The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
127
|
sequence length |
458
|
structure length |
458
|
Chain Sequence |
TGKIVQVIGAVVDVEFPQDAVPRVYDALEVQNGNERLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGEATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis for inhibition of bacterial ATP synthase by subunit epsilon of the rotor stalk
rcsb |
molecule keywords |
ATP synthase subunit alpha
|
source organism |
Escherichia coli dh1
|
molecule tags |
Hydrolase/transport protein
|
total genus |
127
|
structure length |
458
|
sequence length |
458
|
chains with identical sequence |
E, F, L, M, N, T, U, V, b, c, d
|
ec nomenclature |
ec
7.1.2.2: H(+)-transporting two-sector ATPase. |
pdb deposition date | 2010-08-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
D | PF00006 | ATP-synt_ab | ATP synthase alpha/beta family, nucleotide-binding domain |
D | PF02874 | ATP-synt_ab_N | ATP synthase alpha/beta family, beta-barrel domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3 | Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 | ||
Mainly Beta | Beta Barrel | Thrombin, subunit H | Thrombin, subunit H | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |