3OAAD

Structure of the e.coli f1-atp synthase inhibited by subunit epsilon
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
458
structure length
458
Chain Sequence
b'TGKIVQVIGAVVDVEFPQDAVPRVYDALEVQNGNERLVLEVQQQLGGGIVRTIAMGSSDGLRRGLDVKDLEHPIEVPVGEATLGRIMNVLGEPVDMKGEIGEEERWAIHRAAPSYEELSNSQELLETGIKVIDLMCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGERTREGNDFYHEMTDSNVIDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLLFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADDLTDPSPATTFAHLDATVVLSRQIASLGIYPAVDPLDSTSRQLDPLVVGQEHYDTARGVQSILQRYQELKDIIAILGMDELSEEDKLVVARARKIQRFLSQPFFVAEVFTGSPGKYVSLKDTIRGFKGIMEGEYDHLPEQAFYMVGSIEEAVEKAKKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP synthase subunit alpha
publication title Structural basis for inhibition of bacterial ATP synthase by subunit epsilon of the rotor stalk
rcsb
source organism Escherichia coli dh1
molecule tags Hydrolase/transport protein
total genus 127
structure length 458
sequence length 458
chains with identical sequence E, F, L, M, N, T, U, V, b, c, d
ec nomenclature ec 7.1.2.2: H(+)-transporting two-sector ATPase.
pdb deposition date 2010-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00006 ATP-synt_ab ATP synthase alpha/beta family, nucleotide-binding domain
D PF02874 ATP-synt_ab_N ATP synthase alpha/beta family, beta-barrel domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1140.10 Mainly Alpha Orthogonal Bundle Bovine Mitochondrial F1-ATPase, ATP Synthase Beta Chain; Chain D, domain3 Bovine Mitochondrial F1-atpase; Atp Synthase Beta Chain; Chain D, domain 3 3oaaD03
2.40.10.170 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3oaaD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3oaaD02
3H4MA 4AKEA 5DN6D 1N0VC 1IY0A 1SHKA 3GJ8A 3TW4A 1RRGA 4AYWA 4Q1BA 4GZLA 4XWOA 3K0CA 5FBLB 3D7MA 1R7RA 4Q1FA 1WQ1R 2XTZA 2ONKA 4Y0AA 2AD1A 2QE7A 4BLRA 3MWYW 4L5BA 4R98A 2NZJA 1NVVR 1V43A 5CITA 2Z83A 1DO0A 3T61A 3BFXA 3B1ZA 3KJGA 4UXHA 4AY2A 4BEJA 5GJWC 2KWIA 1JB1A 3A58B 4DEXA 4O3MA 4RY2A 2ZPTX 4LJ7A 3H0KA 3ICEA 2PLFA 3QVVA 5BN5A 1CU1A 1U99A 3U2QA 3LWNA 1MH1A 1TQ6A 4GOXA 4XSHA 1H8HA 4PC3A 5H8WA 4I4LA 1YE8A 1HEIA 5TDHA 1EGAA 5FBWB 3TH5A 2JLWA 3SBEA 3EAQA 1G4UR 1KJWA 3L0PA 1NP6A 5KO2A 4M53A 3MWJA 2OV2A 4B3CA 1N6LA 2DFNA 2CVHA 1W4AA 5CM8B 2HEIA 5HKKD 1OIXA 4PXAA 4UJ5A 3BOSA 2IS2A 2YVUA 4JLPA 1DAEA 1Q21A 1YR7A 2ZE6A 4HYYA 5FOVA 4A36A 1CR4A 1IJEA 3QIAA 1IXSB 4QGGA 4EAQA 1KSHA 3F8TA 4BLQA 2ZRNA 4Q9HA 4D80A 2ZAMA 1TEVA 1G8YA 2JAQA 2NQ2C 3CW2A 2Z43A 4M1OA 5AUQA 5BQ5A 3WXMA 3SZRA 1P75A 4JBWA 1GNPA 3DM9B 4RZ3A 4DLRA 1OSNA 2AFIE 2D2EA 2REXB 1G8PA 3TLXA 1CJKC 3NKVA 1TU3A 4BRUA 4TWZA 4YMSA 4YDSA 1NMZA 2FEOA 1QRAA 1JPNA 3WP0A 3FKSA 2Z5FA 2RMKA 2FPMA 4YQFA 4AURA 3G5UA 4TZ0A 3FKSD 4RFSA 4E5UA 2GJAA 3LW7A 3EZ7A 1F3OA 4U00A 5JEEA 4EPXA 3HU1A 3KX2A 4LC0A 5IF9A 1XTJA 1E0AA 3OF5A 3MSXA 2D2FA 3VKGA 3WYFA 1ZCAA 1PUJA 4B2IA 1L4YA 3I62A 1QHYA 3M1IA 1NKTA 4GI7A 3I5XA 4XVQA 1CULC 3RC3A 2ZRBA 4OK6A 4Q9KA 3NVAA 1ODFA 3QXHA 4IVPA 3GLGE 1Z6XA 2GWHA 4TSFA 3OESA 5F3WB 3I8XA 2ZI5A 1QHHA 3L0OA 2O8EA 1EG7A 1SVIA 3DO6A 4TSFD 4M2LA 4PHGA 1N0UA 1ONBA 3MMPA 3LBHA 4EJSB 1ZCBA 4OK5A 2ZSBA 4BFVA 1U8AA 1NBME 5M04A 1BMFA 4UKDA 3R7WA 4L9SA 1P61B 5JS8A 3G0HA 3Q5EA 1BMFD 3ZVLA 4DLVA 2IYWA 1TNDA 1NY6A 2D62A 4MGYR 1Z6YA 3K0FA 2F3TA 3K09C 2SHKA 1UJ2A 1YZUA 1CJTC 2IS6A 1AQYA 2FEMA 2V8OA 2QRZA 1W48A 4LPKA 1P5ZB 4TL9A 3CRRA 5KNDA 4LSGA 1IJFA 1K6MA 2QQ0A 2PL3A 1G64A 3X1DA 1RRCA 2WJJA 1PJRA 3W6NA 4BPBA 1Z0DA 2REOA 1P9WA 3KFXA 4DEYA 5JWRA 