA 3EMCA 1FP9A 1C91A 3VDBA 4ZFMA 2JE8A 3PZTA 3SIMA 1RPKA 4NRRA 2WZHA 4PMUA 2XG9A 2JIEA 2QPSA 1VRXA 5JUVA 2WVVA 3FNDA 1CBGA 1Y7VA 1H0GA 3FXYA 1HKMA 4W8LA 1AQ0A 3I3EA 3T09A 2NW0A 3BAYA 1KR0A 3VIHA 1LWHA 1CECA 2WBGA 4UTFA 4ML4A 1TFVA 4D6IA 3AZTA 1G01A 1R87A 3GBDA 1B3VA 2XIBA 5A6MA 1DWJM 4GZIA 3AOFA 1GHRA 4AZCB 1XH1A 3T2QA 1XGZA 1D2KA 5EBAA 4EAMA 3OGVA 3WQ8A 3ZSTA 1OINA 3BMWA 3QOMA 4M82A 1XH2A 2J78A 1J11A 2YLLA 2QF8A 3BAJA 3CZJA 1UKOA 4UZUA 3L4WA 3AS1A 1DWHM 3MU7A 4AD3A 4Q7NA 3PZOA 4PMZA 3WL0A 3UEQA 1Q4NX 1VF8A 4D6GA 1EQPA 2J7DA 1U30A 4PEEA 4ZE4A 3EDFA 5A6LA 3NSMA 2D2OA 4CD6A 5FL0A 2VURA 1HP4A 4GZJA 5E09A 3T08A 3CHEA 3E1F1 3UESA 1TUXA 2E9BA 3CUJA 3NSNA 4PN2A 3VD3A 5BWFA 1OGSA 4D6JA 1JDCA 3VIFA 1SMDA 1E72M 2VNCA 3TTOA 5HOSA 1SFSA 4EANA 1UA7A 1V3JA 1WKYA 2QLYA 1KBKA 1W2PA 4YHGA 1CXFA 3IJ8A 2GJPA 4DWSA 4HPHA 5TD4A 3ARRA 4W86A 2V5CA 5CZKA 1UWUA 4BQ4A 2WVVB 1UH2A 4J28A 1UD4A 1BGGA 5FOOA 1JXKA 1LL4A 1WZAA 1V6YA 1UZ1A 3K1DA 2WANA 2WSKA 4B3LA 2WVUA 1VBRA 2OWXA 1FH7A 4DM2A 5A6JA 3T2PA 1HJSA 3FHAA 4KGJA 1NWRA 1J10A 1WDPA 3SUWA 1HJUA 1OB0A 2A3HA 3W24A 3GH5A 4FLSA 1GOKA 5D9OA 4YN5A 1WDRA 3J7HA 1V08A 2OYLA 4P8XA 7A3HA 1NP2A 5BXPA 3WF1A 1FOBA 2X1IA 1M53A 5DEZA 4AC1X 4HMDA 5ABGA 3SCUA 6CGTA 3RDKA 1GQIA 3ARUA 4XB3A 4W8BA 1V6UA 3VUPA 4A4AA 1LWJA 1WCGA 4PUEA 5CGTA 1KXTA 4JFUA 3M46A 3WNMA 4OUEA 4AMCA 1E6ZA 1UWQA 1QBAA 1QW8A 2ZIDA 1LJYA 1EA9C 2YDRA 2CIPA 4TVCA 2YA1A 3WH8A 4J7RA 2PWDA 2WM0A 4W89A 3W29A 3PZQA 5IHRA 2WW5A 1E4MM 3AYSA 4AD4A 2UY2A 4D6CA 1W9DM 1UWRA 5JBEA 1W1TA 2WKGA 2DDXA 3NDZA 4TXEA 1WPCA 1W3KA 3AMLA 1C90A 4PMYA 3MUY1 2D3NA 2XYLA 5IFPA 5I24A 2W61A 1OGGA 4HMCA 1WZLA 1V02E 3TTYA 2WHJA 1GQKA 1E6QM 1K9EA 1C8QA 1E5NA 1JF6A 4M8UA 3BCDA 4UFLA 2DEPA 1LG1A 4P7NA 3BC9A 2A3CA 1FH9A 1NM9A 3NYDA 1QBBA 5DF0A 1V3MA 1SYTA 1UKQA 4B15A 3N13A 4NRSA 4EE9A 5E9AA 3W4RA 1NH6A 1MW3A 3WY1A 1JF5A 4QLJA 3VNZA 5DT5A 4WSKA 4UQAA 4D71A 1CGVA 2AMGA 3L4VA 4BQ5A 2EQDA 1J0HA 3PTMA 3AICA 5GNYA 2GK1B 1E4LA 2GJXB 1B31A 2OSXA 3WEOA 2A3BA 1H3GA 3LMYA 1Q6FA 2ZXDA 1OT1A 5EFDA 4HOZA 4W87A 5A95A 2YIHA 4JCLA 3B9EA 2ZOXA 2DIJA 2D0HA 4ZXOA 3CUHA 3W26A 2RGMA 3OG2A 2PWHA 1W1VA 1OCQA 1OWQA 1CENA 4V27A 3O9NA 3ZQ9A 1KGXA 3G6LA 3MUIA 4IM4A 1M7XA 1WZMA 4M24A 2J62A 2G3JA 1HN1A 4JFTA 5EB8A 1R86A 3ARVA 1UWIA 3M6DA 5I2UA 2WCGA 5A8OA 1JFXA 1CZ1A 2FH6A 3GDBA 4FLOA 1KQYA 4X0NA 2ZUTA 2ZXBA 4PMRA 4UR9A 2XSBA 4P8VA 4GKLA 3B8SA 2GFTA 4BQ2A 5I3DA 3AQUA 2BNJA 3OLEA 2ZXQA 3CHCA 3QR3A 3WQWA 4HTYA 2OSWA 5DMYA 3LPOA 1JD7A 1V3KA 1QVBA 5FIPA 2CCRA 3RM9A 3L4ZA 3GH4A 2VQTA 3VKKA 3ALGA 4UFHA 5F7UA 3II1A 3FY1A 3HN3A 4PBGA 1IV8A 1EDGA 2HVMA 4LYQA 2UY3A 3ZR5A 4ACZB 4H8UA 1KWKA 1JZ6A 5GQBA 5HPOA 4IPLA 4CCDA 3WNOA 4S3KA 3VX1A 3RM8A 1EHNA 4W8AA 2DPEA 3L2LA 1BYBA 3UR7A 4AY1A 2BHYA 5A6SA 5ABEA 3S6TA 2E0PA 2V3FA 4LYRA 4H8VA 4KMQA 2D1ZA 1TG7A 3TA9A 4UCFA 1UA3A 2GJRA 3ARXA 2BFGA 3ZJ8A 1V0NA 2A3EA 1FH8A 1TA3B 2VRQA 2J8FA 8A3HA 1JZ4A 2W62A 2XVPA 2J47A 5DT7A 3WMCA 5A2CA 2VZTA 2BHUA 1HVQA 1W3HA 1ISYA 1KB3A 2GVYA 2VJXA 4PMDA 2D3LA 2XIIA 3PZUA 2F61A 1H0IA 1ISVA 3WFLA 2QPUA 5BROA 1XSIA 4HPGA 5CG0A 3O2LA 1UKPA 3WD2A 2CXGA 4CN1A 2CHOA 1UD6A 2GSJA 3DYOA 2VX7A 2YL5A 4B9YA 3KL0A 3VX0A 3U5UA 4UOQA 1J0ZA 1E3XA 4U3CA 1MFUA 1I1WA 5EFFA 1KFWA 2ZUSA 4AZBA 1JZ8A 1ECEA 1NWSA 3IJ7A 1XC6A 3CHDA 2VO5A 4CD7A 2VR5A 4BQ3A 1BHGA 4OBRA 5ABHA 1MWOA 3MS8A 1BYDA 4Z2GA 1V02A 1E6PA 1BYAA 1CXIA 1MQPA 3NDYA 5A2AA 1V0MA 4AD5A 1C3FA 5D8ZA 3WD1A 1HIZA 3CGTA 4QLLA 2JIWA 1OSEA 2D23A 2WZEA 1UH4A 4MADA 1R7AA 5AYBA 4D72A 3U5YA 1CTNA 5A8QA 4CU7A 1ESWA 3AROA 4NI3A 4TVUA 3DHUA 2J7EA 1CWYA 2DGAA 2Y5EA 3DECA 1W3JA 3WSUA 3VO0A 2JEPA 3WH7A 4PMOA 1L8NA 2VI0A 1BTCA 1PAMA 1JZ5A 4IISA 1EHAA 4QCFA 3ZT6A 2WMFA 2J7CA 3EBVA 3GYCA 4HZ6A 4KWUA 3GZAA 3DC0A 2VT0A 2WB5A 2Q8XA 4NSBA 4V28A 3A4AA 3W53A 1GQJA 3BLPX 1BSIA 4MJ4A 3D5HA 2WMHA 4U5KA 1JAKA 2OWCA 2IXVA 1NOFA 3VNYA 1VIWA 4B16A 2DH2A 3PBGA 3UERA 2DIEA 2CEQA 5CQ1A 4AD1A 5LA0A 3AIWA 1W9BM 1QI4A 2UWFA 1H11A 4JFWA 4BS0A 1BVNP 4U2ZA 4LYPA 4AW7A 3IAQA 1L0PA 4QCEA 4NZCA 3WMSA 3T0BA 3AMDA 3ZJKA 1J18A 1VFFA 2C7FA 3VD9A 1NQ6A 1XSJA 4WIWA 2BXYA 3W37A 4OZOA 4P7RA 5CLWA 2XSAA 2E4TA 4S3JA 4V2XA 1CGYA 5CLTA 4MB5A 1KXVA 2VCCA 1BLIA 3IK2A 2EXOA 4PSPA 1HJXA 3MMWA 3SUUA 1VEMA 3ALFA 1E1EA 4M56A 3AZRA 3WNNA 1B2YA 4H8HA 2XVKA 1NOUA 3UETA 5BRPA 1GHSA 2GUYA 3N17A 3VGFA 2X8RA 3BMVA 4AIOA 2WMIB 2YA0A 1F4AA 3L4XA 1EGZA 1LF1A 2OWWA 3JUGA 1VFOA 2ZX8A 2J25A 3WDPP 4E8DA 4U2YA 2EJ1A 2ZX9A 2VOTA 4AZGA 3SCNA 2X05A 2BHZA 2ZX6A 1K9TA 3FHQA 4TTGA 2GDVA 3PZMA 5C70A 2DSVA 1E0WA 1B90A 1ODUA 3ZO9A 2FHCA 2WC3A 5M03A 3VM7A 5FKYA 2J7BA 1GQLA 1K9DA 2EPNA 4BA0A 5JH8A 1UYQA 1GOIA 4CUCA 4KH2A 3BAXA 3TTQA 4DM1A 2XFRA 4UQ9A 5BXTA 5CGMA 5CSUA 5I23A 2XFYA 2Y8VA 2XWDA 4F9JA 4PTVA 5FD0A 5IDIA 1HX0A 3BH4A 1XD1A 1W9PA 1V0LA 1E6SM 2EO7A 1KXQA 1G1YA 4UFKA 4UNIA 1HJQA 1CYGA 5A8NA 2VZSA 1FFQA 5GNXA 4UOZA 1E71M 3W0KA 2WHKA 3VIKA 1DWFM 1GONA 1UKTA 