3OAAD

Structure of the e.coli f1-atp synthase inhibited by subunit epsilon
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
458
structure length
458
Chain Sequence
TGKIVQVIGAVVDVEFPQDAVPRVYDALEVQNGNERLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGEATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for inhibition of bacterial ATP synthase by subunit epsilon of the rotor stalk
rcsb
source organism Escherichia coli dh1
molecule tags Hydrolase/transport protein
molecule keywords ATP synthase subunit alpha
total genus 127
structure length 458
sequence length 458
chains with identical sequence E, F, L, M, N, T, U, V, b, c, d
ec nomenclature ec 7.1.2.2: H(+)-transporting two-sector ATPase.
pdb deposition date 2010-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain
D PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1140.10 Mainly Alpha Orthogonal Bundle Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3 Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 3oaaD03
2.40.10.170 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3oaaD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oaaD02
4DSNA 5EP4A 2WJJA 3NH9A 1JR3D 1KI6B 2IXEA 2ZRNA 4QG7A 2QAGB 4HUQA 1Z0AA 4UNSA 2WPDD 1PLLA 1ZD9A 3W90A 5KDOA 5FTMA 3RC8A 4YMUA 1YQTA 4B35A 2J7KA 1QHYA 1R4AA 2OCAA 3SJZA 4AKEA 5AJXA 1L7VC 2CCJA 2VSXA 4TL6A 3MJRA 4I1SA 1W49A 3U7EB 2QRNA 4PPGA 5H70A 2OBNA 1Q21A 3L0PA 4DBLC 2CCGA 4EPTA 3GLGE 1XCGB 3C5HA 3VQTA 3MJHA 3B13B 5KOYA 1ODFA 5HZKA 2IYZA 2ZI7A 5AUNB 1OFTA 5JECA 2GILA 2BIFA 4L9WA 4LBYA 1XZPA 2RKOA 3LBIA 2CK3D 5H68A 2CDNA 2QPOA 2ORIA 3VX4A 3KXKA 2YINC 4CEIA 3ICEA 1AA9A 2ODWA 3A36A 3ZVRA 2IL1A 4YDHB 3OIVA 2D2EA 3KFXA 1Z29A 1YZLA 1Z0FA 2J1LA 1Z8FA 4JVSB 3QY0A 1W36C 2G83A 2QM7A 5CITA 2CBZA 2ZE7A 4TYWA 2WWHA 5JCPA 2WSSA 1P3JA 3KDSE 3U7FB 5FFMA 3VKGA 4JYBA 5JRJA 1DPFA 1BMFA 3TR0A 3PG5A 4AY2A 2HXYA 4UNPA 4WA7A 4QNRA 3QKTA 4OHWA 4C0BA 4QOSA 2OCPA 4OYHA 1EESA 1IONA 2C99A 4GBMA 3X2SA 3DM5A 2CEAA 3UWOA 2AXNA 2CHQA 2WOJA 1HYQA 3FWYA 2BMJA 1YU9A 2IYWA 2QAGA 1VCMA 2YJTD 3W9YA 5D3MB 3AKEA 2PCLA 3NH6A 1DTSA 3W5IA 1R7RA 2PT7A 1ZNXA 4KHZA 5FTJA 5DI3A 3UANA 4IDQA 2CNWD 3A4MA 2QGZA 3SEAA 3IIMA 3QF7A 4TYQA 1IY0A 1E96A 5SZHB 2P6NA 3T1TA 2N46A 1EFUA 1OXTA 1S1CA 4IDOA 4NYJR 4M2LA 2H18A 1NG9A 3D31A 4URVR 3QKSB 5A4JA 3AVPA 1XTSA 3KUCA 3P27A 3HU2A 1X1RA 3VHXA 1KO7A 2F43B 1DAEA 4W5HA 4MYHA 3WRXC 2EFCB 1JNYA 5FBQB 4GNKA 2NGRA 2F3RA 1M6NA 4ZCIA 4M22A 4R2HA 5FUYA 4DDWA 4IDPA 3RABA 1U99A 4LI0A 1L8QA 4B47A 3T5GA 4MGYR 1D9ZA 4QHSA 1HQCA 5IK2A 1E1RA 1KDTA 2I1VB 5FOXA 1H8HD 2GXSA 1W5SA 2D06A 2DCUA 4MRPA 3RWOA 4ESHA 5CYOA 3NC0C 5JBQA 3J81k 1XTKA 3OIWA 5GVSA 1V5WA 3TW8B 2JJ2D 1BH2A 2QEQA 3W34A 3IO3A 4BLTA 2IYVA 4FCWA 4HEJA 4DDVA 3KL4A 5BN3A 2V1XA 3CNOA 2YOFA 2NTYC 3CPJB 2KI5A 4M1WA 3RRMA 2QAGC 3AVWA 2EQBA 3GLFE 2GF0A 3MRSA 3MFYA 1NMYA 1KI3A 4G5SA 4A8JC 2QP3A 3A1UA 3MCAA 4U00A 4GOKA 4EAQA 2IA5A 3IO5A 3LLMA 2BMEA 2R6AA 4TMKA 5ANRB 4EDHA 1ZD1A 3VKWA 2O8BB 2ZEJA 4C0SA 1GNPA 3LQRA 5LB2A 2YC2C 3QOFA 4X8MA 2I1QA 1NY5A 4AYWA 1Z6YA 2DFLA 2JLYA 4DUGA 2QE7D 2JLQA 1XTJA 5CJPA 2NG1A 3SNHA 1QG4A 4B76A 4BFXA 1NSTA 4D82A 4HB0A 5JEDA 1GAJA 3UMRA 1IN8A 5DIFA 3PXGA 2GAAA 5KTYA 3SQXA 1IN4A 2ZQ5A 1G7TA 5J4HA 4RZ2A 5L3QA 1AGPA 1NJGA 3T12A 5TV2A 4F4CA 1CJVC 1OV4A 3GFTA 1YVDA 1GL6A 3KX2A 1OKKA 4LJ9A 3ND9A 1CU1A 1CJKC 2RGGA 3I8SA 5HE9A 4V0LA 3QG5A 4UXJA 4KVGA 1Z06A 2FPLA 4U02A 3CH5A 4B43A 2N1BA 2W2VA 5L3SB 4E22A 4JVMA 4HLQB 1BS1A 2AHOA 1BO6A 2VYFA 2V7QD 1X3SA 1IY1A 1T0JB 4JBWA 4D4KA 4DLTA 1DAGA 5G53C 2HYDA 3K0FA 2ZUBA 4QXAA 3TSZA 3IGFA 3BB4A 3T5DA 1KMHB 1VECA 2YWEA 2QMHA 4FI3C 1FMLA 1WP9A 1GRRA 2OLJA 4TMTA 4X8LA 1XXHA 2EFEB 1DAMA 3E2IA 4F38A 3PR1A 5KSYA 1T0HB 1A7JA 3RRYA 1S2MA 4XVQA 1DAHA 2OO7A 4HAZA 4B48A 2FA9A 2A30A 4Z1MA 1NIPA 4MGKR 4Q4LA 2DFNA 5EXSA 2YOGA 1G4AE 1LY1A 2ZYWX 2X19A 4XSGA 4TLBA 4YQFA 2G0TA 5EZ5A 3GLIE 3AVQA 2JDID 1RYFA 3RRZA 1NVXQ 5CK4A 3WYFA 4LRWA 1QVRA 5EE0A 4JLDA 2QE7A 4TMWA 2ATXA 3MWLA 4O2RA 1CR1A 2W2TA 1KI9A 2OE2A 4D0NA 5CJ2A 2REOA 2O5VA 2XZOA 3K70B 2IWRA 3FMFA 2ZRPA 3A8TA 3K1JA 2WJIA 3L8YA 1KDPA 3R20A 1SQ5A 4PFSA 1YZTA 4QC2A 3PV0A 4I4LA 1G3UA 2EW1A 4LWZA 3HU3A 1HT1E 5JRZA 2CCKA 4NH0A 3QPWA 4AWXA 2GTPA 3EZ2A 4B6EA 1HH4A 3L0OA 2WJGA 4G5RA 3Q5DA 3THWB 2JASA 4BFWA 3VTKA 1TADA 3LBHA 3DZ8A 5BN4A 5KDDA 1JXMA 4RKEA 1L4UA 4TT3A 2DY1A 2GJSA 2EWVA 1P4SA 5UKDA 2F1JA 4DHEA 4LBVA 1N5KA 3FPAA 3OE7D 1IHUA 5SZKB 4OI0A 2WICA 1JALA 2OG2A 3G5UA 1KMQA 1U90A 2GJ8A 1EGAA 3EC2A 1EFHA 4YC7A 3THXB 2YYZA 4XWAA 4GSYA 1FOEB 3CM0A 1E32A 1H65A 4PQRA 1E2QA 4M9QA 1D6JA 5F2EA 4EUNA 1QRAA 1XXHB 3KKQA 2XEXA 4WBSA 2GCPA 5KSPA 1F2TA 2J0UB 3B1WA 3BOSA 2HT6A 2IBMA 1S0UA 1AZTA 3OEEA 4LUCA 1NI3A 3LVRE 1ZINA 4KAXA 4IVQA 3X1DA 2WOOA 4QBFA 4AIIA 4HATA 1R0XA 3ZIAD 5K8IA 1N6NA 1YRAA 1HQYE 4Q02A 5FOWA 1VG9B 2QN6A 5AUPB 2YWGA 4NYIQ 4QM7A 1AZSC 2Z0MA 3EXAA 4MH0R 3QJYA 5E3HA 2O8EB 4M9ZA 4TSFA 1FP6A 2QRZA 4G01B 5JS7A 5B2ZA 1ZCAA 1I4LD 3AF2A 1AGRA 4BLQA 1TQ6A 1SXJE 4RJLA 4CEJA 5J47A 2IYLD 2AK3A 1YZGA 2G88A 2J9RA 3PUVA 4HAXA 4LYHA 3T34A 3NBFA 4WZBE 1TPZA 1IN7A 1T91A 2WV9A 