3NC0C 1KO5A 3WY9A 1N25A 3QPWA 2C2HA 2XJ9A 2EU8A 2A2ZA 4I99A 3NH9A 1CEEA 2G83A 3U6BA 1GILA 3KTAB 5JRZA 2HJVA 2IYUA 1E2KA 1RRFA 2IYYA 3IGFA 3PCRB 4MUAA 5DHAA 4TQ9A 2FDCA 1VYUA 1YR8A 4RD6A 1FTSA 1G41A 3KKPA 2XZOA 2WWFA 2ZYTX 3LH5A 5EE1A 3L0SA 4ZO4A 5ELXA 4EPVA 3UG6A 4PR0A 5A5GA 2NZ8A 2HDNB 3G82C 4Q47A 4W7SA 4PSAA 1OB2A 2FG5A 2IX3A 1P6XA 3A8TA 2DCUA 3A1VA 4JBYA 4WAUA 3T12A 3PR1A 2ZJOA 2H16A 1QHGA 4DLZA 1R4AA 2Q3FA 2W2TA 4NYJR 2NG1A 2HJGA 5BYJA 3D3QA 3UATA 3EPLA 2ZI9A 3MWKA 4QBIA 1LVGA 2GXQA 1K5GA 3SJCA 4HAXA 1Z28A 1I2MA 4QGHA 1KHTA 3HU2A 2VSXA 3QXJA 4NU0A 1RC8A 4KVAA 4GP7A 2C98A 1MABB 3LV8A 4ZKEA 2IEZA 2JLSA 3WBJA 3LQQA 1JEEA 4QBGB 1JECA 2BCGY 4ARZB 3GLFB 3QJYA 4BFTA 2IS1A 1F2TB 1YU9A 2Y8EA 3CWQA 2ZVPX 1OIWA 3DKPA 4IOJA 3VR5A 3P26A 3U3KA 3AUXA 4CW7A 3DOEA 3FE2A 3AVQA 1QHIA 4NCIA 3OFNA 5G40A 2V1XA 2P6RA 2FZ4A 1XPOA 3CO5A 3OFND 1H8EA 1Q3HA 4D0LB 2VQSA 3MJHA 3KXLA 3QXCA 1H8ED 4NZYA 3PEWA 4TYYA 4PZLA 3GJ6A 1HT1E 1XEXB 5FI0B 1AJEA 2GA8A 1P3JA 1RZ3A 1RYFA 2CE7A 2WJGA 3CONA 3PIRA 3T34A 1R8SA 4MGZR 5JI3E 1E0KA 4L4UA 1KI9A 4YMVA 1W4BA 1G19A 2AK3A 5CDFA 1BIFA 1HURA 3I5YA 1NG9A 3U44A 1T6NA 3LDAA 3SFZA 5JWHA 3GLFE 1AS0A 1W47A 2YC4C 1TF7A 5CK5A 2QNRA 1UBEA 2R8RA 1TL7C 4P32A 1BKDR 3K9GA 5DIFA 1MOZA 4LX0A 2MSDB 3VX3A 1KI4A 4ITRC 3B13B 4Q7MB 4XSGA 3A4LA 1DO2A 2JJ1A 2ZI3A 1IN4A 1J7KA 1E0SA 3B78A 2V4ZA 1I4LD 3RS5A 3EA0A 3AGPA 2JJ1D 4QM7A 4PC7A 3VHLB 4PHHA 5AWFC 2ANCA 2H57A 4YXWA 4NBSA 4LV6A 4DT1A 1Q57A 4KLNA 5BN4A 1IONA 2ZRHA 4YXWD 3RC8A 3GJ7A 4EQ6B 4BWYA 4ZIRA 5EXXA 4MRRA 4Q18A 4NE2A 1J99A 4PPNA 1R2QA 1S9DA 4AKIA 1NNEA 3PUVA 5EZ6B 2FGKA 4A0HA 3S1AB 1G7CA 2JIZA 3Q9LA 4JMPA 1FW6A 2JDIA 2OUKA 2Z4SA 3AF3A 4Q1AA 2JIZD 5JSZA 4A9AA 4QOSA 4OHXA 4X8LA 3SU8A 4V02A 5BYKA 3NHBA 1HA3A 2IEYA 2WTUA 3VTKA 4F4JA 1NN3A 4QBHA 1XCGB 2ZAOA 3ASYA 1OHHA 3THXA 2D7DA 2O8BB 1HV8A 3RLFA 1E3MA 1OHHD 1Z2CA 2CCKA 4JKIA 421PA 4HLDA 2QEQA 1E9BA 3TAHA 1KI7A 3THOA 4K8OA 3MD0A 3T06B 3OEEA 1W5TA 3L43A 1UAAA 4BQSA 1KAGA 1NSTA 5KOYA 3OEED 4Q1EA 1R5OA 3WMGA 3V4RA 4LBZA 4P4SB 1VTKA 1OF1A 2BMDA 4JVNA 4M1MA 5FPKA 4TL7A 4D4JA 1JAHA 3BS4A 3AF1A 4NKRA 5KYKA 4GRAA 1MR3F 2ZROA 4X8HA 1XX6A 1N2CE 3RNLA 4PQRA 4HSEA 2LCFA 1S3SA 4KU4A 4LYAA 1G17A 4MGKR 1MRNA 2J59A 1HUQA 1FL9A 2IYSA 4V0OA 4HATA 2AD5A 4MKIA 2WWGA 1TADA 1IBRA 2WIAA 1FUUA 1L4UA 5LB4A 3AKDA 4HZIA 4A15A 4JL5A 1H65A 2VHCA 2DY1A 5SZIA 4OHYA 4BFSA 3CH4B 2A5GA 2L0XA 1SVMA 4DZZA 3LD9A 1N6HA 1Q0UA 4G1UC 4GDFA 4DSTA 1WF3A 2JATA 2V6IA 4QL3A 4LJ9A 4Q7JB 4G5RA 1E79A 4ESVA 4UJ3A 4I1VA 3U7GA 3QKSA 3B1VA 4EFNA 1DVRA 1UKYA 1E79D 1OFHA 4UXIA 1OT3A 3EG5A 3LBNA 1JBKA 1DEKA 1ESNA 3C7KA 2F1IA 5SZKB 3V4FA 3B7GA 1HQCA 2W2VA 2R44A 4W9MC 1KMHB 4H1UA 4Q4JA 1RJ9A 1P9RA 4JT4A 4O2LA 3MG9A 4QRHA 2GZDA 3CZQA 2Z4RA 4U5XA 3W6OA 1KAOA 2KJQA 2OBNA 4DCTA 1N0WA 4G5GA 1Z0FA 3ZLJA 5FPSA 5ANRB 1U9IC 2AWNA 2IS4A 2G1KA 3WNBA 2VPPA 4TYQA 2GBLC 2ZVQX 5FOUA 5KDOA 5DSZA 4BE7B 4ESHA 4NYMR 1KI2A 2PZGA 3TQCA 4URWR 5CJ2A 3GLIA 3DMDA 4TYPA 2GXAA 3X2SA 3TW8B 3HJNA 1IAQA 1S8FA 1U98A 1W0JA 3L82B 4PSKA 3T35A 2QP3A 4BECA 1US8A 2BKEA 2EQBA 5D3MA 3MCAA 1P7CA 1XTQA 1AS3A 2CJWA 4IFBA 5JBQA 2FX3A 4AKGA 5CB6A 1ZVQA 4B3DA 2OXCA 3ZQJA 3THWA 4CT4B 3CRMA 2J41A 3T1VA 1LS1A 3P4XA 4URYR 3CR7A 2YNMA 1RPZA 4C2TA 2WPDA 4HDQB 1U0JA 1XJ0A 1AIPA 4PANA 1JJ7A 3RRYA 1GRNA 1EFUA 2WPDD 1U94A 2GXSA 3EZ9A 2O8DB 1XZQA 3VR1A 3PUXA 3CUEF 3K09A 3LVRE 3ADKA 5C4GB 4MDFA 3TR5A 5JECA 1CKEA 1T91A 4A2PA 5G3ZA 2RGAA 3A1WA 4PQYA 2AHOA 1XD8A 5KPJA 3X1XA 1OFTA 4QFMA 2JLUA 1Z5ZA 2H5EA 1X86B 1XD2A 3QVUA 2A5JA 5L3QB 1X8JA 2R62A 1ZM9A 3VNUA 1A5TA 1KZ7B 1SXJA 1QDEA 3QPUA 