3OA8A

Diheme soxax
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
229
structure length
228
Chain Sequence
ANPGFLNVDRGEVLWSEPRGTRNVSLETCDLGEGPGKLEGAYAHLPRYFADTGKVMDLEQRLLWCMETIQGRDTKPLVAKPFSGPGRTSDMEDLVAFIANKSDGVKIKVALATPQEKEMYAIGEALFFRRSSINDFSCSTCHGAAGKRIRLQALPQLDVPGKDAQLTMATWPTYRVSQSALRTMQHRMWDYRQMRMPAPDYASEAVTALTLYLTKQAEGGELKVPSIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxA
publication title Diheme SoxAX proteins - insights into structure and function of the active site
rcsb
source organism Starkeya novella
molecule tags Heme-binding protein/heme-binding protein
total genus 79
structure length 228
sequence length 229
chains with identical sequence C, E
ec nomenclature ec 2.8.5.2: L-cysteine S-thiosulfotransferase.
pdb deposition date 2010-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3oa8A01
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3oa8A02
2FWLA 3NBTA 4D6TD 2PCCB 1CRYA 1IZL0 1NTMD 1CSVA 3H1JD 1WEJF 1CRHA 1M60A 1SQPD 3L4OA 2C8SA 1KB9D 4O1QA 1CHIA 1DW1A 2BLFB 5CIHB 2B0ZB 1CHJA 3H1HD 1M6ZA 1A2SA 4WQDA 4AAMA 1CORA 1CRIA 1YNRA 3SJLA 2B4ZA 3X39A 1DVVA 3O1YA 1AKKA 2L4DA 3CX5D 5CYTR 2LITA 1C52A 1DW2A 2C9XB 1CC5A 1FI3A 1CRJA 1CTJA 2FRCA 1FI7A 1S6VB 1FHBA 1FOCA 3PXSA 4EIFA 3ZOOA 1EB7A 1W5CT 2VHDA 1CNOA 5C9MA 5CIDB 3HQ8A 1LC1A 3L71D 1HZUA 1BE3D 1HZVA 1E2RA 1HJ4A 2MHMA 1QN2A 1H31A 1RZ6A 4U3FD 1GU2A 351CA 5EXQA 4PD4D 2B10B 3O20A 3L72D 2AIUA 5CIFB 3DP5A 3L75D 2C1DB 3WFCC 4L1QA 1IRWA 4JCGA 1IRVA 4QAOA 1SQVD 4P4QB 1CXAA 4LJIA 4EICA 2ZONG 1I5TA 5CIGB 3ORVA 3OA8A 3NBSA 5KAIV 2PACA 1N50A 4FA1A 1A56A 1CYJA 4H0JA 1HJ5A 4WQ7A 1S5LV 5B6QA 1ZZHA 5KLIB 2V07A 1AOFA 1QL3A 3RN1A 5TISV 1YFCA 3HQ6A 4AAOA 1KB0A 1CRCA 3CXHD 4PW9B 4L3HA 3BCCD 1U74B 2ZZS1 5DFSA 4AANA 3CU4A 4GYDA 4WQCA 1CCHA 1LMSA 5GTIV 1LC2A 4FA4A 3SVWA 1VYDA 3CWBD 1COTA 3VNWA 1L0ND 3CYTI 1I55A 3DR0A 3OCDB 1NIRA 3L73D 1C6RA 1CSWA 3VYMA 155CA 1PP9D 1SQQD 2BPBB 1C2RA 2DGEA 1PPJD 3WUIA 1IQCA 3KZIV 1QL4A 1CIGA 1RAPA 2ZBOA 3RN0A 1BCCD 2CA4B 1I8OA 2D0WA 1C2NA 5E79V 1BGYD 4UB6V 1DW3A 1QKSA 3H1ID 1NNOA 1QYZA 1H33A 4NFGB 2XTSB 3ZBMA 3L70D 3PH2B 1IO3A 3VRDA 4MU8A 3WFEC 1GDVA 1H9XA 2QJYB 1GJQA 1GIWA 4YE1A 5DJQC 1CIHA 2C1DA 1BL9A 2GIWA 1HRCA 4AALA 1CYCA 3WFBC 4XXLA 1I6DA 1K3HA 1CHHA 2PCBB 5DJQB 1KYOW 1HROA 4FA9A 1GKSA 1LS9A 3O5CA 2ZOOA 3ZOWA 2ZXYA 1H1OA 3C2CA 3L74D 1N9CA 2YQBA 2QJKB 4Q5PA 5CIEB 3PXTA 1ETPA 4FANA 4WQEA 2FYNB 5H2FV 1K3GA 4RSZA 3WU2V 2BH5X 451CA 2JTIB 4H0KA 4WQ9A 1MG3D 2HV4A 4UB8V 3ZIYA 2C1UA 1H32B 1DT1A 3SXTA 2IBZD 5AURA 1AOQA 1CSXA 4J20A 1R0QA 2ORLA 4Y5RA 4O1WA 2B12B 3WFDC 4K3IA 1FCDC 1OCDA 1B7VA 2N3BA 3OCDA 1SQBD 3HQ7A 4KMGA 4EIEA 3CP5A 1NMIA 2GB8B 1A8CA 1MG2D 1C7MA 1C6OA 1LFMA 2BGVX 1CSUA 2B11B 4PWAA 3TYIA 5KLVD 2OZ1B 3SWSA 1I8PA 1FI9A 1NTKD 1L9JC 4V2KA 1U75B 3TGUD 1RAQA 5GTHV 4DY9A 1CEDA 3RLMA 2CXBA 2YK3A 3A9FA 1CO6A 2D0SA 1EZVD 1C6SA 1L9BC 1GQ1A 1KX7A 2CE0A 3RMZA 2CA3B 2YCCA 1C75A 1J3SA 2C2CA 1W2LA 1F1CA 3M97X 2AI5A 3CX5W 3L4MA 1JDLA 5B66V 1NMLA 1NU1D 1YEBA 2N18C 2QJPB 2V08A 4EIDA 4AX3A 3NWVA 1DIIC 3H1KD 1M70A 2JQRA 1E8EA 3DMIA 2N18B 4PJ0V 1HCMA 5KAFV 1NTZD 2A06D 2N9IA 1KX2A 4WQBA 3ZOXA 3MK7C 2MTAC 3A0BV 1CCRA 1N90A 1RZ5A 4WQAA 1KYOD 1H33B 2N3YA 3MK7B 5CIBB 2DVHA 4WQ8A 1FJ0A 2BCNB 1CIFA 2FYUD 1I54A 1H32A 1I6EA 5KKZB 1YCCA 3JBTB 1N15A 1WVEC 1CTZA 2AXTV 4FB1A 4N0KA 4GEDB 4L3GA 1KIBA 2EXVA 4XYDB 4FA5A 1H31B 1HJ3A 3O0RC 4IL6V 1YICA 1MZ4A 2CE1A 3PXWA 1CYIA 3ZCFA 2GC7D 1P84D 1YIQA 2N9JA 1OAEA 1CXCA 2LIRA 5B5EV 3H1LD 1HH7A 5IY51 1F1FA 1CIEA 1CTYA 1DIQC 2GC4D 3WC8A 3HQ9A 2BCCD 3OA8B 3CXHW 3ZOYA 1DVHA 1H9YA 1E29A 2OZ1A 1YEAA 1L0LD 5DF5A 2BH4X 2C1VA 4FAVA 5C0ZA 3A0HV 1CRGA 1KV9A 5CICB 2I8FA 1DW0A 1SQXD 1ZRTD 1AYGA 1YTCA 3SLEA 2YIUB
chains in the Genus database with same CATH superfamily
2FWLA 3NBTA 4D6TD 2PCCB 1CRYA 1IZL0 1NTMD 1CSVA 3H1JD 1WEJF 1CRHA 1M60A 1SQPD 3L4OA 2C8SA 1KB9D 4O1QA 1CHIA 1DW1A 2BLFB 5CIHB 2B0ZB 1CHJA 3H1HD 1M6ZA 1A2SA 4WQDA 4AAMA 1CORA 1CRIA 1YNRA 3SJLA 2B4ZA 3X39A 1DVVA 3O1YA 1AKKA 2L4DA 3CX5D 5CYTR 2LITA 1C52A 1DW2A 2C9XB 1CC5A 1FI3A 1CRJA 1CTJA 2FRCA 1FI7A 1S6VB 1FHBA 1FOCA 3PXSA 4EIFA 3ZOOA 1EB7A 1W5CT 2VHDA 1CNOA 5C9MA 5CIDB 3HQ8A 1LC1A 3L71D 1HZUA 1BE3D 1HZVA 1E2RA 1HJ4A 2MHMA 1QN2A 1H31A 1RZ6A 4U3FD 1GU2A 351CA 5EXQA 4PD4D 2B10B 3O20A 3L72D 2AIUA 5CIFB 3DP5A 3L75D 2C1DB 3WFCC 4L1QA 1IRWA 4JCGA 1IRVA 4QAOA 1SQVD 4P4QB 1CXAA 4LJIA 4EICA 2ZONG 1I5TA 5CIGB 3ORVA 3OA8A 3NBSA 5KAIV 2PACA 1N50A 4FA1A 1A56A 1CYJA 4H0JA 1HJ5A 4WQ7A 1S5LV 5B6QA 1ZZHA 5KLIB 2V07A 1AOFA 1QL3A 3RN1A 5TISV 1YFCA 3HQ6A 4AAOA 1KB0A 1CRCA 3CXHD 4PW9B 4L3HA 3BCCD 1U74B 2ZZS1 5DFSA 4AANA 3CU4A 4GYDA 4WQCA 1CCHA 1LMSA 5GTIV 1LC2A 4FA4A 3SVWA 1VYDA 3CWBD 1COTA 3VNWA 1L0ND 3CYTI 1I55A 3DR0A 3OCDB 1NIRA 3L73D 1C6RA 1CSWA 3VYMA 155CA 1PP9D 1SQQD 2BPBB 1C2RA 2DGEA 1PPJD 3WUIA 1IQCA 3KZIV 1QL4A 1CIGA 1RAPA 2ZBOA 3RN0A 1BCCD 2CA4B 1I8OA 2D0WA 1C2NA 5E79V 1BGYD 4UB6V 1DW3A 1QKSA 3H1ID 1NNOA 1QYZA 1H33A 4NFGB 2XTSB 3ZBMA 3L70D 3PH2B 1IO3A 3VRDA 4MU8A 3WFEC 1GDVA 1H9XA 2QJYB 1GJQA 1GIWA 4YE1A 5DJQC 1CIHA 2C1DA 1BL9A 2GIWA 1HRCA 4AALA 1CYCA 3WFBC 4XXLA 1I6DA 1K3HA 1CHHA 2PCBB 5DJQB 1KYOW 1HROA 4FA9A 1GKSA 1LS9A 3O5CA 2ZOOA 3ZOWA 2ZXYA 1H1OA 3C2CA 3L74D 1N9CA 2YQBA 2QJKB 4Q5PA 5CIEB 3PXTA 1ETPA 4FANA 4WQEA 2FYNB 5H2FV 1K3GA 3D0WA 4RSZA 3WU2V 2BH5X 451CA 2JTIB 4H0KA 4WQ9A 1MG3D 2HV4A 4UB8V 3ZIYA 2C1UA 1H32B 1DT1A 3SXTA 2IBZD 5AURA 1AOQA 1CSXA 4J20A 1R0QA 2ORLA 4Y5RA 4O1WA 2B12B 3WFDC 4K3IA 1FCDC 1OCDA 1B7VA 2N3BA 3OCDA 1SQBD 3HQ7A 4KMGA 4EIEA 3CP5A 1NMIA 2GB8B 1A8CA 1MG2D 1C7MA 1C6OA 1LFMA 2BGVX 1CSUA 2B11B 4PWAA 3TYIA 5KLVD 2OZ1B 3SWSA 1I8PA 1FI9A 1NTKD 1L9JC 4V2KA 1U75B 3TGUD 1RAQA 5GTHV 4DY9A 1CEDA 3RLMA 2CXBA 2YK3A 3A9FA 1CO6A 2D0SA 1EZVD 1C6SA 1L9BC 1GQ1A 1KX7A 2CE0A 3RMZA 2CA3B 2YCCA 1C75A 1J3SA 2C2CA 1W2LA 1F1CA 3M97X 2AI5A 3CX5W 3L4MA 1JDLA 5B66V 1NMLA 1NU1D 1YEBA 2N18C 2QJPB 2V08A 4EIDA 4AX3A 3NWVA 1DIIC 3H1KD 1M70A 2JQRA 1E8EA 3DMIA 2N18B 4PJ0V 1HCMA 5KAFV 1NTZD 2A06D 2N9IA 1KX2A 4WQBA 3ZOXA 3MK7C 2MTAC 3A0BV 1CCRA 1N90A 1RZ5A 4WQAA 1KYOD 1H33B 2N3YA 3MK7B 5CIBB 2DVHA 4WQ8A 1FJ0A 2BCNB 1CIFA 2FYUD 1I54A 1H32A 1I6EA 5KKZB 1YCCA 3JBTB 1N15A 1WVEC 1CTZA 2AXTV 4FB1A 4N0KA 4GEDB 4L3GA 1KIBA 2EXVA 4XYDB 4FA5A 1H31B 1HJ3A 3O0RC 4IL6V 1YICA 1MZ4A 2CE1A 3PXWA 1CYIA 3ZCFA 2GC7D 1P84D 1YIQA 2N9JA 1OAEA 1CXCA 2LIRA 5B5EV 3H1LD 1HH7A 5IY51 1F1FA 1CIEA 1CTYA 1DIQC 2GC4D 3WC8A 3HQ9A 2BCCD 3OA8B 3CXHW 3ZOYA 1DVHA 1H9YA 1E29A 2OZ1A 1YEAA 1L0LD 5DF5A 2BH4X 2C1VA 4FAVA 5C0ZA 3A0HV 1CRGA 1KV9A 5CICB 2I8FA 1DW0A 1SQXD 1ZRTD 1AYGA 1YTCA 3SLEA 2YIUB
chains in the Genus database with same CATH topology
2FWLA 3NBTA 4D6TD 2PCCB 1CRYA 1IZL0 1NTMD 1CSVA 3H1JD 1WEJF 1CRHA 1M60A 1SQPD 3L4OA 2C8SA 1KB9D 4O1QA 1CHIA 1DW1A 2BLFB 5CIHB 2B0ZB 1CHJA 3H1HD 1M6ZA 1A2SA 4WQDA 4AAMA 1CORA 1CRIA 1YNRA 3SJLA 2B4ZA 3X39A 1DVVA 3O1YA 1AKKA 2L4DA 3CX5D 5CYTR 2LITA 1C52A 1DW2A 2C9XB 1CC5A 1FI3A 1CRJA 1CTJA 2FRCA 1FI7A 1S6VB 1FHBA 1FOCA 3PXSA 4EIFA 3ZOOA 1EB7A 1W5CT 2VHDA 1CNOA 5C9MA 5CIDB 3HQ8A 1LC1A 3L71D 1HZUA 1BE3D 1HZVA 1E2RA 1HJ4A 2MHMA 1QN2A 1H31A 1RZ6A 4U3FD 1GU2A 351CA 5EXQA 4PD4D 2B10B 3O20A 3L72D 2AIUA 5CIFB 3DP5A 3L75D 2C1DB 3WFCC 4L1QA 1IRWA 4JCGA 1IRVA 4QAOA 1SQVD 4P4QB 1CXAA 4LJIA 4EICA 2ZONG 1I5TA 5CIGB 3ORVA 3OA8A 3NBSA 5KAIV 2PACA 1N50A 4FA1A 1A56A 1CYJA 4H0JA 1HJ5A 4WQ7A 1S5LV 5B6QA 1ZZHA 5KLIB 2V07A 1AOFA 1QL3A 3RN1A 5TISV 1YFCA 3HQ6A 4AAOA 1KB0A 1CRCA 3CXHD 4PW9B 4L3HA 3BCCD 1U74B 2ZZS1 5DFSA 4AANA 3CU4A 4GYDA 4WQCA 1CCHA 1LMSA 5GTIV 1LC2A 4FA4A 3SVWA 1VYDA 3CWBD 1COTA 3VNWA 1L0ND 3CYTI 1I55A 3DR0A 3OCDB 1NIRA 3L73D 1C6RA 1CSWA 3VYMA 155CA 1PP9D 1SQQD 2BPBB 1C2RA 2DGEA 1PPJD 3WUIA 1IQCA 3KZIV 1QL4A 1CIGA 1RAPA 2ZBOA 3RN0A 1BCCD 2CA4B 1I8OA 2D0WA 1C2NA 5E79V 1BGYD 4UB6V 1DW3A 1QKSA 3H1ID 1NNOA 1QYZA 1H33A 4NFGB 2XTSB 3ZBMA 3L70D 3PH2B 1IO3A 3VRDA 4MU8A 3WFEC 1GDVA 1H9XA 2QJYB 1GJQA 1GIWA 4YE1A 5DJQC 1CIHA 2C1DA 1BL9A 2GIWA 1HRCA 4AALA 1CYCA 3WFBC 4XXLA 1I6DA 1K3HA 1CHHA 2PCBB 5DJQB 1KYOW 1HROA 4FA9A 1GKSA 1LS9A 3O5CA 2ZOOA 3ZOWA 2ZXYA 1H1OA 3C2CA 3L74D 1N9CA 2YQBA 2QJKB 4Q5PA 5CIEB 3PXTA 1ETPA 4FANA 4WQEA 2FYNB 5H2FV 1K3GA 4RSZA 3WU2V 2BH5X 451CA 2JTIB 4H0KA 4WQ9A 1MG3D 2HV4A 4UB8V 3ZIYA 2C1UA 1H32B 1DT1A 3SXTA 2IBZD 5AURA 1AOQA 1CSXA 4J20A 1R0QA 2ORLA 4Y5RA 4O1WA 2B12B 3WFDC 4K3IA 1FCDC 1OCDA 1B7VA 