4BFTA 2ODEA 4CT5A 4EPWA 4C2UA 1VKJA 3K09C 1OXSC 2D4HA 3AKDA 3WBKA 5EE1A 1CR0A 4Q7LA 2WZQA 5JJKA 2KE5A 4C0HA 2UVQA 1KI1A 2ZJ5A 3K0SA 1VYTA 3SOPA 2BKUA 1OB5A 4C7OB 4PZYA 2IS4A 8OHMA 2OSBA 4L9SA 4DC9A 2UKDA 5JZVA 1D2NA 2VHUA 1ZD8A 2ORVA 3OHMA 3CPHA 5EXPA 2HT1A 2N42A 1WF3A 3I4LA 5FL7D 2ZRMA 2TMKA 2VTKA 5AUQA 1XPRA 1Z2AA 2FZ4A 2A3RA 3THWA 4DLXA 4QM6A 1G8PA 2B6HA 1UPTA 3CLVA 4JSTA 3EASA 2G0NA 4TLAA 3BB1A 4LJAA 1XD8A 2DFKB 4RD0A 5TY0A 1XEFA 4MYTA 1TF5A 2V6IA 4URWR 1XRJA 4LYJA 1E2DA 4YXWD 1TF7A 5DSZA 2KSQA 4NCHA 4EPRA 1NVVQ 4GDFA 4WIAA 3F0TA 5DI9A 1G5PA 2QG6A 1M8PA 2ANBA 2QI9C 4DB2A 2V1UA 1A82A 2WSMA 3FKSD 1M7HA 3AH8A 4IKEA 3HDTA 4NYMR 1U2RA 3AP3A 4HDOB 3AV0B 4MRRA 1X1SA 1F6BA 3DPUA 4XOIA 3EPHA 4WZAE 2E87A 3B8HA 3E70C 3C15C 2FE4A 4B3BA 3OFNA 2YWHA 5FBRB 2JLRA 1WRBA 3R9WA 2QT0A 4URUR 3BH0A 4JLNA 2ZRHA 1NNEA 4HYYA 3B6EA 3FTQA 4H9GA 1VTKA 1E79A 1CLUA 1ESNA 5FTNA 4B33A 4MA4A 5TXGA 2CLSA 2R6GA 2DWQA 3ADDA 3BD9A 1EXMA 4DEYA 4IRUB 1S1MA 3FKQA 4Z8XA 2BCJQ 4WXRA 4TN1A 3GLIA 3CW2A 4JS0A 2DPXA 1GFIA 2ZE8A 2J7PA 2B7BA 3NBZC 5GJBA 1CR4A 4JLOA 5JLJA 1XX6A 3THYB 1FX0B 3LLUA 2A7QA 1QHNA 1OKKD 3U3MA 2ECKA 3VAAA 2CL6X 4LHXA 4BE7B 5EXXA 1FPMA 1VCNA 4IDNA 2HV8A 4HZIA 1IN6A 4Q1CA 1U81A 4HZUB 4HDCA 4MUBA 3AF1A 2P5TB 5BW8A 4LPKA 5L3QB 1QHSA 3CRW1 1XPUA 4Q1EA 2BMFA 2RGCA 1Z2CA 1SXJA 3P26A 2QENA 3K8YA 4ZO4A 1JXOA 5FR2A 1W5TA 2QSYA 1E2IA 4JL6A 4PC7A 4Q03A 1JEDA 4A4DA 3Q5EA 5KHOC 4XSHA 4RKFA 1LS1A 4X8OA 2F9MA 4OQLA 5EP1A 4AG5A 1E2LA 3I8XA 4I1VA 1WBBA 1P72A 2GXUA 3I72A 3KKOA 3FVQA 3NKVA 1DEKA 2CJWB 2FSHA 2JDIA 3CR8A 3EIQA 1UBCA 1F2UB 1F60A 1KJYA 3EA5A 5DYIA 4FWTA 4KCGA 2ZSAA 1DVRA 3A58B 1HV8A 3K0AA 2FGKA 1DAFA 4DXAA 3ZQJA 3B1ZA 3TSWA 2J0SA 2JGNA 4ZKDA 2AFIE 4BFSA 1NBME 2VH5R 3VKHA 3T35A 1BIFA 1SGWA 1KIMA 1HT2E 4D80A 1J8MF 4QRHA 1SKYE 2PMKA 2QA5A 5F98A 2J41A 3QQ5A 1MT0A 2OLKA 2CMKA 1AS2A 2ZU0C 3GCGA 3GJ6A 3SC3A 2BCGY 5IHPA 2ZAMA 2PZGA 4LSGA 5FUWA 1EWQA 2ZE6A 5AJYA 3X1WA 1NN5A 1Z0DA 5TDHA 1FTSA 5C2JB 2VSOA 3O8BA 5E4FA 5GJWC 2GCNA 3NG1A 3BBPA 3RSLA 4F4JA 2XJ4A 5KNDA 4P4TA 1OYYA 5JSZB 2DHRA 4XTCS 4ZIRB 2WM9B 1MH1A 3T06B 5BN5A 1RRFA 4OI4A 3CZPA 3Q9LA 4IEEA 4TTQA 2E9SA 4DEXA 4RZXA 5DNYB 1KKMA 4B44A 3AKYA 2FEOA 4KFSA 3T1VA 3VR4A 4O25A 1EFRD 2OUKA 4MRNA 3FHTA 1X8JA 1MABA 1MO3A 2IF0A 5C46F 3ADBA 2R6FA 3TR5A 2IS1A 3EZFA 2WMNB 4E09A 3KQLA 3U4QA 1E2FA 4LJ7A 5G40A 1J70A 2ZRBA 1KK1A 1NLZA 2BEJA 2WKRA 1Q44A 1QG2A 1Z6GA 2J59A 4DUGD 221PA 3QIAA 3W3AA 1KNQA 1ZUNB 1KOFA 2XXAB 2GCOB 1OFUX 5BYJA 1SVLA 3UK6A 3LXXA 2DBYA 2GRJA 2ZAOA 3AGPA 4GZLA 3BB3A 5B30A 4UNNA 4M1OA 5D3MA 3HU1A 3WNCA 2FWRA 4Z8YA 4C30A 4AKIA 1L2TA 1RVDA 3TAUA 4ZDJA 4D4JA 4EKDA 1GITA 2X2EA 2C03A 4RFSA 4CF7A 1OXXK 2R6DA 4Q9HA 3B9PA 3F8TA 2C9OA 4C0KA 4BFYA 1VG0B 2FF7A 3TVTA 4US1R 4MKGA 5AK0A 4P32A 4UJ3A 2Q3MA 2BMDA 4RZUA 3TVDA 3TK1A 1G3QA 4Q4AA 2ZRGA 3CRQA 3FOZA 2OHFA 4GP7A 1MRNA 3B85A 1IXZA 5DN6D 2QSZA 1GDDA 2FPMA 4P4UA 1U9IA 1OHHD 2ZPTX 4P31A 2NZ8A 5FBWB 5HE8A 1ZNYA 4R7ZA 5FOUA 1A4RA 5FOSA 3JZAA 4TL7A 3NEJA 1VCOA 3ZDQA 3IIJA 2ZS9A 3BJIC 3K53A 1NRJB 1N25A 2IX3A 1WQ1R 1Z28A 2JLWA 2IHBA 4Q1AA 1GOTA 1R0ZA 2ZITA 3QENA 2EYUA 3TQCA 1A2BA 1ZIPA 4KFUA 1X6VA 2NZJA 1NP6A 1Z0JA 1ZJ6A 1ZM3A 2GDJA 2IW3A 2REXB 3RVBA 3F3YA 3PEYA 4KLZA 1IJFA 3IHWA 3CKLA 4KJZA 3AVXA 3SN6A 3O47A 1E94E 4PZLA 1NBMA 3CZQA 1RYHA 2VHCA 2O0HA 3K9GA 5FPYA 4BUJA 2OBMA 1ZMXA 4BPBA 2CHGA 2ZSFA 3RANA 4TZ0A 3DM9B 2A5YB 2VHTA 4EQ6A 1ZNWA 1W7AA 1EK0A 3U3KA 3W6NA 2ZRAA 3RS5A 2VRWA 621PA 2WKPA 4QFMA 4HAUA 1N2CE 4Q4JA 3ZQ6A 2IS6A 2NQ2C 2HF8A 3PEUA 5A5GA 3FGNA 1FX0A 4IOJA 1VYUA 1M2OB 2O0JA 2O8DA 5DISB 3SHWA 2JJ1A 3K0CA 1XZQA 4ZV4A 1SHKA 1DO2A 1Q3TA 4D2IA 5C4GB 2OXCA 4HZUA 1LTQA 2C2HA 3FMIA 4QL3A 4JVNA 3TLXA 1ZC3A 3EAQA 1YR6A 4JYCA 4A82A 4MRVA 2ATVA 4KSCA 2VF8A 1S4QA 3RS0A 4KLNA 1NSFA 3SHFA 3VX3A 4JT4A 3D3QA 1R2QA 2DWPA 5EZ6B 4C0JA 2ZI5A 1WE2A 3WYGA 3R8FA 2W0SA 4AD8A 3SFZA 2PCJA 4S35A 4KVAA 1XB2A 4M0LA 2KWIA 3QI2A 3OEED 4KV9A 3BORA 2P0EA 1DADA 4NPHA 1E98A 3K0CC 1ZNZA 2ERYA 1XEXB 4M9SA 3CWQA 3KQHA 1XFAA 1T3HA 2IXFA 1OH5A 2F55A 2D62A 1QZXA 1F3OA 1UKZA 2R2AA 2B8WA 4IHQA 4KODA 4PO8A 3VU9B 4DDTA 5B64A 4B3XA 1S96A 2CL7X 4JLAA 3TUJC 3OIYA 1R0YA 2CE7A 2JJ1D 2GETA 1NLYA 1PLKA 2H16A 4M21A 4WZ6A 1GTVA 2GKSA 2PBRA 2PZFA 1RZ3A 1Q1BA 1W46A 3B1YA 5L3VA 3BFKA 4RD4A 3I1FA 3KJGA 3C14C 3GEIA 4POAA 3DEFA 2BBTA 5CM9C 4LV8B 2OFXA 3A6PC 4HAVA 4DCTA 4CT4B 4CEIB 1G41A 4US0R 2UZIR 1VPLA 3B78A 4Q4HA 4C7OA 2I3BA 2RHMA 2PZEA 4OK6A 1OSNA 2VEDA 3OIUA 1Q0UA 4KBGA 1H8ED 3CONA 3W8RA 2F7SA 1JEEA 1O87A 3HPQA 1II8B 5KNBA 2CLCX 4Q4AB 4XIGS 1W0KD 1U8YA 1DG1G 3K9LA 3KJIA 4DZZA 1XCPA 1AKYA 1LFDB 1E99A 1E9SA 1XTQA 3BXZA 4KXFB 3R9IA 1FQKA 1M7BA 4LHWA 4JLJA 4OHVA 1IXRC 1MABB 2BOVA 4FW9A 4CZ2A 3BC1A 5L8VA 2HXSA 2O8EA 4Q9JA 1N5LA 2XNSA 4ASUA 2QQ0A 1UBFA 1W4RA 3CX7A 3KJEA 2QBYB 2FV8A 1R5BA 3GJ5A 4K81B 2QPAA 2Q9BA 2ZU6A 1G7RA 5CLLA 5TB5A 1ZBDA 3KB2A 1AS0A 1KSFX 1IQPA 3PUXA 4MGIR 3TQFA 5FPSA 2MMGA 1TL7C 4OQXA 2Z6VA 1JAHA 2QTHA 1II8A 1TU4A 2QTFA 2REBA 4HDQB 3DL0A 1ZM2A 2C5LA 1V43A 2YHSA 4AK9A 3NVAA 2ZJBA 3GLHA 4TLEA 1WB9A 3C41J 4V0ME 1RE0A 1SVIA 1S9DA 1CBUA 4V0NA 1KY3A 5FI1B 3RNLA 5HKKD 