1VCOA 4G5QA 4HAUA 2V9PA 1DE0A 3LXXA 1T8TA 1Z83A 2FU5C 2DR3A 1SXJD 4FMCB 4R2IA 5E7IA 4UNRA 5B64A 2A3RA 3WYGA 2W83A 1VDZA 3LAWA 4DLWA 5L3SB 2XX3A 3EIHA 1NLFA 3AVUA 2JGNA 3P32A 4IHQA 2F3RA 2ZU6A 3UKDA 1ETUA 3EWSA 3W8RA 1KGDA 3EC2A 1I4DD 4MQBA 5AJVB 4TMZA 5CDFE 3SHWA 1QHXA 2CVFA 4I1UA 1QHHB 2O8EB 1FNMA 3X1YA 1ZIPA 2WBLC 4EPTA 1E2PA 2ZJBA 4B3GA 1A1VA 1IXRC 2YJTD 3AF2A 2VYFA 2X77A 4AK9A 1O3YA 3GLHA 3F0TA 2WSSA 1TTTA 4M1KA 2XAUA 5EP1A 2N42A 4I81A 3TUJC 1WCV1 3WNDA 4DCVA 2WSSD 1JXOA 4Q9IA 5KSPA 1CJVC 2VIIA 4FMDF 4K81B 1T5LA 4P0TA 3KUDA 4KJZA 4N0DA 3EPJA 2V1UA 1UEJA 2FN4A 3NXSA 2QRNA 4GBMA 2GK6A 2VP4A 1VECA 3ZD6A 2UZIR 4C7OA 4Q02A 4Q4HA 4L8GA 2RGBA 4FCTA 4M1SA 1G8GA 1Q12A 5DYIA 2ZRPA 5B58C 2ZRLA 3AB3A 1XEWX 1E2LA 4Q21A 4NYJQ 5J4HA 5JFGA 5TB5A 4RD0A 3THYA 2DWOA 2GF9A 2J3EA 3I1FA 4LBVA 4B76A 2ZRKA 4DJTA 1NSFA 4HDOB 5E4FA 4GFDA 2WV9A 4NP6A 1E0JA 1DPFA 3LW8A 1EXMA 2ZXUA 1XU4A 4BEBA 4J0QA 3QG5A 1R0WA 2NPFA 2WJVA 4NTZA 2IXFA 4KFRA 2RGCA 3D6TB 1LF0A 3AF0A 4XVRA 2WKPA 3OE7A 3TJZA 5LDDC 4OK3A 3W5IA 4HAZA 2W6ID 3KKQA 3OE7D 2WM9B 3L8YA 1Q1BA 2DHRA 3Q7QA 1RYHA 2F1RA 2DBYA 5FBQB 3C4JA 4AYTA 1G7SA 2F9MA 3OIVA 3VAAA 4BFYA 2J87A 5SZHB 3ZS9A 3H86A 2D4HA 5TV2A 3UPUA 4BLOA 3W6PA 3ND9A 4B74A 4WVFA 3H1TA 4QHYA 2OBLA 4PQFA 2W00A 1AGRA 3A6PC 4CGZA 4P4UA 1R0YA 1OXSC 1OYWA 3AH8A 4OHWA 4FWTA 1G7TA 4LV5B 2GZAA 1LB1B 2HF9A 3CRW1 2DYKA 1HT2E 2QAJA 4UNSA 1KKLA 2IBMA 3REFA 4HB4A 1J90A 4TN1A 2OCBA 2P65A 5K8TA 3LFUA 2BBSA 2A5FA 5BW8A 2XZPA 4IXNA 5CYOA 5KNCA 2REBA 4WIAA 3LVQE 4YMUA 1KK0A 2ZITA 3QEOA 4PO1A 4Z54A 3C14C 2GRJA 2P5TB 2ZR7A 2D74A 5K8LA 2EFCB 2XSZA 2QMOA 3CKLA 3RS7A 1KO7A 3FB4A 1DG3A 1RW4A 4A82A 2YINC 1E69A 3K8YA 1FTNA 1U2RA 4OHZA 1KKMA 4CEHA 1E2DA 3KZ1E 1Z0AA 1G3IA 4Z8YA 5EUQB 4D0NA 5GJBA 1UFQA 2H17A 5C46F 1N6OA 2J1LA 1NL3A 5GVSA 3U44B 2AN9A 3IIMA 4AWXA 4R7ZA 1FNNA 2AFHE 2MSEB 2VP6A 2PEZA 3VMFA 1FPMA 2IHYA 5FTMA 5C1BA 1R6BX 1YZQA 1ZJ6A 1OPXA 1XP8A 3I4LA 4N3NA 1J8MF 4DKXA 2FJUA 2VP2A 2O8CB 3CRQA 2I1VB 2XB4A 3FFBA 4WXPA 5LBIA 3TNFA 1J8YF 4EPRA 1LV7A 2ERXA 1VYTA 1Z2AA 5FL3A 1M6NA 1CTQA 1WMSA 4P4TA 2FNAA 2Q9BA 2QE7D 2OT3B 5DLQC 4HB2A 1Q1ZA 4HAYA 1T5IA 4KV9A 2AKYA 3QF4A 4BLTA 4ACBA 2QG6A 1Z6AA 3VHXA 1EFRA 3ZJYA 4WW0A 5AJZA 3ZZ0A 1OFUX 5L3RA 1EFRD 2JEOA 1UKEA 1P2TA 4LHWA 4TQAA 2WZQA 3T1QA 5J4YA 1GL9B 2BWJA 3C16C 2B7CA 4IDPA 1H8HD 2IYTA 3SDZA 1YJ5A 4H1VA 1C1YA 3IDQA 1JI0A 1YRAA 4OQXA 1A82A 4B75A 1U90A 1S1CA 4C0KA 1XTSA 1TX4B 1XPUA 2C95A 4JLKA 4ZI2A 2P6NA 5JSZB 2AL7A 2D7CA 1E2FA 1G8HA 1F2UB 4B6FA 2P67A 1UDWA 2QAGA 3HP1A 1GAJA 1XCMA 2PCLA 3EZFA 4JLNA 4MRVA 5JHHB 1NVUQ 2V3CC 1AS2A 1GP2A 4PC1A 2ODBA 3C41J 2IYXA 4EJSC 3QI2A 1CJMA 3ZVRA 1T3HA 3FOZA 1FQJA 2MMCA 4WOPA 3A1SA 3CNNA 2QI9C 1SHZA 3PUZA 2ZSEA 2G6BA 1ZAKA 4L16A 4IRUB 1M1YE 4QGAA 2O8FA 3SJBA 1Z22A 1IY1A 2GJ8A 2I4IA 2ZSFA 1E9DA 2OM2A 1I2DA 1E9FA 2EWVA 3QKRA 1D2NA 4IOLA 2FF7A 4C0HA 2C03A 3UANA 621PA 2VO1A 1RRPA 1EFTA 4GZMA 1KIMA 5FUWA 5TXGA 3NEYA 3EPHA 3FYHA 2X2EA 4A8JB 4NONA 1SXJE 3CX8A 1S1MA 3F5FA 2GBLA 3RSLA 3CWZA 2FGJA 4MH0R 5TARA 4IDHA 4AI6A 4U7DA 1LW7A 2YOGA 1TUEA 5DO9A 1E2EA 1D6JA 4PO8A 3CX7A 3RRZA 3LLMA 3W34A 3IPYA 2RGNA 2RHMA 3QXSA 1GIAA 2ZE8A 3NDPA 2B21A 4DDUA 4URXR 1AKYA 1II0A 2W0SA 4CEJA 1ZUIA 1XXHA 2HV8A 3A36A 5CLQA 1M7GA 5F2EA 1ZU4A 3B8HA 3ASZA 3V9PA 4EKDA 2VHQA 3U3MA 2ATXA 3AVXA 3F3YA 2GILA 1MRSA 3EA5A 3GFTA 3NBZC 1P60A 2E9SA 1IY2A 3FMIA 3R20A 2BBTA 2KSQA 3QKSB 5KPDA 1VCNA 4Q19A 1NIJA 1ZD8A 2O0HA 1Z6TA 3OZXA 1XFAA 2XOKA 2BCJQ 3DM5A 3L8ZA 5J40A 2OEPA 4LYJA 5FR2A 2EFDB 5AUPB 1YHNA 1DAGA 4RSGA 2XOKD 3SBDA 1II9A 1XEWY 4NYMQ 4Q4JB 1RJ9B 4EPWA 