3OAAD

Structure of the e.coli f1-atp synthase inhibited by subunit epsilon
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
458
structure length
458
Chain Sequence
TGKIVQVIGAVVDVEFPQDAVPRVYDALEVQNGNERLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGEATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha
publication title Structural basis for inhibition of bacterial ATP synthase by subunit epsilon of the rotor stalk
rcsb
source organism Escherichia coli dh1
molecule tags Hydrolase/transport protein
total genus 127
structure length 458
sequence length 458
chains with identical sequence E, F, L, M, N, T, U, V, b, c, d
ec nomenclature ec 7.1.2.2: H(+)-transporting two-sector ATPase.
pdb deposition date 2010-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain
D PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1140.10 Mainly Alpha Orthogonal Bundle Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3 Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 3oaaD03
2.40.10.170 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3oaaD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oaaD02
1IOZA 1G5RA 1XEXB 4GMDA 4GOJA 4PAMA 1DBSA 1IBRA 3I8SA 4PO8A 4QBGB 2XXAB 1IAQA 4X8LA 3VFDA 3PUVA 1W36C 4EQ6B 4RD0A 1Q22A 3ZS9A 3K0AB 4WZAE 3RC3A 4UJ3A 2GDJA 1W0JD 4QNMA 3EIEA 3ADCA 3VMFA 3EG5A 3HR8A 3UK6A 1CKEA 4Q9LA 3TSWA 1KKMA 1KZGB 3DMNA 1ZNXA 4LBWA 1XJCA 1YZKA 1LS6A 1DO0A 2XSZA 3FMPB 3OIWA 4KVGA 4U7DA 3THWA 1US8A 3AKYA 2YKGA 3ZH9B 2VP4A 2X1VA 1S2MA 4YXWA 3OE7D 1OH8A 1MV5A 1JR3E 3Q5EA 3QUSA 4XSHA 1JR3A 1E9SA 1CR0A 3U2QA 1W46A 4D4MA 3EIQA 4CDGA 4DEXA 4ACBA 2ASEA 4L15A 2W2TA 2J0UB 4PO9A 3VHLB 3T1TA 4TZ0A 4W5HA 1ZJ6A 2OESA 4LI0A 3PEWA 1QHXA 2E1RA 2A7QA 2J0VA 2CLCX 3ADBA 3O47A 1CJUC 4WW0A 1G41A 4OQNA 4FN5A 2F43A 3B78A 1DTSA 4CEHA 4M1TA 3OEHD 4N1AA 1XFAA 1NN0A 3CX8A 3EZ2A 4GPTA 4KYIB 1E1RA 4DT1A 1F2TB 3Q8XB 4YONB 4UXIA 4MGIR 2FU5C 4Q7JB 3F0TA 4OK5A 2AK2A 4IDOA 4C4PA 3GEIA 3AVXA 2G83A 3C4JA 1WE2A 2XZOA 3S1AA 1N5JA 2GK7A 2ZYWX 4B74A 4L4UA 1OHHA 2WKPA 1KAOA 2B92A 3CF0A 1E9DA 3U3MA 2AKAB 4A6PA 3AVVA 2OSBA 2C5LA 1ZCAA 4AY2A 2PH1A 3HP1A 4H1VA 4B3FX 5GADl 4NDZA 4OQXA 2BVNA 3B9QA 2O8EA 1ZP6A 2PZGA 2ONJA 4NHOA 2I3BA 3U5ZB 1IXRC 1SVKA 1BOFA 1Z6YA 2IXFA 2CCKA 4ZPXA 4HZUA 3BOSA 3TVTA 3MAAC 3ZZUA 4I1OA 4RD6A 1N6OA 2F6RA 4YMSA 2JLQA 2P6RA 1XD9A 2A3RA 2N42A 4RY2A 3G82C 1RFLA 4CF7A 2VSOA 3PV0A 4A0FA 4N0EA 3KQUA 1F5NA 2Z6VA 1NBMA 1X1SA 3VR1A 4LJAA 1YZNA 3LXRA 2C95A 4X8OA 2HXSA 5HE9A 3THXB 3DZ8A 2DY1A 5B58C 1NI3A 2NO0A 2ZSFA 1KYIA 1NN3A 2IYTA 2RHMA 3SBDA 4H9GA 3KFXA 3KQHA 1MO4A 1IN5A 2CJWB 2VPPA 2IHBA 5DLQC 5FPHA 4URUR 2BBSA 4FCTA 2ZTSA 3T61A 2NPIA 4BWYA 3EPKA 1H8HD 3IQXA 2ZI6A 2WBLC 3OEED 5EUQB 2HT1A 1OB2A 1XTQA 1ZM4A 3GFOA 3AKCA 1GIAA 1KNQA 2WAXA 1TX4B 2GF9A 4PZZA 2A5FA 1UFQA 3EASA 3CM0A 2OBLA 5AUOB 4LGMA 1JNYA 5KO2A 4UXJA 3H2YA 2GAAA 2GILA 3B2EA 2ZIAA 1JQLB 3WBJA 4Q5IA 2WJHA 1NG9A 1KO7A 4CEJA 1NJGA 4NYJQ 2FPLA 1P9NA 4CT5A 2O8DA 2HT6A 1G8YA 5JCZA 3AP2A 3K0FA 1QHHB 4QXAA 3RS3A 5G53C 3FTQA 1PLJA 4TSFA 1XPUA 3LX8A 4JS0A 3B5JA 5FPSA 1N5IA 3BH6A 4BRUA 1ZD9A 1E96A 1KGDA 2G0NA 5DE3A 3BD9A 4IDPA 4Z8XA 1P60A 2IW3A 1CBUA 4A1FA 2CNWD 4IXNA 4MGZR 5L3QA 3H1TA 4CGZA 4FCVA 4PHFA 4D0LB 1PZNA 5J4VA 3IEVA 5GJCA 4BFWA 3GFPA 4GFDA 5DHAA 4C0QC 2P3SA 4XVUA 5LDDC 2R6GA 3WRYC 2KB0A 1GAJA 2ZSEA 2ZM5A 2ODBA 3ASZA 3Q5DA 2JIZD 4YQFA 4A2WA 2YWEA 2XB2A 1I2DA 4WBSA 4TT3D 5FL3A 4FI3C 5KPJA 4JLNA 1SHZA 3VHXA 4G5RA 5EZ6B 3D6TB 1KI7A 5EE3A 2EU8A 1E9FA 2BM0A 2QM7A 2RH5A 2L0XA 1QHNA 1JPNA 4AKIA 3SHFA 5CM9C 1YZUA 4HAVA 3LDAA 1TQ4A 4DLWA 4MRVA 3O8CA 2O8BB 1D2NA 1TPZA 4OHWA 5TVKA 4OHZA 3PEVA 4JYCA 3PJRA 3R9WA 1FP6A 5G41A 1IM2A 5JLJA 5AUPB 2WPDD 4QKQA 4AD8A 1E69A 2ZI3A 2QE7D 1T8UA 2XEXA 4RZXA 2JLVA 5DO9A 5ANRB 2NPFA 1UKVY 4R71A 1Q1EA 2NGRA 4ZKDA 2CK3D 1SVOA 2LKCA 2OV2A 1OYYA 2FA9A 1ZRHA 4KFTA 3VAAA 3IO3A 1XD2B 4LPSA 2GETA 1P5ZB 5FOSA 3ND8A 1UBFA 1JEDA 4V0ME 1HY3A 1FFHA 3BB1A 4V0MA 1W5SA 4FMCB 4QOSA 2C04A 2W0SA 2LWIA 3RSLA 1GKYA 4B35A 2H57A 3EPJA 2GHIA 3GJ5A 1K8RA 3PQCA 1FNNA 2IF0A 3SI7A 721PA 1NP6A 4BFVA 1EG7A 3GFTA 4PFSA 2ORIA 2YOGA 3WYFA 1CU1A 1IJFA 2W0MA 4QGGA 1T91A 2FNAA 2OT3B 2J7PA 2ZVPX 5IK2D 1YZQA 2NG1A 5BN4A 2BOVA 3IGFA 4LBZA 4CYMA 1WB9A 4YMWA 3VKGA 4MITA 4PC6A 1RW4A 4BEBA 3ADKA 2F1IA 4NYJR 2WWIA 2D2FA 3PEUA 2HV8A 4AYTA 1T6NA 4UNRA 1U8AA 3A1TA 4LHZA 1W0KA 1E2FA 3SYNA 2R6DA 2C2HA 3R20A 1KSFX 4C0SA 3BORA 2NO6A 3A36A 1AM4D 1HA3A 5DI3B 4ZCLA 3TSZA 3VQTA 1PLKA 4TLAA 4WAUA 5H8WA 4OBEA 4ASUA 4MKHA 3AP3A 1CRQA 1XJQA 1GL7A 2WZQA 1ZD8A 4IDNA 2A78A 1XTKA 5E95A 3IKJA 2H92A 2YWFA 4MGYR 3SZRA 2W6IA 1K5DA 3X1ZA 1E0AA 5JFGA 3VR4A 2O8FB 1XXHB 4ACAA 1EFRD 3W34A 3AF1A 2PBRA 3WHLA 3TR5A 4KFSA 2V55B 4YLGA 3SC3A 4U02A 2KE5A 2J0QA 4LWZA 3QVVA 2DFNA 4BECA 4EPWA 4GI7A 5HZHA 2XGJA 1F60A 1XNJA 5L8VA 2O8CA 1E9CA 3A1UA 3NC1C 1UADA 5FUWA 5CJPA 1L4UA 1G7SA 3R8CA 2JA1A 4F4IA 1O87A 5AJVB 3QSYA 3SJCA 2GRJA 4EFLA 5FL7A 3KQNA 1FQKA 2XSZD 2XITA 5SZJA 4LJ5A 5P21A 3L0PA 4HLCA 2N46A 2ZREA 2CE2X 3B82A 4LHXA 2VHCA 4QFMA 4XH9B 4AKHA 2BBTA 1JR3D 4ZDIA 1KOFA 1OE0A 1ESMA 1XX6A 1CP2A 