1W0JA 1US8B 1Y63A 3NHAA 1AS3A 3U6BA 4BASA 2FU5C 3X1XA 1E79D 4TMZA 1EX7A 4ZIRA 4G5OA 2Q21A 4NL4H 1KNXA 2IC5A 4W5WA 1COWA 1E2MA 1F2TB 2J0UA 1HUQA 2AX4A 4BLPA 1ZC4A 3EWSA 3A1VA 4JLKA 1KHTA 2A78A 2VP6A 1U94A 1TUIA 4B3GA 3ONWA 2BM1A 3C8UA 4DVGA 1YHNA 2QPTA 2JIZA 2GEVA 2GESA 4Q47A 5FL3A 4L4UA 1WBDA 4NE2A 3PFIA 2CJWA 4CW7A 1R8QA 2BBSA 1UF9A 1UKEA 4PC2A 4OJQA 2WAXA 3A1WA 2ZYTX 4HLCA 3P20A 1XEWY 1E2HA 2ZR9A 4DLYA 1P60A 1FZQA 3AVUA 1UDWA 3TW4A 3NXSA 1I2MA 4JL5A 3UIEA 1T8UA 3SYKA 2XNDA 1E1QD 2GEDA 2IYYA 3L43A 3ZZ0A 3ADCA 2FGJA 5FOVA 4A6XA 2BEKA 4RSGA 5EQTA 2R62A 4Q5IA 2RGDA 3ZZTA 4B3CA 1SVKA 2XZLA 4RD3A 2YOHA 3NDPA 1Q12A 3IQWA 3V9PA 5FR1A 3W3ZB 3GP8A 3F5FA 3A4LA 3REFA 2RHDA 2IYTA 1U0LA 2OZEA 2ZVPX 3QE0A 4Y0VA 1OIWA 2GXAA 1CIPA 1P6XA 2J0VA 3AGQA 3B7GA 4IVPA 3SDZA 3Q8XB 2GBLC 1ZW6A 4B2PA 1PLJA 1A2KC 2VHQA 2LWIA 2WMOB 2JATA 1IXSB 3B82A 3NBYC 2OAQ1 3THYA 1JR3A 5EXTA 1SXJD 1YKSA 4DIDA 3GLIB 3H2YA 5GJVC 3WRYC 1JQLB 3CF0A 3MWKA 2XJ9A 4IFBA 3L2OB 2QU8A 3SYNA 3DDCA 2GNOA 1G3IA 2J46A 2GWHA 3QKSA 4Q7MB 5JHGB 5JS8A 1KYIA 4OQFA 2VIIA 1QHHA 3BK7A 2MSEB 3KUDA 3HWSA 1P9WA 4JLVA 4EFNA 4NCJA 4LCBA 1GM5A 2EWWA 3EC1A 3NIBA 3OEHA 4L15A 3K0EA 5E7IA 1FNNA 4LJ4A 1E2JA 1SKQA 1IOZA 1Q1EA 2RGNC 4MKHA 5C1BA 2P67A 3T1QA 4NTZA 4BQSA 3P1JA 4PAOA 1KAGA 3T61A 2CNWA 2PLFA 4LJ5A 1KKLA 3VR3A 2FX3A 3BE4A 4PTLA 3U3JA 4BEBA 1LV7A 3PIRA 3GPLA 5H8WA 1W2HA 3FFAA 2IWHA 2WTUA 4LBWA 2Z4SA 3M4YA 4TQAA 1AQUA 1J7KA 2HLDA 1SKYB 3CNNA 3CRMA 3MLEA 2GK6A 3QF4A 4BRUA 4BZQA 3QG1A 2IYUA 1W36D 4BZPA 1IM2A 3OEHD 2L0XA 4XWKA 1OJLA 5KNCA 1D2MA 5IRCD 4LV6A 1EG7A 1KJWA 4YLGA 1OT3A 1AQYA 4LDJA 2IT1A 1G20E 1U0HC 3QEJA 4LY6A 2Q9AA 1XD9A 2QMEA 3FKSA 4A2WA 4AI6A 2FFBA 2XX3A 2XOKA 2VP0A 2AWOA 1R6BX 4LYAA 2D7CA 2R8RA 4D81A 5JCZA 3KFVA 2B8TA 2ZSEA 4FCVA 4Q7KA 3O8CA 4MKIA 3RHFA 2PLRA 2W83A 4K8OA 1DARA 4DB4A 1MRSA 3PUZA 4UNRA 3H86A 5KUTA 5ELXA 3LY5A 4KFRA 2GEUA 2OM2A 2NO1A 4UNQA 1QBKC 1P9NA 2QMOA 3QPVA 5AJVB 5F3WB 1N6OA 1E9EA 3U7HB 1X8KA 1XJ0A 4FIDA 2C95A 2P2LA 3L0IB 4EPXA 1CEEA 4UQOA 1H8EA 2EYQA 4D4MA 3IQXA 3VMFA 1N6KA 2QROA 3R7WB 2PX3A 1SVWA 1NVVR 3LNCA 3OESA 2NMVA 4B34A 1E0JA 4QJ5A 1RFLA 3IEUA 4UXHA 4R71A 2J5XA 3ZS8A 2A9KA 2Z5FA 6Q21A 1D8TA 1FP7A 5EUMA 4EPVA 4F7WA 3W6PA 4HUQB 1W48A 3VNVA 2IEYA 3B2EA 1ZRHA 4HB4A 1TF2A 2IYQA 3G82C 3LBNA 4ZPXA 5FUVA 1XJQA 5HPYB 3BFXA 2X77A 4I81A 1W0KA 4OBEA 2WPDA 4A9AA 4TYYA 4M9XA 3LX8A 5SZJA 4NCNA 2HDNB 5G3ZA 4EJSB 4LHVA 3T1OA 3Q85A 4LJ6A 5DI3B 2D3WA 4D6PA 1KI7A 3SE0A 3K09A 1XMJA 3K0AB 3SS8A 2YNMA 4I1UA 4Q9KA 3ZVLA 3AB3A 4TSFD 4MUAA 1FNMA 3RWMB 4ITRC 3GLGB 4O3MA 2O8CB 2VBCA 5G41A 3U5ZB 2BKEA 4P4SB 2NO7A 1M7GA 4WOPA 1AJEA 4CRWB 1GP2A 2ZTSA 2XNDD 1DAKA 2P3SA 2QT1A 4I99A 3NDBB 4OHZA 4K46A 3D6TB 2PEZA 1OFHA 1IAQA 2O52A 3N2IA 3ETLA 5DO9A 4HB2A 2KBFA 3LD9A 1OPXA 2AKAB 4MKFA 4US2R 3QXSA 1XMSA 3TAHA 2NOAA 3VHLB 1E0AA 1P9RA 3AUYA 3L82B 1CP2A 5HZHA 1UJ2A 3GLFB 3THXA 4YMVA 5LD2C 3LA6A 4M1MA 2ERXA 2X1VA 4B73A 3KQNA 2FH5B 4XVRA 3VR1A 2F9LA 1RJ9A 4GMDA 4N1AA 4ACAA 1D9XA 1E9RA 4QBIA 4PQYA 1GVNB 4Z1MD 3VR2A 1KZ7B 3H84A 4A36A 2FFQA 1KTVA 1XBTA 4DLUA 3PUYA 4PHFA 4QGGA 1U98A 4A2QA 3EWAA 2ZROA 3TH5A 1COWD 2WWGA 5CB8A 1VDZA 1N0UA 1ZP6A 2WJHA 3GLHB 3THOA 4PSKA 5TARA 1P2UA 2ONKA 4X8HA 3RRNA 1E9BA 1NMZA 3A1SA 3SU8A 2OCBA 5JI3E 2RMKA 2WSSD 4Y0AA 2GJ9A 1EX6A 2IYSA 4EJSA 5C4MA 2ZRDA 3AF3A 2XITA 1GKYA 1XD2B 2ZI9A 4IEIA 3ZS9A 3LAWA 3Q72A 3D8BA 4IFEA 4ARZA 4AKHA 1DBSA 1G3MA 2RH5A 3NWJA 1N6RA 1OFIA 2OEPA 1W44A 1E4VA 2IF2A 2WIAA 2ZRLA 2AL7A 4FMCF 1ZUHA 4MDEA 2G77B 2XTNA 3ZZUA 3FB4A 2VA8A 3WP1B 4NU0A 3CUEF 2WKQA 4NDZA 4U7DA 1KO1A 2NO9A 3B60A 3QSYA 1Z63A 1NKSA 2DB3A 1E9AA 3P4YA 1WCV1 4Z54A 4RCYA 2AD1A 5CDFE 3UXMA 4Q9IA 2ZR0A 4YXWA 4RFVA 3R8CA 2IUUA 3BS4A 5FBLB 1FTNA 2RGEA 3GMTA 3N70A 1DOAA 4QGAA 3KKNA 4IXNA 4BRWA 3U44A 421PA 4B32A 2P6RA 1FFHA 4GT1A 4JKYA 1JR6A 3I62A 4A8JA 1Z0KA 3KXLA 2ONJA 1CTQA 5E7MA 4DLSA 1WDTA 4EJSC 1FQJA 2W0MA 4DLWA 4XVUA 3K70D 1E2KA 2PL3A 4DSTA 4E07A 4TT3D 3R7WA 2ZREA 4F93B 4U5XA 5DHAA 4EFMA 1NMXA 4OQNA 2ZRJA 2OCYC 4XJXA 2BV3A 4MRSA 2ZR7A 2CE2X 3BAFA 4JSYA 1Z5ZA 1CXZA 1I2DA 3IBYA 1G3RA 1GWNA 1LW7A 2W2XA 3A1TA 4L8GA 4LJ8A 4KI0A 1KZGB 3S1AB 3EPKA 1NN0A 2GXQA 4EPYA 2Z4RA 3HR8A 2R44A 5CLQA 1K6MA 1MO5A 4BLOA 1XDBA 4D26A 3MG9A 4AC9A 3EARA 2XTMA 2VL7A 5DN6A 1OH7A 3N2EA 3DMNA 2ZYUX 3CNLA 1DG3A 2P65A 3M0EA 2X8AA 1N0VC 2YVUA 4CIDA 3PVSA 2MMCA 4NYMQ 1IBRA 4WXPA 1G9XA 1QHXA 2ODBA 1EFCA 3KQUA 3EZ7A 3TSOA 3BFVA 3Q7QA 4PO9A 4F91B 3TIFA 1ESMA 3LFUA 1SXJB 1TEXA 4JT2A 4PXAA 4QHYA 3TGPA 3RSOA 2V3CC 2H92A 4PSAA 1E2EA 3RS7A 5KYKA 3WMGA 2Q3HA 4RZ3A 2W6ID 1YRBA 2BHRA 3ICQB 2H7VA 1G1MA 3H4MA 2JLXA 5KDLA 1XU4A 4GFDA 1HA3A 3W6OA 2G9NA 1DO0A 1KK0A 3OZXA 3U44B 1I4DD 3PEVA 1NN1A 3DO6A 2XAUA 2H5EA 3SFVA 3AP1A 5DYGA 3M6AA 5F9HA 4GZMA 2G1JA 3TJZA 4EFLA 1GRNA 1RPZA 2ZRKA 2OFWA 1LF5A 3PITA 4ZDIA 4LHYA 2XXAA 1OH8A 3IDQA 4C4PA 1KO4A 2ZI3A 4JBXA 1OW3B 4OHYA 2GZAA 4ZI3A 1XJCA 4OJKA 1U8AA 4OI2A 1NBMD 2VO1A 1ZM4A 2QL6A 1L4YA 2RCNA 5CK5A 3OFND 4V03A 2ZM5A 4IXMA 4M8NE 4ACBA 2ZXUA 4ZDKA 1T9HA 5CM8B 5HCIA 1BMFD 1GUAA 2A5GA 4LYFA 4D4LA 1YJ5A 4C3ZA 1C1YA 3ZVMA 5FBVB 3L0SA 4NYIR 4DKXA 4DLZA 2DYKA 