4PSVA 4QHSA 4R71A 2J7PA 1CR1A 1YZNA 2F1HA 1S96A 2ZRIA 3K0AA 1NG1A 3NEJA 1NF3A 5C18A 3ZVMA 2J7PD 3N99A 1R8QA 3ADCA 3MRSA 4B33A 4LBWA 4A92A 2QM7A 1E1RA 1IN6A 3W3ZB 2BOVA 1E1RD 4HLQB 2GVZC 2JCSA 2YWGA 2ZETA 5BWMA 2OFWA 3TGPA 3O47A 1CXZA 2CCGA 4ZCLA 2YC2C 1PV4A 4A2WA 1G18A 2GCOA 4FINA 4OL0A 3EX7C 2CMKA 3PV0A 3VU9A 3O8RA 3KUCA 3P4YA 2ZEJA 1N6IA 4B71A 3B1XA 4TLBA 3BGWA 5F9HA 1BS1A 2J0SA 3GD7A 3NIBA 3ZZUA 4LHVA 2OBMA 4AIIA 4BFUA 2VHUA 1QBKC 3U7HB 2GVDC 5D3MB 2R6DA 4MITA 4YONB 4A2QA 1KTVA 3X1WA 1BYUA 1D9ZA 4DLXA 3THWB 1GRRA 3UK6A 4NCNA 5JJLA 1XMIA 1P72A 3PENA 1W46A 3V00A 5TVKA 4FCWA 5KDLA 3BAFA 3AV0B 4Q00A 2N46A 4JJKA 2ONJA 2QA5A 2BMEA 1QZXA 2J0QA 4QHTA 1D2MA 1DELA 3VR2A 1XPRA 2RH5A 4V0NA 2UKDA 4B3FX 3GMTA 4HUTA 4D2IA 2PMKA 2CDNA 3SOPA 2KE5A 2IYVA 3TR0A 4PAMA 1AK2A 2ZR0A 3GJ3A 4TT3A 5L8VA 4KFSA 1NVWQ 2W58A 3CF6R 3KQHA 4LZZA 4AYXA 4TT3D 2Z0MA 4W5JA 1SXJB 1V5WA 4MUBA 1LNZA 3NTUA 5IK2A 2CLCX 2R6AA 5BN3A 1X6VA 4ACAA 2IXEA 5FUVA 5IK2D 1S4QA 1VHTA 3KXKA 2PZEA 2HUPA 2ZSAA 2C99A 3FMFA 3IO3A 3GLGB 3K1JA 1KI3A 2A78A 2BDTA 3GFPA 4OQMA 4LHXA 2AR7A 2ZJZA 3U3JA 3AM1A 4XVUA 5EJEA 2O0JA 2Z6VA 3H84A 1J70A 4ZV4A 4YMTA 4GL2A 2ZJ5A 1DAHA 3SN6A 1U0LA 4B43A 4LY6A 2OHFA 4JVLA 1XWIA 4GOJA 4LDJA 1UBGA 4M1TA 5DE3A 4HZUA 4DB4A 2EFGA 4JJZA 3TAUA 2R6GA 1W49A 1KMQA 1N5IA 5FPYA 5H68A 4WZ6A 1QVAA 4D4MA 6Q21A 3KQNA 3B1YA 1CF4A 1G3UA 4KFUA 4XH9B 3SC3A 1ZNZA 1ZC4A 4C0SA 1MO3A 4PC2A 1D8TA 2B92A 4ILEA 4BLPA 4V0KA 4KI0A 3E70C 3RYTC 4WXRA 2F6RA 3C8UA 3NG1A 4KITB 3I73A 4N0EA 1OJLA 3EW9A 1XRJA 1KI6A 2HLDA 1N6RA 4PPGA 2PCJA 2FFAA 4IKEA 1EFCA 1K8RA 1S0UA 3B2EA 2HLDD 4M21A 3Q7PA 3OIUA 4JLOA 1R0ZA 4LV8B 2MSCB 2XITA 2JDID 3HWSA 4UNNA 2FSIA 3AKEA 5HPYB 4DSOA 1SGWA 4QGFA 2OCAA 2KBFA 2XGJA 3ADDA 3AQ4A 3KXIA 2ANBA 4IOKA 4LPSA 2LWIA 4JLDA 3NBYC 2ZRGA 1FP6A 2VH5R 3GJ5A 4NYIR 3K0SA 2WHXA 3N5CA 5JS7A 3GJ4A 4IXMA 2VLIA 4LC1A 4BFXA 2WAYA 2D3WA 3QF7A 4Z51A 3FHCB 121PA 2WJIA 1OH7A 2MMGA 4EIWA 3TVTA 2ZJAA 1QHNA 3IEUA 5G53C 4TLCA 3EZ2A 3WBKA 2FSHA 2F7SA 3K0EA 2W6JA 2CLSA 1P2SA 1MO4A 4Z1MA 2W6JD 1D2EA 3TUIC 3EARA 3GCGA 4IDNA 4Z1MD 3FGNA 4NCJA 4XOIA 5JJKA 2PMDA 3IO5A 4WZBE 4ZDIA 5TMPA 4C30A 4LOAA 2BJWA 4JL6A 4ZDWA 3DZ8A 3KKMA 4G5SA 1SZPA 2IF0A 3MWLA 1YZGA 2RKOA 2QN6A 2PEYA 4JS0A 3BB1A 3ZDQA 2WOOA 4Q5IA 3SNHA 4S35A 2YHSA 3SE0A 2DWQA 2GZHA 5K8UA 1XJCA 2CXXA 3NDBB 1IN7A 5G41A 3HYTA 1SKQA 2FFBA 1KDRA 4M22A 3TMKA 4D6PA 1W0KA 4XJXA 2GCPA 4Q4LA 1P2VA 3IIKA 2FMXA 1OXVA 4G01B 1JPJA 4MYTA 4KHZA 4A4DA 2QP4A 4M4SA 1W0KD 2WWWA 4DC9A 4DCNA 2QTVB 2VHTA 1G4AE 4POAA 1KDOA 1OH6A 2ZREA 1JQJC 2QZ4A 4RKEA 3FKQA 1XXHE 1BYIA 3R8CA 3WYAA 1GVNB 4LI0A 1HQYE 1W36B 1WB9A 4CEHB 4JLMA 2BEKA 3AVPA 4LYHA 3KKNA 3GP8A 1GL6A 3OHMA 2AWOA 2E87A 4EJSA 1T4GA 2QQEA 1OFIA 2PBRA 4Q7KA 2OXRA 5JMTA 1XMJA 3GJXC 3CF0A 3OAAA 4HUQA 3VKHA 4N1AA 1AZTA 3OAAD 4QNMA 4BZXA 2VBCA 1FQKA 1N6NA 3OEHA 4GMDA 3R9WA 1NMXA 3U3OA 4ZCIA 3IEVA 3BIFA 3E1SA 3FWYA 5HE9A 2IWHA 4E03A 3KJEA 3OEHD 5EXSA 1ZUNB 1CRQA 3QE0A 1GL7A 5EZ5A 5JLJA 2FFHA 2ZR9A 3BE4A 2FPKA 4OKSA 2JLVA 5DH9A 4US0R 5FTLA 2IWRA 1NRJB 4ZDJA 3TE6A 4BFWA 1Q3TA 1VYVA 1TU4A 1XD9A 2QPAA 1AN0A 2RB4A 4LWZA 1CS4C 4O0MA 1CLUA 2C77A 4F38A 1E4YA 3CNLA 1W0JD 4B3BA 3RVBA 4S2EA 2CHVA 3JZMA 3LX8A 4UNPA 1RIFA 4HB0A 3TSZA 1RKBA 5CLLA 1IM2A 4NCKA 4JSYA 3QBVA 2HYDA 1TMKA 1OXTA 3HYRA 5EE9A 4LJ5A 1JAIA 3ICQB 1XF9A 4D26A 2AXPA 3AVTA 2YV5A 1Z3IX 3PJRA 1OIVA 2BM1A 2QAGB 221PA 3JVUA 3AKCA 4CEIA 2GESA 1MO5A 4GP6A 5KTYA 1T3SA 3LNCA 4D4KA 2OCPA 1OLOA 1S9HA 4EDHA 2OSBA 2QPTA 3AVVA 1ZM2A 3UIEA 4FCVA 1EX7A 1OW3B 1E6CA 1L8QA 3AEZA 2GKSA 2P6UA 4TL8A 3NBXX 3C15C 4TYWA 