2PMKA 2V9PA 3Q7QA 3CRMA 3QG5A 3ZS8A 5DNYB 2WHXA 1G9XA 1XCPA 2F1RA 1S1MA 1ELOA 1I4LD 1ZNWA 4GSYA 5JEEA 3KTAA 4EPTA 1OV4A 4AKGA 1Z63A 3UPUA 1E9EA 1GSIA 2D7CA 2ZANA 3GMTA 3OIYA 4QNRA 1UKYA 2IWHA 4NCKA 3R7WB 1Y3AA 2CVHA 4BZPA 5M04A 1EK0A 1FUKA 3NBFA 1GL6A 2YNMA 1E1RD 1E2LA 3A4MA 3GJ8A 5FUYA 4RFVA 2HJVA 3G0HA 421PA 5KDOA 2ZAMA 2IK8A 2GXSA 4HYYA 1EGAA 2CL7X 4PPGA 4BUJA 1C9KA 1VYTA 1ZIOA 3EX7C 4JJKA 3LVRE 1G21E 1R8SA 4DCVA 3L82B 2WIBA 4GT1A 5J5CA 3O8RA 4DDTA 4JBXA 1DAIA 3B60A 4KCGA 4DSOA 2Q9BA 1BYUA 1OXTA 3E2IA 3VX4A 1QHIA 4AIIA 3H4MA 1RJ9A 4RKFA 4DEYA 2BJVA 3I32A 1OXXK 4KXFB 4EPRA 4QBIA 2IL1A 4XWKA 3V4FA 3CH4B 2VBCA 3B13B 3SFZA 2GXUA 1SKYE 1Z0AA 2D06A 1DAFA 2AKYA 3IEUA 1OH5A 3QIAA 1XZPA 2FSGA 3B1YA 1CF4A 3BH0A 3NBZC 3MRSA 4US1R 3C14C 5AJZA 2E9SA 2LKDA 4X8MA 3AM1A 4NTZA 4LHYA 4Y0VA 2V1XA 3UWOA 1NBMD 3CRRA 5FUXA 5J4KA 3BC1A 2QRNA 4TYNA 4JL5A 3KDSE 3I5YA 3MCAA 1KO4A 1MRNA 1SVWA 2EWVA 2GJSA 3IO5A 4BLPA 3ZYCA 4KI0A 1E2KA 5KNCA 2ERYA 4LPKA 2BBWA 2Q3HA 1EFUA 5FR1A 1ZNZA 5J4YA 3P1JA 2BCJQ 5DYIA 4P4SB 3SOPA 3ZLJA 2FJUA 2AD5A 3AQ4A 3CUEF 1L2TA 2QENA 1O3YA 1T3SA 2PT5A 3U7FB 1FX0B 2FMXA 1VECA 1OW3B 3IIMA 1DELA 4M1KA 3ICEA 3IQWA 1OXUA 1NVWQ 1MO3A 1KI3A 3ZQJA 1NMXA 1KI2A 1ZBDA 2PMDA 3GLHB 2IUSA 5JBQA 2JDID 4QJ3A 1YRAA 4Q00A 1N6PA 1SVLA 2JLZA 5JSZB 1N2CE 1QG2A 1BS1A 3PXGA 3K09A 4HLUA 2QORA 4P3YA 1IHUA 1Q3TA 1UDXA 2FH5B 1LFDB 4PC7A 1KK2A 5IDVA 1G18A 1RIFA 4D82A 3UATA 1M7GA 1JEEA 4FMCF 5KSOA 3QNUA 2AD1A 3EC2A 3I1FA 3CWZA 2IS2A 3TJZA 3EIHA 2PZFA 5JHGB 3L43A 2IS1A 1TL7C 3TUJC 1TU4A 1GFIA 5SZHB 1KO1A 4WA7A 1AZTA 2ECKA 4K8OA 3VKWA 3MG9A 3WMGA 1I4TD 1GZSA 2G1KA 3BH7A 1P75A 4XOIA 4C0BA 5HTKA 3BB4A 1R5OA 1T4GA 4DLSA 4EKDA 4ZI2A 2GTPA 3SN6A 2EYUA 1VCIA 3DEFA 4TQAA 1R0ZA 4HDOB 5D3MB 4FMDF 2FPKA 1D9XA 3EZ7A 5L3VA 2AWOA 5F9FA 2VHJA 2FG5A 3GJ7A 4OYHA 3M4YA 1AIPA 3Q3JB 4LV6A 2WMNB 2JJ1D 1F6BA 2V7QA 3CRQA 2CCJA 1P6XA 2FF7A 1VCOA 3C5CA 5CJ2A 1SQ5A 2ZU6A 3K1JA 1TADA 3UWKA 1XZQA 5DGXA 1TQ2A 1E9RA 1Z0DA 4WIAA 4TYWA 1XMIA 2FOLA 5C4GB 4F7WA 4HB2A 2RGCA 4AKEA 1F2TA 5JEDA 3IUYA 4Q48A 4DSTA 2H5EA 1ETUA 2HUPA 3D8BA 2HJGA 2DFKB 3NDBB 5LD2B 1KTVA 3ETLA 3GCGA 3KUDA 3FGNA 4HAZA 4Z51A 4BE7B 4TTQA 1ZYUA 4HI0E 4LBYA 1KDPA 4NBSA 3GQBA 1VG1A 1WP9A 2P5SA 4LV8B 4M22A 1YE8A 3P4YA 1F3OA 4YMTA 2F9MA 1QHGA 2OFWA 2PT7A 3KXKA 4LJYA 1M1YE 2D4HA 2GAOA 3CBQA 2J7KA 2PEZA 4G5SA 1N3BA 2UKDA 1S3SA 2REOA 5F3WB 3DHWC 2F7SA 4MYCA 4C0AC 1YZTA 3A58B 4C2TA 4MUBA 5F98A 5LB2A 1PVOA 2Z0MA 3THYA 5AR1A 1NLYA 1Z83A 2FEMA 4TMZA 3RS4A 4AK9A 1CR4A 3WRXC 1GRQA 4A2QA 1DAKA 4HB4A 2GXQA 1DO2A 1FUUA 3R8FA 2DCUA 2ZRJA 4EJSA 1XJ0A 5LPNA 1F2UB 3W6OA 3LY5A 2IA5A 4B71A 2KSQA 1AK2A 3JZAA 1ZAKA 4US2R 1XB2A 4ERNA 3RS0A 5JJLA 3MJHA 4C0JA 1HV8A 4O0MA 2QL6A 5JWHA 4B6EA 1W4CA 1M7HA 3K53A 2OO7A 3NVAA 1TQDA 2XZPA 3FKSA 1JBKA 5DIFA 4LJ8A 1PJRA 2DHRA 1FTSA 2VA8A 1UPTA 5FPKA 1OIVA 1N25A 2DWQA 4F91B 4Q1CA 4Q4JB 3GLFE 2QBYB 5G3YA 4JVLA 3GLFA 2WWXA 3QXSA 2CL6X 2H17A 4UKDA 2AXNA 5EE5B 1KJYA 1YKSA 4Q4AB 5LB4A 2DR3A 5CLLA 1W4AA 1J70A 3X1DA 5HKKA 121PA 1II8B 2ZRPA 3QE0A 4QRHA 5IHPA 1CR2A 3IBYA 4A8JB 4RZ2A 3Q72A 2DB3A 1RZ3A 4AI6A 1JALA 1KJWA 1HT1E 1N0VC 2EW1A 4E03A 1Q1ZA 221PA 3O8DA 4LK2A 4PSKA 2GBLC 2GKSA 3NBXX 1FQJA 3RS2A 4BASA 2QT1A 2XTNA 3W6PA 3O8BA 1J90A 2ZRHA 3I72A 4Q4LA 2RGNC 3I92A 4DVGA 4TLCA 1COWA 2CLDX 3GJXC 2IYVA 1F48A 2GJ9A 2QPAA 3WMFA 4DLUA 4R98A 3HU1A 3IPXA 4RD1A 1T9HA 3K70D 4Z8YA 2YINC 3TR0A 5GJVC 4UNPA 5IF9A 4A2PA 4PAOA 2NMVA 5AUNB 1S9HA 4JVMA 1XBTA 2JJ2D 4P32A 2K5UA 2IWRA 3TE6A 4MDEA 2OILA 1P72A 1G8GA 1XEWY 1NMYA 2QAGB 1KO5A 3A1VA 4KV9A 4RD3A 1C4OA 5FTLA 4LOAA 2G0TA 1FP7A 3BERA 2VF7A 2OE2A 2ATVA 4LC0A 2C99A 4LHWA 1ZM7A 4LYJA 1XMVA 2R6CA 3ASYA 2IT1A 5BXQC 2BCGY 4RD2A 1KI8A 1YR8A 2A9KA 4R2HA 4M0LA 3KKMA 2V3CC 2WWGA 4HB3A 3N70A 1D5CA 2G88A 2OCAA 5K8LA 3LO5A 1ZINA 1D2MA 2XJ9A 3W5JA 1ONBA 2OLKA 1ZIPA 2OXCA 2W2VA 4M21A 1IQPA 4Q7MB 2IEYA 4ITRC 3BBPA 3LBIA 2ZXUA 3CIOA 1KDOA 2HYDA 2ZRBA 4DCUA 3IBGA 1KI6B 1KI9A 4IDHA 4N0DA 4MYHA 4CEIA 2PX3A 3FFAA 1FMJA 3H84A 1G64A 2WICA 3RANA 2W6JA 3HWSA 2JAQA 4RFSA 2Q3MA 4BZXA 3KKNA 3U7GA 3AGQA 1MABA 3QOFA 2DWOA 5KNDA 1NF3A 2IS6A 5L3SB 4QM7A 4DLTA 1ZC4A 4Q7LA 2IYUA 1P2TA 1BIFA 1L7VC 1KMHA 4TL6A 3WHKA 2ZSBA 2H1LA 1VCMA 1A82A 4A0RA 1XD2A 3RVBA 4A4DA 2J5XA 4XD7A 4E09A 3QEOA 2F9LA 2G77B 2HDNB 2RCNA 4PZYA 5FOTA 4MRRA 2OAQ1 3SEAA 3ZVMA 2YOFA 3Q9LA 4LUCA 3GP8A 1KAGA 3CZPA 4TQUS 4MGKR 1L8QA 4C3ZA 3OZXA 4RSGA 3U44A 4V0NA 5D3QA 2EYQA 1N0UA 4ESHA 4I4LA 1E94E 3WP1B 1IY1A 4MH0R 1QVAA 4NL4H 5FOVA 2ZI9A 2IHYA 3PUYA 2FZ4A 3BK7A 3RSOA 2ZJ2A 3QQ5A 2QPOA 2ZUBA 2VF8A 2Y8EA 4V03A 3SJZA 1AKEA 1BYIA 5DSZA 1G7TA 2PLRA 3T1OA 3PITA 3PVSA 4D26A 3TAUA 1AJEA 5BW8A 3VR2A 1Z47A 3U61B 1E2HA 1GWNA 4AWXA 1H8EA 4PPQA 2FX3A 2FPMA 2D3WA 1GOTA 1KSJA 4IEEA 2IYWA 4NYMR 4Q66C 3U3KA 2J3EA 5EP3A 1E9BA 3U3RA 2ZJ8A 5KNBA 1AQUA 2Q3FA 2XOKD 2Z83A 1II9A 5AJXA 1G6HA 5KU1A 1CULC 3DOEA 2Z5FA 2QN6A 2WKRA 4KLNA 2YYZA 5BYKA 2BM1A 2ODWA 1N5LA 2PL3A 4PHGA 2WV9A 2QM8A 4L9SA 4TN1A 4KFUA 2MMGA 3N2IA 4WXRA 3THOA 2EFGA 1N6KA 5JCPA 1TMKA 1XXHE 3C16C 2O8FA 1UBGA 1PLLA 1XXHA 3IDQA 3QKRB 4R7ZA 3K9GA 3VNUA 3TIFA 1K6MA 2OAP1 4ZIRA 