2N3BA 3OCDA 1SQBD 3HQ7A 4KMGA 4EIEA 3CP5A 1NMIA 2GB8B 1A8CA 1MG2D 1C7MA 1C6OA 1LFMA 2BGVX 1CSUA 2B11B 4PWAA 3TYIA 5KLVD 2OZ1B 3SWSA 1I8PA 1FI9A 1NTKD 1L9JC 4V2KA 1U75B 3TGUD 1RAQA 5GTHV 4DY9A 1CEDA 3RLMA 2CXBA 2YK3A 3A9FA 1CO6A 2D0SA 1EZVD 1C6SA 1L9BC 1GQ1A 1KX7A 2CE0A 3RMZA 2CA3B 2YCCA 1C75A 1J3SA 2C2CA 1W2LA 1F1CA 3M97X 2AI5A 3CX5W 3L4MA 1JDLA 5B66V 1NMLA 1NU1D 1YEBA 2N18C 2QJPB 2V08A 4EIDA 4AX3A 3NWVA 1DIIC 3H1KD 1M70A 2JQRA 1E8EA 3DMIA 2N18B 4PJ0V 1HCMA 5KAFV 1NTZD 2A06D 2N9IA 1KX2A 4WQBA 3ZOXA 3MK7C 2MTAC 3A0BV 1CCRA 1N90A 1RZ5A 4WQAA 1KYOD 1H33B 2N3YA 3MK7B 5CIBB 2DVHA 4WQ8A 1FJ0A 2BCNB 1CIFA 2FYUD 1I54A 1H32A 1I6EA 5KKZB 1YCCA 3JBTB 1N15A 1WVEC 1CTZA 2AXTV 4FB1A 4N0KA 4GEDB 4L3GA 1KIBA 2EXVA 4XYDB 4FA5A 1H31B 1HJ3A 3O0RC 4IL6V 1YICA 1MZ4A 2CE1A 3PXWA 1CYIA 3ZCFA 2GC7D 1P84D 1YIQA 2N9JA 1OAEA 1CXCA 2LIRA 5B5EV 3H1LD 1HH7A 5IY51 1F1FA 1CIEA 1CTYA 1DIQC 2GC4D 3WC8A 3HQ9A 2BCCD 3OA8B 3CXHW 3ZOYA 1DVHA 1H9YA 1E29A 2OZ1A 1YEAA 1L0LD 5DF5A 2BH4X 2C1VA 4FAVA 5C0ZA 3A0HV 1CRGA 1KV9A 5CICB 2I8FA 1DW0A 1SQXD 1ZRTD 1AYGA 1YTCA 3SLEA 2YIUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FWL A;  3NBT A;  4D6T D;  2PCC B;  1CRY A;  1IZL 0;  1NTM D;  1CSV A;  3H1J D;  1WEJ F;  1CRH A;  1M60 A;  1SQP D;  3L4O A;  2C8S A;  1KB9 D;  4O1Q A;  1CHI A;  1DW1 A;  2BLF B;  5CIH B;  2B0Z B;  1CHJ A;  3H1H D;  1M6Z A;  1A2S A;  4WQD A;  4AAM A;  1COR A;  1CRI A;  1YNR A;  3SJL A;  2B4Z A;  3X39 A;  1DVV A;  3O1Y A;  1AKK A;  2L4D A;  3CX5 D;  5CYT R;  2LIT A;  1C52 A;  1DW2 A;  2C9X B;  1CC5 A;  1FI3 A;  1CRJ A;  1CTJ A;  2FRC A;  1FI7 A;  1S6V B;  1FHB A;  1FOC A;  3PXS A;  4EIF A;  3ZOO A;  1EB7 A;  1W5C T;  2VHD A;  1CNO A;  5C9M A;  5CID B;  3HQ8 A;  1LC1 A;  3L71 D;  1HZU A;  1BE3 D;  1HZV A;  1E2R A;  1HJ4 A;  2MHM A;  1QN2 A;  1H31 A;  1RZ6 A;  4U3F D;  1GU2 A;  351C A;  5EXQ A;  4PD4 D;  2B10 B;  3O20 A;  3L72 D;  2AIU A;  5CIF B;  3DP5 A;  3L75 D;  2C1D B;  3WFC C;  4L1Q A;  1IRW A;  4JCG A;  1IRV A;  4QAO A;  1SQV D;  4P4Q B;  1CXA A;  4LJI A;  4EIC A;  2ZON G;  1I5T A;  5CIG B;  3ORV A;  3OA8 A;  3NBS A;  5KAI V;  2PAC A;  1N50 A;  4FA1 A;  1A56 A;  1CYJ A;  4H0J A;  1HJ5 A;  4WQ7 A;  1S5L V;  5B6Q A;  1ZZH A;  5KLI B;  2V07 A;  1AOF A;  1QL3 A;  3RN1 A;  5TIS V;  1YFC A;  3HQ6 A;  4AAO A;  1KB0 A;  1CRC A;  3CXH D;  4PW9 B;  4L3H A;  3BCC D;  1U74 B;  2ZZS 1;  5DFS A;  4AAN A;  3CU4 A;  4GYD A;  4WQC A;  1CCH A;  1LMS A;  5GTI V;  1LC2 A;  4FA4 A;  3SVW A;  1VYD A;  3CWB D;  1COT A;  3VNW A;  1L0N D;  3CYT I;  1I55 A;  3DR0 A;  3OCD B;  1NIR A;  3L73 D;  1C6R A;  1CSW A;  3VYM A;  155C A;  1PP9 D;  1SQQ D;  2BPB B;  1C2R A;  2DGE A;  1PPJ D;  3WUI A;  1IQC A;  3KZI V;  1QL4 A;  1CIG A;  1RAP A;  2ZBO A;  3RN0 A;  1BCC