3UPUA 1P2VA 3AVVA 1CKEA 5E7JA 4TTPA 3VR6A 3LVQE 4QBHA 2JJ2A 1ZM9A 1UAAA 3KZ1E 3GJ8A 2OFOA 4A92A 2IK8A 4FMCB 3ASZA 1WA5A 4GRAA 3IUYA 3GJ4A 4DRZA 1E1RD 2Y8EA 5GJCA 2HF9A 2YZ2A 4LC0A 1Z22A 3C7KA 2RB4A 1OIVA 3RS3A 1HY3A 4WVFA 2C9CA 4PZZA 1KDOA 2ZVQX 1RKBA 3OAAA 1FL9A 3DOEA 2QAJA 3DOFA 3QUSA 4URYR 1J99A 1ZU4A 4QJ3A 1UEJA 1W2GA 4FXPA 2KB0A 4FCTA 4MGZR 4AYTA 3EIHA 2GF9A 4C2TA 1JPNA 3GFPA 3AVOA 1UBEA 4H1VA 4BFVA 4II7A 1C4OA 3EA0A 4XH9B 4BGDA 2F6RA 4N0DA 3CBQA 4NYJQ 4Q21A 2P5SA 4PPFA 1SVOA 4DCNA 4PR0A 3GJ3A 5IK2D 2EVWX 1BOFA 2BM0A 2KJQA 3BERA 4KYUA 4P4SA 1HEIA 4RD6A 5K8UA 4Q1DA 3UG6A 3CR7A 2FSIA 2WIBA 4R98A 3TMKA 2RGNA 4A2PA 4LOAA 1C9KA 2AN9A 4YDSA 5EE3A 3VFDA 2W6JA 4PAMA 5FI0B 1Q1ZA 4C0QC 3U61B 2WJYA 2HJGA 4XD7A 2GCOA 1KO8A 1MOZA 4LV5B 4RVCA 4W9MC 2KBEA 2HCBA 4PHHA 4ZI2A 5EUQB 5P21A 3BIFA 2NO6A 1UDXA 1T6NA 3WNDA 4KYIB 1G8GA 4IOKA 4DCVA 2ZIAA 5K8LA 1TX4B 3GEEA 1W36B 4IW3B 1G16A 4LK2A 2XOKD 1GIAA 2BVNA 2K5UA 4B2LA 4C9BA 1KK2A 2OT3B 5JEEA 2WHXA 5EP2A 2Q6TA 3LV8A 2GBLA 3HJNA 3NHBA 3SI7A 2V54A 4DDUA 1TAGA 1P75A 3ZVNA 3PUWA 3E5HA 4V0KA 4B6FA 4TL8A 4A0HA 1G6OA 2ZSBA 1LVGA 1SVSA 3ND8A 1G8FA 2FN4A 3RS4A 5KO2A 3AVYA 2YC4C 4Q48A 3GJ0A 3CF2A 2Q9CA 3H0KA 3JVUA 3RS2A 4E5UA 2BC9A 4Q7JB 4FD2A 2EFHB 2BBWA 3RDPA 3I73A 1RIFA 2FSGA 4IDHA 4CVNA 5SZIA 2DR3A 1VCIA 1XF9A 2BWJA 2WVJA 2HEIA 2GZDA 3AEZA 4OK3A 2JEOA 3AP2A 3RYTC 1XWIA 2V4ZA 2PJRA 3TRFA 1ONBA 3NBXX 4JLPA 2QM8A 2OBLA 4Z51A 1HE1C 2HCJB 1GSIA 2V9PA 5H1YA 2OXRA 2LKCA 2HYIC 1B23P 1Q57A 2DWOA 2JAQA 1E1QA 4ABYA 2FMXA 5AJZA 1N6IA 1T8TA 4Q4HB 4FMDB 5IF9A 4ON9A 4OQMA 3QF4B 4TQ9A 3CWZA 1OB2A 1KSJA 4JLBA 4NONA 4NCKA 3SBEA 4Q1FA 5KSZA 5DHFA 3W5JA 1XEXA 4JBYA 1GZSA 1KDRA 2JJ8A 5JWHA 1CJUC 1DELA 1E0SA 4QJ4A 1J2JA 1NIJA 1OHHA 4RD2A 2ZI4A 4WW0A 3GJ7A 5F9FA 1KSGA 2GA8A 4DLRA 1N6PA 4DT1B 5FPTA 1N6LA 3KXIA 1T5IA 4BLRA 1UM8A 2VHJA 1HTWA 2FEMA 1UFQA 2ZS7A 3LW7A 3W8NA 3SBDA 2PJZA 2AR7A 1KI2A 1W1WA 1OXUA 4G3XA 3S1AA 3LWNA 4IJMA 4A1FA 1VYVA 2O8FA 3U7GA 4BECA 5TMPA 1AKEA 1Z83A 2J3EA 1XPOA 3EG5A 1I4TD 4PSVA 3GFOA 3RC3A 4JL8A 1MO4A 3K0FB 3SQWA 2C04A 1E6CA 3CRRA 2AWNA 2D2FA 1OXVA 4PC1A 1M74A 4FWIB 4R2IA 5CYPA 5AWFC 2XTZA 1N5JA 4TLCA 2QGNA 2EFGA 2OAP1 4OHXA 3PENA 2G1KA 4A8JB 1S3GA 3C4JA 3HP1A 2H57A 2D74A 1VG8A 2AK2A 1E2NA 4B3DA 3LO5A 5L3RA 1E3MA 4M1YA 5JJIA 4YONB 4ZDWA 1Z0IA 1FMJA 3VNUA 1UKVY 1II0A 3OAAD 1TEVA 1HURA 3UG7A 1R10A 1TTTA 1DAIA 1E0KA 3B1XA 1XMIA 4A0RA 1KI4A 3ZIAA 3I61A 1P62B 1GL7A 4ZCMA 2F43A 3BH6A 2IUSA 4LHZA 2A5JA 2CK3A 2MSCB 5DH9A 1A1VA 2V6JA 1NN3A 1RW4A 4KSBA 1RRGA 3CB4A 3GD7A 4TLDA 3TE6A 3HR7A 3SR0A 4DSUA 2VP2A 1D2EA 4B71A 1W0JD 5HKKA 4BWYA 1XD2A 1ZVQA 2PEYA 1CS4C 2GVDC 1P2SA 3IHLA 3I32A 2AFHE 3UMFA 3WMFA 3SJBA 4V02A 4DWJA 1Z6TA 4PAQA 3EX7C 5GVRA 1DS6A 1F2UA 1ZUIA 3VR5A 4PC6A 1SULA 3ADKA 1O3YA 4Q18A 5C18A 2ZJOA 2LCFA 4E03A 2VLIA 2NO0A 2ZJYA 4DCSA 5CIWA 3EZ6A 2I4IA 3WHLA 1PVOA 5HCNA 5EP3A 1SHZA 3CH4B 3K9NA 5LB4A 5FL7A 3WY9A 2GHIA 4TTRA 5CIQA 5K8TA 1JPJA 4GI7A 3ECCA 1RJ9B 4RFSB 1US8A 2NIPA 2QBYA 1Q1QA 3U60B 2V8OA 1PZNA 1NJFA 4JLMA 5BYKA 2J87A 3UATA 3CO5A 3QXXA 5JFGA 4TYNA 2PX0A 2JIZD 3DKPA 4UXIA 2EU8A 3CF6R 1TUEA 1Z6XA 3I3SR 3AQ4A 4RY2A 1OF1A 1JJ7A 2XSZD 3LH5A 3KKMA 3QBTA 1S3SA 3NEYA 2CVHA 1MV5A 2E1RA 2B21A 4P33A 2FFHA 3WBJA 1LNZA 1XP8A 2BJWA 1E69A 1KI6A 1OLOA 4HAWA 3EW9A 3WHKA 3WMEA 2FOLA 2PMDA 1Q20A 3IBGA 2F1HA 2XGJA 3KB1A 2DFTA 2RGAA 5FH9A 1IY2A 521PA 1P61B 5FPHA 121PA 1OYWA 4NBSA 1KMHA 1JECA 4XTRA 821PA 1MO6A 1SXJC 3IPYA 1RC8A 1JQJC 1XCMA 1PV4A 3DHWC 4S2EA 3JZMA 4W5JA 1GKIA 3Q3JB 5J5CA 3V00A 3V4RA 2VPPA 4TQUS 4AYXA 1CULC 1G19A 2QP4A 2VQSA 1E9CA 4FINA 4NZYA 4A15A 4BFUA 4PQFA 1MKYA 1J8YF 2B7CA 1U8ZA 3P4XA 3QEOA 4PHTA 1R8SA 4CDGA 2A2ZA 5JWRA 3QBVA 3REGA 1YZQA 4JKIA 2F1RA 3K9HA 1Z3IX 1X8LA 2NPFA 3UKDA 2O8BA 3KTAB 1KJZA 3FHCB 2ZYVX 4URZR 5G3YA 2ZANA 4ESVA 5EE9A 2HUPA 2ZE5A 1AM4D 4QGHA 1XXHE 2OESA 2Q3FA 4OK5A 1FW6A 2BBOA 4KU4A 3MWYW 4JVLA 5HR5A 3FMPB 4HI0E 4G5GA 2JLZA 5JMTA 1EFTA 1GILA 3TKLA 2WWIA 4N0EA 1Z08A 2WJVA 2J0QA 4ASUD 1G18A 1U9IC 4HSEA 4B2IA 4LJYA 1XTIA 4CEHB 3HYTA 3WXMA 1G4UR 4PPQA 3U3OA 5LD2B 4WAUA 3OE7A 3UMSA 2NPIA 4DSOA 1B0UA 4CYMA 1NLFA 3C5CA 3TUIC 5A0FA 4KITB 1YZUA 4TL9A 3CRVA 1YR8A 2D7DA 3SYLA 1GRQA 5JJLA 3ZD6A 3TNFA 2R9VA 1TQ2A 1XNJA 4EIWA 1J90A 2PH1A 2QQEA 5DLQC 2W00A 4AG6A 3SZRA 2YWFA 1LF0A 2C98A 4D0LB 1PUJA 1Z47A 4QGFA 4OI1A 1XTRA 4PC3A 4EQ6B 2F1IA 1W4BA 1XMVA 3HPRA 4QBGB 4NKRA 5J4YA 1NG1A 2BDTA 4P3YA 4CGZA 5J4LA 4LPSA 2WWWA 3UWKA 1GG2A 2OILA 4OKSA 3PJRA 1R0WA 5IT5A 3G0HA 2LKDA 2ZUCA 4Q4JB 4R9UC 1E2GA 1ANKA 2ZETA 3AM1A 2ANCA 1G291 3MUFA 3ZJYA 1PJRA 1SVMA 3K70C 3FFBA 3LRPA 3ZLJA 4PANA 4ARZB 1UKYA 5GADl 3QXCA 3RAPR 1LS6A 3ZH9B 5LPNA 1QHIA 1ZCBA 2O8DB 3NTUA 2JLSA 3MMPA 4LGMA 1AK2A 1CR2A 2VP5A 1DE0A 2EFDB 3A37A 3M1IA 4QKQA 1IJEA 2ZRFA 3BGWA 5L3SA 2H1LA 2W6IA 1XEWX 3MD0A 4HLUC 4NHOA 1T3SA 2H17A 3GLFA 2C8VA 3BH7A 4DIEA 1TU3A 4RD1A 5B58C 2WWYA 1YE8A 4NMMA 1G17A 1K8RA 1ZIOA 4D0GA 2IS2A 1BYIA 2GAOA 2Q0HA 2ZJAA 4IVRA 1G64A 1TNDA 4C0LA 4TWZA 1JR3E 3HYRA 2G6BA 3ZGXA 5JHHB 1T4GA 3Q7PA 4F4IA 5DGXA 3U3RA 3EPLA 4F92B 3MSXA 4JMPA 1N5IA 5E95A 1SZPA 1U0JA 3CX6A 2P6UA 2FZLA 5EE5B 