4LJ6A 3K9LA 3WMEA 3A1TA 1KY3A 4PC6A 1JALA 2QROA 4DVGA 4HDCA 3UXMA 3UMFA 2O8FB 1A4RA 3ND8A 5J4VA 3QEJA 1MABA 521PA 2CNWA 3QKRB 5FPTA 2W0MA 4C0AC 1GM5A 4O25A 4AG5A 2CNWD 4RFSB 1FZQA 2ZRCA 1F2TA 1G9XA 1N5JA 1U0HC 4B73A 3RABA 2ZYUX 4C0LA 2PX0A 2ORWA 3BC1A 1IN5A 1E2QA 3HPRA 5CYPA 2WWYA 2QSYA 2BMJA 1GRQA 2ZTSA 1T8UA 1KDTA 3VNVA 1Z0JA 2GNOA 2FH5B 4HAWA 3RHFA 3SFVA 4A0GA 5KU1A 2ZJ8A 3FPAA 4B2PA 5CK4A 1KZGB 1VIYA 1KK2A 2HF8A 3DVLA 1E94E 5E3HA 4URUR 1RFLA 4Q01A 3ECCA 2IL1A 4MKHA 4PZYA 1LTQA 1Z08A 1B0UA 2WSMA 4OHVA 1KOFA 1XEXA 2Q6TA 3OIYA 1M34E 2QM8A 4CEJB 1Q20A 2EVWX 1ANKA 2HYIC 3R7WB 1DAKA 3GEIA 1YZKA 3BK7A 2CCJA 1OH8A 1NJGA 4IEEA 1SVKA 1E2MA 3U5ZB 5GJVC 4DCUA 1TEXA 4BUJA 1FX0A 2FPLA 3K0FB 4RCYA 3U4QA 2HT6A 1UDXA 1Z6GA 3AVYA 2H1LA 5LD2B 1NJFA 2WJYA 1W7AA 4JLBA 4Q1DA 4QJ3A 4B48A 2WOJA 3IKJA 5JEDA 5HCIA 3K70C 2ZS9A 5KHOC 2B7BA 2ZS7A 3E2IA 4MKGA 1FUKA 3BB4A 3RSOA 4II7A 4B44A 4XWKA 2A9KA 1DAMA 2FSFA 3UMSA 4C4PA 2XXAA 3I3SR 3AUYA 1OYYA 1HYQA 3GEHA 1X1SA 1G5TA 1EX6A 1NLZA 3QXXA 2ZI6A 3C5CA 4IFEA 4FI3C 4PAQA 5TY0A 1CIPA 4XTCS 1HH4A 2DFTA 4HAVA 1XDBA 1NIPA 2QT1A 1RVDA 2TMKA 1ZU5A 1XMSA 2OESA 4OI2A 4BRWA 1E2JA 2X19A 2GCOB 3S1AA 4TMTA 1VG9B 1E2HA 1UKZA 2WKRA 3FVQA 5JHGB 3VU9B 2QT0A 2ZRMA 4A1FA 3EWAA 1G16A 2BBOA 3LA6A 3Q5DA 1E2IA 4EFLA 4FIDA 1Q44A 1G7RA 3B1WA 5AJWA 4U02A 3CM0A 4KYIB 2C96A 2VSOA 2F43A 4JLAA 1ZIOA 2IW3A 4HB3A 1E2NA 1JR6A 4F4CA 3SQXA 2O8BA 3QOFA 5JWOA 2V7QA 3BRWD 4BZPA 3W5JA 3VR6A 3I61A 1OE0A 3QNUA 2V7QD 1CBUA 5IT5A 3KQKA 1COWA 3B85A 4Q03A 1COWD 1TUIA 2ODWA 1LY1A 2G88A 2ODNA 4XIGS 2VP0A 3WRXC 2BHRA 2ZI7A 3CX6A 5FBRB 5JI2E 1XJQA 2HCJB 4P4SA 4PPQA 3ZS8A 4D4LA 5SZJA 1KSGA 3GPLA 1QVRA 1YR9A 3ZVNA 2QPOA 5EUMA 3KJHA 3DPUA 4TZ6A 2JLYA 3QSYA 1T0HB 1Y63A 1ZNXA 2VTKA 3UWKA 1SULA 4E07A 2IF2A 4DWJA 2K5UA 3JVVA 4JZKA 1B23P 4KLZA 3ADBA 2J0UA 1ZNYA 2F1JA 3RANA 1NN0A 1PVOA 2JLXA 3KKOA 2GCNA 3I72A 4W5HA 1N6PA 4DSUA 2XSZD 2IHBA 3K9HA 5KSOA 1OH5A 1Z0IA 3CB4A 1YZLA 5JJIA 3AF4A 4RZXA 4OQNA 1EWRA 1AKEA 1ZD9A 3CRVA 5KSZA 3LQRA 2KBEA 3R9XA 1NY5A 2Q21A 1WBBA 4FN5A 2ZANA 3BWDD 2KI5A 4RD4A 2A30A 1Z47A 1CP2A 1U8YA 5EXTA 4IOMA 3CH5A 3T1OA 3X1ZA 5FFMA 2CHGA 3MUFA 3J81k 4JLJA 3W8NA 3ZH9B 1G5PA 4HZUB 2PLRA 1G291 5FH9A 3EIQA 4JIMA 3EIEA 4YC7A 3FDIA 2BM0A 2C78A 4ZPXA 1ZC3A 1ZMXA 1ZINA 4C2UA 1BO6A 4EFMA 1E9CA 4HLCA 3PG5A 4LJYA 3KQUA 3L0IB 4Y0VA 1VG8A 2GDJA 3I92A 3Q3JB 2AKAB 3SI7A 4DT1B 3T5DA 1U8ZA 4G3XA 2DFKB 2IUTA 1GDDA 2ZRJA 2RGXA 4ZIRB 4D0GA 1HE1C 2X8AA 4A8JC 3GLIE 2WMNB 4NYIQ 1ZM7A 2NO7A 5L3VA 1XBTA 1KI6B 3DDCA 1PLJA 4YDHB 4DRZA 4LUCA 3PEUA 2YWFA 4LJ8A 2V55B 4MYCA 4WA7A 2OE2A 4WBSA 3AVWA 1DOAA 5FOWA 1VMAA 2G0NA 1GKIA 4MRSA 2QGZA 3GEEA 5CM9C 4ZI3A 3FHTA 5FOSA 2WICA 1KDPA 2EFEB 1LS6A 3PFIA 4OJQA 4TMVA 2XJ4A 4TQUS 1GFIA 1M7BA 1P73A 1XTIA 3SEAA 4D81A 3B5JA 3THXB 1XZPA 3BXZA 4FMCF 4V0LA 2GJ9A 2R2AA 3CR8A 2BKUA 4US2R 3C5HA 5FUXA 4I1SA 4B6EA 4CIDA 4JBXA 1FOEB 4CDGA 3PEVA 5HKKA 3BFKA 3QPVA 5FOXA 8OHMA 2IYQA 4OJKA 4RJLA 2ZS8A 1X1RA 4QBFA 1PLLA 5LB2A 1YZTA 3QKUA 4IVQA 4NL4H 4F4IA 3D31A 5GADl 2QMHA 2O8DA 1KSFX 1MO6A 1CR0A 3TRFA 4MGIR 1U9IA 1SVLA 1DG1G 4M1WA 2A7QA 4NDZA 4A0FA 4CZ2A 4F7WA 1HE8B 3FHOA 5FL7A 2IYZA 2J46A 1P9NA 1R10A 5H1YA 4C0QC 1AZSC 1G6HA 1W44A 2CK3A 2NTYC 4L9WA 5FL7D 5HR5A 3AP2A 5E7JA 1JR3A 5EP4A 2JJ2A 1YQTA 2CK3D 4JLVA 3TSOA 1JXMA 1ZW6A 3M6AA 3BFVA 4Q4AA 1JR3D 3ZQ6A 5L3QA 2JJ2D 1XNJA 3FFAA 1VCIA 4KSCA 4AD8A 1QF9A 4CVNA 1PLKA 2BBWA 4JVSB 1ZUHA 2R9VA 4US1R 3U6KA 4LHYA 2JASA 2C9OA 2JLQA 4RD2A 4C3ZA 5L3SA 2G1JA 3UMRA 2QBYA 2BJVA 5F9FA 1BH2A 2GEDA 1JNYA 2EW1A 1E9SA 3B60A 2QMUA 1VKJA 2QMEA 4MYHA 2FV8A 2WWIA 