3WNKA 2J7FA 3AJ7A 5FCZA 1R85A 1MFVA 1KBBA 4M1RA 5A8PA 2W63A 2CESA 4E8CA 4AWEA 3QOKA 3GNOA 4Z2LA 1UR4A 2E8YA 2JF7A 4BF7A 1DWAM 2WPGA 3CO4A 4CN4A 3WD4A 4LXFA 2OYKA 1G9HA 1WDSA 1LL6A 1DTUA 1EDQA 1M03A 4KRTA 1QNSA 3APGA 3WQVA 4J3SA 2CHNA 4EKJA 4DWSC 3MMDA 5BXRA 3WN6A 2PWGA 1OD8A 2DSUA 4CD5A 3NCOA 2E9LA 1JNDA 3A4XA 4TX6A 4JZ5A 4NF7A 3U57A 1VEPA 1ZBCA 1D7FA 4UQBA 2EPLX 2CYGA 3FAXA 2IUZA 1BG9A 1CEOA 1HKIA 1CGTA 4MJ2A 1CGUA 1O7AA 1WAWA 1UD2A 1EOKA 5DO8A 3IJ9A 2XVGA 3WBAA 1PZ2A 3WFZA 1P6WA 3A6OA 1US2A 4PCSA 4PCTA 1HXJA 1XRVA 3WF3A 4A3YA 3CMJA 4QFUA 2O9RA 1UR9A 3VD5A 3NJ3A 3CHFA 4LGXA 3AHYA 2QMKA 1JNEA 1HNYA 1G94A 1QOXA 2XHYA 5BCAA 2ZUNA 4JKMA 3VGBA 4E4PA 3SUVA 3KL3A 4DWSD 1U2YA 4MPKA 1HL8A 2J7HA 1B9ZA 2CERA 1TA3A 3MMUA 4UQCA 4MTVA 2WBKA 4TVDA 2TAAA 3A4WA 3DYMA 1W32A 2D0FA 2C8NA 1UD3A 4LQ1A 3HMCA 2O9OA 1GZJA 2W92A 1MVYA 5D8WA 3SCRA 3ZJ7A 2VQUA 1H5VA 1GNXA 1QI0A 1AQHA 1KCKA 2VL4A 3GNRA 5A6AA 4F66A 5E0FA 2ZX5A 2J79A 2XVNA 1GORA 2XPKA 1C7SA 1JGIA 2UY5A 4RE2A 2WK2A 4U3AA 1CXEA 1IZKA 1V3LA 1YQ2A 3OLDA 1K9FA 1PEZA 1QNOA 1VAHA 3CUFA 3EMQA 3GXIA 1QNQA 3WH9A 1X1NA 4PUDA 3OGRA 5BXSA 3N18A 4GIAA 5D4YA 2G3NA 3UCQA 1TE1A 2GK1A 3AFBA 3WF0A 4BZYA 2CPUA 2BY0A 3AS2A 3ZOAA 2PBOA 4IPNB 5I79A 2VX6A 5M17A 2QHAA 1E6NA 4J3TA 3GNPA 3B9DA 4Z2JA 2DSKA 3EDJA 4GPNA 3VMOA 4AYSA 1N82A 5D9NA 3NSXA 2PWEA 3U7VA 1B0IA 4KRUA 7TAAA 1BGAA 1PIGA 2WHLA 4UQEA 1PX8A 2WKLA 4PTXA 4HA3A 1OBAA 5ECUA 4N42A 1QNPA 1UQYA 2QMJA 1W1YA 3AIEA 3WMBA 1W9UA 2JFEX 4MNMA 4M80A 4W84A 4PMXA 3FAWA 4CKQA 1UZ4A 4URIA 3OLGA 4UQDA 3ARSA 3I3DA 2JALA 5CPQA 2DT1A 3RM4A 1H49A 1C92A 3PZNA 1JDDA 1GW1A 1EO5A 2GJXA 4J3UA 4GZEA 2XVLA 2E40A 1UKSA 3MUZ1 1E0XA 2WCAA 3GXFA 3N1AA 4PTWA 4AZ7A 3A3HA 3RPMA 4AZ6A 1LG2A 2ZE0A 2PC8A 3EDDA 2DT0A 2E3ZA 3KWXA 4ATDA 2WWDA 2D0GA 3OZOA 4HP5A 3WD0A 2XGBA 4CN6A 2G3IA 1JFHA 1E1FA 3ARZA 2J74A 3W38A 4GXPA 3WH6A 1E73M 1JI1A 3CLWA 3LPGA 4OIFA 4PYSA 2XTKA 4UFJA 1JYNA 4CD8A 1XCWA 4UFMA 2PI6A 1WNOA 3ZIZA 1E6RA 2EPMX 3THDA 4FLRA 4MB4A 3CIVA 5IXEA 3POHA 4OBSA 4GI9A 4EK7A 2ZUMA 3BAIA 4D1IA 3UG5A 1V03A 1JD9A 5GPRA 3RJXA 1ODZA 1JIBA 1I75A 1B30A 1NOWA 3WDQA 4WF7A 1C7TA 4DWSB 2VVNA 4HA1A 3CZ8A 2G8ZA 4DUWA 1JXJA 4GQRA 2CBIA 5FL1A 1E43A 4R27A 1DWIM 1DHKA 1Q6EA 2ZWZA 3OIHA 1WE5A 1ZJAA 3T0AA 1MW1A 1I1XA 4C7DA 2E9MA 1JZ7A 1ZL1A 3HU7A 1W9XA 1E4NA 1F4HA 2XUCA 4FMVA 1UWTA 2IXUA 3VIGA 1RH9A 2J7GA 3VIPA 1OM0A 1BQCA 3AS3A 4OJYA 2WXDM 4FK9A 1GJWA 3M7SA 2G4FA 1MXGA 1SMAA 1CGWA 7CGTA 5IHSA 2XM2A 3CPUA 3UR8A 1VFUA 3WUGA 2ZUVA 3VILA 4D6EA 4J27A 1UG6A 1JI2A 4ZE5A 2XM1A 3LPPA 4XUYA 4JAWA 2O9PA 2VTFA 5AC5A 1HVXA 1PX4A 4P7QA 1CIUA 3WQ5A 2B31A 1LLOA 2D20A 4JHZA 1ISWA 2BY3A 2V3GA 3CZKA 1HT6A 1RD6A 1ISXA 3UG3A 1B3YA 1XD0A 5JIPA 1VEOA 4PRWA 6A3HA 1GJUA 3POCA 2JF6A 2W66A 2XFFA 2ZICA 4U5IA 4CCEA 1W1PA 1V6WA 4HU8A 3BCFA 3SCWA 4XZWA 1BAGA 1MQQA 2WC4A 2ZWYA 2CBUA 2J4GA 3FW6A 2YL6A 3K4AA 1XYZA 1X6LA 2Y8KA 5DFAA 5HNNA 2WC7A 3WUFA 4QAWA 4ATWA 3L4UA 1GCYA 3EMZA 4JCMA 3WF2A 1QHOA 1ZS2A 3WIJA 1E6XM 3T2OA 4YHEA 5I5RA 4C7FA 4GINA 3D3AA 1XV8A 3AXIA 1J01A 3SCPA 5I77A 3N9KA 3AYRA 2F8QA 4ACYA 1Q6CA 1MQRA 4D6FA 4RL3A 3TOPA 2YBUA 2X09A 1KGWA 1A47A 1FA2A 1U33A 4WKHA 1G0CA 1PPIA 3WDRA 1JDAA 4W85A 1UWSA 3K46A 3VD4A 3QHMA 1AQMA 1EQCA 1VJSA 1FP8A 2YOCA 2C0HA 2WLZA 1JAEA 1W3LA 2J77A 4QP0A 4AXNA 3PZ9A 3WUEA 1XHGA 4H04A 4D1JA 3VMPA 2DSWA 3N15A 5AYIA 2YLAA 4ZENA 3WNLA 3AHXA 2XWEA 5AC4A 2QV4A 5BRQA 4PTMA 1B1YA 3CZLA 5HDRA 3ZJ6A 5I6SA 4ZXLA 1M01A 3MSDA 4W88A 4MB3A 1B3WA 1MW2A 2MANA 3BGAA 1GOMA 1WP6A 4J3VA 1HKKA 2WYSA 1BG4A 2OLHA 4D6HA 1O6IA 3IANA 1UD8A 2VMFA 5E0CA 1W9VA 4Z2HA 4W7UA 1MYRA 3VTRA 2PF0A 3SURA 1LL7A 3RMEA 3VIMA 4AZIA 2CKRA 1OT2A 4OOZA 1EDTA 2ZXAA 5GNZA 2Y2WA 1D3CA 3WQ4A 5HPCA 1BPLB 2VUYA 5A1AA 5JBDA 3ZR6A 1XSKA 3AI0A 1FHLA 4GQQA 4IUGA 1SR0A 3WL1A 2W4XA 5BYWA 1UR2A 2FHFA 1TR1A 1Q6DA 5A2BA 2Z1SA 1V0KA 2DT2A 1YHTA 4B3KA 2BVYA 2D24A 1J0JA 3TP4A 1PJ9A 2ZUWA 3KL5A 4L4OA 4AZCA 3KZSA 1PIFA 3VDHA 4OKDA 2D22A 1JYXA 3L2MA 2NT0A 2DH3A 4C7GA 2BY1A 1J0YA 4AEEA 4WJXA 3AZSA 4CCCA 3UG4A 3OA5A 3WKZA 3DYPA 4L4PA 3VVGA 3AIRA 1C8XA 1HF6A 3OBAA 4MAZA 4P8WA 3AXXA 2CITA 3GBEA 2PBGA 2FDMA 2X2YA 5A8MA 2YL8A 4XX6A 5CXPA 3QGVA 5A6KA 1WO2A 4JKKA 3ZSSA 3VDAA 1HP5A 4J3WA 3QHNA 3RILA 4ATLA 4P7LA 3BLKA 4JL2A 2VVSA 1DWGM 3ARWA 1CLVA 4HU0A 3WH5A 4F8XA 4HZ7A 3TONA 5ABFB 1PX3A 2JEQA 3SEPA 5C71A 1DP0A 1TVPA 1V6VA 2AOSA 2AAAA 1K6AA 1MXDA 2W91A 1ZBVA 5HBFA 5LYRA 3HJEA 1OD0A 3VOCA 4HZ8A 4MAVA 2J75A 1GOQA 1KXHA 3W6MA 4BCEA 3ARYA 2VZVA 3W27A 2VCBA 3VD7A 5M5DA 1US3A 1H1NA 2O9TA 3AHZA 3L4TA 1ZU8A 1CDGA 2BS9A 2EBNA 5KZ6A 3AXHA 5CPTA 4PMVA 1IT0A 4DUXA 4U31A 4GO9A 4MNJA 2E8ZA 3CMGA 4QLKA 4TOQA 4E2OA 1RP8A 1JL8A 4AEFA 3BSGA 1B3XA 1ZBWA 4GO8A 4AD0A 3T0DA 4X0VA 4F79A 3AS0A 2YDQA 1NWTA 1TMQA 3ZT5A 1CXLA 1KGUA 1NARA 5A69A 3MANA 3NUKA 5C8BB 4OOUA 3TTSA 3WDIA 3ZM8A 4HOXA 3CZGA 1QHPA 3F5JA 1BVZA 1E9LA 5JBFA 3VIIA 3ZMRA 3ECQA 5EMYA 1V3IA 4M81A 