D;  2CA4 B;  1I8O A;  2D0W A;  1C2N A;  5E79 V;  1BGY D;  4UB6 V;  1DW3 A;  1QKS A;  3H1I D;  1NNO A;  1QYZ A;  1H33 A;  4NFG B;  2XTS B;  3ZBM A;  3L70 D;  3PH2 B;  1IO3 A;  3VRD A;  4MU8 A;  3WFE C;  1GDV A;  1H9X A;  2QJY B;  1GJQ A;  1GIW A;  4YE1 A;  5DJQ C;  1CIH A;  2C1D A;  1BL9 A;  2GIW A;  1HRC A;  4AAL A;  1CYC A;  3WFB C;  4XXL A;  1I6D A;  1K3H A;  1CHH A;  2PCB B;  5DJQ B;  1KYO W;  1HRO A;  4FA9 A;  1GKS A;  1LS9 A;  3O5C A;  2ZOO A;  3ZOW A;  2ZXY A;  1H1O A;  3C2C A;  3L74 D;  1N9C A;  2YQB A;  2QJK B;  4Q5P A;  5CIE B;  3PXT A;  1ETP A;  4FAN A;  4WQE A;  2FYN B;  5H2F V;  1K3G A;  4RSZ A;  3WU2 V;  2BH5 X;  451C A;  2JTI B;  4H0K A;  4WQ9 A;  1MG3 D;  2HV4 A;  4UB8 V;  3ZIY A;  2C1U A;  1H32 B;  1DT1 A;  3SXT A;  2IBZ D;  5AUR A;  1AOQ A;  1CSX A;  4J20 A;  1R0Q A;  2ORL A;  4Y5R A;  4O1W A;  2B12 B;  3WFD C;  4K3I A;  1FCD C;  1OCD A;  1B7V A;  2N3B A;  3OCD A;  1SQB D;  3HQ7 A;  4KMG A;  4EIE A;  3CP5 A;  1NMI A;  2GB8 B;  1A8C A;  1MG2 D;  1C7M A;  1C6O A;  1LFM A;  2BGV X;  1CSU A;  2B11 B;  4PWA A;  3TYI A;  5KLV D;  2OZ1 B;  3SWS A;  1I8P A;  1FI9 A;  1NTK D;  1L9J C;  4V2K A;  1U75 B;  3TGU D;  1RAQ A;  5GTH V;  4DY9 A;  1CED A;  3RLM A;  2CXB A;  2YK3 A;  3A9F A;  1CO6 A;  2D0S A;  1EZV D;  1C6S A;  1L9B C;  1GQ1 A;  1KX7 A;  2CE0 A;  3RMZ A;  2CA3 B;  2YCC A;  1C75 A;  1J3S A;  2C2C A;  1W2L A;  1F1C A;  3M97 X;  2AI5 A;  3CX5 W;  3L4M A;  1JDL A;  5B66 V;  1NML A;  1NU1 D;  1YEB A;  2N18 C;  2QJP B;  2V08 A;  4EID A;  4AX3 A;  3NWV A;  1DII C;  3H1K D;  1M70 A;  2JQR A;  1E8E A;  3DMI A;  2N18 B;  4PJ0 V;  1HCM A;  5KAF V;  1NTZ D;  2A06 D;  2N9I A;  1KX2 A;  4WQB A;  3ZOX A;  3MK7 C;  2MTA C;  3A0B V;  1CCR A;  1N90 A;  1RZ5 A;  4WQA A;  1KYO D;  1H33 B;  2N3Y A;  3MK7 B;  5CIB B;  2DVH A;  4WQ8 A;  1FJ0 A;  2BCN B;  1CIF A;  2FYU D;  1I54 A;  1H32 A;  1I6E A;  5KKZ B;  1YCC A;  3JBT B;  1N15 A;  1WVE C;  1CTZ A;  2AXT V;  4FB1 A;  4N0K A;  4GED B;  4L3G A;  1KIB A;  2EXV A;  4XYD B;  4FA5 A;  1H31 B;  1HJ3 A;  3O0R C;  4IL6 V;  1YIC A;  1MZ4 A;  2CE1 A;  3PXW A;  1CYI A;  3ZCF A;  2GC7 D;  1P84 D;  1YIQ A;  2N9J A;  1OAE A;  1CXC A;  2LIR A;  5B5E V;  3H1L D;  1HH7 A;  5IY5 1;  1F1F A;  1CIE A;  1CTY A;  1DIQ C;  2GC4 D;  3WC8 A;  3HQ9 A;  2BCC D;  3OA8 B;  3CXH W;  3ZOY A;  1DVH A;  1H9Y A;  1E29 A;  2OZ1 A;  1YEA A;  1L0L D;  5DF5 A;  2BH4 X;  2C1V A;  4FAV A;  5C0Z A;  3A0H V;  1CRG A;  1KV9 A;  5CIC B;  2I8F A;  1DW0 A;  1SQX D;  1ZRT D;  1AYG A;  1YTC A;  3SLE A;  2YIU B; 
#chains in the Genus database with same CATH topology