1UKEA 1NY6A 2X8AA 4C0KA 1LV7A 1W7AA 1J2JA 1IN7A 2RGGA 4I81A 4S2EA 1G20E 2RGDA 3I4LA 2VEDA 1SXJB 1W44A 5LD2C 3AVQA 4JLOA 4H1UA 3RHFA 4YDHB 3SR0A 1VIAA 1Z06A 4GNKA 4D4KA 3K0CA 2P67A 3DKVA 3LXXA 4KFRA 1R5NA 3LLUA 2P0EA 5FI0B 1U8ZA 2ZYTX 5HE8A 1CJMA 2WM9B 2X2FA 3LLMA 4AG5A 4OK6A 1E4YA 5FBWB 4BGDA 3PENA 1R5BA 4IVPA 4Q01A 3UG7A 5JWOA 3C41J 2QP9X 3G5UA 3MWJA 1XTRA 2B7BA 2H16A 3QXHA 5C2JB 3OFND 1HURA 1M2OB 4A9AA 2WWYA 3JVVA 3ZD6A 4IJMA 3TVDA 2WIAA 1OFUX 2ORWA 1RC8A 4UXHA 1LF5A 2QMUA 2CVFA 4KVAA 2EFEB 1IY2A 2GZDA 4JKYA 621PA 1Z2CA 3KKPA 4CZ2A 5FH9A 2WMOB 1QVRA 4Q9KA 4A0HA 2HYIC 4TTPA 5F2EA 3WYGA 4ILEA 2WSSD 2Q6TA 4XSGA 3TH5A 3THWB 1E9AA 2RHDA 1OYWA 3NDPA 5FBRB 4HAUA 2IS4A 2ZUCA 4LYFA 1CS4C 3H86A 4MRSA 1X8KA 2CL0X 4LCBA 5EP1A 3TLXA 2XNDA 4OQLA 3CW2A 3UMRA 4EFNA 2XJ4A 1ZM2A 1Z2AA 5DN6A 1OKKD 5E4FA 3I61A 1KI1A 5C1BA 1S8FA 2HCJB 4DLYA 3X2SA 4F4JA 1HUQA 2KBEA 4XWAA 1VMAA 3DM9B 1SVIA 2QMOA 4V0LA 3VTKA 3QBVA 1E79D 1JXMA 3WYAA 4P33A 2OLJA 2F43B 4CEHB 2AFIE 3WBKA 2EQBA 3IPYA 1ZU4A 1OLOA 1QF9A 4L8GA 3UMFA 3WNDA 1DOAA 4DT1B 4LYAA 4A8JC 2KBFA 2C9YA 4DLRA 1BMFA 5IT5A 5C18A 2DPXA 4NCJA 4TMVA 3CRVA 1U9IC 4LJ6A 4PTLA 1XD8A 2FGKA 5H1YA 3HPRA 3OAAD 1T5IA 1N5KA 3CPEA 2ZVQX 2LCFA 4Q1EA 3S1AB 1VPLA 1EWQA 2Q0HA 3BFVA 3HDTA 4V0KA 4HAWA 1ZM9A 4IW3B 1FW6A 1ODFA 1CXZA 2A2ZA 1S3GA 2O8EB 4A36A 4P31A 1KSGA 1G5PA 1A1VA 5FPYA 3CNNA 4HZUB 2RGBA 1J8YF 1TUIA 1XRJA 3CH5A 4TMKA 2R9VA 2ORVA 3RLFA 1X86B 2YHSA 4FMDB 2QAGC 4E07A 5CB8A 3QPUA 1SKQA 1GKIA 3KUCA 3FKSD 4CW7A 2JCSA 3HYRA 2JJ8A 2BWJA 4KAXA 2YOHA 2R44A 2ZE5A 2J59A 3GEHA 2W58A 3FPAA 4QM6A 3RYTC 2ZSAA 5KTYA 3T1QA 4OL0A 4ARZB 4YMVA 1JPJA 1NSFA 5GJWC 2IYLD 1DAGA 2VTKA 2H8KA 1Z0FA 3KXIA 4HAYA 2P2LA 2CDNA 3UMSA 5EJEA 1AZSC 3NH6A 1M34E 2FE4A 5HKKD 4PC3A 3SBEA 2GZHA 2C8VA 4FWIB 3D3QA 3H0KA 4PPNA 1XU4A 1RRGA 4TMXA 1OIXA 1Q21A 1SXJD 4Q02A 3I8XA 3KJIA 1OXSC 3EAQA 3KKQA 4MYUA 2IYSA 4Q1AA 1T3HA 1U90A 1E2IA 2UZ3A 1HQCA 1R7RA 4B3CA 1ZUHA 1G8FA 4JLMA 4Q4HA 1P73A 2QPTA 3C7KA 2G6BA 5AJYA 2Z43A 1W1WA 3MGCA 4Q9HA 1N6RA 3FMOB 4RCZA 1W47A 1COWD 2HCBA 3BRWD 2WVJA 4IHQA 5DISB 2NIPA 2KJQA 3TW8B 4JLDA 2WOJA 3NC0C 3QVUA 4NCNA 4V02A 1S0UA 5CYOA 2YVUA 4JLBA 4JLKA 3KZ1E 3LFUA 2P5TB 2ZRGA 3ZDQA 3CNOA 1DAMA 1RE0A 3C15C 4CEJB 2C9CA 2XAUA 4B3XA 5GJBA 1WF3A 1SGWA 4IOKA 3K0FB 4O3MA 3SYLA 2D62A 3OF5A 3GLGE 2OCPA 3GLGA 4DB2A 4YXWD 2P6UA 3QKSA 1OFTA 5CIWA 5B2ZA 3LWNA 1A5TA 3EC1A 5E7MA 1AS3A 1A2KC 2ZJ5A 1TF2A 1TF5A 5L3QB 2PCJA 1QRAA 2DFTA 4C7OA 4B47A 1FPMA 4LJ7A 1KI4A 3D31A 4HUQA 1XMSA 1XEWX 3CNLA 3TNFA 2GVDC 1RRCA 1U8YA 3CR8A 1HEIA 4NH0A 4G5QA 4S35A 1P7CA 1VIYA 4UNNA 2ONKA 1NRJB 3ZJYA 4UNQA 2VHUA 4B2LA 3LQRA 1U0JA 2OG2A 1YRBA 2ZJOA 5L3RA 2QTFA 4BLSA 4J0QA 3AVUA 2ZJZA 2JLUA 1VKJA 4B2PA 1YU9A 4LC1A 3UKDA 1L4YA 1Z22A 1W5TA 1UM8A 4B33A 1B23P 4FD2A 1WQ1R 2YZ2A 5JI3E 3BAFA 1ZM3A 4ZDWA 2GESA 4HEJA 3GLIE 3GLIA 1QBKC 8OHMA 3X1WA 2TMKA 3OEHA 5EXPA 3RAPR 3F3YA 4B48A 2OCYC 1OHHD 5A0FA 3LD9A 3RNLA 3GJ6A 4D4LA 4BFSA 4OI0A 2ZR9A 5G40A 4CT4B 2ZJBA 3PFIA 2ZJAA 2OZEA 3FDIA 3M1IA 4OJQA 3SU8A 2CCGA 4NU0A 2PZEA 2WJVA 2ZI4A 4MA4A 1EWRA 5KUTA 3QF4B 5LBIA 5UKDA 1U81A 2PLFA 2X77A 3AUYA 4MUAA 4B3GA 1CEEA 2B7CA 1Z8FA 2RGXA 3LNCA 5J4HA 5KSYA 1ZC3A 2AK3A 1XPRA 1SXJC 4R2IA 3VR3A 2NTYC 4QBFA 4B3DA 2FWRA 2J1LA 3REFA 2GVZC 2R2AA 1JAHA 1R0XA 4NCHA 4MDFA 2V6JA 1Z6GA 3AF4A 3D7MA 3GPLA 3I73A 2G9NA 2A5JA 4NMMA 4TMWA 2MSEB 2H7VA 1LF0A 3ZZTA 5FBVB 4F4CA 4QJ4A 1SULA 5J40A 1Y63A 3M6AA 1DPFA 1M74A 2GA8A 1AGRA 2ZRKA 1H8ED 1KKLA 2GCOA 3N5CA 1KHTA 4GRAA 1OPXA 2VQSA 2R62A 5JHHB 4RJLA 2FFHA 3T34A 4Q4JA 3RWOA 1GILA 4UQOA 1H65A 1X1RA 5FBQB 2GXAA 4BLTA 1FL9A 1TEVA 4M2LA 2WKQA 1SVSA 2QGNA 1E3MA 2QI9C 2BBOA 4M9XA 1CJKC 1P61B 4JLAA 1B0UA 3DO6A 3LW7A 3QKTA 2JLWA 5KSPA 1W2HA 2CXXA 1YR6A 1XPOA 2OUKA 3WMEA 1G3UA 3C5HA 5EZ5A 4BFXA 4LX0A 2VP5A 2Q9CA 2WTUA 2EVWX 4M9ZA 4Q47A 5JZVA 3LBHA 1EX6A 4OK3A 1IJEA 2ZE8A 2I1VB 5FTMA 5JRJA 3TGPA 2YJTD 1H8HA 1HQYE 3DM5A 3OEEA 2ANCA 1ZCBA 3DOFA 1XEXA 1OXVA 3U4QA 2XXAA 2ATXA 1FMLA 1EXMA 1JXOA 5GVSA 3FMFA 4EQ6A 5CK5A 1AN0A 4TSFD 3K0AA 1J99A 1R6BX 2WJGA 1P3JA 3GJ0A 4Q21A 3NBYC 1GRNA 1IXZA 2ZROA 4DCSA 2D2EA 3CLVA 3ZIAA 4PXAA 4URWR 3KXLA 5K8UA 3K70B 1MOZA 3T5GA 1NVVQ 2HF9A 3JVUA 3WP0A 4EPYA 1R10A 5BWMA 3EZFA 3I3SR 4PZLA 2O8CB 2GWHA 2CNWA 1K5GA 3TUZC 4XVRA 2QZ4A 4KO8A 2J0UA 1ZNYA 2BKEA 4Q9JA 4ABYA 1Z0IA 2OXRA 4HUTA 2F3TA 1VTKA 1E2EA 2JLSA 1CLUA 1OFIA 1WA5A 2DFLA 3PUXA 3BIFA 4LJ4A 3Q85A 2VL7A 3NTUA 4LHVA 3DL0A 2FZLA 2C98A 5JJIA 2GJ8A 3GJ3A 4FWTA 2QA5A 2XX3A 2ZRAA 4US0R 1TQ6A 1CIPA 4TT3A 2FDCA 2ZS9A 3X1XA 2J9RA 1ZMXA 4PC1A 3HR7A 2RGAA 2O0HA 4IVRA 1E0JA 3GD7A 2ZR0A 1UEIA 4RZUA 4DWJA 3QG1A 1HYQA 1V43A 2E87A 2OEPA 4JBWA 3B8HA 3KTAB 2X2EA 1E2QA 1PV4A 2GZAA 2YC4C 2W83A 3AUXA 2VH5R 4XVQA 1DAHA 4B34A 4C0HA 4IXMA 2ZJYA 2ZRNA 4AYXA 3NWJA 1NLFA 3FHCB 1TU3A 1NVXQ 1QDEA 1U2RA 2AL7A 3VX3A 1DVRA 1NIPA 2WPDA 2AWNA 4M9QA 1BMFD 2QRZA 4DCNA 3W3AA 2QE7A 1LVGA 3VNVA 4D6PA 4R9UC 4URYR 1EESA 2SHKA 1GTVA 4TLBA 1HT2E 3K8YA 2CK3A 3K0EA 2QP4A 3VU9B 1NNEA 4CVNA 4OI1A 3U6KA 4Q9IA 1WBDA 3P4XA 1W2GA 2R8RA 2IYQA 2XTMA 2ODNA 1YZLA 2QQ0A 2ZETA 3MWLA 3SQXA 3W6NA 3DVLA 1VG0B 3FKQA 4D4JA 