2VRKA 4GI6A 2ZX7A 1PBGA 5ABFA 1GVYA 3W6LA 3M07A 3O6AA 3GXDA 4AD2A 2A3AA 5E6YA 1E15A 3SCSA 3L4YA 4MB1A 2YDSA 5CJ5A 1ITCA 1H4PA 3AIBA 3OB8A 1KWGA 2YL9A 3WD3A 2F2HA 4WKAA 1BF2A 2EEXA 2XGIA 1J12A 4XZBA 2V3DA 1JG9A 3VU2A 3OLIA 1OIFA 1UR0A 3ARQA 2X0YA 3SCVA 3ARTA 2CETA 2VCAA 2VX4A 3WEZA 3BXWA 1HKJA 1PZ3A 1V6XA 2XJ7A 4QDMA 2WZIA 1UD5A 4Y7EA 2VX5A 3WF4A 1CXKA 2Y4SA 1ZB5A 4H41A 4WK9A 4AIEA 3S2CA 4MNLA 4TUFA 2YJQA 3VINA 3WNPA 4MDOA 2WVSA 1Z32X 3I3BA 1AMYA 1WDQA 1QPKA 1ZBKA 2O92A 3QHOA 1H09A 4DUVA 3CBWA 2FH8A 3BAKA 2OYMA 3N04A 4PMNA 3WBEA 2VR4A 1E4IA 2YA2A 2OSYA 4P8UA 4AZHA 2HISA 4KGLA 2W5FA 1JZ2A 5IFTA 3AHVA 1GUVA 1CXHA 3WDHA 3AMCA 3B9AA 3MV11 5A6BA 4W5UA 4LPCA 2PB1A 4H7VA 1UQZA 2CNCA 3PTKA 4CU8A 3SUTA 3OZPA 3F5LA 1EIBA 2DT3A 3GH7A 2DQXA 2FHBA 3THCA 3GXMA 2V3EA 4A3HA 4Z2IA 1G5AA 2WMIA 3RCNA 6TAAA 1E70M 1FFRA 1OGBA 3W25A 1VFMA 3EYPA 3PTQA 4CGTA 2NSXA 3W81A 2WVTA 1C8YA 1R8LA 4X9YA 1NP0A 2CKSA 4Z2KA 3WQ6A 4D6DA 4UOJA 1M04A 4W5ZA 2FGZA 2WAGA 4PSRA 4RE4A 1VENA 5AY7A 1UUQA 4P7OA 4HOWA 1CLXA 1XYFA 1NWUA 3AMGA 4AISA 5A6BD 3MKKA 1QNRA 3WELA 1FHDA 2EPOA 2VRJA 4U33A 4AZ5A 3GTNA 1VB9A 2G41A 3CUGA 1QI3A 2PWFA 3FN9A 1ZJBA 4N0RA 3MO4A 1XH0A 3PN8A 4K68A 3GM8A 2WMGA 5HXMA 1QW9A 4UFIA 1E55A 2G3MA 3MV01 2ZUUA 9CGTA 1ISZA 5I0DA 1J0KA 1H41A 2J8GA 1JYWA 4FLQA 4WLCA 1UHVA 3MUAA 4M29A 4RE3A 1EO7A 3VDCA 4AIUA 4CVWA 5M3WA 3EDEA 8CGTA 1CGXA 3RO8A 3AHTA 4JFVA 5E70A 1WB0A 4B9ZA 2DSZA 3DHPA 5D9PA 2V38A 3N11A 4R5EA 4MNKA 4HA4A 5JIWA 1W2VA 3CH9A 3CUIA 1J9YA 3WUBA 4CU6A 2EPKX 1EXPA 2ESCA 1E5JA 3K8MA 1C93A 3CTTA 2V5DA 2WWCA 5LA1A 1CNVA 1GVIA 3K8KA 3OGSA 4TX8A 3W82A 1GOWA 1HL9A 1V3HA 1E40A 3VGHA 3VM5A 3AIUA 3WEMA 3SCOA 3WDJA 4Q22A 1J0IA 4YPJA 4XV0A 2FGLA 5LA2A 1TVNA 1HJWA 4W93A 4LX4A 3VIOA 3WENA 1JYVA 3SCQA 4ZEPA 1KCLA 3SUSA 2BV9A 4WSJA 5KEZA 3PZIA 1UR8A 3K8LA 3PZGA 1W91A 2VZUA 1BYCA 2CBVA 2WMJA 3VMNA 1QHZA 3PZVA 1IZJA 1HJVA 1R7OA 1E0VA 3VPLA 4JFSA
chains in the Genus database with same CATH superfamily
3NM3A 2A0NA 1XF0A 1LQ0A 4C60A 3TNOA 3L67A 3WJWA 5F2GA 4PMQA 3ZXWA 5I7GA 5LNSA 2VC9A 3K4WA 4S3DA 2BDQA 3VNMA 1RP9A 1XCXA 3N6QA 1SJCA 1H63A 3CB8A 5CAKA 2OEKA 3G6MA 3FA3A 4UZSA 3CWHA 2MPHA 3BOFA 1NEYA 4HPNA 3D6NA 3W28A 3AMKA 1E9IA 4IGMA 5K9DA 4L9ZA 1OG0A 1Q6LA 2CZVA 3PHAA 4CNOA 3U2EA 2CBJA 3F4NA 3ES7A 3PFRA 1ZCNA 3XINA 2X0HA 3B04A 1TZ7A 1FKIA 1EOMA 4RXFA 1OIMA 1TV7A 3COTA 4DBEA 4IPPA 3UXIA 1FWFC 3ZVIA 1XLAA 3ZT7A 3ARPA 3KE0A 3TN3A 4HTBA 4CD4A 3VGDA 1U1JA 2QJIA 3IJLA 4F9DA 2F84A 3N4EA 3M5ZA 1XLMA 3T9PA 3RCMA 1KFCA 2CZ5A 3VGGA 2FB2A 4MDPA 2K8IA 4HMEA 4HT3A 1GOOA 3QPZA 1OHLA 2W0UA 1ZK6A 2WSPA 1YNPA 3LCHA 3ITLA 1V4YA 4INFA 3L66A 1NF0A 3RNDA 3LZ5A 1J6YA 2Y5JA 3SIMA 3TV8A 3CLMA 1PYFA 1XIMA 3R43A 4UC5A 4C6PA 3GVGA 2IPFA 4DJDD 2JIEA 3R25A 3EOLA 5JUVA 1OC5A 3EA3A 4UIOA 3T09A 3N6JA 3UGVA 1DXIA 1QNVA 1JCLA 3O07A 3E0FA 2C18A 1WX0A 1UBSA 5RUBA 1SQ7A 4D6IA 3HFYA 2EAWA 8TIMA 1ECQA 1RALA 3EWZA 1XICA 1B3VA 5CH9A 3T7VA 4AH7A 3T2QA 4RCXA 3OGVA 3ZSTA 1VRDA 2VWSA 3CUXA 4ZR8A 5CAHA 3H7VA 3QOMA 1QWGA 1DIKA 4M82A 1XH2A 4Q3MA 2J78A 1EYMA 1IIHA 1UKOA 4P61A 4UZUA 3WQGA 2A79A 3MU7A 3VE9A 3U8GA 2BGQA 4Q7NA 1W1IE 2DFAA 3FOKA 3WL0A 1Q4NX 1TTIA 4D6GA 1THFD 1NTHA 3SN0A 1D7IA 4ZBCA 3CAWA 4EIVA 4C6DA 5A6LA 5I07A 1SJBA 5FL0A 1AH0A 4UTJA 2OLSA 4B3ZA 5E09A 2BWGA 3E1F1 4IFRA 1TX2A 1TUXA 2QCNA 3UP8A 1EF2A 3B4UA 1NQKA 3CUJA 3NSNA 3LCLA 2RKXA 2YCLA 5BWFA 4D6JA 5CBIA 2RAGA 1JDCA 1SMDA 1QO2A 1O12A 4O12A 5HOSA 4DRKA 4BEUA 3SN1A 2OX4A 1V3JA 3VOIA 1Q85A 3B3DA 1EL3A 1KBKA 4RKAA 5G2HA 1MO0A 1NSGA 4UB9A 1X1OA 4ERGA 4J40A 1UH2A 4ZQCA 3EAUA 1BGGA 2V6AA 4HPXA 1YXCA 4O0ZA 1B54A 1LL4A 1V6YA 4QG9A 2WANA 4B3LA 2KGJA 4GE8A 4DM2A 1HJSA 4KGJA 4D8LA 4Z1AA 4QE1A 1TV8A 4K2SA 2YPIA 1YMYA 3DU0A 3W02A 1OB0A 4GIEA 1LT8A 3L5MA 2J27A 2BOGX 3SRDA 3M44A 4YN5A 4BF5A 1V08A 1WA3A 1E9YB 4Z42C 5XIMA 2X1IA 3GTHA 4E3TA 2GVEA 4L65A 4HMDA 5GJPA 4L6HA 4UTTC 4F0RA 3R10A 1WCGA 2XIOA 4PUEA 5DMMA 1GVRA 4OUEA 3TDFA 2BX7A 4H8NA 5D33A 2QAPA 4TVCA 3UWUA 1A5AA 1IHIA 1VFTA 1DOSA 2H9AA 3TJ4A 2WM0A 4F0HA 4W89A 1IEIA 4C6KA 2CC0A 2O4MA 5D30A 1Q6HA 1L6YA 2UY2A 4D6CA 1RA0A 5JBEA 1SW7A 3I4EA 3NDZA 3ABQA 3C2RA 1W3KA 4PMYA 3MUY1 1FCUA 3G0UA 5I24A 2W61A 1OGGA 1XUZA 4DPQA 1UP0A 3G8RA 3A21A 5CPMA 3NQGA 4RDVA 3WQOA 3CPRA 3BANA 1E5NA 2E25A 5D37A 2FPYA 5C2XA 5DIVA 1QBBA 3T8LA 2OEMA 2PDUA 3KZPA 1ZJHA 1XDMA 4B5XA 3W4RA 4ZGYA 1RJPA 1TWWA 3WY1A 1JF5A 3EX3A 1IXOA 5DT5A 3TX9A 4JFMA 4Z17A 1W5MA 1PWLA 3OBEA 1V8EA 3N3MA 5K2ZA 3L4VA 1RLCL 3W1AA 3AICA 3BL3A 2GJXB 1B31A 2OSXA 2DW6A 3W7JA 4Q7IA 3VNJA 2YIHA 1QT1A 5C9ZA 2RGMA 4JTIA 4ZB5A 1OCQA 4H7ZA 4FXJA 1FKRA 2X30A 3KCOA 4QS5A 4O57A 3MUIA 1PB0A 1TTPA 1YPIA 3NEVA 2HVOA 2TODA 1AD1A 4LY4A 3C0QA 3M6DA 4AHQA 5HW8A 3K30A 1MRAA 1W17A 5A8OA 3OQ8A 3GDBA 2V5BA 4F4RA 5IOBA 6ENLA 4XD4A 1VBGA 4QROA 1SO4A 5PTDA 1YIXA 4WUIA 2VOMA 3CHCA 2ZXQA 4G2DA 2R24A 2DU2A 1M7PA 2QCGA 2WQDA 1IZCA 3TAKA 3LPOA 3LRKA 2FTYA 