2UZ3A 3W9YA 4A6PA 2ZYWX 4DSNA 3GLHE 4W5WA 3PQCA 3CPHA 1GSIA 1KO4A 1W2GA 2IT1A 1II8A 3IQXA 2P0EA 2RHDA 2XEXA 4PHFA 5JCZA 2ZRFA 1M2OB 3U3RA 1Q1EA 1E9EA 1AQUA 1HY3A 2O0KA 3KL4A 4TL6A 3RWOA 1YRBA 2ODEA 1X8LA 3PEYA 1L7VC 3WHKA 3BERA 3RS3A 4HUQB 1J2JA 3TIFA 4JT2A 2C8VA 2QTFA 3M0EA 3N2IA 2PZFA 1QG2A 4QKQA 4XTRA 4F91B 1TF2A 2CHQA 1SQ5A 2OFOA 1WRBA 1L2TA 2F9LA 4CYMA 4D25A 4ON9A 3CBQA 4CT5A 2Q3HA 4AG6A 1W5SA 1XMVA 2NIPA 3AGQA 4Q9LA 5DGXA 3W90A 4A6XA 3BH7A 2BV3A 2FE4A 2VRWA 4DDVA 1OB5A 4Q48A 1P4SA 4GT1A 4DBLC 1G20E 1E96A 2DFLA 4DDWA 3LX5A 5EE3A 1G6OA 3GLIB 4HI0E 4C0BA 3RS4A 4ZKDA 5F98A 1U81A 1SXJC 2PJRA 4E09A 4DLSA 4LJAA 4F92B 5EE0A 4DXAA 2ZUCA 3IHWA 2RGEA 4EUNA 1EESA 2ORVA 1US8B 5AUNB 5UKDA 2OAP1 1UPTA 3BD9A 2QU8A 2CJWB 1Z8FA 1G3QA 2NOAA 5H70A 3HU3A 2H8KA 1UM8A 1S2MA 2P2LA 1E4VA 1KK1A 3AP1A 3N2EA 3P1JA 4X8OA 3ZGXA 2G0TA 4RCZA 821PA 2EWWA 3EC1A 3B9PA 4NMMA 3JZAA 2FSGA 2GK7A 1KJZA 4JYCA 4XWAA 4Q9JA 5DI3A 1UF9A 1UKVY 4E22A 5DISB 3SYLA 1KO8A 4DLTA 1ZD1A 2PT5A 2ZRDA 1XTKA 2RGGA 5AJYA 4PHTA 5DI9A 1DADA 2YKGA 2PX3A 1XCPA 3CPEA 2PH1A 1EK0A 2W2XA 1DAFA 2EYUA 4UXJA 2YWEA 1Z06A 2WIBA 3SJZA 4TYNA 1DBSA 2G9NA 4QG7A 1CR2A 3LLUA 3A4NA 2GEVA 3K70D 1FP7A 3SS8A 3RS0A 1XD2B 3DCLA 2FWRA 1G8FA 2VSFA 2O52A 4MRNA 4FWIB 1ZYUA 5AUOB 2IYRA 3BB3A 4CEIB 2VHJA 3K53A 4B47A 4TLAA 2GETA 3P27A 4V0MA 3SQWA 1T0JB 2P3SA 2ORIA 2ZQ5A 4HLUC 3IPXA 4OI0A 1VIAA 2IK8A 2Q0HA 3A4MA 3KQLA 1E98A 1W1WA 2GJKA 2BEJA 1DAIA 2DWPA 3A37A 3KB2A 4BLSA 5CB8A 2X1VA 2XZLA 1WA5A 1WBDA 1YR6A 5FI1B 2O5VA 2OCYC 2ZJYA 4Q1CA 4R2HA 5FR1A 1E99A 3ZZTA 2QY9A 3N70A 1M74A 3SHFA 3FMOB 3GJ0A 3GLHB 1NVXQ 4MKFA 3LXRA 4GNKA 3UG7A 2WJHA 4R9UC 3CIOA 2V6JA 4KYUA 1GKYA 1FX0B 4MRPA 5FTNA 2NMVA 1A7JA 3U4QB 2O8CA 4RKFA 3KJIA 4OI4A 4QJ4A 4YLGA 4AKHA 2XTNA 4M9QA 3LY5A 3VX4A 1RE0A 5J47A 4CRWB 4UQOA 4DCSA 4C7OB 3HR7A 3W3AA 4Q4HB 2G77B 4TTPA 1Z0KA 3VR3A 2H18A 4A0RA 4IW3B 4TLDA 1GKUB 2XXAB 3IBYA 3VR4A 3EXAA 2FZLA 3BH0A 3CF2A 2CLDX 2ZUBA 1NN1A 4PFSA 1GWNA 3DOFA 5LPNA 3THYB 3O8BA 4KBGA 1GOTA 4RD3A 2BMFA 2WKQA 2ZE7A 5EQTA 2FFQA 4EPYA 1Z29A 2ERYA 2ZYVX 4RFVA 3A1UA 2GTPA 2IC5A 4JVMA 4CF7A 3R8FA 2J5XA 2C9YA 3DEFA 3HDTA 2EYQA 4PO9A 3QY0A 4TMWA 2WMOB 3Q72A 1NN5A 3ZD7A 2E1RA 4KFTA 3KB1A 1K5DA 1IQPA 1KI1A 1F2UA 3AVOA 2OFXA 3BJIC 4FMDB 4NCHA 3TUZC 4ERNA 5EE5B 3BORA 1W36C 4C9BA 3BH6A 2EFHB 3EASA 4F93B 2RAPA 1KYIA 2F43B 3DL0A 1E32A 1N5KA 1ZRHA 5FTJA 3MGCA 4KO8A 2GXUA 4L15A 4FXPA 2WAXA 3K9NA 4V03A 2Q9AA 2QGNA 4M9ZA 2DPXA 4B2LA 2B8TA 2BIFA 2B6HA 2YOFA 2ZRAA 4KBFA 2CL0X 2QTHA 1QG4A 2LKCA 3IHLA 3EPKA 1IOZA 3MJRA 3WP1B 4P3YA 3K0CC 5EP2A 3OIWA 3VQTA 1GNQA 4OI1A 2B8WA 1GZSA 5A4JA 1NMYA 1LFDB 2GEUA 1TQDA 4GSYA 1F5NA 3E5HA 4ZCMA 1A2BA 1VG0B 2JJ8A 3FTQA 1I4TD 1JR3E 1LF5A 4D82A 4M0LA 4A8JA 1VHLA 3TKLA 3TVDA 2F55A 3PVSA 3ZYCA 2RCNA 4G0NA 3B9QA 5HZKA 2GJSA 1EWQA 2J0UB 5HZHA 3RAPR 4M9XA 5D3QA 4M8NE 1VG1A 3GQBA 1TPZA 2ZSDA 3Q8XB 3QENA 2FA9A 3FMPB 3CPJB 4LGMA 5FTKA 5KNBA 3SYKA 5C4MA 2AXNA 1FFHA 4QJ5A 1D5CA 1T3LA 4ABYA 3O8DA 2QP9X 2CBZA 2QAGC 1N5LA 2OLJA 1W4RA 5J5CA 3VKWA 2VF7A 3AP3A 2CL7X 1CRPA 1GTVA 2C5LA 4NHOA 5E95A 1G3RA 1E1QA 2OILA 2YYZA 1TF5A 3PUYA 4UNQA 1JEDA 721PA 1GUAA 3RS2A 1E1QD 5FBVB 2GHIA 2OG2A 1NVVQ 2C04A 3U61B 4GOKA 1Z63A 4KCGA 4BFZA 3L2OB 4FW9A 1VCMA 1G21E 3MLEA 2CL6X 3T15A 1DARA 4M9SA 4IDQA 4B34A 2ASEA 1CJUC 2IXGA 2ZIAA 3QF4B 4JYBA 3WNCA 1XB2A 2P5SA 4BASA 1X8KA 4MDEA 3Q85A 1E9RA 5FUYA 4PPFA 1SVOA 4BGDA 2YZ2A 4IVRA 3KDSE 2GF0A 4BZQA 1S3GA 1KO1A 1TQ4A 3LO5A 1KNXA 3D8BA 1JJVA 2QORA 3KTAA 4KODA 5B30A 2NO6A 1GNRA 4IEIA 2OLKA 3DZDA 5DHFA 5FOTA 1UBCA 3QKTA 3T1TA 3HR8A 3QUSA 1KNQA 