1CJTC 4PO1A 1IN5A 1WMSA 3PQCA 4IOMA 2FPKA 5CB6A 2RGBA 5J40A 5TVKA 1CRPA 2ASEA 3QXHA 2F3TA 1EWRA 2JA1A 3IEVA 1E4YA 3B5JA 1G5RA 1OE0A 4URXR 4CEHA 5FUXA 2AXPA 4O2LA 4HB3A 3TUZC 4L5BA 4N3NA 4AKGA 4M1SA 3N99A 3H1TA 2CL0X 2O8CA 4TMXA 2XZPA 3DVLA 3T15A 2IEZA 1ZM7A 1VHLA 3O8RA 2QTVB 4ZKEA 1G21E 1VIAA 3SJCA 1CRQA 4LC1A 2XSZA 2W58A 2HJVA 3BRWD 4IOLA 1E9DA 4GP6A 4NCIA 1WXQA 1KI8A 1JI0A 1OIXA 5JSZA 4NP6A 2RGXA 1W4AA 3EIEA 2JLUA 1OH6A 2ORWA 4BLSA 2ZS8A 4L16A 2G3YA 4PX9A 4YMWA 5FTKA 4HLUA 3AVTA 1T3LA 5J4KA 1N0WA 1D5CA 2BJVA 1CF4A 4Q1BA 4G1UC 4MYUA 5DE3A 3WNBA 1X86B 3QXJA 2ZUDA 3QKRB 4KBFA 2WAYA 4GOJA 4D25A 1E9FA 1II9A 2GJKA 2C9YA 2WWXA 2X2FA 4A0FA 4C0AC 1ZAKA 1TQ4A 4MYCA 5HTKA 2QNRA 1G5TA 4DLVA 3KJHA 3WP0A 3I92A 2O0KA 2J7PD 1FUUA 1BYUA 3U4QB 4PPNA 1RRPA 1M34E 3D7MA 3WYAA 3LXRA 2QY9A 4XWOA 3FE2A 5JWOA 1G7SA 2Z43A 4JZKA 1TQDA 1YZNA 2R6CA 4FMDF 3IPXA 4M4SA 1A5TA 3ZYCA 3AKCA 5FTLA 2FJUA 2FSFA 2ZI6A 4TZ6A 5BQ5A 5KU1A 2ZRCA 4LBZA 5LBIA 1G8HA 5AUOB 4HLDA 1P73A 2C96A 5KSOA 4W7SA 3X1YA 4BEJA 4YMTA 2XB4A 3QKUA 1QDEA 4FN5A 4KO8A 1KK3A 4Q9LA 4MITA 4XD7D 2UZ3A 2V55B 3LX5A 1KSHA 5LDDC 2VSFA 3VU9A 2AD5A 2VF7A 4LX0A 4ZCLA 1R5OA 1LB1B 1KY2A 4B3FX 4J0QA 2GZHA 1ZU5A 3X1ZA 1YR7A 4GL2A 1MR3F 4M1TA 2RAPA 4BZXA 1FUKA 3OF5A 4DCUA 1S8FA 3GEHA 5BXQC 3LW8A 4BFZA 3GLGA 3I5XA 3TBKA 4H1UA 3RLFA 4TMVA 1NKTA 4QHTA 4KFTA 2A5DA 3LDAA 2CHVA 2C77A 3PCRB 3U2QA 1N3BA 3C16C 4B74A 1ZYUA 1KO5A 1NL3A 2ZRIA 4Q00A 1NY6A 1EFRA 2C78A 3B1VA 1QHHB 3QVVA 3GQBA 1GKUB 3CIOA 3E1SA 5J4VA 3R9XA 2O8FB 4Q66C 3EPJA 1Z6AA 3KKPA 2H8KA 3AUXA 3ASYA 3QNUA 5CDFA 4RCZA 3FYHA 2FDCA 2FNAA 3IIKA 1G8YA 2IYXA 2QMUA 3IILA 3IKJA 4HAYA 2VP9A 2IUTA 5IDVA 2YKGA 2ZJ8A 4P0TA 3CX8A 3EZ9A 1H8HA 4GPTA 4QNMA 4I1OA 3SJAA 1ETUA 3AF4A 2JCSA 3KQKA 1PUIA 1W47A 2FFAA 3MAAC 1VG1A 1M1YE 2ZJZA 1G6HA 1JB1A 3B9QA 1AIPA 3PEWA 4MDFA 4ERNA 5EJEA 4O0MA 5B57C 1F48A 2CXXA 2WBLC 3MGCA 2A5FA 1RRCA 1K5DA 5AJWA 4UKDA 3FMOB 4JJZA 3GJXC 3A4NA 1QVAA 4A6PA 4FMBB 3JVVA 4G5QA 2R65A 2IHYA 1UEIA 4ILEA 2Z83A 1GL9B 2SHKA 2VP4A 2GJAA 1NF3A 2HLDD 2MSDB 3AF0A 5AR1A 3N5CA 4G0NA 3QVUA 3DCLA 2OV2A 1Y3AA 2J45A 5D3QA 1T5LA 2ODNA 4B75A 1E2PA 4JJKA 2QZ4A 4V0MA 5M04A 2V7QA 4OL0A 3CPEA 1JAIA 2IXGA 2WWFA 1GNQA 4DT1A 4Q01A 1QF9A 1Z07A 4V0OA 1TMKA 2JLVA 1K5GA 1N6HA 2YV5A 1CJMA 2QORA 3V4FA 1G7CA 4Q19A 4UJ5A 1UBGA 2PT5A 4M1KA 2CVFA 1KGDA 2B92A 2GVZC 1NVWQ 1S9HA 3DKVA 3ZD7A 3BWDD 721PA 1VMAA 3FDIA 3QPUA 1GNRA 3L8ZA 1HE8B 1P7CA 1UADA 2XB2A 4JIMA 4AURA 4GMXA 2ZSDA 4A0GA 4PHGA 2QUZA 1BKDR 5FOTA 3U6KA 3NC1C 1W4CA 1F5NA 3DZDA 4TYPA 1NVUQ 5BWMA 2CLDX 2AKYA 1P2TA 5KPJA 1AN0A 1P5ZB 5JI2E 1Q22A 2GK7A 1JBKA 3I5YA 3P32A 1VHTA 1YR9A 1QHGA 5KPDA 1ELOA 3GLHE 4MQBA 4GOXA 2QP9X 2ZJ2A 3FHOA 4HUTA 4YMSA 3DMDA 2IYRA 3LQQA 2W6JD 1JJVA 1YZKA 3KTAA 4LZZA 1R5NA 1Q3HA 4CEJB 4DJTA 1KAOA 3O8DA 4M53A 3MWJA 5FPKA 2FG5A 3QKRA 1VIYA
chains in the Genus database with same CATH superfamily
4HWSA 3TRDA 1TAHA 2WJJA 1JR3D 3TGLA 4GVUA 1R5JA 2CVQA 4QG7A 3RXAA 1CY2A 2IE8A 2QAGB 4HUQA 4UHHA 1PLLA 4WESA 4MRMA 3SR4A 3W90A 3KCGH 3WAKA 4EUHA 3TF5A 1Y3XA 3KQLA 1H9CA 1OI4A 3A25A 4Z9AA 1R4AA 2LVBA 4N3BA 5EWLB 5C7IO 3K2BA 3VJLA 1I9CA 4LJRA 5I3CA 2AXQA 2CCJA 3GGCA 1A4IA 2QYHA 1D6MA 4I1SA 3I12A 1ZMJA 1W49A 1UBJS 1GJ6A 8KME2 3I0NA 3U7EB 4MLDA 3QX8A 2H6MA 4PPGA 3DHKH 1N2CB 3COYA 3NM6B 2BLLA 2J2UA 4LYGA 1IXKA 1EG2A 3FIJA 2CCGA 2JCYA 2FR8C 2BEVB 3OU2A 3C5HA 3JU3A 4PNEA 4AKSA 3PZRA 5DTIA 3V5NA 1A98A 4YZUA 3AONB 2GM4A 5BSVA 1I4OA 2XUHA 3LOUA 5JECA 5DPAA 4L9WA 1BW9B 3SLGA 4LBYA 1XZPA 3L77A 4KG7A 4R1SA 3E7XA 1V2OT 3FNGA 4LZPA 3FJ1A 1LWOA 2YINC 4CRBA 1O97D 4IBOA 3U80A 1A0JA 2ODWA 3LP5A 3IALA 3ZVRA 1IQFA 3QVSA 2WNHA 5ARDA 3OIVA 5IMBA 1JKMA 1QH9A 4XGRA 3UNXA 1ECBA 3RUDA 1RQPA 1N2JA 3DE0X 3L33A 1VLQA 2G1UA 4X20B 4YRCA 2VK4A 1KFJB 3E7DA 1KL7A 2P62A 4JEUA 4MQLA 1MTWA 2ZE7A 1EI9A 2A5IA 1KQOA 3HGNA 5ALHA 1BE6A 1I6WA 2WSSA 4LNUA 4ZRMA 5JCPA 1EZZA 4RPLA 5FFMA 4CKWA 2R0QC 5JRJA 1P3Y1 3ER9A 3TR0A 2YTZA 1EQ9A 2WIGA 4GW3A 2Y99A 1FY5A 3QKTA 4OUDA 1DT5A 4UEWA 2Z9IA 1XOIA 3W1VA 1Z1IA 4U6NA 2XD9A 4DQXA 3AR2A 2Z6BD 2AZXA 1E63A 5AO9A 5G1PA 4EG4A 3DM5A 3P8NA 3SSAA 4EY4A 3EG9A 3UICA 3UWOA 1C5WB 2FN9A 3LS2A 3FWYA 1CUFA 2ZDVH 2PMBA 3GFSA 4A1TA 1NW6A 3TTSA 1SEPA 3HE3A 4X20A 4X7PA 2OY0A 1A2CH 1DTSA 1J33A 2ZIZA 3A6KA 1R7RA 1RVV1 3Q3XA 1M1YB 2XQVA 3C3AA 3SXUA 1LK0A 3VV3A 1NULA 2PUJA 4KO2S 1BDIA 3QW4B 4ZPJA 2X86A 5DI3A 2MSLA 3A89A 3EA8A 3SHVA 3RSFA 1UANA 5EYPB 1JDSA 1JKXA 3CXRA 4Q93A 3T1TA 5HBRA 4V1CA 1S1CA 4IDOA 2QF0A 4XGIA 1NG9A 4KXXA 1DJNA 4ISBA 4N6OA 4BMSA 1O4VA 3QKSB 3W95A 2B4AA 1XTSA 3KUCA 4M7RA 3LX6A 4RK1A 5GM2A 1DIGA 3EQ7A 1PGQA 3V7YA 2ON6A 2PNFA 1T0IA 1DAEA 1O5FH 3M35A 1TA4A 2OC1A 4GNKA 1ZGIA 2JAPA 1HAVA 2HRBA 3R0FA 2EIHA 3U69H 2BDBA 1SQ0A 3GDFA 1GHAF 5FUYA 2AW5A 4DDWA 4IDPA 4G81A 2EX0A 1W88B 1XDGA 3RABA 1MAVA 2C5GA 7MHTA 3P92A 3MH4A 3U98H 1C30A 2G8LA 1M1NA 2HRDA 4HTCH 4QSMA 4UARA 1Y7TA 5ARCA 3T5GA 2JKZA 4HN4B 2Q2WA 2W8BB 5IK2A 1OT5A 1R15A 4F2HA 5BUZA 5THXA 3EWNA 1H8HD 4ESHA 1W5SA 4GI5A 5JBQA 4J1TC 2VWHA 2YJGA 3D5EA 4W63A 2ADOA 1GUFA 1M1ZA 1RYEA 2ZP0H 1QOPB 3G0CA 4Q6BA 3TW8B 2XNJA 4IC5A 2IYVA 1LDTT 3B36A 