4QE4A 1JD7A 3LLDA 1FXPA 1V3KA 3LCFA 2CLPA 4G8TA 3D46A 3GH4A 2I9EA 1PTDA 3MY9A 1SSGA 2OFNA 5F7UA 3RLUA 3FY1A 3MI3A 3N3TA 4BI5A 1NMWA 3ZR5A 1XYLA 2JKPA 2MLXA 2QDDA 3SY1A 3VA8A 4AAJA 4HZMA 1PHQA 4UDMA 1LBLA 4TU1A 1EHNA 2C14A 4IZGA 4W8AA 4RV3A 3WJSA 1BYBA 4AY1A 2BHYA 4NJJA 5LXEA 1K1DA 5HQLA 2E0PA 2V3FA 3S47A 4H8VA 4GJ1A 4CQDA 2F6XA 2VELA 3QY8A 4UTUA 2XIJA 4UTTA 3NQFA 4I7VA 3KCLA 1XLJA 3NO1A 2YZRA 2IPGA 2XVPA 2J47A 2QNEA 3WMCA 2E1DA 3UZZA 2BHUA 1JCYA 3W9ZA 2HWGA 3RFWA 4IT4A 4JTHA 3GKFA 2F61A 4RPPA 1ISVA 3WFLA 1K8ZA 3KAFA 5CG0A 3IRDA 4CEXC 4GCXA 2ZRVA 3WYZA 1OCNA 2YXGA 4B9YA 3DI1A 3VX0A 1FWTA 4V1YA 3U5UA 4A8NA 4R88A 1R30A 2V2DA 4H4IA 1E3XA 5HNRA 4R7WA 4U3CA 3W2KA 1UR3M 4JNYA 5FA5A 1EC9A 3NDOA 2Q02A 3L5AA 1D8CA 4QBXA 3IJ7A 4XQ6A 3CU2A 2VR5A 1S2AA 4BQ3A 4GIVA 3NXFA 5H8MA 1TWDA 3H7UA 3MS8A 4EXAA 4ZO7A 1V02A 1CXIA 1MQPA 1H7RA 5A2AA 4FSAA 2PE4A 3B7XA 3WD1A 2YW3A 4M3PA 1VC4A 4MADA 4D72A 4AX6A 1CTNA 4NZFA 5A8QA 4CU7A 4N2YA 4EXQA 1UZDA 3AROA 1DJQA 2F2KA 3VKCA 4C6QA 4NI3A 4XZ9A 3ZWTA 1A0EA 2DGAA 4Z0JA 3DECA 3WSUA 4ZB2A 1E0TA 3Q65A 3H2MA 2OQLA 2ZZ4A 2WO5A 4IISA 2NXHA 2FZBA 3MVTA 2WMFA 1JJKA 2AL2B 4HZ6A 3VOHA 2WB5A 3LTSA 4V28A 1LOSA 4XKYB 4XAGA 3KRSA 1BSIA 3STCA 1IX5A 2WMHA 4U5KA 5EMKA 1Z8AA 1T8XA 4UTLA 1IEQA 3L9CA 4KQNA 2IXVA 3BOXA 1GYMA 3RHGA 3UWVA 2DH2A 4QIUA 4TO8A 3UERA 1KBLA 3UI5A 5AHFA 4NNRA 1QI4A 4GYJA 4KKXA 4GLEA 4BF8A 4BS0A 3IIPA 1KLYA 4JTEA 4LYPA 3KOYA 1ICQA 2DUAA 3WMSA 3VZZA 4AWSA 2BXYA 3MUCA 2P5NA 1GPWA 4H9UA 3U4AA 5CLWA 4FHAA 2PGEA 2E4TA 2Z6JA 3M0ZA 3PB2A 2DZBA 3IK2A 1SJAA 4GWEA 2EXOA 2HNEA 3MMWA 4QQ3A 2OKTA 3WQDA 1VEMA 3QZAA 3WQCA 3WNNA 4H8HA 1Q6QA 2DVUA 5BRPA 2GUYA 3N17A 4P2VA 4AIOA 3BW3A 1VFOA 4OUIA 4E8DA 3NI6A 2VOTA 1T6MA 3LHYA 1G4SA 3DFYA 1K9TA 3GHSA 4TTGA 1L9WA 1GEQA 5FSDC 1LUCA 1U5HA 2DSVA 1VQTA 2HNHA 2E77A 1ZJIA 1UP2A 3TUUA 3QR0A 1GVOA 1YBQA 2QUVA 3TMQA 2P50A 4L7ZA 1GYLA 2YYUA 5C9XA 2J7BA 3NTPA 4QJ1A 3F2CA 1TX0A 4GYKA 3WK2A 2VFIA 3T4WA 4NT0A 2Z29A 3OA3A 1VCGA 5BXTA 4AXKA 4JGDA 4LNYA 1CW2A 5I23A 5AHEA 4GQBA 3R13A 2XWDA 2ZZ2A 5FD0A 1Q7QA 2PDKA 3RGTA 1W9PA 2C91A 3T8QA 2F38A 3AJXA 5HQEA 4REQA 1CI1A 1FFQA 4LAUA 1YATA 5TAOA 4HYRA 3VIKA 1UKTA 2J7FA 2PN0A 3NPWA 1MFVA 3JXVA 3H9RB 4KRZA 4LANA 4AWEA 5H8PA 5I02A 3EWUA 3HIJA 4BF7A 3MI6A 4N9BA 4LJ3A 3WD4A 2GQ9A 4KWOA 3M0LA 1MEIA 1G9HA 1WDSA 1LL6A 5T91A 4E3VA 1DTUA 3CYVA 1UWAA 2BXVA 2VGBA 4XZHA 3TJIA 3WQVA 1VP5A 5FEWA 3FCPA 2CHNA 1ML1A 4BWLC 3O5GA 4LUTA 4GVIA 1WOBA 3TQPA 5ECVA 3C2OA 3IGUA 3C2YA 1JNDA 2Y61A 1R9XA 3CAKA 2Q3OA 2R1KA 1ZBCA 1D7FA 1P4CA 4EPDC 5GJNA 3FAXA 3M0XA 3HGSA 1P1XA 2IUZA 1XYBA 1E1CB 2XP4A 4MJ2A 1CGUA 2XINA 2PPOA 2E6DA 2XVGA 1PZ2A 1BQGA 4CNNA 1P6WA 3WLQA 3A6OA 2WOQA 4NAFA 2YCEA 1SZGA 1HXJA 2VDHA 1KTBA 3W7QA 5H6HA 3QXBA 3FIGA 3KUMA 3CMJA 2O9RA 4FPSA 5DY3A 2GQAA 1RK6A 2HEJA 3BGJA 2YB1A 3TN4A 1HNYA 3ABXA 2XHYA 3EOUA 5KZEA 4JKMA 3VGBA 3SUVA 3KL3A 2ISVA 3QPYA 2H8XA 1U2YA 1NJJA 1YPFA 1B9ZA 4GFIA 3MMUA 4FP1A 4MTVA 3NZ1A 4TVDA 3BVJA 4GC3A 3DYMA 4KIEA 4GGQA 3CMFA 2RJGA 3N9RA 4LQ1A 1FVPA 3G2GA 4HB7A 1IQ8A 1GZJA 2W92A 2ZVRA 3R8HA 2HQAA 4LAYA 1AQHA 2WSQA 3P5YA 3GNRA 5A6AA 3M0KA 4LV4A 3OODA 5BOEA 3EX4A 1GORA 2XPKA 1YQ2A 3N4FA 1K9FA 5HWNA 1X39A 3OGRA 2Q71A 4JFJA 3PTDA 1MUMA 5DMLA 3AFBA 1IT8A 5AB3A 1BD0A 4BZYA 2R1LA 3V36A 3UZXA 2BY0A 1I2NA 2DZVA 3KS6A 3ZOAA 2VX6A 1SPQA 1OFEA 1N8FA 2LKNA 1M5WA 4QEEA 5FF2A 4ROQA 1P43A 1TMLA 4AF0B 3EDJA 3R1ZA 4KRUA 4ZPTR 3H4XA 1RQHA 1L2UA 2HBVA 2TRSA 4XZMX 2V5JA 4BY3A 1OBAA 1XLCA 2YFOA 1LRQA 1VFLA 3E49A 3UA4A 2I16A 3AIEA 1UQYA 2OZ8A 5DX7A 1W9UA 2OZ3A 3HBLA 3OOBA 5KZMA 4BFAA 4ZQNA 3LUOA 5AC8A 4MZYA 4IHCA 5G1TA 3FAWA 3NO5A 2NSOA 4ODKA 1UZ4A 4BWLA 2NV9A 4PRTA 3ICJA 3OQEA 3I3DA 4OV9A 3W1UA 3NQCA 2WQPA 2DT1A 3RM4A 1PWMA 4HNLA 4RW3A 4EPKA 1C92A 5JH2A 1JDDA 1EO5A 2D2JA 5HAOA 2QYGA 5BMWA 4WY0F 2E40A 4LEFA 3GXFA 3P6LA 3HF3A 3EDDA 2DT0A 1TPB1 4F40A 4JPGA 4MFEA 2D0GA 4WXYA 2XGBA 4L1XA 3ARZA 4QT3A 2VENA 1LWIA 3KVMA 3VKAA 1YE4A 4AVNA 2E67A 3TU9A 5I3JA 3CS2A 1QW7A 1WNOA 1P5QA 1XBXA 3HQOA 2EPMX 4E2BA 3TFCA 3UW6A 4XBSA 1GOXA 4MB4A 4B5VA 3LTPA 3POHA 4I6VA 4OBSA 1S2CA 4QSHA 3DGBA 3S1GA 2ZQTA 4XIAA 4IMCA 2M1IA 3FVMA 1V93A 4V33A 1DE6A 1ZCOA 4ZQOA 1ODZA 2XZ9A 3QF0A 3S2JA 1POJA 1LQ2A 2VXNA 4DWSB 3B9OA 2VC6A 4AY8A 1EWEA 1DWIM 2ZWZA 3W00A 1ZJAA 1R3YA 3T0AA 1RCQA 1JZ7A 1ZL1A 3HU7A 1W9XA 1F4HA 1IEXA 1CLKA 4FMVA 2IXUA 4DJDA 5I3FA 1ZFJA 3VIPA 1BQCA 1W54A 2G4FA 3TXZA 3AYVA 2Z25A 2PDBA 2XM2A 2B7PA 1S38A 3QV9A 4J27A 3NOEA 1KFJA 4QEHA 1QRQA 2P8CA 2XIMA 3I6CA 1ONRA 2VTFA 5AZ1A 1X97A 3LX9A 3WQ5A 4GCAA 3B0VC 4RNFA 1L2QA 3GK0A 2B31A 3GIQA 1LLOA 4JFKA 4QDPA 1GK8A 2BY3A 3LV6A 1HT6A 4JIRA 1XC4A 3G1FA 3G3MA 1XD0A 3WLOA 2R1MA 1T5AA 4GQ0A 2ZICA 1MMFA 4MWAE 4E38A 1M41A 4GNVA 4MJMA 3UJFA 5HA7A 3R0DA 1W56A 4XZWA 1TIWA 2WC4A 3QC3A 2CBUA 1LT7A 3D0CA 1FKXA 3TN6A 3TCSA 3TJLA 5FEZA 1F74A 4DJEA 2WC7A 3DIPA 1RBOB 3R0UA 3GO2A 3PP7A 1QHOA 1ZS2A 3E96A 3T2OA 3H4GA 4LY8A 3D3AA 3AXIA 4LBUA 5TIMA 4RK8A 2IKIA 2MNTA 3N9KA 4JTTA 2YBUA 4CQ8A 2CLOA 1U33A 1EYEA 1QDSA 4Y9NA 3PFMA 1UWSA 3VD4A 3QHMA 3WJXA 1EQCA 4M51A 4QDWA 2F6UA 1W3LA 1JCNA 4K7YA 4JYEA 2V5LA 2Z7GA 1IGSA 5C6MA 1XHGA 3NQEA 4LNCA 2ABBA 2V63A 1T11A 3JZEA 1ELSA 3NPUA 1FWGC 5AC4A 2GUUA 2QV4A 4JDBA 4ERAA 5MHBA 4PTMA 4U28A 4JY8A 1ZAIA 4PFMA 5HDRA 3FA4A 4Z1CA 4ZXLA 5DCBA 2PP3A 3CQIA 3WLSA 2MANA 4IOTA 3RMJA 1GOMA 4RNJA 3R6IA 1RK5A 1O6IA 1UD8A 2VMFA 3LSBA 4ICMA 1SO6A 4W7UA 1MYRA 1AD4A 2VEFA 1OT2A 4C1NB 4B5WA 1EDTA 2WZMA 3WLMA 1FWWA 5TQLA 3UYCA 1E0UA 1U1UA 5HPCA 2XZ7A 4FX8A 4NIRA 1UJPA 2ZQSA 3GIPA 2X42A 3AI0A 4MGVA 2IPWA 1LBFA 3WL1A 5BYWA 3IHZA 1TR1A 1MXSA 4DRJA 3MDYB 2BVYA 2ADAA 2D24A 2HS8A 2PGWA 4DJFC 1J0JA 3LLFA 4US5D 2AMXA 4DYKA 1Y5XA 3KZSA 4ZO8A 3TJXA 2PDJA 3A12A 2NT0A 2DH3A 3PC0A 2DVXA 3BG3A 3AZSA 4CCCA 3UG4A 4GFSA 1KNWA 4PB3A 1C8XA 3WLNA 4MAZA 4P8WA 4Z1BA 2CITA 1YTEA 1ADOA 3RR4A 3SQMA 4A8LA 4XX6A 5LHEA 2ZDRA 3LRMA 1TJRA 4C6LA 2PDMA 1TJ0A 4XG1A 4ATLA 3TQVA 1FX6A 1CLVA 4HU0A 4LF1A 3WH5A 3Q45A 4HZ7A 7REQA 5ABFB 3H23A 1V6VA 3N2MA 1MXDA 5LHFA 3HJEA 1OD0A 2WJEA 1XDLA 1GOQA 1KXHA 3LHVA 3ARYA 2VZVA 1UASA 4NL1A 3LG3A 2VFGA 1IXNA 4LS1A 3QZ6A 3QYSA 1R47A 1ZU8A 1CDGA 2EBNA 5KZ6A 4U31A 4GO9A 4MNJA 3PRDA 1QPQA 1TQXA 3LNMA 2A2IA 1W0MA 3T0DA 1X7IA 4F79A 3AS0A 1I0BA 2VEIA 3KTCA 3BOLA 1CXLA 1LTDA 2GWGA 1T40A 4CNTA 3G77A 1NARA 3MBFA 5HK4A 3G1YA 3WJZA 3TTSA 2VFDA 2WNNA 3CZGA 1E9LA 3CGNA 3KBSA 4DBDA 5JBFA 3WLPA 1V3IA 3GFZA 1SFJA 2ZX7A 4GI6A 3T4CA 4BI7A 4WDXA 4O1AA 1W5OA 1GVYA 3M07A 4JX6A 3UWQA 4FXRA 4D9PA 1E15A 3NZRA 4HNVA 4Q4SA 4YIWA 2O0TA 3CAQA 4MB1A 2YDSA 5CC6A 1F3EA 1YYAA 3AIBA 1K6WA 5FJRA 3WLHA 2V3DA 2GZXA 3ARQA 1WAUA 1J4EA 1Z9AA 1UOZA 1ZP4A 3W7LA 1HKJA 4ASTA 1PZ3A 1V6XA 3BQ5A 4GVFA 3XIMA 4GC4A 3NG3A 3V0UA 2VX5A 3MC5A 1QR7A 1PTAA 1K4GA 4GIRA 4DIAA 4H9VA 4GG9A 4AIEA 2IKHA 2YFNA 2V69A 4TUFA 5FJPA 1W8SA 4MDOA 2WVSA 3I3BA 3QTPA 1RQBA 4PMNA 3N04A 3BAKA 5D2YA 3WBEA 4DHGA 2VR4A 5XIAA 1E4IA 2YA2A 3FGCB 2OSYA 4P8UA 3PK7A 4DJDC 2HISA 4KGLA 1HGWA 4ODRA 1HFBA 4UMAA 1A5OC 5LSMA 3C8FA 4MJZA 3TA6A 1E51A 2FZNA 4JICA 1KKOA 1XIIA 2PB1A 4H7VA 3T0CA 4OE7A 4O1EA 2HCVA 3TC6A 3SUTA 3OZPA 3W1XA 1XIFA 2DQXA 3GXMA 5KITA 2ZQ0A 3LEPA 3EWDA 2WMIA 4Q4QA 3RCNA 1KM1A 4DRQA 1QOQA 1A50A 4A05A 1KO0A 3O5DA 1E70M 3N9SA 5IBXC 1OGBA 3UQNA 2OMAA 2ZFAA 3RITA 5CJNA 3S5NA 1SO5A 5HW6A 1NP0A 4JX5A 4Z2KA 4KEVA 3WQ6A 1V7AA 4UOJA 2O56A 1M04A 4ODPA 3REQB 4L4MA 3LCIA 4RE4A 3O5MA 4HK7A 3KOXA 1S1PA 1BXNA 3SGZA 3AMGA 2ASHA 3GD6A 3VDGA 4I7WA 3MKKA 2JK2A 1KLZA 2Z27A 2PWFA 2I1OA 4U10A 4GY7A 4OFCA 1ZAJA 3QW4B 3ME3A 3QMSA 4DN1A 4H7CA 4M7TA 4UFIA 2A7RA 2J8TA 3MV01 4KESA 1O66A 1AJ0A 2BMBA 3LNPA 3SY8A 4S3CA 3URQA 4FLQA 4C6JA 4O13A 4M29A 2Z2AA 5DLCA 2PD9A 1X98A 1ZNNA 1VHNA 3PJUA 3VDCA 4AIUA 4CVWA 5M3WA 2UZ5A 8CGTA 4RPQA 4I5XA 4JFVA 3GU0A 2DSZA 3DHPA 3N11A 4R5EA 3P84A 3L21A 3ABSA 2INFA 2EPKX 2ZE3A 3WK0A 3K8MA 4GIYA 1C93A 4H3DA 1TV2A 1OC7A 4QE5A 2OODA 4F3HA 4ZB0A 5LA1A 3EEZA 4G1NA 2G96A 2NV2A 1F6YA 3OGSA 3DCPA 4FEZA 1HL9A 2B7OA 4FOKA 3AIUA 6PTDA 2HS6A 1YW5A 4TW6A 3O6CA 1J0IA 4YPJA 2YX0A 1O5QA 3W1QA 4D8ZA 4L61A 2I56A 1S5NA 4LX4A 2PCEA 3NQVA 2FFCA 5LIKX 4RNHA 5KEZA 3AU2A 3UNDA 1E44A 3TROA 3CYJA 4H9YA 1BYCA 2CBVA 2NWRA 1C9HA 1T99A 3EX6A 1QHZA 5T8GA 1IZJA 4JFSA 5C2GA 4G1KA 1MDLA 3TWBA 3OJGA 3NYZA 5CPSA 5FEPA 2FDSA 3MCNA 5CZTA 1G4PA 3KBMA 4MYXA 2C0AA 5LIWX 1S2TA 1XLFA 3W07A 3SB0A 3H8AA 4LTSA 4QT2A 3PAOA 3SCTA 2PZ0A 3DN5A 2YB4A 4UTKA 2JZVA 3FK4A 2PAJA 2VM8A 3LB0A 5KZDA 3U3HA 1B9BA 5FEXA 4KEUA 1S46A 5F4XA 3EGJA 1J2BA 1FKLA 3RIKA 2P8BA 3MSGA 3H2CA 3QMTA 4TW7A 5D2VA 2WLYA 3KVLA 2J6VA 5JH1A 3WCZA 4L9XA 2BVDA 3K4DA 3C6CA 3IAPA 3RJYA 3CIXA 5J8LA 3C2FA 1KR1A 2C16A 3I65A 3UY8A 2QDEA 4P5UA 1EJRC 3BURA 4S3BA 4AG0A 2O7SA 3QRHA 3SJNA 5A94A 3P93A 4TTUA 2YBTA 2W67A 1QI5A 4QG8A 3CPGA 1CPUA 1PV8A 5AYYA 2XP8A 1XLIA 3N12A 1BSLA 1E56A 3WBXA 2PPPA 1O95A 5E6ZA 3NIYA 4IIGA 2WMKA 3GR7A 4KWSA 4C6CA 3PRAA 2Z1KA 4BHYA 2FMOA 1RVGA 1REQA 1WXYA 4LAVA 1FP9A 4Y9PA 1LLWA 3R79A 3ZZ1A 3VDBA 2YXOA 3PZTA 3CEPA 3VKDA 1Z48A 3G1XA 5K3VA 2XG9A 1UP3A 2QPSA 1VYPX 1VRXA 4LFYA 3FNDA 2QF7A 2PRLA 4IMFA 3L0NA 1Y7VA 1H0GA 3FXYA 4HNCA 2IKJA 3P3BA 3CTLA 1FKGA 4PEKA 3QPEA 3BAYA 4G6CA 1RD5A 3VIHA 3C2VA 1F8IA 2PDIA 1WBJA 3H54A 3ZLFA 4ML4A 3WQPA 1TFVA 3AZTA 3GDKA 3E02A 3KOFA 1R87A 3UYIA 4JQ2A 2Y85A 1XH1A 2A7NA 3HG2A 5EBAA 3OP2A 4GBDA 1IR1A 3BMWA 1J11A 2YLLA 4F0KA 3CZJA 3AS1A 1DWHM 1W3IA 4PMZA 3PZOA 5FI8A 4HHHA 2QGYA 1PVNA 1EQPA 1EPXA 2J7DA 3TC5A 4IT1A 2GDQA 4AMAA 4B2DA 2D2OA 4CD6A 1J2WA 4MYAA 2KX9A 3KHDA 1TPWA 3GC5A 4IMGA 3IK8A 3T08A 3CHEA 4LCSA 1IT7A 1A0DA 3OHIA 1TV5A 2PODA 1EFZA 5D02A 4ODMA 4LUIA 4KQZA 3CO8A 3KDNA 1OGSA 4W9QA 1R38A 5T9BG 4ZODA 1E72M 2CLFA 3TTOA 1EXBA 4LUSB 1JRCA 3LGGA 2QJGA 5DRIA 1W2PA 3IJ8A 5TD4A 3LDVA 4XWUA 4NYYA 2J13A 4BQ4A 3LXAA 3ITCA 4J28A 1UD4A 4AFYA 5FOOA 2AQWA 1JXKA 1RR2A 4A2SA 2XN1A 2RUSA 1WZAA 2QCDB 