4OI4A 2DWPA 1KK1A 4OI2A 2QTVB 4BQSA 4PHHA 3T35A 5JRZA 1D2EA 3V4RA 1Q44A 4DDWA 4ESVA 4A6XA 2J7PD 3F8TA 3UXMA 1RJ9B 1N0WA 3CX6A 3EA5A 2J41A 1MO5A 3CWQA 2IYXA 4WVFA 4AG6A 3THXA 4TLDA 2OBNA 2BMFA 2ZITA 4MYTA 4GOXA 3RC8A 2ERXA 4ZI3A 3F5FA 3NG1A 4ZCIA 3R9XA 2F3RA 1G7CA 3PR1A 5BN5A 4M8NE 4DHEA 3PIRA 2O52A 1W0KD 2A5YB 2CJWA 2IYZA 2CEAA 2RB4A 2O5VA 2REXB 5IK2A 3A4LA 1RKBA 5DI9A 3AV0B 5CIQA 5EUMA 1CTQA 4QGAA 1Q3HA 2ZS7A 3WNBA 2RGEA 4ASUD 1XCMA 1LW7A 2ODEA 1GVNB 3LV8A 3NEYA 3NIBA 4M1YA 2A5DA 2VP9A 3AF0A 2D7DA 4GDFA 1G6OA 3NEJA 1KJZA 1NVVR 1VG8A 4B44A 2W6ID 2PX0A 1E2PA 1WXQA 1KZ7B 4Q1DA 1DADA 2AX4A 1G17A 3VKHA 1P62B 2WOOA 3CONA 5GVRA 1KSHA 1OT3A 3QKRA 4KBGA 2FN4A 4KU4A 4YMUA 2ZE7A 2FFQA 1HE1C 3EXAA 4TYQA 3RS7A 5K8IA 2VIIA 4JZKA 2ZQ5A 1QHHA 4NYMQ 5HCNA 2FEOA 4JLJA 1XMJA 1UF9A 2JATA 3J81k 2IUTA 4LJ9A 3TRFA 3RRMA 4RKEA 4IDQA 1GNQA 4QC2A 2ZYUX 4WZ6A 5JMTA 2F55A 5HPYB 5EE0A 2F1HA 1M8PA 2NQ2C 3L2OB 3L0IB 1EFRA 3EWSA 1T3LA 1P9RA 3MLEA 5FTKA 5H70A 5C4MA 4WOPA 1JJVA 3UG6A 4D2IA 1KMQA 2P6NA 5EXXA 2ZE6A 2ZRMA 1OH6A 2VSFA 4IFBA 2V1UA 2QAJA 2IX3A 3LW8A 1RYFA 1NMZA 2WWHA 5FL7D 4L5BA 3RWMB 5BN3A 2IYYA 1A2BA 3AP1A 4Q03A 1MRSA 1E4VA 4DSUA 3E70C 4G3XA 1IXSB 1LNZA 4PPFA 1KK3A 5FTNA 4HZIA 3IIJA 2WAYA 5KDDA 1KY3A 2D74A 1JR6A 4DRZA 2PJRA 2ZRFA 5TB5A 4PQRA 1ANKA 4EFMA 3BFKA 1S1CA 1GG2A 3NHAA 2V8OA 4JJZA 1UEJA 1JJ7A 4UJ5A 1OSNA 1JB1A 4W7SA 1CJVC 4FINA 3T12A 4DDVA 3SHWA 2OM2A 2O8BA 1OJLA 2IYRA 4Q7KA 1VYUA 2WSMA 3AKDA 3CKLA 3U7HB 4KHZA 3FB4A 2QMEA 2DYKA 4KYUA 3KJGA 3P26A 3KJEA 1OF1A 4IOJA 4TLEA 3EPLA 4KJZA 2R6AA 2QUZA 3ZQ6A 4A82A 2GK6A 1G7RA 3TQCA 4JVNA 2ZAOA 3QEJA 3B1VA 4BZQA 5CYPA 2FSHA 3P32A 3A37A 4NZYA 1TAGA 3U3JA 4B43A 4MKGA 4B73A 3REGA 3IHWA 4LZZA 3RRZA 2HXYA 3K9LA 3K0SA 2R65A 2HLDA 3CRW1 4HDQB 4ZO4A 1YR9A 3ICQB 1IONA 4FCWA 4BLOA 3EWAA 2MMCA 4PR0A 3ZD7A 4BFZA 3A1WA 1WCV1 1VYVA 4TQ9A 4TZ6A 4QJ5A 4M53A 2IXEA 5DHFA 1AS2A 2RAPA 3MWKA 1JI0A 1R0WA 2BMJA 2F1JA 1G4UR 3AGPA 4JLPA 2CLSA 4DLVA 4RVCA 4NKRA 5EP4A 3ADDA 2NOAA 3THYB 2QT0A 1G3IA 1TUEA 2ZI5A 1NVUQ 4G5OA 3SE0A 4B2IA 3K70C 3A8TA 1HTWA 3SFVA 1W4BA 4EIWA 1G4AE 1X6VA 4OJKA 5KSZA 1W4RA 4EJSB 5FOWA 2QTHA 2XB4A 4D0GA 4LDJA 2JEOA 1NBME 1NLZA 4BEJA 4TMTA 3FYHA 5DI3A 1LB1B 2BKUA 3NXSA 3T1VA 1S4QA 4ARZA 3KL4A 4B32A 3B85A 3U7EB 3MFYA 1FNMA 1RVDA 3FVQA 1GM5A 5B64A 2XZLA 3B7GA 4I1VA 2PEYA 4DB4A 2BJWA 1GITA 2Z4RA 4U5XA 5KDLA 3CPJB 4ZCMA 5FI1B 4M9SA 1XCGB 4BFUA 1V5WA 3GLFB 2VLIA 4GZLA 1Z08A 3RRNA 4PX9A 5TY0A 3E5HA 4W9MC 1XF9A 1ESNA 4O25A 4NE2A 4DLZA 3OIUA 3Q7PA 4JLVA 2JDIA 1XTJA 1RYHA 2BHRA 1AS0A 4MKIA 4ZDKA 3AVOA 3TQFA 4BLQA 3RABA 3MWYW 4Q1FA 3AB3A 1Z6AA 1ZD1A 2QNRA 3SYKA 2NO7A 2VP6A 1YR7A 1QG4A 3ZIAD 3QJYA 1E2JA 1MKYA 3MJRA 3MMPA 3QXXA 4BLRA 2MSCB 4OQMA 4Q18A 2B8TA 5AJWA 5CITA 3GJ4A 3DZDA 4O2LA 4ON9A 4W5WA 5FR2A 2IXGA 1DAEA 4GBMA 2GCPA 1KO8A 3EZ6A 3CZQA 3L0SA 2NZ8A 1MT0A 2QG6A 2X19A 2A5GA 3AVPA 1NN1A 5KPDA 3V00A 2UVQA 2VHTA 3AF3A 4IVQA 1MR3F 5KYKA 4TL9A 1E1QA 3DMDA 1US8B 4M1WA 3QENA 1PUIA 4QGFA 4NP6A 2V7QD 4DXAA 4FMBB 3I62A 1U99A 1GDDA 4I1UA 2AHOA 1P9WA 3CR7A 4Z54A 3NHBA 5TV2A 2GBLA 2ZSDA 4TTRA 4DUGA 5SZKB 3QPVA 4HSEA 3R7WA 4Y0AA 2RGNA 1G8HA 2FSIA 4DLXA 4EPVA 2JJ1A 1SVMA 3TK1A 4Q19A 3KQLA 3B9PA 4F93B 1FZQA 5HR5A 4PSVA 2OCBA 521PA 3TW4A 5H68A 1XTSA 4E22A 1N6IA 5E3HA 1A7JA 2AN9A 4C0LA 3V9PA 1X3SA 4Q1BA 4QHSA 2C77A 1LS1A 3HPQA 1TTTA 4K81B 4RZ3A 3BWDD 3T5DA 2CMKA 4FXPA 3A6PC 2BV3A 3WY9A 1NJFA 1G16A 3FWYA 4CEIB 4L16A 5J47A 1Q1BA 2ZU0C 1EFCA 3HYTA 5BQ5A 3W8RA 1XEFA 3DPUA 3MSXA 2QY9A 4RFSB 1W48A 1S96A 1NKSA 1MABB 4Z1MA 1E2GA 1VHLA 4C30A 4B76A 5FOXA 2XTZA 2I4IA 1U0HC 3CX7A 1IN8A 3QF4A 2ZRLA 1KMHB 2YC2C 3SJBA 2CHVA 2OBMA 5K8TA 1Q0UA 3TBKA 2J46A 3PEYA 4PANA 4W5JA 3P20A 2NZJA 3K09C 1XDBA 3DDCA 4HLUC 4NCIA 2WJIA 2HF8A 1G19A 3CF2A 2KWIA 1E99A 3IHLA 5JS8A 2NO1A 2BMDA 5CK4A 1WMSA 3QBTA 3U44B 1G3QA 2V6IA 3UIEA 5FPTA 1NSTA 2FFAA 3LVQE 1R4AA 3FHOA 5JWRA 2JLYA 4YDSA 1OB5A 4GOKA 3ZGXA 4P4SA 4DC9A 1CRPA 2CBZA 1Z0KA 1VCNA 2FFBA 2VYFA 3AEZA 5AK0A 3MUFA 5EXTA 1DEKA 1T0HB 821PA 4AYWA 3BXZA 1FX0A 1UJ2A 2Q9AA 2ZPTX 1KDTA 2ZRDA 2GJKA 4F92B 3K9NA 3PG5A 2WWWA 4TYYA 4XTCS 5HZKA 3GLHE 3GLHA 1TNDA 2BEJA 4IFEA 2QMHA 4XJXA 4M4SA 5JSZA 2CHQA 3EA0A 4AURA 3ECCA 4GP6A 4WXPA 4JKIA 2I1QA 5ELXA 1E98A 2P65A 4KBFA 4D0NA 3W5IA 3I5XA 2RMKA 3BFXA 3U3OA 4ZDJA 4GMXA 3HU3A 2IUUA 1OIWA 1XTIA 1P2UA 4TL8A 3WNCA 1R0YA 5TDHA 2QU8A 4FIDA 1EX7A 1P4SA 1T8TA 4OKSA 3BS4A 1UAAA 3TSOA 2B6HA 2V54A 2O8DB 2XNSA 4ZIRB 3QF7A 3RDPA 6Q21A 3SDZA 1DARA 1OH7A 1GRRA 2FSFA 4DDUA 3LX5A 1E2DA 2ZS8A 4EAQA 2EWWA 5D3MA 3UANA 1W0JA 1PUJA 1AQYA 2ZI7A 1D6JA 4DKXA 4HDCA 2JLXA 1GNRA 1LTQA 2AR7A 2JJ2A 5E7IA 4D25A 1FTNA 5KHOC 4D81A 2DBYA 4WZBE 3X1YA 2EFDB 4HAXA 3A1SA 1EFTA 4NPHA 3OE7A 4DSNA 3KX2A 4TWZA 1A4RA 2UZIR 5G3ZA 1KDRA 3QXCA 4NYIQ 3EPHA 2BIFA 1W49A 4B3BA 2GEUA 1YJ5A 3SQWA 2AFHE 5FUVA 1QHSA 3AKEA 4BRWA 3PCRB 4DIDA 5F9HA 4CIDA 1G3RA 3TAHA 2QQEA 1VDZA 2IF2A 1DS6A 1ZUNB 5HCIA 3L8ZA 1E0SA 4EJSC 2OFOA 4OHYA 3K9HA 4PC2A 5EXSA 5AUQA 1UDWA 2W6JD 2ZUDA 3T06B 1U94A 3ZVNA 2CE7A 4U00A 3U6BA 2JGNA 5J4LA 4POAA 3ND9A 2WJJA 3PUWA 5CLQA 4AC9A 3HJNA 2Z4SA 2ZEJA 4G1UC 4P4UA 4C2UA 