1U28C 3GYBA 4HVCA 1AE5A 3KLOA 1O2IA 3OE1A 4HEJA 4DDVA 2G71A 1AZWA 2I2DA 1BRMA 3PLNA 3VDMA 1LGYA 1DSSG 4GAWA 1QO9A 1SA0B 1WSAA 1HI9A 2OWEA 4Y6OA 4Y9DA 4Y9SA 1ZTJA 1T0UA 3M5WA 4ZC1A 1MVLA 3IBTA 3RYHB 3MFYA 1IBCA 3EUAA 4RE5A 1UR5A 2QP3A 1UMBA 3LYAA 4U00A 2QTCA 1DJLA 1MAYA 2C7PA 5L2YH 2FEQH 2IA5A 3IO5A 2Z9DA 3N58A 4J16C 3RSHA 4Z3DA 4I0WB 3CB2A 3G59A 1JLSA 4ISCA 2O7NA 2R6AA 4M9RA 1DJOA 3KYBA 2BY4A 3AU9A 4YB8A 3VKWA 4EDHA 2C1EA 2ZEJA 1T4VH 2FWWA 1GNPA 3KJXA 3LQRA 1L4ZA 4IINA 1LI7A 5E4TA 1J1UA 4OSPA 2PGXA 1ODJA 2ORED 2B20A 2XQJA 3AHDA 3F5DA 1P2BA 3M9LA 2I1QA 2IZ1A 1Y5MA 2FMHA 1OWKA 1Z6YA 1YCFA 2C2BA 5A3RA 2VIVA 2VRCD 5AK3A 1RZRA 4I4NA 3I64A 3L18A 2NG1A 3SNHA 3MXTA 3CZAA 1NT4A 1NSTA 3QYPA 4M0UA 3ONVA 4TY6A 1ZBQA 3KOZA 2PRIA 5JEDA 1JMYA 4HXEB 4YAWA 5C1YA 5I8ZA 4GIBA 3UWPA 1PDWA 5CX1B 3KHVA 5PNTA 2ZQ5A 4E0BA 4ZARA 4EHDA 2OM6A 1LA2A 1L5NA 3W5AA 3IJPA 1A76A 1NJGA 4MVJH 5F23A 1EVZA 1FTYA 4JYPA 3ERCA 3HMQA 4UDWH 1OV4A 3ELAH 1J39A 1YVDA 2FYTA 2VNKA 1GL6A 4ND8B 2X9NA 4LJ9A 2COEA 4KTSA 2TMYA 4NE9A 5AM2A 5HBGA 5K4HA 2J9GA 3A86A 5C5OA 3LOXA 1J5XA 2JFVA 2OVFA 4V0LA 5HE9A 1Z06A 5TEVA 1IBMB 5DX0A 5LXTA 3CH5A 3ISVA 1HOTA 2W2VA 2I55A 1ZSKA 3W9BA 4E22A 4HLQB 2NQTA 3T7EA 2AHOA 2VN8A 4JJFA 3DMTC 3LL4A 5IDXA 2ZXFA 3O93A 1KEWA 1NRWA 1T2CA 4BO8A 4D3SA 2WT9A 3NPMA 3ZYDA 2QY0B 1T2DA 1L3IA 2ZUBA 3GT0A 4DDHA 1TW2A 3IEKA 3IGFA 1GFSA 3PNMA 4OA5A 3T5DA 2QMHA 1FMLA 2TGPZ 4K40A 4TMTA 1Z2NX 1FFEA 1A97A 1FDTA 1GJRA 3SSMA 2SICE 3PR1A 3OX1A 3SU3A 5EG4A 3YASA 4B3TB 5KSYA 5AI5A 3NYQA 3CLSC 3RRYA 3ZNQA 6CHAB 3MB5A 4HG6A 4L3WA 1GJ7B 3EXEA 2PQMA 3SHQA 4B87A 4CM7A 2YUTA 5JROA 1AB9B 2DFNA 4KPUA 1UBLS 2DSNA 3INNA 2ZYWX 3RE1A 2IOFK 4XSGA 4H3KB 4YQFA 4NCAA 4KGVA 1BJRE 9LDTA 3A9SA 3VSBA 2YVAA 3AVQA 2JDID 1G5QA 3CE9A 5CK4A 4Q7YA 2CNNA 4WJG2 2EW2A 2ZU5A 3JQBA 1EVKA 1QX4A 5ELLA 5T4HA 4TMWA 3LGTA 3KEFA 2ATXA 2IEAA 5JB9S 3MILA 2THFB 3OIDA 1XT6A 2OE2A 4NECA 5B1IA 1RBMA 5BN4B 2O5VA 5LZ7A 5CFRA 2XZOA 4RM3A 3FMFA 1TYEB 4RGYA 4BO0A 2XNHA 3K73O 1YBAA 1VSTA 2ZDAH 2WJIA 2R751 4GGOA 3L8YA 2YNMC 1KDPA 3E23A 3ESXA 4MVXA 1Z2DA 5L40A 3SU2A 1OLXB 3QK1A 1YZTA 1GO2A 4G0VA 1WUIS 5DM70 4I4LA 1NI4B 1T13A 3NOOA 3PUKA 3PQ3A 1J09A 4MKRA 1RMQA 3HU3A 3EEFA 3EOAI 2VNIA 3MYYA 3UHAA 1SB1H 5IPFA 3F7NA 3LRXA 2WFLA 1HH4A 1M1YA 1ZRKA 1KAQA 4G5RA 1SZDA 1FLDA 3IWMA 5JSYA 2HI0A 4YAIA 4EJ6A 3M7TA 3GGDA 5GM1A 1TADA 4NMXB 5IABA 2QVBA 3CF4A 2O19A 2XC0A 2YVKA 3GPBA 4BO5A 3OOSA 3GDOA 1L4UA 3LHSA 2C8YB 2QQGA 3NTLA 3PXCX 4TT3A 4FHEA 5GP1A 1WXWA 1VB5A 3RQIA 1VA4A 3GWZA 3SC6A 1EHYA 1I24A 3JCZA 5E4JA 1TO6A 2IKQA 1EFVB 1WUHS 4MPDA 4OY3A 3PE6A 4DGSA 3AU8A 1LC3A 1L0BA 4QOEA 1A5HA 4GPIB 4M0DA 4I86A 1QPBA 4KGZA 3Q7SA 1NBHA 3ZVBA 2OG2A 3G5UA 4MWBA 2NU9A 3VH2A 3AW0A 1JJAA 2YQ5A 1WW2A 2GJ8A 3ICVA 5IC4A 5LKRA 4J2TA 1J0CA 1U5CA 2J48A 2PYIA 4GSYA 4J94A 4QX6A 3JR3A 1RLOA 4PQRA 1JR2A 1O30A 1DJQA 3N8IA 4M9QA 1N1MA 4ABEA 4I50B 1XXHB 4DARA 2G4VA 2A32A 5D1HA 3URKA 1F2TA 3PTLA 2R8XA 4B6QA 2IBMA 3RVLA 1JRLA 3MU1A 1S0UA 3FVWA 5ALVA 2YZ7A 1DWUA 1V2UT 3SN8A 4AIRA 3X1DA 5DLPA 2WOOA 4RTOA 1VE5A 3SF0A 4BOHA 1G32B 1UJMA 3HFGA 3ND6A 4OQYA 4OLBA 1QURH 3O3OB 4AIIA 2ZULA 2PX4A 4RUKA 2Q62A 4TTAA 4G0WA 4KLAA 4U32A 1EEHA 2HRVA 5K8IA 2PUDA 1HQYE 1AMUA 3D7SA 3GPIA 1TX7A 1LI4A 3H2KA 3BN3A 2VT2A 1QNJA 1Z4NA 1NRRH 2Z0MA 3BCRA 3QJYA 3E1XB 1W94A 3COZA 4OREX 4XDYA 3VPFA 2CZCA 3GRYA 4TSFA 4LCEA 4WBNB 4G01B 1HFEL 5JS7A 5B2ZA 3WWDA 3AF2A 1NU6A 4KQWA 3WO1A 3SF8A 3SP1A 1OTXA 2IYLD 2AK3A 1YZGA 3VEQB 1K89A 3CWCA 1B8OA 3NBFA 3WLTA 3PT5A 5KQLA 3DE4X 3RTAA 2WVAA 5G4BA 1T91A 2KX7A 1Y42X 4AJHA 3ZGOA 5EEHA 2ODEA 4EPWA 1I2ZA 2WHRA 1BBRH 1N9ZA 3K09C 3N6RA 3EE6A 1L5KA 1Z71A 3PWSA 4JYZA 1D1SA 3EGXA 3LPMA 1HFKA 5DCUA 1MFPA 4CTNA 1VHDA 4Q7LA 4ZXXH 3SNDA 4AZWA 2KE5A 2ZLBA 1WUJS 3AR5A 3ECAA 1GTZA 3OLYA 5H3CA 4EEZA 1UDCA 3PEEA 4X1KA 4ZO8A 1MG0A 2GR9A 4W8HA 2IS4A 2D0OB 4F6CA 2V35A 4QDXA 2O3RA 2QXGA 2WHPA 3OO0A 4DC9A 3STJA 2NUPB 1YQUA 1OX6A 1T1IA 1L5VA 5HMAA 3CPHA 5EXPA 1I3MA 3N0TA 4B6PA 2O5EA 1C1QA 1BGXT 1JIJA 4FGSA 2QG9A 5AUQA 3K71B 1BMDA 1BXRB 1UJ5A 2WF7A 3ETGA 1Q0TA 5EPEA 5ILOA 1GG6C 3TLJA 1D6NA 2WA1A 5FWXB 4WV3A 1G8PA 4CLRB 2LP4Y 3FGPA 1E1CB 1UPTA 4LK3A 5FJJA 2QSJA 1LLFA 1ZY2A 2EBHX 1UMCA 2CJFA 1OPHB 1KIAA 1P9LA 2G0NA 2ZKIA 3FX2A 3BB1A 1RMTA 1RKXA 4RSRA 1NM5C 2VK1A 2Y5GA 1YS6A 4RD0A 5ECGC 5TY0A 3VNRA 4G0ZA 1TF5A 3VGCC 2GRAA 2CUTA 3PJEA 5C3NA 5BOSA 1G9IE 3KGPA 1CQZA 1E2DA 1AZ8A 2VYVD 1RDFA 1W6UA 2A4MA 1OCEA 4NCHA 3HSSA 3RRFA 4I9GA 3UMJA 1TJ4A 4C4SA 4O4JF 4F5YA 3F0TA 1Z5UA 3PE3A 3GCDA 1G5PA 4WN9A 4J1YA 5HG0A 1PJQA 1CRLA 4GM4A 2V1UA 3O3CA 3HVIA 1GNSA 1C7FA 1U2RA 3GVIA 1BEZA 1RIWC 3AV0B 3KYDB 1AC5A 4MRRA 4O63O 5JCJA 1C1OA 2D8AA 2W2NA 3L8HA 4CRDA 2R66A 1SQFA 1WSDA 4MVJP 3VR5H 5K99A 4I5GA 2FO9A 3OMXA 3C15C 5BNTA 1E92A 1O3OA 3AI3A 4DWWA 4B3BA 2WV7A 3W2GA 1OXGA 2OAGA 4N8DA 4LIPD 3VOSA 3ZXUB 4E2XA 2QT0A 3R9WA 1U0RA 1Q0RA 2AW3A 1K8XB 4LE1A 5DCYA 1FS4A 3FPKA 1RAFA 2B4KA 3MWDB 4JLNA 4WJZA 5ESDA 3REOA 4HYYA 3EXEB 2GM3A 3ZU6A 4B3MB 1BH6A 1WXXA 1VTKA 2HMAA 4TMFA 4X71A 1V2QT 1MG5A 2PQ0A 3B51X 1QFZA 2IVFA 3DP9A 2HPHA 1H9IE 2H9EH 3PWCA 5TXGA 2R6GA 4ZAYA 1WPQA 2DWQA 3T3PB 