4CLMA 1UZ1A 2WSKA 1GEHA 3UPBA 3W7DA 1VBRA 3HPFA 1FH7A 5A6JA 5HWMA 1YE6A 2EJAA 4V1XA 1J10A 2NQHA 2X40A 1WXZA 3BO9A 2V8ZA 3HGOA 3E12A 1GOKA 4S38A 5F2LA 3J7HA 2OYLA 2HV5A 1NP2A 1ICSA 5AHIA 3PWAA 4GOAA 3F7JA 1FCVA 4WGXA 4AC1X 4G56A 5C7VA 5ABGA 1XQLA 1DJWA 2O7QA 3ITTA 4IQ2A 3M0VA 3A9BA 3AAMA 3MBDA 5CGTA 1KXTA 3M46A 2RSEA 4TX0A 3O8AA 4IUOA 3TZNA 2E1WA 4AMCA 2OZ0A 3Q37A 3W70A 3TYZA 1QW8A 2ZIDA 3V4BA 1EA9C 2CIPA 4LT9A 2YA1A 1I9CB 4JD4A 3VC5A 4ML9A 3LENA 1GZGA 2PP0A 1PKMA 3W29A 1HO4A 3PZQA 5IHRA 3FA5A 3Q94A 2WW5A 1PZ0A 1XISA 1W9DM 1UWRA 4A3UA 2PRMA 1Y0OA 2DDXA 3LBOA 1XP3A 1C90A 1VYSX 2XYLA 5IFPA 1O60A 4HMCA 1V02E 3UZWA 2GVJA 2WHJA 4MUZA 1K9EA 1REQB 4DXVA 3AALA 2FIQA 3O06A 3V3WA 3YPIA 2RDWA 4M8UA 4GY1A 4IQEA 1LG1A 3AC0A 2A3CA 1FH9A 3NYDA 2I5QA 1V3MA 1SYTA 3G3DA 4B15A 3N13A 3TCEA 4NRSA 4PR4A 3A9IA 2V5KA 4WSKA 1J5TA 4UQAA 4IQJA 1CGVA 2AMGA 3SQSA 4ODNA 4JTLA 1J0HA 1FWAC 2Z1BA 4ICCX 3VOGA 2A3BA 3LMYA 4HOZA 2Z1VA 2DIJA 2D0HA 1L6WA 1XI3A 2R14A 2PWHA 3QGKC 3PWIA 1YXDA 1ZP3A 1KGXA 5CCZA 3G6LA 4IM4A 1WZMA 1JUBA 1KRAC 4AVOA 5EB8A 1LDCA 4JYFA 2XH4A 5LZLA 2NXIA 2R1PA 1DTNA 2WCGA 1JFXA 2FH6A 3M64A 4PBEA 2ZUTA 1OYAA 2XSBA 1ZAHA 3HPXA 2GFTA 5I3DA 3AQUA 2KFWA 3GR4A 4FN2A 2DUXA 3QR3A 1T7LA 4YTRA 4O1DA 5C55A 1AG1O 1VFSA 4G9PA 2PF8A 3GTYX 4IX2A 5J5DA 5XINA 4F0SA 1XJBA 1R9ZA 4AC7C 1AZ1A 3WK3A 5LNRA 1KW1A 1H60A 3L4ZA 2VQTA 2WSRA 4NJIA 3GZ3A 4HKPA 2HVMA 3G1DA 4ACZB 4RR4A 4MVAA 2DZTA 1HL2A 3NVTA 2QQ6A 1JZ6A 5HPOA 4PCPA 4AWUA 1XRFA 3VZXA 3BTNA 4HGXA 3RM8A 1A5BA 3S9IA 1DORA 4GA8A 4DZAA 5A6SA 3DFPA 3S2LA 3KP0A 2D1ZA 3TA9A 1OCBA 1CB2A 1ZENA 3ARXA 1PHWA 5HUPA 4Q4KA 2J8FA 2WKJA 2J9YA 3SSJA 2VZTA 3WLLA 1ISYA 3PJWA 3UPWA 3TW6A 2AAMA 2UBPC 1DE5A 2D3LA 1OEPA 2XIIA 4J3ZA 4DO7A 1XSIA 1XLBA 4BF9A 3O5LA 3WD2A 4CN1A 2CHOA 3OIXA 4K8HA 2VX7A 2YL5A 3KHJA 4JTJA 2Q01A 1R9YA 2C1IA 4CQCA 4UOQA 1J0ZA 4I9TA 3SO7A 2WM1A 1MFUA 1I1WA 3URBA 4DEFA 2ZUSA 3INPA 3KM8A 1EP2A 5AHLA 3HFTA 1NWSA 2P3ZA 1PS9A 3CHDA 4CD7A 4DT4A 4OBRA 2P3EA 4I9MA 3PUGA 1GJPA 1XGDA 4IJCA 4LV9A 5AC6A 3MZ2A 1V0MA 2VGIA 2I14A 1IF2A 5H91A 1C3FA 1VCVA 3UZ5A 3K2GA 4C1KA 1P7TA 1OSEA 3QC0A 2WJDA 3B8VA 1UH4A 5AYBA 1ZLPA 4H00A 3MZNA 1KBJA 2VC5A 3DHUA 2Y5EA 3DFOA 3I6RA 3HZ3A 3WLKX 2JEPA 2VD9A 3UPMA 4OV4A 2VI0A 2X1SA 1PAMA 1JZ5A 2PFHA 2OOFA 4QCFA 2OOGA 2J7CA 9RUBA 3EBVA 4NVTA 3VCNA 1XPGA 1UUMA 3Q2DA 3CUZA 4Q4OA 4NSBA 4MFDA 3C3NA 3W53A 2Y8UA 2ZZ7A 4BI6A 3P8IA 4AHPA 3BW2A 3VABA 3D5HA 1JAKA 2E6YA 4YTSA 1XL9A 1VIWA 4B16A 3PBGA 4C5YA 4JTCA 2DIEA 2CEQA 3OG3A 4ZO6A 5AHMA 2BP1A 2PTYA 3SGUA 2YDAA 2HXUA 4AW7A 1L0PA 3T0BA 3AMDA 4YXGA 1HG3A 4XAKA 1VFFA 3VD9A 4XZNX 1XSJA 2XH2A 3PUEA 3TK7A 2FTPA 4ECLA 1LUCB 2XSAA 4NJGA 4V2XA 4YTQA 3LHWA 5CLTA 1EX5A 2VCCA 4C6OA 2E5DA 1A5KC 2A4AA 1HJXA 1EBHA 4K38A 1P0BA 3SUUA 2PDNA 3GXTA 4M56A 4HSNA 3AZRA 1JVWA 2JKAA 3M9YA 3B8TA 3O16A 2VHLA 4NJHA 2WMIB 4R7OA 3G1RA 2OWWA 3JUGA 2E6FA 2DIKA 5C7HA 1Q8AA 4U2YA 2EJ1A 2NWSA 2ZA3A 4L1WA 3SCNA 3NRKA 1QPRA 3TLLA 1PDYA 2QDGA 4XZIA 2ABAA 4LBSA 3GYEA 5C70A 1ITUA 1VH7A 2AKMA 4JBRA 1EJXC 1WUEA 1ODUA 3ZO9A 2FHCA 1ZHAA 3PPCA 2VFEA 5FKYA 3VM7A 1GQLA 3ANYA 2PP1A 3K5XA 1EEXA 4DB7A 2PSNA 4DJEC 1CT5A 1UYQA 1GOIA 3IJDA 4GGBA 5AFDA 3H21A 5CGMA 3RX2A 4GH1A 4O8RA 4Q4MA 1NFBA 2QEZA 3W01A 3NQ2A 4PTVA 5IDIA 1HX0A 3BH4A 4Q7BA 4FF7A 2HJPA 3BLFA 1U5JA 1E6SM 4IQDA 1R3RA 3V7PA 1KXQA 4F2BA 2LPVA 3O63A 5A8NA 1QK2A 1E71M 3FJLA 1TTJA 1NU5A 2R8WA 2E6AA 1DJNA 1SZNA 4IT6A 2GVGA 4GXWA 4HSHA 3GTFA 4Q8QA 5FCZA 3B8DA 1W5QA 3UWYA 4O54A 3LV5A 4G7EB 4O17A 2WNQA 1V77A 1G7UA 3GS6A 1O4UA 3Q4DA 1N55A 2CESA 3B4YA 4DBSA 2JKEA 2VGFA 2E8YA 1IXQA 2WPGA 2PUZA 1A49A 1KD0A 3CB3A 4HYWA 4LAXA 1EPVA 3W7HA 1QNSA 4MLJA 4J3SA 2AQVA 2G37A 5H2ZA 3FEMA 4EKJA 4DWSC 2UV8G 5BXRA 3GG1A 4GY0A 3WN6A 2PWGA 4I6KA 4CD5A 1UPMB 1UZHA 3GUWA 1MSSA 3NQ6A 1P0DA 4DI9A 1Y8BA 4GK8A 3LA4A 3U57A 1JVNA 4HK5A 4UQBA 2CYGA 4CNPA 2VYOA 2M08A 1BG9A 1HKIA 3M7WA 2J6XA 2GL5A 5G1YA 1O7AA 1UD2A 1EOKA 1VLWA 5DO8A 4A8IA 2P88A 1RCOB 3PY2A 3DFNA 1TRIA 4WD0A 2PEVA 3C5QA 1X8FA 4PCTA 1ZCCA 4X61A 4A3YA 2HK0A 4QFUA 1AFSA 3U0HA 1Q2RA 3CHFA 4HBKA 5DMNA 4YWSA 1QPLA 3AHYA 3KFTA 2ACQA 3B0PA 4R53A 2ZZ3A 2CU0A 4GQGA 1OFRA 1QOXA 5BCAA 3W2MA 4IG2B 4CQ9A 2PCQA 4KFPA 4MPKA 2QUMA 5AHNA 5HWJA 4K1GA 1YEYA 1QTWA 4UQCA 1UUOA 2WBKA 3NZPA 2V0TA 3IIVA 3JU2A 4ERIA 4LC8A 5CZSA 3RRXA 2O9OA 3GW3A 3I7SA 4PULA 5FJOA 4HBOA 3SI9A 2QCHA 4NUWA 2G97A 3PR2A 5E0FA 1LQAA 2NLIA 4GNJA 3OZYA 2J79A 3RR1A 3BGGA 1W5PA 1FWNA 1PEZA 1VAHA 3GXIA 1FY6A 4JTFA 1TV3A 3W22A 3TNBA 1TE1A 2VDIA 2GK1A 5D09A 2CPUA 1X7FA 3OW1A 4FNRA 5BOOA 2PBOA 4IPNB 5I79A 1R9HA 3T81A 5M17A 5CKSA 2QHAA 1TIMA 1E6NA 1LYXA 1L1PA 1K8YA 1QU4A 4LW7A 4Z2JA 3L7RA 4GPNA 1N82A 2KZHA 3KTXA 4YVPA 3QFWA 2INEA 3LLXA 3ES8A 3NSXA 1QAPA 3U7VA 3H4WA 1TPVA 1PDZA 4GNKB 2WHLA 3VNIA 4WX2A 2B81A 5I00A 4FZIA 2Y78A 4HA3A 2OT0A 4PTDA 5ECUA 4WDWA 4N42A 1JUKA 1QNPA 3G1VA 2YYTA 1OADA 1KFEA 3CV7A 4W84A 5HJLA 1XQKA 2DY3A 4N6FA 3UJRA 4CKQA 2QCCA 1FDYA 4LBRA 3VC6A 3W7OA 4UQDA 1Y5WA 3ARSA 3KAOA 1BRLA 5CPQA 4QXIA 3E2RA 3GG8A 3APTA 1H49A 1A3XA 3LI0A 1R3VA 4UTWA 3M6YA 1UKSA 2ZTJA 5DCDA 3A3HA 1JDEA 2ZE0A 3Q58A 4ITZA 3HPZA 5TNVA 2D2HA 1KM0A 5SWUA 1EJ7L 1KRCC 4MF4A 1DHPA 1PCKA 3NQ8A 1JFHA 1E1FA 1ONEA 4OIFA 2XTKA 4AB4A 1RHCA 4DYJA 3ZIZA 3SADA 3BMXA 5HT1A 3CIVA 1R3SA 4HNUA 2GJNA 1O5KA 1DJXA 4EK7A 5HMFA 2EG6A 4PTNA 3UG5A 2OG9A 3RJXA 3LERA 4OVXA 4DXKA 1I75A 3PWGA 1ZY9A 1C7TA 1AJ2A 3IGXA 4HK6A 2G8ZA 5HWCA 1PSCA 1BWKA 3FKRA 4GQRA 2CBIA 1XLKA 4W4QA 4OT7A 1DHKA 5CZJA 3VNKA 1WE5A 1GVQA 2Z26A 4KCWA 5K4ZA 3C52A 4NZ1A 4KT2A 1MW1A 1KRMA 1I1XA 3MI2A 2XUCA 2X1RA 1SFLA 3TLQA 4OJYA 2WXDM 4FK9A 3PS7A 1GJWA 7CGTA 4PA8A 3CPUA 5HMEA 1VFUA 3HO8A 3WUGA 2QPXA 4HBEA 1K3UA 3KX6A 3VILA 4C1LA 3LPPA 3PBUA 1YX1A 4YTTA 2O9PA 4QTGA 5AC5A 1HVXA 4P7QA 1CIUA 1GKQA 4UUIA 3CQJA 1OX5A 3SECA 4GUIA 4L56A 4JHZA 3CWOX 3EX2A 3CZKA 1LM1A 3E5BA 4LALA 2EKGA 2EHHA 3ZR4A 6A3HA 2DJXA 4C6MA 2VEPA 2JF6A 2XFFA 4U5IA 2NUWA 4CCEA 1V6WA 4WJEA 1YW1A 4RUBA 3T6CA 4HU8A 3IV8A 3SCWA 4WSHA 4G7EA 3O5RA 3GNDA 2ITKA 2BTMA 1J79A 2YL6A 4CQBA 1MEHA 1N7KA 5D03A 1X6LA 5D38A 3FLUA 5EMLA 4I90A 3TW9A 3M16A 4NZ5A 1OFPA 4G50A 4ATWA 2NX1A 3L4UA 4H6RA 3KAGA 4JCMA 2VUNA 2DZXA 3GAYA 1XG3A 5LKYA 5I5RA 5KSWA 2CLLA 3L65A 4C7FA 3CWNA 4GINA 1XV8A 1RSCA 1J01A 4AWTA 2VEGA 2X1UA 2F8QA 2QUTA 1MQRA 4D6FA 4Y9MA 4RL3A 2X09A 1KGWA 1A47A 1ADSA 5AVHA 5E1QA 4Q8VA 1DBTA 5DQPA 5F1VA 1VJSA 4XKMA 1FP8A 2C0HA 4U85A 1IWPA 3B8IA 2J77A 3A5FA 3P7YA 1KFLA 2RQSA 5BRBA 5AYZA 4AXNA 3PZ9A 3A5VA 3WUEA 1XFCA 3VMPA 4DXXA 2DSWA 3N15A 3EXRA 5AYIA 2YLAA 2AKZA 1HTIA 3MP4A 5BRQA 1XIBA 2QULA 1JDFA 1P6CA 3CZLA 1KBIA 5I6SA 2PWVA 4BJHA 4GUFA 3CQ0A 4MB3A 1B3WA 3PBYA 3O1NA 1MW2A 3P14A 2YSWA 3G8EA 2GGGA 4Q8WA 4OHQA 1HKKA 3G1SA 2POZA 1BG4A 4IWWA 4DRHA 1YTDA 3ENLA 1W9VA 3UY7A 4MGGA 4IH3A 4AZIA 3PB0A 2CKRA 1QUMA 3G0SA 1XG4A 2BGNE 3FSUA 5U4NA 3NZGA 2RFGA 2Y2WA 3THQA 3NQDA 5J6EA 3WQ4A 3JYJA 5C2CA 3A4JA 2VUYA 3GDMA 2XP9A 4LAMA 5DELA 4MSSA 1D7HA 4LB4A 1FHLA 4IUGA 2W4XA 7ENLA 1UR2A 2FHFA 1SW3A 5A2BA 2Z1SA 1H7WA 1V0KA 1PKYA 4YL2A 3GHUA 4YLWA 1ME7A 4JDYA 1EJUC 3KL5A 4L4OA 4AZCA 3VI2A 3AWNA 3VDHA 4OKDA 4C7GA 4ODQA 1J0YA 1GTHA 1OF8A 3IVSA 4C90A 4L4PA 4FR6A 3DG6A 5J5RA 3AIRA 1KV5A 3DEQA 3C8NA 3AXXA 4IFOA 5JXQA 2G0WA 2IQ0A 2X2YA 2XPAA 2YL8A 5CXPA 3PUDA 3EIPA 4IPIA 1OFOA 3QGVA 5A6KA 4QHRA 1WO2A 4JKKA 5REQB 1I45A 2BSLA 3BLKA 3OU8A 2VVSA 4JL2A 3NPXA 1JULA 5EMJA 3DG7A 1VPXA 4F8XA 3DGRA 3TONA 3KAIA 5C71A 1DP0A 1TVPA 2M2AA 2QIIA 3HA1A 3W1NA 1K6AA 2W91A 3EWCA 4ZOBA 3VKBA 4DRMA 2XISA 4N19A 2J75A 2Q5AA 3W6MA 4NNCA 3WG6A 3D3FA 3DBPA 1C8VA 4LB3A 2YR1A 4R34A 1TMHA 3AXHA 4M0XA 5CPTA 1IT0A 3P82A 2Z4GA 4HYVA 4RW5A 4QLKA 4TOQA 4E2OA 2NX9A 3BSGA 1ZBWA 4AD0A 3TSMA 2YDQA 4S23A 4H6EA 2WJZA 2WNZA 1F6PA 1VIZA 1E1CA 5A69A 2NUXA 2PLCA 3ZYZA 3NPVA 4OOUA 6XIMA 3F5JA 1BVZA 1Q6OA 4JTQA 3ZVHA 5EMYA 4M81A 4I7UA 1DV7A 3C0LA 2PD5A 7REQB 5ABFA 3O6AA 4GYPC 2I57A 3P60A 4DAIA 4TYOA 4C1NA 3L4YA 4IXXA 3PPFA 1VFHA 5EYWA 1DQXA 3L68A 4KETA 5CPLA 1XPYA 5CJ5A 3IEBA 3WLTA 3I10A 2YL9A 4LCRA 4JQ4A 4DI8A 2F2HA 1TPDA 4ZSTA 4FAMA 1TQJA 3ATYA 1Q63A 3ARTA 3SCVA 4YU1A 3BQ6A 2VX4A 2CXEA 3TOYA 3IIXA 4A3QA 3BXWA 3CIWA 4LWWA 1S5MA 2OPJA 3UJSA 2WZIA 3S1UA 1UD5A 5BXJA 1HZYA 3VAWA 3AU6A 1ICPA 4H41A 4WK9A 2CLKA 4EF8A 5E0KA 4X60A 4XZLX 2X1TA 4O50A 1QPKA 2O92A 5JU6A 2FH8A 2H3DA 2ZRUA 3I4KA 3GDRA 1IWAA 5BOFA 3V5OA 1CXHA 2HE8A 4ZL1A 3WDHA 2WJFA 3DOPA 3IV3A 4DUOA 3MV11 5A6BA 4LPCA 4XD5A 3QKEA 1OCJA 2CNCA 4CU8A 1EIBA 2FHBA 5FESA 3BDKA 4R7JA 2Q3RA 3RLVA 4Z2IA 1G5AA 1FWSA 4Y9AA 6TAAA 1FFRA 3W25A 5B7YA 3PTQA 1Z42A 3W81A 4GD0A 3NXLA 1R8LA 3QY7A 4D6DA 4W5ZA 3HG3A 1B57A 4P7OA 2ALRA 2X0SA 3GG7A 4HOWA 2HRWA 4TIMA 2GPTA 5FJTA 5TF0A 3ZLHA 3IUDA 5A6BD 1KA9F 1QNRA 1F9CA 1P6BA 1N2VA 3W88A 1FUYA 3W3OA 3WELA 6REQB 1OK4A 2VRJA 4U33A 4KFOA 2ZDSA 2VP8A 2ZA2A 2AQOA 4IGSA 3UCCA 1EIXA 3N34A 2N87A 1YNYA 3FN9A 1UC4A 1M65A 3FJ6A 4S3AA 1ZJBA 3N2TA 5FSEC 2HPMA 1XH0A 1YBQB 1FKJA 4K68A 2RDUA 3GM8A 2WMGA 1FKFA 1QW9A 5HXMA 1E55A 2G3MA 3MSYA 5C54A 1L6FA 2VFFA 4IF2A 5CZ0A 2PTZA 3RG6A 1H41A 2J8GA 3G0XA 4D2JA 1Q6RA 1JYWA 1UHVA 2J24A 2CZFA 4L5ZA 3HGRA 4WDTA 2IW0A 4GGHA 4LVBA 2QDHA 4GABA 5JQ9A 1WB0A 2YGYA 4PL2A 4KS0A 3E0VA 4HA4A 1W2VA 4J9JA 3CH9A 3CUIA 4EWND 1J9YA 3WUBA 1NF7A 3W1RA 1VLIA 1AZ2A 2ESCA 3CTTA 4J4KA 3RLGA 2QVHA 1GVIA 1Z41A 4JQAA 5CC3A 3SBFA 3STPA 2XSXA 2R6OA 3U6WA 4RDZA 4ZOEA 1BKSA 3R0KA 1E40A 4WZHA 3VGHA 2Z7KA 1O5RA 4JEQA 3WEMA 4L6OA 4Q22A 4XVDA 4B90A 1D6OA 2FGLA 1J96A 5LA2A 2FQIA 3HOJA 3U2CA 1XIGA 4FAPA 2E68A 3LD5A 4LCQA 3WENA 3KS5A 4K37A 1KCLA 1S5WA 3SUSA 2ZRZA 4A2RA 2Y63A 5CSSA 1UR8A 3K8LA 5G1MA 4O15A 2GOUA 2V81A 5HUOA 5CBJA 1W91A 1XR2A 3NQAA 2J66A 5JMUA 1VZWA 4QS6A 3H70A 3LHUA 3S1WA 1XKJA 3VPLA 1A3HA 3AIQA 2DVTA 2YCLB 4WKFA 2VZOA 5GVJA 4A29A 2ZQVA 4S3EA 3TYEA 1EH9A 3W7MA 2NVDA 4JHOA 5HULA 2GGHA 3AYTA 4W9TA 4UNKA 3LPFA 4RNIA 3UU0A 4UCGA 1K70A 4MKNA 2X2GA 4K8GA 1VS1A 1JUEA 1P7TB 4RDWA 2GDUA 1TCOC 3RF9A 2UY4A 4C5ZA 5EL1A 4H9MA 1DEDA 1LRNA 1ITXA 2WNWA 1H7PA 3CQHA 2PLMA 3ODKA 3RYSA 1FJDA 2QGHA 3SSZA 4CVUA 4KW2A 3M0HA 4H9ZA 1IEWA 2DZWA 4H1ZA 4H9XA 2RUQA 3CZEA 4K36A 1QI2A 3RUBL 1AVAA 4JTDA 1VBUA 1M7OA 3U7BA 2R1NA 3W84A 1AK5A 1SM9A 1PCWA 4Q6JA 2QUUA 3F5KA 1BXCA 4NQ1A 4KR0B 4W7VA 2C71A 4E0CA 4DRNA 1QASA 1P1MA 1Q6GA 1MW0A 2FAPA 3PPHA 3V1HA 3BAWA 1WZKA 3RN6A 3PNUA 3EPOA 3OTRA 1EJWC 1ME9A 2X7WA 3G24A 5CSYA 2Y24A 2YKKA 3MPGA 2DV0A 5I78A 1SJDA 3EDKA 1F76A 1UR1A 2RGLA 5FACA 3EMCA 4JFLA 3THAA 7TIMA 1C91A 3V75A 1A5CA 4ZFMA 4GXMA 4E5TA 1XRTA 2ISFA 4NRRA 2WZHA 2VC7A 2BOEX 3SRHA 1RUSA 4NAEA 1PZ1A 3GIYA 4PCFA 4DRPA 1CBGA 2VWTA 4WJ8A 3RK8A 3LUTA 4W8LA 2FMNA 1UC5A 2NW0A 1TZ9A 1KR0A 1BKHA 1FWCC 1LWHA 1CECA 4DWDA 4UWMA 3KOZA 5A5WA 4IFKA 2PV3A 2WBGA 3MUXA 1G01A 1E9ZB 2WSYA 4XBJA 3GQYA 3NL3A 4JTRA 4XSLA 1DVJA 2XIBA 2B0MA 5A6MA 1Y0EA 4RLIA 4GZIA 1GHRA 3SZ8A 4X9SA 3QV7A 3M41A 1XGZA 4EAMA 4YJ5A 2YZ5A 2RUCA 1UMYA 3V5FA 3V16A 2CW6A 4E2DA 3L4WA 2GVLA 2XN2A 5D2WA 3UEQA 3S5SA 1TELA 3GTIA 4XD6A 4LVAA 3R12A 3EB2A 1F3XA 1TZZA 4DBUA 1U30A 2PLKA 1D9EA 4PEEA 4ZE4A 3EDFA 3NSMA 3ZFHA 1AL7A 2BODX 3UESA 3H22A 3QLLA 3GKAA 1B3OA 2ZQUA 5M2FX 4GUHA 3VD3A 1GT8A 4KWVA 3UVIA 3IKDA 2ZADA 4ILSA 3FEQA 4B5SA 1UA7A 4QRNA 1WKYA 1BVWA 3MB9A 1DJHA 2V2CA 1PE1A 3BJFA 5B80A 4YHGA 2FB3A 1CXFA 2GJPA 4DWSA 1DIDA 4HPHA 4ZZ9A 1EWDA 3LOTA 3GVRA 2ZVIA 4W86A 3WZ0E 2V5CA 5CZKA 2PDHA 1UWUA 3KRUA 3MWAA 5AOUA 3PAJA 1A0CA 1F2JA 5G4WA 2ICSA 4IMEA 4GMEA 3K1DA 2WVUA 4ZQMA 3EKLA 3I68A 3MDWA 2OWXA 3TIMA 2GQ3A 3T2PA 4AEOA 3FFSA 1WDPA 3SUWA 3W24A 2NLYA 3QH2A 4FLSA 3CC1A 1J4RA 4P8XA 3IJIA 4TV5A 3MTWA 1TR9A 1FWBC 3WF1A 3T44A 1IWBA 3O6DA 1M53A 5DEZA 1FDZA 3SCUA 6CGTA 1GQIA 3ARUA 4XB3A 3BARA 3VUPA 4JOMA 3TYBA 3DFSA 1RZMA 3WNMA 5BZAA 1B4KA 3OO2A 1JCHB 4LU0A 1LJYA 4Y8EA 2YDRA 2O4QA 3WH8A 4J7RA 3UG8A 4ZPWR 3UF9A 2PS2A 1TWZA 1M68A 2QCFA 1E4MM 4AD4A 4JYSA 3W71A 4DRSA 2OQYA 1W1TA 4GJJA 2WKGA 1LLZA 4TXEA 1WPCA 3AMLA 4XAZA 2DG4A 2NZLA 1WZLA 4S39A 3GC4A 1VJIA 5IM51 1E6QM 1I8JA 4PE8A 5G4HC 3TCZA 3NNTA 4P7NA 3BC9A 1D3HA 2F9RA 2RDTA 5DF0A 1ENUA 1UKQA 3W1MA 4EE9A 3W7EA 4QLJA 3VNZA 1FXQA 3NFUA 3UA3A 3ITVA 5HR7A 1OG6A 5A8GA 2PURA 7PTDA 4AQLA 3R8GA 3ONBA 3GRIA 2EQDA 2C1HA 5DN1A 1E4LA 3WEOA 1Q2SA 4ZPVR 2ON3A 2ZXDA 4IPJA 3UXKA 1G67A 3U9IA 4JCLA 2ZOXA 3GDLA 3OBKA 4IJBA 5AECA 3W26A 2OKOA 3OG2A 1OWQA 4UTIA 4F0MA 4DZHA 3O9NA 3UCDA 3BLEA 5K7JA 2HBXA 4IGNA 4NYUA 3UXDA 4C6EA 3E74A 1K7EA 2PPGA 3SAZA 4WCJA 4OQVA 4JIIX 1CZ1A 4FLOA 3QMRA 4X0NA 4AHOA 2ZXBA 4PMRA 4GKLA 3B8SA 4BQ2A 2QW5A 3OLEA 5LNVA 4DF0A 4UTWC 4GKTA 5L6UA 2VCDA 1GZ1A 4HTYA 3HM7A 4XTIA 4PUUA 2C13A 4S2BA 3JYMA 2X41A 1QVBA 1I6NA 2QJMA 4XO6A 5ABTA 3H7RA 5KETA 2CCRA 4LVFA 3IUHA 3T0TA 3F4DA 4EXBA 3II1A 1W1A1 1IV8A 1XX1A 4NY2A 2AL2A 2UY3A 3F1QA 1IE7C 3WQEA 4H8UA 2C3ZA 4IPLA 2NQZA 3TKFA 1UPPA 1DJIA 4ZTXA 3EWXA 3QQ1A 4ZTYA 3VX1A 4MPQA 2DPEA 4ORMA 3KP1A 2QCMA 4A6GA 2P10A 5ABEA 3IUIA 4KMQA 2A1YA 3RRAA 3W74A 1D8WA 4UCFA 3P74A 2GJRA 2MLYA 6ALDA 1V0NA 1FH8A 4L6DA 1TA3B 2PDFA 3GY1A 1QMLA 2BZNA 8A3HA 2W62A 2Y6ZA 1AA1B 1FKWA 2PMQA 3P2VA 5A2CA 4KCTA 1KB3A 2VJXA 1F40A 1CB7B 4N9DA 4PMDA 2QPUA 1KM3A 4HPGA 3O2LA 1UKPA 2CXGA 3IWPA 1UD6A 1OFAA 2GSJA 3CGMA 3T42A 4ZCWA 3NVDA 3S2NA 4JTSA 5E5CA 2OLAA 1F7BA 3MCMA 3IIOA 5EFFA 1KFWA 2PU0A 5DXYA 1TPEA 1JZ8A 2PZNA 2EPHA 2VO5A 3O5EA 1BHGA 2QZRA 5BU9A 1K03A 1A80A 4Z2GA 1D3GA 1OFQA 3NDYA 1TRDA 2CWXA 2KR7A 4AD5A 2Z0IA 2HROA 5D8ZA 1IGWA 1J4IA 1HIZA 2JIWA 2P53A 2WZEA 4JNMA 4MIMA 1YTKA 3L12A 1Q66A 1LOLA 1BEUA 1CWYA 2A5HA 3VO0A 3WH7A 1BTCA 3M5YA 4JTUA 1K77A 4DZIA 1M3UA 1DJGA 1XM3A 3ZT6A 1A3WA 2Z28A 1EJVC 4KWUA 1Q6UA 1M7JA 2QUNA 2Q8XA 3QGAC 1A5MC 1XBVA 1GQJA 4WRHA 4Q32A 4MJ4A 1A5LC 2XPBA 3FAPA 2A85A 3DKJA 2VN1A 2ODOA 3VNYA 3AXMA 1KFKA 5GJMA 4GUJA 5CQ1A 4LVGA 3ANVA 4JIQA 2PDGA 3LXBA 1R3WA 4X2RA 3AIWA 1W9BM 2UWFA 1H11A 3TXVA 4JFWA 3K1GA 2E7FA 1BVNP 3BV4A 2KAUC 4U2ZA 1QJWA 2DG3A 3IAQA 4PUKA 3BZGA 3CL6A 4NZCA 3KLKA 4ES4A 4WIWA 3KVJA 1WKDA 2OGYA 4OZOA 3TVAA 5I06A 4Y2WA 3P0WA 2XN0A 1Q7ZA 1CGYA 1JEZA 1EEPA 4PSPA 2GLKA 3W2UA 3LBCA 4MM1A 3ALFA 3UVAA 4HJFA 2G3FA 1B2YA 3B0YA 1NOUA 3UETA 3B97A 3MT1A 3VGFA 2X8RA 3BMVA 1WXJA 3MVIA 2YA0A 1HGYA 7ODCA 4AVFA 3L4XA 4Q8MA 2ZX8A 3QLDA 2J25A 3IGSA 1IYXA 2ZX9A 1W8GA 2ZZ6A 2X05A 2BHZA 4B4HA 2HXTA 4JYDA 2GDVA 1EJSC 4Q8NA 3M0IA 4R3UA 2WC3A 4KBXA 3URAA 1K9DA 2JGQA 4BA0A 3GAKA 1I2OA 3V35A 3KCEA 4KH2A 3BAXA 1F3TA 3TTQA 2XFRA 4UQ9A 4DM1A 4E4UA 1WDDA 2PDQA 4YTUA 3DHDA 4M6QA 2LGOA 4F9JA 2L2SA 1XD1A 2W3ZA 3NQBA 1V0LA 2P1FA 1G1YA 4X22A 3K13A 2A3LA 1HJQA 1CYGA 4NZ3A 2VZSA 4TX9A 5GNXA 3QBUA 3S5YA 3W0KA 4MZ1A 1GONA 5MKGA 1EGVA 2P76A 3WNKA 5HR6A 1KBBA 4M1RA 5A8PA 1R6WA 3DH7A 2W63A 2FGBA 2Z1XA 4E8CA 4ZOAA 3GU1A 3QOKA 3W2LA 3GNOA 4Z2LA 2ZA1A 1M1BA 1UR4A 1TWIA 4NJKA 1TE6A 1Q4WA 4PB5A 1DWAM 1NVMA 3QVQA 1QPNA 4AY7A 3CO4A 1YKWA 5EU9A