4O2RA 1AA9A 2KI5A 4YC7A 3LBNA 2BDTA 2QGZA 1LY1A 1MO6A 4DIEA 2ZR7A 3W9YA 3R9IA 1W36B 4JYBA 1Q1QA 1R2QA 2WWFA 3LRPA 1SZPA 2CHGA 4HLDA 1UKZA 2AXPA 3HU2A 2GF0A 2HLDD 4XD7D 3A4NA 4JVSB 5EE9A 3W90A 5TXGA 2H18A 3VU9A 4XWOA 1WRBA 4A15A 1II0A 3P27A 5FBLB 3FFBA 3EARA 1T0JB 1TEXA 3FE2A 4LV5B 4URXR 1NG1A 3FHTA 2GJAA 1F2UA 1N6NA 1Z29A 2EFHB 4JT2A 5B57C 1D8TA 1E2NA 4GP7A 3OESA 4II7A 4F38A 1GNPA 4B6FA 1QZXA 3CF6R 4JBYA 1VG9B 4JIMA 4TL7A 1NIJA 2Q21A 5SZIA 1Q12A 1GL9B 5DH9A 2J0SA 1CJTC 1DE0A 5IRCD 3CPHA 4PQYA 4B75A 2QBYA 3KB2A 4LBVA 2C78A 3VR5A 4M1MA 4Q4AA 1G3MA 4QL3A 1GKUB 2FGJA 1J8MF 1II8A 1BO6A 4JMPA 2GEDA 2V4ZA 1HH4A 1GP2A 2G3YA 4A92A 4A8JA 2QSYA 3EZ9A 4LRWA 4DBLC 1Q20A 1U9IA 3M0EA 5EE1A 2QROA 4M1OA 4EDHA 5EQTA 1IN6A 2B8WA 2XOKA 1RRFA 1Z07A 4KSBA 4DCTA 4PO1A 3AVWA 1EFHA 4DJTA 3U60B 1AKYA 1BKDR 3SNHA 2VO1A 1T5LA 4I1SA 1YQTA 2NO9A 4HLQB 4URZR 3N99A 3B1WA 3C8UA 1YZGA 1UBCA 4NYIR 3AH8A 3QPWA 1ZW6A 1DG3A 1P2SA 4Q4HB 3ZVRA 2REBA 1D9ZA 4RCYA 1WDTA 5B30A 3QY0A 3ZZ0A 5CDFE 1R8QA 2QAGA 2PCLA 3L0OA 5CDFA 5CB6A 2A30A 1C1YA 5KOYA 2O0JA 3JZMA 4EUNA 3L8YA 1NL3A 4XTRA 4JSTA 5FFMA 2RKOA 3QXJA 1Z0JA 2N1BA 2ZRIA 1E6CA 4OHXA 4MRNA 2BMEA 4G5GA 1U98A 4BPBA 4X8HA 4MKFA 4QHTA 1CR1A 2PJZA 3OFNA 1E1QD 4I99A 3TUIC 4PAQA 2JIZA 3AF2A 5AWFC 3GLGB 4QG7A 1AGPA 1Z3IX 3QKSB 2GNOA 5C46F 1JAIA 3FMIA 3PUZA 4KODA 3WXMA 4FW9A 2VSXA 1N6HA 4DUGD 2XNDD 5BYJA 4G01B 2QSZA 2W00A 4PSAA 3OIVA 4MRPA 4EPXA 3U4QB 1KI6A 1S9DA 2WSSA 4C7OB 4DZZA 2ANBA 1I4DD 1SHKA 4D80A 4HUQB 1M6NA 5DN6D 2EFCB 3BE4A 3ZVLA 4V0OA 4TYPA 4HB0A 3DCLA 1NKTA 1ZVQA 2VP2A 3LAWA 3NH9A 4OQFA 3W8NA 5JI2E 1W36D 3AVTA 1P2VA 5JJKA 2JASA 4KLZA 3AVYA 4IOLA 1IY0A 4GL2A 3SJAA 2QP3A 3BB3A 2OFXA 5L3SA 5FOUA 3B1XA 3DKPA 1I2MA 1OKKA 5EP2A 3LA6A 3FOZA 1KNXA 3KQKA 4UNSA 1G8PA 3RRYA 1Z6XA 4M1SA 4K46A 4JSYA 1ZUIA 2BC9A 4C9BA 3QI2A 1E79A 1X8LA 1KIMA 2O0KA 1KK0A 3KFVA 4JT4A 3TMKA 1ZU5A 2VP0A 2GCNA 3KJHA 4JL6A 4NONA 3GLIB 4GZMA 3BJIC 2C96A 4Z1MD 1N6LA 5JECA 1GUAA 4IEIA 3EW9A 3LQQA 2IC5A 3VR6A 2ZRCA 4IOMA 1HE8B 3CB4A 2C03A 4QBHA 4QHYA 1DG1G 3OAAA 3KB1A 4N3NA 5A5GA 2J87A 2JLRA 1E32A 1MH1A 4OHVA 2YWGA 2WJYA 3CO5A 4RD4A 1NN5A 5CM8B 3NKVA 4JL8A 4PHTA 3RS5A 1Z6TA 4URVR 3BGWA 1YHNA 1IN4A 1M7BA 1KY2A 4L9WA 1JECA 4XIGS 2BEKA 2GEVA 2R6FA 1G5TA 5TARA 1SKYB 3B6EA 1Z5ZA 1G291 3B1ZA 4MQBA 2HEIA 2ZYVX 4G0NA 2J45A 3LH5A 1E2MA 1NY5A 3IIKA 3K0CC 3MD0A 3TKLA 1FOEB 4CRWB 1QHYA 1Q57A 5TMPA 3T15A 1Z28A 4BFTA 4LSGA 3SS8A 1OFHA 1J7KA 5E7JA 1RRPA 2MSDB 4BFYA 4LY6A 1XWIA 4ZV4A 2VHQA 2GCOB 5JS7A 1BH2A 3E1SA 4QGHA 2W2XA 5A4JA 1G1MA 4IKEA 4HATA 1WBBA 1YVDA 2B21A 2OHFA 1UBEA 1VHTA 4P0TA 5FTJA 3W3ZB 3GEEA 4P4TA 1TF7A 2VRWA 5DYGA 3IILA 2IBMA 2YWHA 3OHMA 3KKOA 3N2EA 1SXJE 4E5UA 4KSCA 1SXJA 1E0KA 4KITB 1JQJC 1XP8A 2QEQA 1U0LA 4PQFA 2YV5A 3QKUA 2C9OA 4IRUB 4ZKEA 2G1JA 1X8JA 2FV8A 2IEZA 3ONWA 4A0GA 4LYHA 1RPZA
chains in the Genus database with same CATH superfamily
2ZKLA 3OJCA 1WVMA 4GLOA 1RXPA 4AWBA 4G1FA 4ZOAA 1PKXA 1TUGA 3LY9A 2YJ6A 3SXUA 1ETHA 1C1DA 3SOSA 1YZKA 3OCCA 3TIUA 4DOQA 3OJFA 3AIIA 1IHSH 3LGTA 3QUSA 1Z5UA 1TGSZ 3MO3A 1W46A 3PHBE 4F96A 3LHSA 2J0UB 3PEWA 3I37X 2JIBA 3DP7A 3Q3KA 4M1TA 1RXUA 2VAXA 1H0RA 4NLLA 4J2HA 4D9QA 1RAIA 2YV3A 3GPIA 3C4JA 3UAXA 2BFAA 4XDGA 1TTHA 3NWPA 3AVVA 1TNKA 2WHQA 3I53A 1ZP6A 1UZUA 1Z6YA 1YJ8A 2Q4TA 1C0IA 3IELA 2FWAA 2F6RA 3U4IA 3WNQA 1RFLA 2Y66A 3HWRA 3SF8B 3RF6A 4Z1OA 1TOAA 4EI8A 4G1EB 4HTFA 1C5SA 4D4GA 3LXRA 5LNK6 3SJUA 4Y10E 1NHGA 3MN1A 5HF5A 3R9XB 4E06H 2E49A 3RHSA 3FF1A 1ZSJA 4JJIA 1YCHA 2WBLC 3QFTA 1W76A 1QO9A 2GF9A 2JF0A 4ZOBA 2XD9A 3KPYA 3C4QA 4XYLA 3COZA 3DMHA 3HJBA 4HJRA 5BSMA 3SIWA 2BTQB 5BPFA 5FAXA 1N5IA 3P7MA 5L7YA 2FZWA 1ZLRA 3PQEA 2H0AA 1OJ7A 2NZYA 5A3JA 2Z2JA 4MGZR 5HRAA 1O5FH 3IG6B 1QOQB 5EJ4A 1Y5MA 4QBTA 3M89A 3JQ8B 3LMKA 4ZXYH 1Z7BA 4KAJA 3HB0A 1KZHA 2ZJ0A 4FI3C 2XWAA 3LU9B 1TFUA 4Q63A 4ETIA 4KNWA 5JNLA 4G26A 2ANWA 1ZPDA 4D4IA 4F97A 5B3JA 1FP6A 4K3UA 1HE4A 5ANRB 3JAWA 2QDKA 4E2ZA 4BO1A 2G55A 5EQRA 1TBQH 1R74A 1Z8GA 5HCUA 1YMUA 5TJXA 3ZWXA 1MQ5A 2HY7A 5FXMA 2BGIA 1FFHA 1V35A 3VVCA 4K8YA 2PKSB 4DY4A 2WM2A 1FI8A 1K8RA 3REQB 1PT5A 3BTME 1CU1A 4UM5A 3HQ4O 1K3TA 1T91A 4JP2A 4F9TA 1Y98A 1WB9A 2ZWVA 3QPDA 3PNSA 1QSGA 5GJ4B 4PC6A 4C20A 2PUEA 1PPCE 3SYNA 2BLQA 1O3EA 1GBMA 3R20A 5A9RA 1DLKB 1AM4D 1HA3A 4EHHA 3RGWS 1WMEA 1E6KA 3ZU5A 4I1YA 1NJ8A 1YB1A 1NFQA 1YMQA 3T2NA 2W4IA 3O75A 5A4IS 4EGCB 3QVMA 2J0QA 5FWYA 2NV2B 3CURA 1P4AA 3T27A 2W7SA 1R0BA 4H3VA 2GD6A 5C0UA 1G7SA 3FF4A 4INHA 2KCOA 2XITA 2O05A 3DDZX 4KMSA 1IOWA 1KOFA 1TTPB 2I6GA 3SBXA 3GRAA 3K16A 3O3CA 2A1UA 4E4RA 1Z63A 3SKYA 2QW0X 2Y1DA 4J1QA 1GSIA 4CFZA 4NCKA 4NA7A 2P0AA 1UXOA 1E2LA 4DLBA 9ABPA 1NVDA 1OPRA 4EF6A 5COBA 1BQ3A 1J1UA 3L82B 4JOBA 2I6SA 4HUJA 4DR2B 3OO0A 4KCGA 4JQYA 3BKXA 1OXTA 1IWOA 1A0JA 2PFSA 3UWSA 3HVHA 1NE7A 4Q0MA 4Y3UA 4JBIA 3RC2A 1XXDA 2E82A 2X0JA 3WAJA 2WTAA 5ERYA 3LUGA 3WWCA 4ZAWA 3IP5A 3ITNA 3S8EA 3BV9B 4QPCA 2ECQA 5J4KA 5AKIA 5BY2A 4YRTA 3GJRA 2Q1WA 3AW0A 5AHRA 3L46A 3ZLJA 5EYPB 4P4SB 4ZT4A 3TQHA 1GPYA 5DHTA 1OA0A 1CVRA 1XKAC 1FY3A 1N2CE 4HLUA 3RTEA 4W1SA 1HNZB 1XNGA 2H6EA 1E1MA 4PZ9A 4FQ8A 5ILOA 3TJZA 3DXYA 4MW6A 2XIQA 