 2FWL A;  3NBT A;  4D6T D;  2PCC B;  1CRY A;  1IZL 0;  1NTM D;  1CSV A;  3H1J D;  1WEJ F;  1CRH A;  1M60 A;  1SQP D;  3L4O A;  2C8S A;  1KB9 D;  4O1Q A;  1CHI A;  1DW1 A;  2BLF B;  5CIH B;  2B0Z B;  1CHJ A;  3H1H D;  1M6Z A;  1A2S A;  4WQD A;  4AAM A;  1COR A;  1CRI A;  1YNR A;  3SJL A;  2B4Z A;  3X39 A;  1DVV A;  3O1Y A;  1AKK A;  2L4D A;  3CX5 D;  5CYT R;  2LIT A;  1C52 A;  1DW2 A;  2C9X B;  1CC5 A;  1FI3 A;  1CRJ A;  1CTJ A;  2FRC A;  1FI7 A;  1S6V B;  1FHB A;  1FOC A;  3PXS A;  4EIF A;  3ZOO A;  1EB7 A;  1W5C T;  2VHD A;  1CNO A;  5C9M A;  5CID B;  3HQ8 A;  1LC1 A;  3L71 D;  1HZU A;  1BE3 D;  1HZV A;  1E2R A;  1HJ4 A;  2MHM A;  1QN2 A;  1H31 A;  1RZ6 A;  4U3F D;  1GU2 A;  351C A;  5EXQ A;  4PD4 D;  2B10 B;  3O20 A;  3L72 D;  2AIU A;  5CIF B;  3DP5 A;  3L75 D;  2C1D B;  3WFC C;  4L1Q A;  1IRW A;  4JCG A;  1IRV A;  4QAO A;  1SQV D;  4P4Q B;  1CXA A;  4LJI A;  4EIC A;  2ZON G;  1I5T A;  5CIG B;  3ORV A;  3OA8 A;  3NBS A;  5KAI V;  2PAC A;  1N50 A;  4FA1 A;  1A56 A;  1CYJ A;  4H0J A;  1HJ5 A;  4WQ7 A;  1S5L V;  5B6Q A;  1ZZH A;  5KLI B;  2V07 A;  1AOF A;  1QL3 A;  3RN1 A;  5TIS V;  1YFC A;  3HQ6 A;  4AAO A;  1KB0 A;  1CRC A;  3CXH D;  4PW9 B;  4L3H A;  3BCC D;  1U74 B;  2ZZS 1;  5DFS A;  4AAN A;  3CU4 A;  4GYD A;  4WQC A;  1CCH A;  1LMS A;  5GTI V;  1LC2 A;  4FA4 A;  3SVW A;  1VYD A;  3CWB D;  1COT A;  3VNW A;  1L0N D;  3CYT I;  1I55 A;  3DR0 A;  3OCD B;  1NIR A;  3L73 D;  1C6R A;  1CSW A;  3VYM A;  155C A;  1PP9 D;  1SQQ D;  2BPB B;  1C2R A;  2DGE A;  1PPJ D;  3WUI A;  1IQC A;  3KZI V;  1QL4 A;  1CIG A;  1RAP A;  2ZBO A;  3RN0 A;  1BCC D;  2CA4 B;  1I8O A;  2D0W A;  1C2N A;  5E79 V;  1BGY D;  4UB6 V;  1DW3 A;  1QKS A;  3H1I D;  1NNO A;  1QYZ A;  1H33 A;  4NFG B;  2XTS B;  3ZBM A;  3L70 D;  3PH2 B;  1IO3 A;  3VRD A;  4MU8 A;  3WFE C;  1GDV A;  1H9X A;  2QJY B;  1GJQ A;  1GIW A;  4YE1 A;  5DJQ C;  1CIH A;  2C1D A;  1BL9 A;  2GIW A;  1HRC A;  4AAL A;  1CYC A;  3WFB C;  4XXL A;  1I6D A;  1K3H A;  1CHH A;  2PCB B;  5DJQ B;  1KYO W;  1HRO A;  4FA9 A;  1GKS A;  1LS9 A;  3O5C A;  2ZOO A;  3ZOW A;  2ZXY A;  1H1O A;  3C2C A;  3L74 D;  1N9C A;  2YQB A;  2QJK B;  4Q5P A;  5CIE B;  3PXT A;  1ETP A;  4FAN A;  4WQE A;  2FYN B;  5H2F V;  1K3G A;  3D0W A;  4RSZ A;  3WU2 V;  2BH5 X;  451C A;  2JTI B;  4H0K A;  4WQ9 A;  1MG3 D;  2HV4 A;  4UB8 V;  3ZIY A;  2C1U A;  1H32 B;  1DT1 A;  3SXT A;  2IBZ D;  5AUR A;  1AOQ A;  1CSX A;  4J20 A;  1R0Q A;  2ORL A;  4Y5R A;  4O1W A;  2B12 B;  3WFD C;  4K3I A;  1FCD C;  1OCD A;  1B7V A;  2N3B A;  3OCD A;  1SQB D;  3HQ7 A;  4KMG A;  4EIE A;  3CP5 A;  1NMI A;  2GB8 B;  1A8C A;  1MG2 D;  1C7M A;  1C6O A;  1LFM A;  2BGV X;  1CSU A;  2B11 B;  4PWA A;  3TYI A;  5KLV D;  2OZ1 B;  3SWS A;  1I8P A;  1FI9 A;  1NTK D;  1L9J C;  4V2K A;  1U75 B;  3TGU D;  1RAQ A;  5GTH V;  4DY9 A;  1CED A;  3RLM A;  2CXB A;  2YK3 A;  3A9F A;  1CO6 A;  2D0S A;  1EZV D;  1C6S A;  1L9B C;  1GQ1 A;  1KX7 A;  2CE0 A;  3RMZ A;  2CA3 B;  2YCC A;  1C75 A;  1J3S A;  2C2C A;  1W2L A;  1F1C A;  3M97 X;  2AI5 A;  3CX5 W;  3L4M A;  1JDL A;  5B66 V;  1NML A;  1NU1 D;  1YEB A;  2N18 C;  2QJP B;  2V08 A;  4EID A;  4AX3 A;  3NWV A;  1DII C;  3H1K D;  1M70 A;  2JQR A;  1E8E A;  3DMI A;  2N18 B;  4PJ0 V;  1HCM A;  5KAF V;  1NTZ D;  2A06 D;  2N9I A;  1KX2 A;  4WQB A;  3ZOX A;  3MK7 C;  2MTA C;  3A0B V;  1CCR A;  1N90 A;  1RZ5 A;  4WQA A;  1KYO D;  1H33 B;  2N3Y A;  3MK7 B;  5CIB B;  2DVH A;  4WQ8 A;  1FJ0 A;  2BCN B;  1CIF A;  2FYU D;  1I54 A;  1H32 A;  1I6E A;  5KKZ B;  1YCC A;  3JBT B;  1N15 A;  1WVE C;  1CTZ A;  2AXT V;  4FB1 A;  4N0K A;  4GED B;  4L3G A;  1KIB A;  2EXV A;  4XYD B;  4FA5 A;  1H31 B;  1HJ3 A;  3O0R C;  4IL6 V;  1YIC A;  1MZ4 A;  2CE1 A;  3PXW A;  1CYI A;  3ZCF A;  2GC7 D;  1P84 D;  1YIQ A;  2N9J A;  1OAE A;  1CXC A;  2LIR A;  5B5E V;  3H1L D;  1HH7 A;  5IY5 1;  1F1F A;  1CIE A;  1CTY A;  1DIQ C;  2GC4 D;  3WC8 A;  3HQ9 A;  2BCC D;  3OA8 B;  3CXH W;  3ZOY A;  1DVH A;  1H9Y A;  1E29 A;  2OZ1 A;  1YEA A;  1L0L D;  5DF5 A;  2BH4 X;  2C1V A;  4FAV A;  5C0Z A;  3A0H V;  1CRG A;  1KV9 A;  5CIC B;  2I8F A;  1DW0 A;  1SQX D;  1ZRT D;  1AYG A;  1YTC A;  3SLE A;  2YIU B; 
#chains in the Genus database with same CATH homology
 2FWL A;  3NBT A;  4D6T D;  2PCC B;  1CRY A;  1IZL 0;  1NTM D;  1CSV A;  3H1J D;  1WEJ F;  1CRH A;  1M60 A;  1SQP D;  3L4O A;  2C8S A;  1KB9 D;  4O1Q A;  1CHI A;  1DW1 A;  2BLF B;  5CIH B;  2B0Z B;  1CHJ A;  3H1H D;  1M6Z A;  1A2S A;  4WQD A;  4AAM A;  1COR A;  1CRI A;  1YNR A;  3SJL A;  2B4Z A;  3X39 A;  1DVV A;  3O1Y A;  1AKK A;  2L4D A;  3CX5 D;  5CYT R;  2LIT A;  1C52 A;  1DW2 A;  2C9X B;  1CC5 A;  1FI3 A;  1CRJ A;  1CTJ A;  2FRC A;  1FI7 A;  1S6V B;  1FHB A;  1FOC A;  3PXS A;  4EIF A;  3ZOO A;  1EB7 A;  1W5C T;  2VHD A;  1CNO A;  5C9M A;  5CID B;  3HQ8 A;  1LC1 A;  3L71 D;  1HZU A;  1BE3 D;  1HZV A;  1E2R A;  1HJ4 A;  2MHM A;  1QN2 A;  1H31 A;  1RZ6 A;  4U3F D;  1GU2 A;  351C A;  5EXQ A;  4PD4 D;  2B10 B;  3O20 A;  3L72 D;  2AIU A;  5CIF B;  3DP5 A;  3L75 D;  2C1D B;  3WFC C;  4L1Q A;  1IRW A;  4JCG A;  1IRV A;  4QAO A;  1SQV D;  4P4Q B;  1CXA A;  4LJI A;  4EIC A;  2ZON G;  1I5T A;  5CIG B;  3ORV A;  3OA8 A;  3NBS A;  5KAI V;  2PAC A;  1N50 A;  4FA1 A;  1A56 A;  1CYJ A;  4H0J A;  1HJ5 A;  4WQ7 A;  1S5L V;  5B6Q A;  1ZZH A;  5KLI B;  2V07 A;  1AOF A;  1QL3 A;  3RN1 A;  5TIS V;  1YFC A;  3HQ6 A;  4AAO A;  1KB0 A;  1CRC A;  3CXH D;  4PW9 B;  4L3H A;  3BCC D;  1U74 B;  2ZZS 1;  5DFS A;  4AAN A;  3CU4 A;  4GYD A;  4WQC A;  1CCH A;  1LMS A;  5GTI V;  1LC2 A;  4FA4 A;  3SVW A;  1VYD A;  3CWB D;  1COT A;  3VNW A;  1L0N D;  3CYT I;  1I55 A;  3DR0 A;  3OCD B;  1NIR A;  3L73 D;  1C6R A;  