3X0DA 3ADDA 1JRSA 4O4JA 3FKQA 4LZOA 1UFRA 2BCJQ 5CDGA 5E0JA 1I80A 1ZESA 2P5YA 2NO4A 1GFIA 3W7VA 2J7PA 4A73A 4DSZA 2OTCA 4JLOA 4OS6A 1Y8CA 1XX6A 4X1YA 5F2NA 1ESZA 5JLJA 5BUSA 4MDYA 4P35A 3THYB 2EFJA 4QE3A 2QLMA 1QHNA 3PTAA 3FETA 3PV2A 3Q88A 3U3MA 4MDEA 2QPLA 4D42A 2PMCA 3LWDA 3F9EA 4PIVA 3D9QX 9ABPA 2Q46A 2CL6X 3KHSA 1B8VA 3KVVA 5EXXA 5SGAE 4ALIA 2R0LA 1VCNA 3JQFC 4HZIA 1L7EA 2PWYA 3RU2A 1UBMS 3O4JA 1FIZA 4MUBA 4S12A 3MJSA 1E3SA 2P3UB 6YASA 1NMQA 2P5TB 4QYSA 4C3OB 1C5MD 1FUEA 5L3QB 1JIXA 4G1FA 1QHSA 1W19A 4P58A 4RAOA 5AVDA 5ALEA 1XPUA 5CNIA 2RGCA 2VINA 2QN8A 3MOIA 3QVMA 1FJ2A 4NX2A 1Z2CA 3QTVH 3P9SA 4P53A 3EA4A 1T6ZA 2QENA 4L4YA 1EOLA 3K8YA 4KAAA 1V8OA 1ORHA 1E2IA 1D6RA 2HWWA 3TLEA 1G38A 4HT3B 1A0OA 2EQAA 2HRCA 5HYVA 3KHTA 1J8DA 2YR0A 5FUQA 3P17H 1JU3A 4AYVB 1TO2E 1UVUH 2B1GA 3WQRA 1LH0A 1HZZA 3UTCA 5KHOC 2DX7A 1KWKA 2ECOA 4MV9A 4X8OA 3ORHA 1A96A 2ZWIA 3LPNA 4OQLA 1JMOH 3VO9A 5CVTA 3HY6A 2GDDA 2GXUA 5AIBA 4WX2B 2IDKA 3I72A 4URFA 1PJ3A 1CUEA 4GWGA 2SECE 4KGDA 5G1NA 2B37A 1DEKA 1EUFA 1TVKA 2CJWB 3ILHA 5BOVA 4CM4B 2FY8A 3KQ5A 4GYKA 1PFVA 4ZQGA 2IOFA 4F2GA 2DY0A 1BZXE 3EIQA 5SICE 4IS3A 1JWTA 5IBQA 4CDMA 4KCGA 1DVRA 1L1RA 3D6NB 3ABOB 5ADVA 1PV2A 2YN2A 2HJWA 2J0SA 2ZYIA 4BFSA 4E4RA 1QM5A 3MU5A 4KQ9A 2NTVA 3VKHA 2I8LA 3K8OE 2P75A 1AB9C 3PUIA 4MV0A 3UC5A 4QRHA 1WTAA 1FP4A 5GINE 3R5TA 2SNWA 1X80A 4IV8A 3V32A 1TLTA 2FEPA 3ZOZA 1TB4A 3OA2A 2F9NA 2PMKA 2QA5A 4EFKA 5CAEA 5K0FA 5BQPA 3LQ1A 1EAWA 3RYCA 5F98A 2J41A 3QQ5A 1GYRA 4MNWA 1QIFA 2CMKA 1AS2A 3RU4T 3GJ6A 4LJLA 4TM7A 1HJAB 2HB6A 2GAIA 1NVEA 4UUAA 5DHRA 1F7UA 4OB8A 5B53A 4R41A 1IHXA 4FGZA 1HKUA 2V65A 3GROA 5D00A 2SGDE 2ETVA 4BNYA 1JG2A 2GPYA 3M6IA 1T5SA 4PZ0A 5SY9A 4A26A 1UAYA 3ND5A 1JFSA 3KPWA 2L18A 1J97A 3QVTA 3MT7A 3BWCA 1T36A 2HHLA 4RYDA 4O4IF 1U2DC 2XJ4A 5CYFA 5IBRA 1CHGA 1L5FA 1TVEA 2XCIA 1AQNA 4XTCS 2IN2A 1J7JA 2R79A 1CUBA 2VAWA 3M5LA 1MH1A 1ZGCA 2AF4C 3JWHA 3PIIA 1JFFB 4XD2A 4RDCA 3IIEA 4OHUA 3L1KA 3DZCA 4KPFC 4LOYH 3KQWA 4TUYB 1XQ6A 4DEXA 2A2QH 1Q0LA 1KKMA 4MVJA 4J3FA 2BISA 1C1PA 3RNOA 3RXVA 1R6TA 5KEDA 4O25A 3PPXA 2H2WA 3L5KA 4BVKA 5A03A 1IDOA 1JPUA 4F1JA 3PWBA 1MO3A 2IF0A 2R6FA 5KYWB 2O7VA 1GHTA 2H5DA 2WMNB 4P93A 2WTBA 2UZAA 1ADYA 2JIDA 4LJ7A 4LRXA 5G40A 2ZRBA 1O03A 1KK1A 4B09A 4B8WA 1IXYA 3AEKB 5LBUA 1GMDF 3FN8A 1GQQA 2J59A 3EOBI 4MQUA 4DUGD 4E1AA 3W3AA 3D8RA 1KNQA 1KOFA 2PTHA 4DJEC 1SVLA 3UK6A 1L4HA 1EFPB 1USKA 2PVSA 2ZAOA 3G0HA 3OTGA 4GZLA 3BB3A 5JQGB 5B30A 2BHLA 2Y0CA 3B3GA 4M1OA 5GNDA 3DS8A 1TM4E 2QYIA 1SRQA 3LECA 1H2RS 1P81A 2O9JA 2QRHA 3D6MA 4YJKA 3S2YA 4DM3A 4RTQA 4DIHH 3EVBA 4E70A 1GVKB 3FDZB 1GITA 4YJGB 2YXNA 1NJ6A 5BV1A 2ZTUA 4Q9HA 1P1JA 2JD0A 4RIEA 4XB2A 1SUDA 4LFBB 1ULSA 4H2DA 4MWGA 2X1LA 2JB9A 3OQ6A 4OO3A 4MKGA 3K5HA 5C34B 4LHSA 2C1XA 4FGUA 4P32A 4XLLA 4CBVA 2G5PA 4J7AA 2BMDA 4C2BA 3LGUA 2A67A 4C7BA 1ZHPA 4Q4AA 2ZRGA 2G67A 1OSSA 4GP7A 1G37A 3B85A 1IXZA 2FPMA 1NFFA 2V5VA 2YY5A 4P4UA 1ZJJA 2WG1A 5KNDD 1JA9A 1O37A 2Y67A 3NT5A 4HRVA 1XZJA 2Z94A 1ZNYA 2A1IA 2X8JA 2ZU2A 5FOSA 1H2WA 1UOEA 1SA0A 2YS7A 3UYLA 1C9PA 1YBWA 2BZ0A 5K0BA 1ADJA 1GBCA 3NEJA 3NKFA 3ZDQA 2ZIQH 2ID7A 3M83A 5FEUA 1BHJA 3EVCA 3O2SB 3K53A 4P00A 3QX9A 1QRUA 1W0YH 1ZAYA 3IHTA 1EP5A 3CLRD 4CDNA 1TE2A 2Z8YM 1ELEE 1RYMA 1TMUH 1BU8A 2Q6IA 4GOLD 2JLWA 2IHBA 4Q1AA 3A7ZA 3ZHQA 4BTTB 1W9HA 2ZITA 5JR3A 3KO8A 2AMPA 1LBQA 3MOGA 2G8TA 4FVBA 2X4DA 4KFUA 1MLDA 4U3JA 4AMVA 3ORQA 1KSNA 1UQTA 1X9IA 2IW3A 3RVBA 4G86A 2H6EA 1VJDA 1IJFA 2JGLA 3IHWA 4UQPA 5ELMA 3SN6A 6REQA 4AP5A 1MJFA 1T15A 1RPAA 3G0GA 1O94C 4K2AA 1RYHA 1Q6YA 2C2GA 1MN6A 2VHCA 1SGYE 4V38A 2II6A 1R66A 3CJRA 4CN9A 1TC2A 1ZMXA 5F21A 4QTTB 2ZSFA 5FBZA 4TZ0A 3OWHA 3KV3O 4FHDA 1LPPA 1GN9A 1B1AA 4IMJB 5BSTA 3WLQA 1ZNWA 1C5OH 3C8DA 3HN6A 2QRLA 4YAGA 4JHXA 1VRCA 3DVRX 1JDVA 3HU5A 1C9JA 2UZ4A 3T6KA 3GN2A 1RJGA 3HB1A 1E1LA 2DH6A 2QL9A 4L76A 3VKUA 3HJHA 1FRQA 3HRKA 2IP2A 3PQFA 4R2MA 3UJ8A 1AQ7A 2M6LA 2HF8A 4RZIA 1P19A 5CRIA 2P9TA 1UZAA 3C97A 1FX0A 1Q31A 2IPOA 3TOSA 3F68H 2YHIA 5H3LA 3GG2A 1JEQA 1M2OB 1SBNE 1XP5A 2O0JA 5AKEA 3RFXA 3RO7A 4BQEA 1KXFA 3K0CA 4ZV4A 1GPKA 1XZQA 4R5MA 5LJIA 3BUSA 1MU0A 1UM9B 2C8KA 5T4EA 4HZUA 1LTQA 4D1YA 4ZANA 4QL3A 5K0JA 1SB9A 3F96A 4A82A 2Q6LA 2B83A 4MRVA 2Q5FA 1J06A 1Z4MA 5DBEX 2QMZA 4OHMA 1KZHA 3HPTB 1TNGA 3PYXA 1EPTC 2ET6A 3RS0A 3O8OA 5KIAA 4D3XA 1NSFA 2JL1A 1F12A 5AM4A 1R2QA 2DWPA 1A61H 2HQ1A 5AICA 4HDRB 5AKIA 3R74A 3ZV4A 4X6XA 4TQGA 3N8DA 2R7MA 3WYGA 2GTHA 2R4TA 1MOSA 4Z5XA 2C2XA 1C1TA 2VSYA 4BVHA 3Q4GA 5LVAA 5ILQA 4S35A 1JSZA 2GK4A 1OU4A 3IUMA 4M0LA 4PGFA 3RMNH 4YQZA 1JBUH 5K05A 4XGQA 3QI2A 3ST7A 4I2NA 2QX4A 4EO4A 3OEED 3AIMA 3S0NA 1YWGO 2BAGA 1U2SA 2W6QA 3U56A 1J49A 3ZJUA 2B0CA 3VR2D 1MA3A 4NPHA 5FDFA 2M5TA 1ZNZA 2ERYA 1CHNA 3RSQA 4ZO9A 4I55B 3E9MA 1C8LA 3KQHA 1TTQB 1NLMA 1XFAA 2W2OA 3FFTA 4TVSA 5EQJB 2FOCA 4RABA 1F3OA 1AA6A 4PO8A 3O4RA 3MQ4A 5B64A 3IP8A 3PHGA 3VYVA 1BEUB 3C27B 3B89A 2CL7X 3HY4A 4JLAA 3HN7A 3PX7A 3TLGB 2CE7A 4UVIA 3B1KA 4BWGA 1CNEA 1PLKA 1XTPA 1PYTD 4M21A 4BN5A 4MQMA 1ELTA 2GKSA 1TPYA 3ZHCA 5L3VA 3ODPA 3UJAA 4DA4A 1E64A 1QWSA 3I1FA 1CF9A 4I46A 3KJGA 2O57A 3SKXA 1H4WA 1CUWA 1N3YA 3DNPA 4POAA 3D4LA 3HKDA 1OILA 2BBTA 4DQVA 5DPMA 3BIVH 4I6JA 3FNRA 3A6PC 2UUAB 1FDSA 4HADA 1C1XB 1TALA 2VJOA 4HAVA 4ZI5A 3WGGA 4UFDH 3GUVA 4CT4B 1G41A 1XTUA 4DCTA 2GN2A 1W3CA 2ZCHP 1IPHA 1K1MA 1SUPA 4CM9A 1WDMA 2RHMA 1K6EA 3TPFA 1OFVA 4QPDA 4OK6A 4YI5A 2ZK7A 3OIUA 3IKLA 4FT4A 5DM60 4KBGA 2Q5HA 5GVSA 3U19A 1Q2UA 5A1JA 5JPDA 4P83A 2O6HA 3AFIA 1B4DA 3CUSA 3GJYA 3UB4A 1WZIA 4BGEA 2Q2QA 2F7SA 3L06A 4L4XA 5I7RA 3E7PA 3F73A 4CMIB 3LC0A 1GTSA 3KRTA 1ZD4A 2AG8A 3HPQA 3Q6MA 2CLCX 4Q4AB 5FA8A 3S4YA 3BRWA 3BRSA 2QGFA 1U8YA 5HK9A 2C7OA 1MOQA 1OASA 2AE2A 3UYKA 2QXUA 2N1MA 2YXPX 4M60A 3H6GA 3I6QA 3Q9NA 4KXFB 1XTQA 3P2KA 1Q7GA 2CJXA 4WKBA 3CLTC 5AVWA 2ZPRA 1YE5A 1N8OB 1Y3FE 4KN6A 4XIYA 3GLKA 3UHJA 3TW8A 3WNQA 1FMTA 1TTPB 3BA1A 1SR8A 1WB6A 1LBHA 4R3UC 2EZTA 2IHZA 2HXSA 3T3EA 3A6FA 1D1QA 2VIOA 5HDBB 3L7BA 4GKBA 3T0IA 5KTTA 1YC5A 3E2PA 1XLWA 1S83A 3KQEA 3SAJA 4NXNB 1UBFA 1W4RA 3CX7A 1CT9A 3KJEA 4UM7A 2FV8A 1R5BA 2VDRB 4HEA6 1ID5H 5HXFA 4K81B 3QUCA 1UOQA 4QO7A 1JHQA 4R9VA 4NWKA 1GYPA 4X84A 4YCMA 5AVOA 3EQ2A 4BGVA 2Y77A 4OXNA 1AS0A 2PNJA 1SC6A 2LP6A 3PUXA 3CLHA 3TQFA 4YCBA 4IV5A 5DULA 3CP7A 4BVGA 2CYBA 1Q6ZA 1KMMA 4L2IB 2FWAA 3P0EA 4P8RA 5H0IA 2P9QA 3VYSB 3LYUA 2F1KA 1N8SA 1II8A 5LP6C 2REBA 2R1TB 4TKUB 2A8YA 1QIMA 2GLXA 5LUBA 1THMA 1GPAA 3RXEA 2W26A 3BTGE 1K5HA 2QTZA 2C20A 1JDZA 2YHSA 3C41J 4HPJB 4D74A 1RE0A 1SVIA 3DWGA 2BKAA 2ODYB 2OK8A 4V0NA 3OQVA 4HS9A 3AEUB 3FGOA 1DQZA 1Y63A 1US8B 3F6BX 4CLOB 5DKFA 4GCHF 2X23A 4BASA 2A7CA 4IDBA 2O3UA 1E79D 1EZXC 1GDNA 4I66A 3UKOA 3ZCPA 2ID9A 4TMZA 4YY3B 4ZIRA 2BELA 4NL4H 1KNXA 2W6NA 4EARA 4JQCA 1UP7A 1COWA 3FOBA 4W5WA 2ZUTA 1HUQA 2FCRA 4BLPA 1ZC4A 4DRYA 4EJ0A 1C9TA 4R1LA 5JBNA 3QX3A 2AMFA 2VP6A 5LZ4A 4EY3A 3LRTA 3ONWA 2GGVB 5BR7A 1GEGA 4TV8A 5JCJD 4FEEA 3G7NA 1H1TA 3C39A 1GADO 4NE2A 2CJWA 4CM4A 1KJ9A 4X1RU 1UF9A 2BBSA 3DZFA 3RU7A 1IQHA 3M3VA 1UKAA 3DOIA 2IZ0A 2ZYTX 4HLCA 3P20A 1O38A 1XEWY 4YCJA 2C58A 1XQXA 4ZCNA 5DTJA 2ZR9A 4AZ3B 5I7VA 1FIUA 2STBE 4OPMA 1FZQA 1TGSZ 1MEJA 4O08A 4R51A 2BYAX 1XMNB 1NUHA 1MB0A 2HA4A 3NXSA 4L75A 5D01A 5A5VA 4X93A 4LQDA 1U2GA 3FYDA 2NYUA 1CE8A 3TL6A 3V3KA 4FN4A 3R3SA 3SYKA 4CTOA 1E1QD 2IYYA 2I9PA 5IARA 1PR1A 1VITG 4G1BA 2AMQA 3E0QA 2RBEA 1HPGA 3G5LA 1YRLA 1QNFA 3HNRA 4H4DA 3MBKA 2A3NA 4NV1A 4BTIB 3AAVA 2PS1A 2RGDA 2VWPA 2XRFA 4EMBA 4Q6WA 4XM1A 3LGWA 1LBSA 1H2EA 3DMHA 2ZPAA 5K7RA 4X44A 4Q12A 1R6XA 4ZYLA 1Q12A 4R8SA 1E59A 3V9PA 3MLBA 3NYIA 3W3ZB 3SLKA 3EXG2 4X63A 2V7WA 1DI0A 3NDRA 2SKDA 5ALJA 5FLEX 3CS0A 3ZWNA 5DG6A 4Y0VA 2KFWA 1AHHA 5TGZA 3ER8A 1SGTA 1CIPA 1EA7A 3COSA 1IIBA 2J0VA 3MJDA 1ZD2P 1IK4A 2DJIA 4IVPA 3M1YA 5DXAA 3DLTA 3UHFA 3RRJA 4L57A 4ND8A 3T94A 1AZLA 1U0OC 2VIWA 1UL1X 4C20A 4Z2YA 2WPJS 4RLQA 4E5MA 5KVAA 2WMOB 3EEYA 3I9MA 2IS6A 1A9ZA 1BTXA 1MJGM 1UC4B 4MIEA 2OAQ1 4EKEA 4E21A 3G1UA 4AM8A 2Z3DA 1JHZA 3THYA 4NXMB 3UJ7A 4ZA2A 4H42U 4HPXB 4EUSA 4PZPA 5AHRA 1XUIA 2BEWA 2AOUB 3BILA 3GLIB 3STYA 4HQOA 3ORRA 4HZGA 2XJ9A 2BDYA 1YONA 2W2KA 3P0IA 2BFBA 3ZD9A 3F5MA 3S29A 1LVYA 2A1UB 1H2BA 1N2BA 2ETXA 2ATEA 2JIQA 2NNWB 2QU8A 3KSRA 4KDCA 1KE2A 4YH1A 2GWHA 3TQIA 1C5ZB 5M34A 1JHDA 4HN2A 1SWVA 1WHSA 3BK7A 4LSWA 3T3HA 2J92A 1G1AA 1Z4QA 2RAVA 3PJFA 3O7WA 5I9BA 2VBGA 1GAQA 4C08A 4EAAA 4NSVA 3CVYA 1GM5A 2TRMA 1DX6A 1U9YA 2EWWA 2VUSA 1EX1A 3ANNA 4LWPA 4ZVKA 3UJDA 1FDOA 2VI5A 1OWHA 4H6TA 1SOWA 1WUYA 2Q27A 3L7YA 5ALOA 5C32A 4DUZB 5BWOA 4ZQHA 4J4BA 1KEVA 1ZOIA 1YE3A 2DH5A 2FUEA 4MTCA 3TEJA 4BQSA 5A2GA 2O2HA 3WQHA 1ULUA 3KYDA 1M73E 2CNWA 3P2OA 1VP3A 1J2TA 1KKLA 4LJ5A 3TDKA 1NS3A 1QP8A 2FX3A 3N8GA 1RAGA 1ORDA 1KEEA 1LV7A 1ISHA 2FI4E 4Y76A 2IWHA 5REQB 2WTUA 3OM0A 2PZJA 3ZZ3A 1LVHA 4LTNA 4LBWA 4UHCA 2Z4SA 4XI9A 4DYHA 4XWGA 1J7KA 2HWXA 4YCCA 1I33A 4MS3A 4RZQA 4JP2A 3OQIB 2GK6A 1NV8A 1XK7A 3EDCA 5CLIA 3EXHB 4BRUA 5JNLA 1C1WH 1G66A 4YP6A 4NZ9A 1SCIA 5IUNC 4J0KA 4ZXFA 4RVUA 5KNCA 1KMCA 4BTLA 1KMNA 4Y6SA 1TBQH 3CKKA 1XVMA 3LP8A 4YLGA 4AB1A 2OXIA 4S1TA 4LDJA 1ID1A 4IWXA 2C90B 4LY6A 1QO0D 1T43A 2Q9AA 3L8CA 5AM5A 1N34B 2QMYA 4D5EA 2GEFA 2WR8A 1JKFA 3FKSA 3OP4A 3FOAA 2FFBA 4HFNA 2XX3A 2ULLA 1FFWA 4S0ZA 2VP0A 3QLUC 1FNIA 2O2YA 4LYAA 2ROQA 1NDQA 1VSVA 1DEAA 3KFVA 3FPEA 2HZBA 1NVFA 1AY0A 2YV1A 2V7PA 3HA7A 4MKIA 4U7HA 2W83A 3K32A 1PFWA 1XTVA 2FSVA 5JV5A 2ZDHA 4HN9A 2XMDA 3PUZA 4KN5A 3PHJA 1FK8A 2CF5A 4DV2B 1CY1A 1V16A 2B8OH 3KWFA 5ELXA 1LNQA 1L1GA 3D6AA 1U3TA 2GEUA 3A82A 4JOQA 3QPVA 5C8YF 1BBRK 5DWDA 1SXQA 3FFXA 2HK6A 5F3WB 1J2YA 1OYQA 1E9EA 1MU8B 4JP8A 3CU5A 4ERXA 5KU7A 3S3TA 3RC6A 1USVA 1T4DA 3TIUA 1PT5A 2BH9A 2PDAA 3L0IB 4JVOA 5TJHA 4MWOA 1L4DA 3ETHA 4D99A 1NDUA 1DNPA 1N6KA 3R7WB 2C3YA 2OBXA 2PX3A 4KWIA 3ZZAA 4KXVA 2B36A 3OESA 4B4VA 1E3WA 3VMMA 3BJEA 2YZGA 3VA7A 3PGJA 5H5JA 1M54A 1T4CB 3FNEA 2A9KA 5TGTA 4BAGA 2NUAA 1SUEA 3K2QA 4G63A 1RJXB 3AQIA 1DKQA 2CN0H 2FXVA 3JYHA 5CVVA 3VJKA 5LWQA 4X66B 1IRIA 4QOHA 4GF5A 4HB4A 3UW3A 1YT5A 4E3WA 4DLTA 2IX9A 1T34A 5DGTA 3M70A 4LTMA 1UCYE 3Q2KA 4TYYA 5J3JA 2WHQA 3LPDA 1FPHH 1E3DA 4M9XA 3BMCA 2TMDA 1TQ8A 5DIZA 5ALGA 1ZLXA 4EJSB 1YA6A 1XYVA 4KP0A 3RMLH 4HLNA 4LJ6A 1Z6JH 1IE3A 4LGVA 2A0WA 2V7GA 2C0QA 4RQUA 4A2QA 1KI7A 4IGEA 1XVLA 1EM6A 2FEAA 1TUBB 2Z3ZA