2VHYA 4WA7A 2ECKA 1WNTA 2I9PA 3BH7A 4OHOA 1PJ3A 2I91A 4F04A 1MT3A 3ELBA 2FWIA 2HBYA 1Z7WA 2STBE 4JNCA 2AWOA 3E7PA 5H9VA 5ALIA 1QKJA 5KWIA 5L2YH 3M81A 1A72A 4ZKOU 3C3DA 3DEAA 1F2TA 2VJNA 4DSTA 1B8UA 5KAPA 2HUPA 1V3QE 1GQYA 1QCZA 4R1TA 2K6GA 2VDLB 1K22H 3N87A 3GQBA 3QFCA 3CG0A 3K3PA 4EI2A 4DMFA 2J4CA 1UTMA 4PX5A 3DHWC 3LY8A 3KXDA 4KN5A 4QPPA 2DCUA 4DJFC 1KXDA 4BNLA 4LY3A 3GWGA 5BSUA 1J9ZA 2QL6A 3FKSA 3PT9A 3MMZA 3SVTA 5FPKA 4RABA 3X43A 3CSUA 2WWXA 2HNAA 4UHHA 4XYBA 1IE3A 3BIJA 3T7DA 5IF3A 2FN8A 4MVCA 1AMUA 3DBLB 1SUDA 3RS2A 1KGSA 3NHSA 4BYGA 6REQA 1O36A 2O2IA 2WIJA 5LUBA 3LUKA 4EBFA 2SGAA 4E70A 4NENB 2WUEA 3P97A 4AFNA 1JVBA 4DQVA 4KMMA 1P7WA 3BERA 1CO7E 4LHEA 5YASA 1UMAH 3HPTB 1XVUA 1J9GA 1MCZA 1AUOA 3HL4A 4RMIA 1PZXA 4YAEA 3S0NA 2OINA 4DMMA 3L8MA 2R3YA 4E21A 4BGUA 4HZGA 4JJ6A 4KX3A 2ZXUA 1OC4A 4D76A 1ULSA 2GMWA 4QLBA 4IHKA 4OP1A 4YRJA 3AGQA 4HNVA 3E22B 4BX3A 1YL7A 4LQCA 5IXJA 4CH8B 4ZEMA 1T3ZA 5IDXA 3M2PA 4MRRA 2HA4A 3CZPA 3QBJA 4ZI7A 3F9FA 4NL4H 3ADPA 3LA8A 1HGTH 3T3NA 5FLEX 2UYYA 1RHQA 1U28C 1E4OA 3M5NA 1FW8A 5FB3A 2VPIA 4AB8A 3WBFA 3A6JA 2HDHA 1JSXA 4WWHA 2XY4A 4LE1A 1THTA 1SC9A 2R5WA 2R87A 4MUNA 2EFGA 5JXHA 3N7OA 1TMKA 1TIPA 1C2JA 2JHAA 2HMTA 1UFRA 4D4KA 3TGJE 2P0EA 4K9KA 5FYDA 2Z3DA 4QUGA 3DFJA 1RYMA 5JT1A 3UG7A 3FPGA 3K6RA 1UIMA 1NBAA 4P7BA 2DUUA 3OO1A 2QMUA 1FEZA 4KVAA 3BDAA 1JKFA 5FH9A 1GN9A 3DUWA 1T2AA 2Q6TA 2VUIB 2AMLA 5E1MA 1V7CA 3MTIA 4N5DA 4OQLA 3CW2A 4QASA 1Z2AA 5BRRE 2G09A 1IEVA 2HLHA 2FCAA 3BMCA 2I4RA 1GHVH 2EX0A 1G2LA 3L5OA 1QF9A 4DT1B 2BI8A 1BMFA 5C18A 4NCJA 2Y0BA 1ZGAA 2JS7A 3B53X 3W9UA 2IW1A 1KP9A 1Z2DA 1QONA 4BO8A 5TC4A 4DA7A 5BVGA 4C08A 1B2RA 3QWBA 1DWPA 4TMKA 4YRPA 3RLFA 5CB8A 2BWJA 2R44A 2J30A 1CUAA 1QTNA 1ZOLA 4ARZB 2IYLD 2PSDA 5F8ZA 2ZGVA 3ONVA 3PU6A 1Q21A 3KJIA 4MYUA 2IYSA 2J4FA 3HH8A 3DTVA 4BV2A 1WUYA 3ESAA 1SLXB 1WQ3A 3DMYA 5CYOA 2ZZNA 4P7FA 1CQWA 4Y9DA 3QU5A 1GI2A 1DAMA 1WF3A 4AF8A 1YNSA 3TRHA 1WD7A 1DFIA 4YR9A 1RAAA 2G00A 4EI9A 1LMWB 1C3EA 3PTLA 1FPMA 1O58A 2Q2NA 3GMIA 2W2NA 3S40A 4MWDA 4WT7A 4P98A 1P7CA 3ZJYA 2C84A 2IHKA 2X40A 3QU2A 1V2OT 1VJ5A 5IU6A 3RP2A 2FZVA 2X8LA 3WL8A 3ZY2A 1MTNC 4H1HA 3C6QA 1YOVA 3AJAA 4LMBA 4YCMA 5A3RA 1MPTA 1WQ1R 2B5OA 4DIKA 3QHQA 3G7NA 3RAPR 3D6NB 3M6FA 1GLVA 3LD9A 1Q7RA 3RSSA 2GYUA 4QPNA 4PU0A 3PFIA 3LC3A 4FLMA 3OT5A 2PGLA 3SU8A 4N5LA 4MA4A 2JVIA 3NPMA 5FBEA 2JGIA 2Y1LA 1ZVMA 3RUFA 1GRVA 3GY5A 1XPRA 3REFA 2J1LA 3CLRD 1DITH 2R00A 2V6JA 4JX9A 5TVGA 5ITZB 1K3FA 4FE7A 1I4OA 4EA6A 2R62A 5DLEA 1TEVA 1UK8A 2MYNA 1PR2A 2QGNA 3C3EA 1C1QA 3IDFA 3T95A 3OECA 1CZOA 1E64A 2WTUA 4NOMA 1XUIA 5JZVA 2AW3A 1QGOA 3HFGA 1YBMA 1MC8A 5JMOA 4M0FA 2Q6VA 1ACJA 1ZVJA 1KY5A 3VTZA 3D7KA 1IXZA 2JIDA 3KXLA 2A2XH 4WKGA 1GTSA 1KXBA 4RVDA 3RUIA 3USES 2JB9A 6LPRA 4RYDA 1ZNYA 2OXRA 3AR6A 2ALJA 3CCFA 4NS1A 1E3IA 2ZRAA 2VOJA 3ZOKA 4WMDA 2FWNA 4Y2QA 4MQFB 1GUDA 3O5AA 1VSBA 4IV8A 4OPMA 4IL5A 1SR5C 1P4GA 1A4WH 4RDIA 3FHCB 1N1MA 2AL7A 3G5MA 2P9HA 3CEAA 3W3AA 3KZOA 1LVGA 1R0RE 2JI4A 1VJ0A 1FNCA 2ZIEA 4Q9IA 3D4IA 1D2RA 1AI8H 3H2BA 3D7SA 4PCLA 3MJEA 3GPBA 5D2CA 4Y6DA 1K0FA 2QTVB 4FLEA 2BLNA 4ESVA 4FONA 1BJUA 3CX6A 2J41A 4GS5A 2ZITA 4ZCIA 2XYAA 2Q2OA 2QF7A 4JBLA 3K9BA 2X8BA 5JAZA 2NUAA 1HAVB 2Q8QA 5L4NA 3UF0A 2ZS7A 2FR8C 4KFCA 4WKNA 1NJ1A 1V2WT 1LKBA 2D7DA 2JEYA 1E2PA 1JFVA 1BFUA 1RTFB 1AGXA 1E7WA 3VKHA 4LE2A 1S8OA 3Q0TA 1BN6A 4CJXA 3QKRA 1QF6A 5K8IA 1QHHA 2IIVA 3H7OA 2A4RA 3L0IB 2K1QA 2P41A 1PZEA 4NMLA 1G55A 5EXXA 2VSFA 3LGWA 1U0BB 2IX3A 2HO4A 4OKIA 3DONA 1M1ZA 3UYKA 2PS3A 2WABA 3TR6A 5E4TA 2LP4Y 1MCVA 3ZKAA 3COWA 1T8NA 3KQWA 3HV2A 4ISHH 3T12A 4Q7KA 1EATA 2WSMA 1YPKH 3FD8A 1NWHA 4KYUA 1UBJS 4NICA 4B2YA 2R6AA 5DW0A 3RSFA 4P5DA 2ZAOA 1NM5C 4YJFA 4XWGA 5D6OA 4QQRA 2R65A 1K2VN 2EJUA 3PWKA 4ZO4A 1CBWC 4BLOA 1LPSA 1JVNA 1K97A 1KEEB 1UBSB 2AJBA 2VDKB 3KPJA 5DHFA 1NVKA 3MWKA 1U7TA 2GQ0A 1VGCB 1NP7A 5LMCA 2Q5JA 2J95A 3T5TA 4OTZA 1BBRK 1RQ7A 1BRMA 2V5UA 5C8DA 4UUNA 3FYHA 3ESRA 1TA6A 1HRTH 3U39A 4E2YA 3MZ0A 2XZLA 3HA3A 3ORFA 3PE4A 4RF5A 5DKFA 5TY0A 3IX7A 2RAUA 3VR0A 4X8TH 2WF5A 4BX0A 1AF7A 3TQFA 1QGDA 3DYBA 2FR0A 1X1TA 3EGVA 3SYKA 3FUXA 1HE2A 1OKXA 2QLNA 3ZIAD 4C1NA 3UJCA 3LP5A 1KO8A 4WN9A 3IDSA 3AVPA 1GQ2A 2A7XA 1IEQA 5IYZB 4G97A 4FU7A 1CVWH 1F7UA 2WPJS 3CR7A 4U6NA 1NXTA 3IP7A 3HRHA 4H6SB 5CD9A 1M1XB 3OZRA 2LGJA 1AMOA 1N6IA 3ZDYB 4RMJA 1RAHA 1QMGA 5DBEX 4KK4A 4FXPA 2AA3A 3FWYA 3HYSA 1HDXA 1EFCA 2WD8A 3W1EA 1FLNA 3WWPA 1TVMA 2O06A 3TJVA 4LDAA 3U7JA 3CX7A 2XQKA 4Z3KA 3H1GA 3GGPA 1PJSA 5JC8A 5K4GA 3ID6C 2NU1E 3SJBA 4MUXA 2OBMA 4YLEA 1GTL1 3EDCA 3KHKA 3S70A 1ZIXA 4ZVLA 8MHTA 5CK4A 1G3QA 2B82A 1PD0A 4YDSA 2H4JA 2WZCA 1Z6ZA 4UE6A 3Q41A 3RYHB 2CSXA 3GLHA 4M4SA 3EA0A 1Q1AA 3M5WA 1T9DA 4MAMA 3HP7A 1Y1PA 1PGPA 5JYEA 4GUXA 1N2BA 3ZDDA 2G4TA 5EKXA 1XZNA 1OH7A 1E2DA 4YP7A 2E6KA 4DKXA 4CMCA 3LWDA 4WZBA 5DWQA 1FA9A 2ZYHA 2PKAA 4KGZA 2BPOA 1XUGA 4NYIQ 4DIOA 2Q6IA 5EC8A 2I7DA 5JBCS 4DF3A 4BRWA 1K9VF 4J8PA 2QQEA 4ZQCB 2Q5OA 1GNSA 2YJ4A 1GYQA 1BMLA 2FTKE 4ES6A 4ZU6X 1M6VA 1IUPA 3R9IA 1GO2A 3G9QA 2WWFA 3FCEA 1JQBA 2GJGA 8KME2 1Y5UT 3DMFA 1F0RA 4XWOA 4A15A 4L0DA 2BOKA 1BU5A 3FE2A 4BAMB 2PGNA 2WJPA 5B57C 