1CSW A;  3VYM A;  155C A;  1PP9 D;  1SQQ D;  2BPB B;  1C2R A;  2DGE A;  1PPJ D;  3WUI A;  1IQC A;  3KZI V;  1QL4 A;  1CIG A;  1RAP A;  2ZBO A;  3RN0 A;  1BCC D;  2CA4 B;  1I8O A;  2D0W A;  1C2N A;  5E79 V;  1BGY D;  4UB6 V;  1DW3 A;  1QKS A;  3H1I D;  1NNO A;  1QYZ A;  1H33 A;  4NFG B;  2XTS B;  3ZBM A;  3L70 D;  3PH2 B;  1IO3 A;  3VRD A;  4MU8 A;  3WFE C;  1GDV A;  1H9X A;  2QJY B;  1GJQ A;  1GIW A;  4YE1 A;  5DJQ C;  1CIH A;  2C1D A;  1BL9 A;  2GIW A;  1HRC A;  4AAL A;  1CYC A;  3WFB C;  4XXL A;  1I6D A;  1K3H A;  1CHH A;  2PCB B;  5DJQ B;  1KYO W;  1HRO A;  4FA9 A;  1GKS A;  1LS9 A;  3O5C A;  2ZOO A;  3ZOW A;  2ZXY A;  1H1O A;  3C2C A;  3L74 D;  1N9C A;  2YQB A;  2QJK B;  4Q5P A;  5CIE B;  3PXT A;  1ETP A;  4FAN A;  4WQE A;  2FYN B;  5H2F V;  1K3G A;  4RSZ A;  3WU2 V;  2BH5 X;  451C A;  2JTI B;  4H0K A;  4WQ9 A;  1MG3 D;  2HV4 A;  4UB8 V;  3ZIY A;  2C1U A;  1H32 B;  1DT1 A;  3SXT A;  2IBZ D;  5AUR A;  1AOQ A;  1CSX A;  4J20 A;  1R0Q A;  2ORL A;  4Y5R A;  4O1W A;  2B12 B;  3WFD C;  4K3I A;  1FCD C;  1OCD A;  1B7V A;  2N3B A;  3OCD A;  1SQB D;  3HQ7 A;  4KMG A;  4EIE A;  3CP5 A;  1NMI A;  2GB8 B;  1A8C A;  1MG2 D;  1C7M A;  1C6O A;  1LFM A;  2BGV X;  1CSU A;  2B11 B;  4PWA A;  3TYI A;  5KLV D;  2OZ1 B;  3SWS A;  1I8P A;  1FI9 A;  1NTK D;  1L9J C;  4V2K A;  1U75 B;  3TGU D;  1RAQ A;  5GTH V;  4DY9 A;  1CED A;  3RLM A;  2CXB A;  2YK3 A;  3A9F A;  1CO6 A;  2D0S A;  1EZV D;  1C6S A;  1L9B C;  1GQ1 A;  1KX7 A;  2CE0 A;  3RMZ A;  2CA3 B;  2YCC A;  1C75 A;  1J3S A;  2C2C A;  1W2L A;  1F1C A;  3M97 X;  2AI5 A;  3CX5 W;  3L4M A;  1JDL A;  5B66 V;  1NML A;  1NU1 D;  1YEB A;  2N18 C;  2QJP B;  2V08 A;  4EID A;  4AX3 A;  3NWV A;  1DII C;  3H1K D;  1M70 A;  2JQR A;  1E8E A;  3DMI A;  2N18 B;  4PJ0 V;  1HCM A;  5KAF V;  1NTZ D;  2A06 D;  2N9I A;  1KX2 A;  4WQB A;  3ZOX A;  3MK7 C;  2MTA C;  3A0B V;  1CCR A;  1N90 A;  1RZ5 A;  4WQA A;  1KYO D;  1H33 B;  2N3Y A;  3MK7 B;  5CIB B;  2DVH A;  4WQ8 A;  1FJ0 A;  2BCN B;  1CIF A;  2FYU D;  1I54 A;  1H32 A;  1I6E A;  5KKZ B;  1YCC A;  3JBT B;  1N15 A;  1WVE C;  1CTZ A;  2AXT V;  4FB1 A;  4N0K A;  4GED B;  4L3G A;  1KIB A;  2EXV A;  4XYD B;  4FA5 A;  1H31 B;  1HJ3 A;  3O0R C;  4IL6 V;  1YIC A;  1MZ4 A;  2CE1 A;  3PXW A;  1CYI A;  3ZCF A;  2GC7 D;  1P84 D;  1YIQ A;  2N9J A;  1OAE A;  1CXC A;  2LIR A;  5B5E V;  3H1L D;  1HH7 A;  5IY5 1;  1F1F A;  1CIE A;  1CTY A;  1DIQ C;  2GC4 D;  3WC8 A;  3HQ9 A;  2BCC D;  3OA8 B;  3CXH W;  3ZOY A;  1DVH A;  1H9Y A;  1E29 A;  2OZ1 A;  1YEA A;  1L0L D;  5DF5 A;  2BH4 X;  2C1V A;  4FAV A;  5C0Z A;  3A0H V;  1CRG A;  1KV9 A;  5CIC B;  2I8F A;  1DW0 A;  1SQX D;  1ZRT D;  1AYG A;  1YTC A;  3SLE A;  2YIU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...