2UUYA 5EMLA 5ESDA 2HX1A 2UWPA 5BNTA 1PEDA 2PIAA 3DBHA 3VO9A 1CJTC 1Q19A 1L0ZA 2QBYA 4AN0A 4JENA 4A92A 2PPVA 3OZ7A 2QROA 3TK9A 1R18A 1IN6A 2I7CA 4DFDA 2C2KA 1T8OA 2PLXA 2JGDA 5AJUA 4DY6A 1T5LA 2AE2A 4I1SA 1JKMA 3G2NA 4O2BB 1NX6A 2O8UA 4XBDA 2RSLA 3GS9A 1MKXH 1JTEA 3WOVA 3ER9A 3ZDBA 2HRRA 4GM1A 4EGJA 3SW2B 1RKUA 2F8TA 3KN2A 5CB6A 3ZX4A 2V7PA 5FFMA 3A7TA 4UULA 1I5EA 5BQ3A 1QG6A 3R9KA 3I1YA 5FV7A 3A7EA 1T34A 4HNUA 1YQXA 1E0DA 4YH1A 3SX0A 4D8XA 3OJ0A 5DKMA 4UPDA 3DSOA 1N6HA 1DT2A 3AJ8A 2QIPA 3ZJTA 4ZANA 4DZZA 5I7OA 3MW8A 3GUVA 1C5KA 4LZAA 1AHTH 1UM9B 3VJKA 2WPKS 4DILA 1WXIA 5JAHA 3MC1A 1E1KA 1GRCA 1QB9A 2BFCA 3GLIB 1QVZA 4IJUA 4UTRA 3FUTA 1XELA 3ND5A 4DIUA 2VNHA 4N3NA 2B25A 2K4MA 5EQQA 2CDBA 2FPIA 4FHZA 2PKEA 1I7NA 3JSAA 2R6FA 1OTXA 5CX1A 4G0NA 1VFNA 3IIKA 1Q31A 3ANSA 1QNFA 1Q57A 3GH1A 2GFQA 4MIKA 4BEWA 2C8LA 5KEIA 3MHTA 3A85A 1XWIA 5I5EA 1NTPA 4GUAA 4I14A 2MTBA 5FTJA 4Y0ZE 1LDTT 4TV9A 5AYVA 1Q7EA 1DG9A 5KI6A 4RF4A 1ADBA 4NZNA 1IHTH 4TMYA 1U3TA 3R5SA 1OX1A 3VFDA 3PA6A 2EBHX 2P9EA 3QPCA 2ZWIA 3C27B 3AEQB 4HP8A 3K9XB 1IQEA 4Q9LA 2YZKA 1RWXA 2FI4E 3AKYA 1ODKA 2D2XA 3GOQA 2UZ1B 4HGOA 3ZHYA 4ACBA 3NV7A 4TZ0A 3L7YA 4LI0A 2J0VA 2FCRA 5T4FA 3BTEE 2VRCD 1CJUC 2DEUA 2F43A 3CX8A 2O6LA 4UXIA 1GKKA 3LHDA 1GPKA 1MLDA 2Q3BA 3FRJA 2GK7A 4O59O 4L4UA 5TPWA 1E9DA 2DUNA 2C5LA 4I50A 3DMTA 1FS4A 2ONJA 3FSGD 3ENVA 4RAOA 3T9DA 4U01A 4KO1S 2GN9A 3BOSA 4HFNA 4I3FA 3QEKA 1BEZA 2J33A 1SZCA 2O1SA 5LWQA 2P6RA 4F46A 4C0WA 3VR1A 4X8OA 2C4FH 3O03A 4YFYA 5B58C 3Q9UA 1CB0A 1S5PA 4PYQA 2IYTA 3SBDA 1H5NA 2FM2A 3V4OA 2PVSA 3H7IA 5CD1A 3RLIA 5D00A 1H8HD 4FE3A 3VUEA 2WAAA 3OEED 3O1HB 1ZM4A 2FMHA 1ZQ9A 1UCFA 1U7HA 2QNIA 1SHHB 1KO7A 4CEJA 1ZXBA 4CT5A 3K0FA 1A5ZA 4JUCA 3VDXA 1ZD9A 4Z8XA 4RIHA 4A1FA 2CNWD 3VV3A 3H2SA 5J4VA 2O7QA 1TZKA 3Q6IA 5E6SB 3GGOA 1OBHA 1UPFA 1TCCA 2ODBA 1W11U 4ZO7A 5AW7A 1P2FA 1LLCA 3ML1A 4BUCA 4XBBA 2NYUA 3HI4A 3LGUA 1NR5A 3JTEA 1PZHA 3ESDA 4KIGA 4V38A 4TKLA 4WESB 1T8SA 1CUBA 2C0CA 1XHEA 1UKVY 1UWLA 2OV2A 2O1XA 4D9FA 4DCGA 1O54A 4JT8A 4Q3OA 1IOVA 2EDCA 1T1RA 4GKVA 3MT0A 4PAGA 1NP6A 4AZVA 2QGFA 1V1RA 1V95A 1WS6A 1KRXA 2D1RA 4LBZA 3I6QA 5CA0F 4D8NA 1HYGA 2H7YA 4Z4FA 4CKWA 4QATA 2LELA 1C1UH 2R8OA 2XT6A 2OC4A 2NO6A 4X6MA 1W34A 2VK4A 8ADHA 3FWPA 4R0VA 3UK7A 5SGAE 3EGDA 3PFBA 4IY1A 5AJTA 1RLIA 2PBRA 3KFLA 4AXXA 4JI8B 4GCHF 3DUFB 1EAIA 1N32B 3STVA 1PAUA 1YQGA 4LXHA 1E9CA 2VGCB 2G1PA 2GKGA 1L4UA 5T7BA 1QVWA 5EODA 3TNSA 3ZHOA 4HX9A 3Q3YA 3HSKA 3R0ZA 5F3RA 3Q7QA 1A9YA 2YHIA 5DNYB 2V3WA 2GEKA 4MCJA 4MR8A 1UJ1A 3GUHA 4J1YA 2QRKA 5HOEA 5LQJA 1Y9DA 2OKCA 3I04A 1PEAA 4IQGA 3HRKA 1CFZA 1WW2A 5SYMA 1G21E 2A84A 4D9KA 2WSIA 2JH9A 3RIXA 2E1PA 1YCDA 2IZ0A 1GA1A 4EPRA 1EA7A 1QO0D 3ZY4A 3TEJA 2HWLB 1C7ZA 3KBOA 2G04A 4LIPD 2ZHFH 2E9SA 2LKDA 4WJLA 1ZA1A 4UC0A 4P38A 3CUYA 1IZ8A 2O2GA 1JE1A 4GP9A 3U80A 3KDSE 2QYOA 4IF6A 5FAHA 1E2KA 4ZEWA 5FR1A 4UPEA 1Z39A 4F56A 3AQ4A 2PW8H 2W3KA 3L7IA 4F84A 1T3SA 1VECA 3SV2H 2CFCA 4D9RA 5DM4A 3TZCA 5AXDA 1GJ4H 2PYDA 5LXTA 3PXGA 1EB8A 4WA8A 1PWEA 1FV9A 3UWIA 2VAWA 1YUNA 2TRSB 1UMKA 5BR4A 2QLFA 2X0KA 3GB9A 2PKYX 3M3SA 3U49A 2HSWA 4TV8B 4ABIA 5LQNA 3BL8A 3L40A 4RY0A 2GZ2A 4DR3B 5F73A 2MSNA 4RM2A 3HL0A 2W6ZA 2WG1A 1R0ZA 5KTNA 2JFGA 1DXYA 2X0NA 3TLMA 3Q3JB 3BYZA 5EJ9A 3K71B 2H52A 2ONCA 1EUDA 4RA6B 4CCYA 4HT3B 3D4PA 2ZSHA 2VU8E 4ABAA 1GZ7A 4X62B 4LZWA 3IUYA 4WXIA 3D0KA 3G0CA 4CMKA 3ETLA 3E2PA 7MHTA 1GPJA 4CT0A 4HI0E 4D57A 4YT2A 3DFIA 2WB4A 3MBOA 4LV8B 5AIAA 5E7QA 2QE6A 3KNZA 1F5RA 1HL3A 3BCUA 3PMBB 4MYCA 4C2TA 4KNVA 2AYXA 1B41A 4LRQA 3WRXC 4FJ0A 1GADO 4KTUA 4AU1A 3WNVA 4EJSA 1E58A 5J2UA 2PX8A 3T1HB 1PJRA 2R5NA 3SLKA 1OIVA 2BJHA 2R85A 1AG9A 1MEJA 3QXSA 2AXNA 4Q4AB 3ZQ4A 5F1PA 4MUHA 3AO0B 2VWMA 1V5FA 2ZJ3A 2ETVA 1SHYA 3FR8A 2B9EA 4MWOA 3RXPA 2DB3A 2Y4NA 3NTRA 1ZUWA 3N76A 5ABWA 4BASA 5B37A 1JILA 4HZHA 5PNTA 1F48A 2GJ9A 2MU1A 5J2TB 1U4OA 3OQMA 3IPXA 2HJRA 1YVRA 4PAOA 5AUNB 4UW9A 1ZRMA 1J9CH 4CMHA 4DABA 2FQXA 3MT7A 4QWMA 4DDMA 4ER3A 1DKNA 2WSYB 3O4RA 1TZJA 1CQQA 2Q6KA 3CH7A 1PR3A 4FLFA 3NI2A 5K8LA 2FWBA 3LO5A 1GYRA 1B93A 3U28C 1P05A 2OXCA 1IPHA 3WQHA 1IQPA 3CIOA 1DC8A 4XR4A 4UTOA 3SX2A 4P93A 4MJ7A 5LMNB 4YP9A 1FJ2A 1NF3A 3C3PA 3WHKA 3RVPA 4QFDA 4O08A 4FYHA 4ZOLA 1DCKA 2GTHA 2F9LA 2ZBUA 2OAQ1 2PWYA 4I5GA 1PFKA 1P7ZA 4TQUS 2NU8B 4DM4A 4I4LA 2QM3A 4RHYA 2Y80A 3F96A 5DGDA 3ZGVA 3QQ5A 5JVDB 4MW5A 3VR2A 3W9BA 1XRSB 2QQ5A 2CJFA 1QK3A 4AWXA 4X66B 4PPQA 2FPMA 1GOTA 4E1BA 2B4QA 4HWRA 2CZGA 2J3EA 2QC2A 4F4FA 2YFQA 2AOTB 1C30B 1TJNA 4INLA 1WDKA 5JBTA 3HJCA 1ZH4A 1HAPH 2ODWA 1XZCA 5C52B 3D49H 3UHPA 1RABA 4WXRA 4MQAA 4NOJA 1YTLA 1PLLA 2NSJA 4N3CA 1CUJA 1PJBA 1MN6A 1IN7A 4K9LA 1CUEA 3IP3A 5LD2C 3SN8A 2OLGA 3SR0A 5HE8A 2RAFA 3LLMA 5TRTA 1C1MA 2AIRA 2QG4A 1XZIA 2FMFA 4D42A 1OX4A 4CV1A 1MX5A 3PENA 4IVPA 2GK4A 1DEOA 2H16A 5C2JB 3OFND 4FCCA 1BHSA 1FX1A 3L18A 3OQHA 1UK9A 2VDMB 1RWWA 4ILEA 3KQOA 2A94A 2RHDA 3SEZA 2A31A 1W7GH 3WIEA 1DY8A 4TM8A 1DXOA 5L4LA 1JDSA 2HCJB 4ZMBA 3X2SA 2WVAA 1MJNA 2A9FA 3IPYA 3AL2A 2KBFA 3CRVA 2J9XB 4BBPA 3HUUA 1O2VA 1MEEA 3S1AB 1I4WA 1PR5A 3FLAA 2B3TA 2P4UA 5F9MA 3UOUA 3RKUA 1S3GA 5REQA 1RFNA 3DLPX 2YXPX 1A1VA 5EGMA 1EZ1A 3AX6A 1C4XA 1NN6A 3M5CA 4P35A 3KALA 4CW7A 5CLIA 3K6JA 5HKAA 2ZE5A 2QUHA 3DPSA 2DOKA 3AXSA 4OL0A 2Y27A 4Q37A 1H9IE 5CVUA 4EUHA 3H0KA 4HLNA 1QAQA 2WAOA 1T3HA 1UJNA 1Y81A 1ZUHA 2Z43A 4JSRA 4BZZA 3G79A 2P4QA 1N6RA 3K20A 3IHKA 5ALMA 3DVRX 4YCCA 4YYZA 2QZSA 2C07A 1NESE 2I4OA 3QMVA 1XZJA 4NS4A 1RE0A 4DMLA 2C9CA 2X5XA 3TXAA 4IIVA 3GLGE 3WRVA 3O6VA 2WJ6A 4CIAA 1AS3A 3W3AH 5BMVF 3TO5A 5A5FA 4MICA 5HFJA 3D0QA 4B2LA 2J3MA 1O2SA 2PA3A 5FEUA 1Z68A 3TZ6A 4MEJA 2I3AA 1K21H 1UM8A 2GESA 5BURA 4FX2A 4G24A 2V35A 2P9BA 2RHLA 4BVHA 2W3IA 1BE6A 1JIVA 1JYEA 1MX9A 3MGBA 4D4LA 2F9UA 4I7EA 2V96A 4NU0A 4Q4CA 4AG3A 5UKDA 3RXGA 3EQ2A 4J43A 2RGXA 3J7TA 1KJJA 1AKMA 4A5TS 4IV0A 4CIYA 1JAHA 1MUUA 4BP8A 3PVCA 2XVMA 1NNSA 5J40A 3L8FA 4G1VA 2R9PA 3ZY5A 1V2VT 1KHTA 1NW6A 4WKBA 1ML3A 1B8OA 4UQOA 5I4CA 3JQAA 2JHCA 2YWCA 4TTAA 3LZDA 2ZGBH 1UT8A 1XPOA 1RU3A 4QAJA 2VP5A 4RXUA 3LBHA 5HSGA 2ZE8A 1CUXA 4NE7A 2C88A 1HEUA 4NZMA 5B7GA 5GVSA 1L1EA 2G9VA 4U3JB 2GP9B 3ZHXA 3GJ0A 2BX4A 5E0OA 3W8EA 3OU6A 3LZ6A 1BDMA 1ZEJA 5K8UA 4QYSA 4B40A 1Y3IA 1C3OA 1DDJA 2B2NA 4NBRA 4NDNE 2CV3A 1ZN8A 3BD7A 2V03A 1P9LA 1L5YA 4DC0A 4W5NA 4KO8A 3KTDA 1W4ZA 2XE4A 4QPZA 3F6RA 4WXYB 5DHRA 3GCHC 3KVNA 4UBJA 2ZC9H 4IFIA 2WHYA 1L5LA 2PWXA 2ZR0A 2WYUA 3CLRC 3QVLA 3WQRA 1E2QA 4IDDA 4TM7A 4R1NA 4ZYWA 3VOAA 1I30A 1NVXQ 1GZ4A 1RBMA 1O89A 2QPLA 4I1RA 3B3AA 4FEYA 4R9UC 1CJBA 1GTVA 4PWYA 4MULA 1VLZA 2QQ0A 3GV0A 2M1ZA 4BQSA 1WPGA 4FU0A 3S7KB 4NJOA 4AFZA 2FX2A 4AKTA 2BMFA 3X0DA 4M8NE 4Z0TA 4WX2B 4MWZA 4C7KA 2ZUVA 1SL3A 1Q77A 5CIQA 5I46H 5CMLA 3QFHA 3ROGA 4M1YA 1O3JA 3G88A 3STWA 4Q12A 3IFSA 2O2YA 4LNUB 3E9EA 4TX1A 2OWDA 2VIIA 1O37A 2V0NA 5ALTA 3FCXA 3CKKA 2JAPA 4RE6A 2P9GA 1Y4SA 2YWDA 1MBMA 2AX3A 3UMYA 5FTKA 5EW1H 3WWYA 2P6NA 3GRVA 4HQFA 3TKAA 1BXRA 5CPFA 4LGCA 1RM5A 4BHTA 4L5JA 4B8WA 1UCYH 4JGGA 2QXHA 3L7LA 1NW7A 4I8XA 5JALA 4MTLA 1CUVA 4AMYA 2V8OA 4H7IA 3OMXA 5FFFA 3D4LA 4PBTA 2O8BA 2IYRA 5B7QA 3CT6A 3Q3GE 1V3UA 2OHJA 4ZHQA 1RR6A 4QFCA 1QRRA 4MJLA 1RWMA 3DLHA 3ZE1B 3QUBA 4CH2B 4UDNA 1XUOA 3GDOA 1GSAA 2Q3LA 1YR9A 1IONA 1D04A 4MNWA 2RHCA 4H59A 5HHTA 5IJ9A 1AS2A 2Z8XA 3RUEA 1YB5A 4TVOA 1N3IA 1U0RA 4DR1B 1GJDB 1ZOOA 1P3EA 3K70C 1HTWA 4EIWA 4AY4A 2G5GX 2QTHA 2ZCUA 3BEOA 4YAIA 4JXKA 1Y7HA 2VATA 2H1FA 1HWYA 1L4KA 2V74B 5CB4A 3MWFA 4ONEA 4ZCMA 3NEAA 4EMBA 1XLTA 3UK0A 1XCGB 1P3CA 3PZBA 4GECA 3RFVA 2JH8A 2HLNA 3O92A 4XCXA 1VKZA 4KUHA 1YQWA 3ZZCA 3UMJA 2XCQA 4Y71A 3FGZA 2H3EA 1E2JA 1URPA 5A6VA 3D3JA 3QBEA 1UWCA 5KPDA 1SXQA 3VDQA 3MMXA 2QOEA 3N0XA 3T7SA 4IVQA 1MR3F 4NF2A 5DP8A 1P9WA 4XUEA 1EUFA 4TTRA 4DUGA 4R9SA 4ZAFA 3G8DA 3ZCQA 1SCAA 1DLJA 3GPDG 3LVFO 2OCBA 1HT0A 4D8UA 1YL5A 1IMJA 4NV1A 1TT5B 4DMGA 3W7AA 2IY7A 3DMPA 3VM6A 2ID7A 1YVPA 3OP4A 1YP9A 3WLQA 5J47A 1MAVA 2CJXA 3DPUA 4RFSB 1XK7A 4C30A 5FOXA 1ISGA 4JZEH 1C50A 3W7BA 2R8ZA 6ESTA 1Q92A 3RAEC 4KPEC 4AYYB 1J20A 3QBTA 3E0NB 3U44B 3TEFA 6CHYA 1JLHA 4QGBA 7GPBA 3ZWOA 4YXFA 4LXTA 1TBZH 1Z0KA 1D2CA 3LBFA 3M36A 1GHWH 4J2TA 1HXFH 3U8OH 1OZ0A 1R5JA 4G5XA 5I48A 1SD1A 4PGHA 3FNGA 4Y6LA 2JBAA 3QGMA 4MQMA 2BSQA 2AV6A 1VKNA 3UWJH 3RHTA 4B3TB 2DCMA 1NZFA 3DXZA 1P2UA 2QU8A 1VE1A 4FILA 3LGSA 4DQXA 1UMCB 4OKSA 1K98A 3IMGA 2B6HA 1DQSA 3RDPA 2F1OA 2ZS8A 3HCNA 3NBKA 4N9QA 1AQYA 1SGTA 4HX5A 1T31A 1VCHA 4D81A 4UQPA 4OXNA 1FFXB 2RHRA 2UZIR 3KR2A 4I6EA 2ANMH 3DAOA 2NU3E 5IJWA 1CQJB 1OILA 3SG0A 4TKMA 2CE7A 4LWPA 5A2QA 3ND9A 1QBVH 1FS5A 1JG2A 4RM3A 1D7OA 2BGTA 4YCNA 4XOJA 4IGIA 5L7WA 4P81A 5EWJB 4BCBA 1AQJA 4UTZA 3GNTA 3H65A 4NE9A 3ABSB 1AV6A 3FHTA 1IFXA 4HXFB 4UFOA 4F38A 1FLDA 4DR4B 4KC0A 1CUCA 2EBFX 3AY3A 1LV8A 1XHFA 5IZCC 3RMNH 4IMRA 2M98A 1R8JA 1II8A 1PS0A 2WJ3A 3L49A 4LRWA 3M0EA 5AH0A 3J80A 5EQTA 2P2SA 1EGQA 1CIJA 3AERB 4XUCA 4CBVA 5CVJA 1HDIA 1VITH 5FRDA 1EFHA 2VO1A 2NO9A 1BTPA 1M34B 2OV3A 2PQMA 5ICSA 1UBCA 3LG2A 4O02B 4CMEA 1AGNA 3QELA 1TVCA 2BP7B 1N7JA 4AX8A 1M1UA 5KOYA 4EUNA 4G5YA 4X7MA 3LP6A 2ZRIA 3T7IA 4X8HA 1CR1A 4BE9A 2JIZA 2AI1A 3AF2A 3MCWA 3ZZDA 4OCZA 1SFQB 3ESZA 3QKSB 3PUZA 3WXMA 1FY2A 1WHTB 4FB4A 4EPXA 4C7OB 2PD3A 8ATCA 3W8NA 5C8YF 1IUOA 4CUJA 1RLOA 2F3QA 4MUMA 5GOTA 3BB3A 3LT1A 1OKKA 2VWGA 1PNTA 2NUPA 2GCNA 2V97A 6GCHF 2GM9A 1XYGA 3BJIC 5HFAA 4MMZB 1TYBE 1VKHA 5A0TA 4DIHH 2VA9A 1BCRB 4PHTA 2EJVA 2G6TA 4C7BA 5D5HA 4LY0A 1P9OA 4B9AA 3F6EX 2AFQB 4KLCA 2J45A 1O8BA 1P2NA 2VDUE 1EUQA 3GY0A 3O0DA 1SOWA 2PY6A 3WMWA 4MP3A 4LY6A 3DFFA 2ZDAH 1ZMRA 4JR0A 1DU4A 4KN9S 5I9TA 5C7OO 1B76A 1NR7A 3NUQA 1KETA 1HXEH 3EIOA 1M8GA 2XUPA 3MTJA 3DTVD 3OHMA 2O2EA 4E5UA 1HRDA 1KDQB 3MB8A 1ZHRA 1I7LA 1LVBA 1JQJC 3LIPA 2O3RA 1Y6QA 4CMGA 3WW7A 3SV8A 1W9HA 3PKZA 1RPZA 4PONA 2KLHA 3RWOA 4GOJA 4PAMA 3N0WA 2AOUA 4X90A 5AW4A 1DRUA 4B5KA 2IHUA 3RC3A 1GWAA 5KOJB 3MK31 1CKEA 2PAAA 2AIQA 1L7MA 2D1TA 1US8A 1LVHA 1OBFO 3KE9A 3UYLA 1QQ6A 3ANYB 4XSHA 1L7QA 4CTNA 4OUDB 4PLCA 3U2QA 2XQVA 1AX9A 3VHLB 3CISA 1X9IA 5AQ1A 4FEGA 5TT1A 3MOSA 1PJ4A 2O8NA 1BA8B 4O2BF 2F64A 4K5QA 1G41A 4G6ZA 1QIMA 4GPTA 3E1GA 2J3IA 3P17H 5DMXA 2VQEB 3FWHA 4OSOA 1J8FA 3A14A 4X8SH 2DBRA 2NM0A 3CF0A 2JI9A 1AGYA 1L1GA 2WAMA 4EARA 5D5PA 3QPBA 2I3BA 2WU4A 3U5ZB 3QEMA 4JCOA 2CCKA 1MD8A 1N7HA 4JR2A 5CFZA 4I1OA 4WVLA