2D06A 2ATVA 5IHPA 2NGRA 2IUSA 4LBYA 3CZPA 1KSJA 1UEIA 2RGNC 2QUZA 4B3XA 1W2HA 3NH6A 1ELOA 3I8SA 1W4CA 1HTWA 1PUIA 3IIJA 1MT0A 2OO7A 3IUYA 4PZZA 5DYGA 2Q3MA 5KUTA 1N3BA 4KVGA 3NC1C 5IRCD 1MKYA 1A2KC 2NPIA 3PITA 4DLYA 4KSBA 3BBPA 1ESMA 4QM6A 3LRPA 4TTRA 4QXAA 4TMKA 1G3MA 3GFOA 1Q22A 2A5YB 4OQFA 4DIEA 3T5GA 1E2GA 2VP5A 4QNRA 4DDTA 5LD2C 4IDOA 1ZBDA 4DLUA 1OXXK 1WE2A 3DKVA 2PJZA 4ARZA 2R65A 4YMWA 3GLFA 3NWJA 5JCPA 1KK3A 4OQLA 4PTLA 2I1QA 4TTQA 1WDTA 2IA5A 4XD7A 3TQFA 1FMJA 4URVR 5CJPA 2R6FA 2GAOA 4XD7D 4ASUA 1NI3A 3UWOA 2ZU0C 3U7EB 1AGPA 5C2JB 4PX9A 4WZAE 3MAAC 3NBFA 4ASUD 4P31A 4Q66C 1UADA 1KI8A 4Q4AB 4V0ME 1O87A 1KY2A 2IUUA 4DHEA 2FOLA 1TAGA 2XNDA 3NHAA 2Q9CA 3ZIAA 3U60B 4LRWA 1P62B 2XNDD 1X3SA 2H92A 3RRMA 3ZIAD 1G1MA 2VL7A 3RRNA 4RD1A 2GAAA 3CNOA 4X8MA 3RDPA 1XXHB 1SKYE 1XTRA 4O2RA 3WRYC 3GLGA 5CIQA 2QBYB 1C4OA 1NLYA 2V54A 2VEDA 3H2YA 5GVRA 2HCBA 1ZM3A 2IYLD 2XTMA 4Z8XA 5P21A 4LJ4A 1G5RA 3ONWA 3M4YA 2LKDA 3DHWC 1NBMA 1II8B 1F6BA 3CLVA 4KXFB 3O8CA 1NBMD 4OYHA 2JA1A 1IHUA 1OKKA 3QBTA 1KJYA 5AK0A 2RGDA 4TMXA 5G3YA 1ZM4A 5KSYA 1OKKD 2I3BA 2OZEA 4FD2A 3K0AB 2JLRA 2G3YA 1DS6A 2NO0A 2PT7A 1XEFA 1Z07A 1MV5A 4GPTA 4KAXA 4M1YA 3R9IA 5K8IA 5AR1A 4EQ6A 2XB2A 2J0VA 1ZNWA 2N1BA 1JQLB 2WWXA 3ETLA 5EP3A 5A0FA 1YVDA 3SYNA 2ECKA 2VP9A 3DMNA 4HEJA 1OV4A 5J4LA 1SVSA 1C9KA 1NKSA 1DTSA 2BC9A 3WHLA 3P20A 2QSZA 4H9GA 4G5OA 5E7MA 4I1OA 2HXSA 1F60A 4DUGA 2YWHA 1TQ2A 2AK2A 4HLUA 3WMFA 4IJMA 1QHSA 1OXUA 1D9XA 4DUGD 3RWMB 1UBFA 4LYFA 5EXPA 5HE8A 1AA9A 2ZE5A 4GMXA 3PUWA 4JKYA 2NO9A 3QG1A 3QQ5A 3VFDA 1YKSA 2AX4A 3B6EA 5B2ZA 2ZI4A 5JZVA 3PXGA 2UVQA 1PZNA 4QC2A 2ZJ2A 2QENA 2A5DA 2W6IA 4Q7LA 5JRJA 5DI3B 1F48A 2NO1A 2XNSA 1M7HA 1R0XA 2ZUDA 3B82A 3KFVA 1IN8A 4MA4A 1IXZA 4AC9A 3TK1A 4LHZA 2WWHA 2BVNA 3REGA 2DB3A 4RZUA 3IBGA 2J9RA 1WXQA 1VPLA 2CEAA 2OAQ1 4JL8A 1GG2A 4TLEA 5CIWA 5GJCA 3U7FB 5J4KA 2H7VA 3AKYA 4LK2A 5HCNA 1R5NA 3EZ6A 3K70B 5B57C 1EFHA 1ZP6A 1N6KA 2JLZA 1FMLA 3IILA 4MYUA 4DIDA 3LBIA 2CE2X 4P33A 5HTKA 2R6CA 1M8PA 2VA8A 2HXYA 4JSTA 3TBKA 2WVJA 4PAOA 4NH0A 4URZR 2C9CA 3SR0A 2X2FA 4K46A 4B35A 4B32A 1AM4D 3SJAA 2ZM5A 2HT1A 5IDVA 4DB2A 1E9AA 4OBEA 2VF8A 4ZDKA 4LCBA 4C0JA 2QL6A 1WP9A 5KDDA 2YOHA 4RZ2A 3I32A 1SKYB 3IQWA 1Q1QA 4NPHA 4RVCA 1P2UA 2KB0A 3TSWA 5AJXA 5DNYB 1R5BA 4FMBB 3MFYA 1KMHA 2J7KA 2J45A 1SVWA 3HPQA 5FPHA 1W36D 5BXQC 1T9HA 1BOFA 5DN6A 1GITA 1Y3AA
chains in the Genus database with same CATH superfamily
1DY9A 1I5EA 5K3AA 5JS2A 2Z56A 3GJ8A 1U7OA 5CU7A 3TW4A 3FPHA 3GY8A 4M0UA 1XTZA 4R98A 2KCOA 1XV5A 3PF9A 1DO0A 4BEJA 1CGJE 3DEIA 3G6WA 2XC5A 1CU1A 5DWVA 1A3EH 1JKJB 4KQJA 1P2MA 1P3EA 3RU7A 2BYTA 2P9GA 1T4CB 3SV6A 1IB0A 3WXBA 6LDHA 2VT7A 5IDQA 1ZK0A 1VGVA 1XKTA 2ZG0H 4B4OA 5HKKD 4EB0A 4HWOA 4JLPA 1DAEA 1VBNA 4HYYA 2BDUA 1QP7A 2GM3A 3LCUA 3O74A 4UM7A 5FUQA 3VO9A 2IHVA 4D80A 2VQ6A 1CUHA 3UQZA 3ZWAA 2PKYX 1OSNA 2MYNA 3SUGA 4YMSA 1TIKA 5B6JA 1K7FB 4EEZA 3EH1A 2IQ5A 5JSHA 3OJ0A 3U1JB 3WYFA 2R4UA 4RORA 1IPHA 3FUCA 1GZ5A 5F3WB 4MNWA 3LC0A 5KINB 3LK7A 4DYDA 4OK5A 4K9MA 5M04A 3HXQA 3TMYA 4UKDA 4ETMA 4EHNA 1UJ2A 1D3AA 4FZVA 4AF7A 5HUJA 4YYEA 3R3GB 2Q6FA 1I6LA 1IJFA 3X1DA 1LDEA 2ANWA 2WSIA 4M8IA 1OAAA 4DIMA 5J59A 5G4KB 2XBYA 1MIOB 3QX9A 2IITA 1INLA 5TGTA 5F77A 4EPVA 3WRYA 2HDNB 2CF8H 1P6XA 1P2DA 4R69A 3IUMA 3KGPA 3HU2A 4FSDA 4O8ZA 3H6HA 3A1EA 1E4OA 3R3XA 2JLSA 5DLDA 4X45A 3ML1A 1PJZA 5CIYA 1N7HA 5F7JA 1QQ5A 4JK3A 2A0FA 3GMDA 4F6RB 2WEKA 5U1PA 4K9LA 3IJPA 1JDSA 1E0KA 1I9GA 2BR4A 1LC3A 5CDFA 4UEWA 3G23A 3U44A 2YUIA 3ZHUA 4DSZA 3VVMA 3PBKA 4OHFA 4LX0A 1JFTA 1N5RA 2FW9A 4MO2A 3KZOA 1NC1A 1I4LD 4PX2A 1W8DA 3EA0A 4NQRA 2RGWA 4XIIA 3MMNA 3BZBA 1QYVA 3RC8A 4BWYA 1T2DA 3KDPA 1ULTA 3IP1A 1EUDB 3ESBA 4F12A 2H07A 4R1PA 3Q9LA 3SOSA 4KXYA 4O4IF 1V5GA 4K05A 3KAKA 3TM4A 5ALFA 3PDIB 1VKNA 5LKRA 2DRIA 2ZIXA 2ZAOA 3OKFA 5B3JC 3MNXA 3MJSA 1QH1A 3C6BA 4P8RA 1T43A 3L43A 4HQ0A 2EJUA 3I05A 4CMGA 4GRIA 4JVNA 3GGGA 4Y6DA 4MRMB 4DIIH 4INHA 3H18A 1JJBA 3UEOA 4H6PA 3GCHB 4RI0A 2ODYB 1R8JA 3L8EA 1AHPA 2PKAB 3W3AH 1M8KA 3UGKA 4MGKR 2PRJA 2NAFA 3EB9A 8AT1A 2HCRA 4AW9A 1R9MA 3VR4H 4ENSA 4A15A 3HK2A 1ADYA 3UJPA 5AVTA 3MJVA 2E1PA 4GKKB 3B1VA 2PLNA 3C7KA 1A9OA 4CJXA 3HDHA 1HQCA 4LQDA 3RNOA 1TUBA 1DO8A 5L2ZH 3TXXA 4BLWA 1C5YB 3W6OA 4IIBA 1EZZA 2JLCA 3BD8A 3FZGA 2EKBA 2IPLA 2Z2YA 2GBLC 2JIPA 1TCUA 4BE7B 3GAZA 1PYTD 3WTCA 4KLAA 1VBMA 4XB6B 4E2FA 1LJUA 3S1SA 2OUAA 1XDWA 4EUFA 3DD5A 4EYEA 4ML3A 5BUQA 5DCLA 3K9FC 3OOSA 2BDAA 1EATA 2DVMA 2OXCA 4ZZ3A 2B1IA 2HF2A 4QYWA 3GCXA 5KMGB 4CMEA 2JFOA 3GVPA 3HYSA 1UC8A 3GJZA 4UU1A 1P81A 2PZJA 4FDAA 2ACVA 4KOAA 5KPJA 4O2BF 2ZCJA 3VHRA 2Q3JA 3H8WA 1VCOA 3UFXB 1C5KA 3OFKA 2V9PA 2ECOA 1NOKA 3SFTA 3O7WA 5DXAA 4XUEA 1VKYA 4PCLA 1BCRB 2C3YA 3BWBA 2ZU6A 4RE5A 2GAIA 2ZYHA 3SHVA 3OSYA 2IGBA 2R2WU 2PLXA 3BMQB 1MKWK 4FXOA 1A1VA 3VJLA 1SC8U 1MW8X 3AINA 3S7TA 3U62A 2ID8A 1O94D 3QEAZ 5KSPA 2P35A 4BCBA 4FE3A 4CMIB 3OJWA 4LQ4A 2GK6A 4BXOB 3WA7A 4B9EA 3C0KA 2ZC9H 4ERXA 3UK0A 3GGDA 1Q12A 2SGPE 4RPLA 1ZGGA 2P2YA 4RA9A 5B58C 3NCLA 5J4HA 4LBVA 4DJTA 4RIIA 4J0QA 4OUKX 5AYVA 2WJVA 4NTZA 3TU7H 4KYVA 5CURA 4OK3A 3I83A 4PINA 1L7RA 3UOGA 1HNEE 2VQ3A 5AW4A 2DBYA 1P31A 1J97A 2CKMA 1QAOA 1EZUC 1ADJA 2J87A 2V0CA 3TLGA 5A09A 3IVGA 4G24A 4IHJF 3H1TA 2EV9A 3C3DA 1R0YA 1OYWA 4YP5A 4EKEA 1UBTS 2PUVA 2JHGA 4MQFA 4EB3A 1ZD4A 4FZJA 3ZVEA 2PUWA 2BFEB 3QEMA 2XZPA 4RAOA 4G41A 4GLLA 2ZR7A 2D74A 5F7XA 3QITA 3U4AA 1ZRBA 2QMOA 4KN5A 2XWBI 3FB4A 5FBEA 2MOKA 2EL9A 1S3IA 3ATWA 1UMKA 1WIWA 4DKXA 2VP2A 4URHA 5HBGA 2ERXA 4Z3OA 1U0NA 1GSAA 2QLFA 3PCTA 2D13A 2G8LA 4DQLA 3QYFA 1YULA 1Z6AA 2D1TA 5BN4B 2O14A 4FM9A 1ZH2A 4LTMA 1PWEA 4WEQA 3CE6A 3N0VA 4E5SA 3VPDA 4BMVA 2HJRA 1JDVA 2X0KA 4JH0A 1B93A 2P67A 1WS6A 4EH1A 2R9PA 5E1DA 1JIJA 1T3HA 4HNAB 3PUIA 1NW3A 2H6MA 2VTEA 2VBGA 2FXIA 5LYJA 1NHGA 5A7HA 4X1PU 2WV5A 4HY3A 4G4IA 1E7YA 1JZSA 4CIXA 1UT6A 4JGIA 4OGWA 4I36A 1F0UA 2H1HA 4QPJC 5DO9A 3LLMA 3CE9A 3FZQA 1BITA 1YJCA 2WNHA 2PIDA 1AKYA 4V2UA 4YV2A 3HJCA 5CLQA 2Y27A 4LF9B 8ESTE 2BGNA 3B3QA 3EXEB 1WSDA 1XC7A 1TCBA 1Y7IA 2A6PA 4M49A 3L8ZA 5FQNA 3RB8A 5AUPB 3ESDA 5B7QA 1RM4A 4Q4JB 1RJ9B 3SLRA 4EPWA 1N1GA 3KYBA 4LBWA 1THTA 4BQIA 1DSSG 8GCHG 2WJ6A 2BOVA 4M7WA 4AZ3A 3H6GA 1I94B 5T5QA 1T15A 2YC2C 4I8HA 4JBNA 3LT5A 3IOMA 4KE7A 3O8RA 4C3VA 3B1XA 3F74A 1DFPA 2OBMA 1SC4A 2ZECA 1RACA 1KS9A 4MITA 2P9TA 3OJOA 3K92A 2IPOA 4F2WA 2R25B 5HHTA 3UK6A 3PENA 1G5HA 1AKWA 1UBSB 3C97A 4EELA 4XR9A 1O2GH 4C7MA 2VDPB 5T6MA 2DUWA 3RVNA 2AKEA 2UKDA 4B3FX 3G89A 4JC0A 4D2IA 4WESB 1ZSYA 3I9LA 2FN3A 2CEKA 2JLAA 1E4EB 2JHPA 4IMIB 5C35A 3MYWA 5IABA 2FOFA 4PWYA 1SBWA 3LP5A 1RP1A 4ACAA 2Q6IA 4MIKA 3KXKA 3DOHA 3RC9A 3A6KA 3BSQA 4XVUA 4FNGA 4B43A 1SR8A 3KB8A 1OYOA 2REQA 3F73A 2ZGVA 5B1EA 2QN5T 2P59A 1A77A 3A3NA 1CF4A 1M0WA 1DCTA 4U9HS 4G4SP 4JI0B 3D2AA 5ER9A 4JUCA 1HKUA 4JB0A 2Z3WA 3Q41A 1XOIA 1DXQA 2FSIA 3IR6A 4EMSA 2QYSA 1Z4QA 1HNNA 2ADOA 2FFJA 2PBFA 3OTIA 2GTBA 5TEVA 2IODA 3SKVA 3C1OA 4WKCA 2CJYA 1N8OB 3SNDA 4J3NA 4HH4A 2GHRA 1EWTA 3RFFA 4FUCA 1QWSA 2FEXA 2CJXA 2W6JA 1DB3A 2V35A 1PNVA 4YCJA 4LOAA 3KOWA 4NCBA 3BB1A 3SE0A 1ST2A 5A2GA 3LLVA 4MVCA 3IXQA 1SKQA 3GROA 1W0KA 3H7TA 4DIOA 4DCNA 1OH6A 8LPRA 1JQJC 4RKEA 1W87A 1BYIA 2V7BA 1H4TA 2HA6A 2P7HA 4JLMA 3GY0A 1BHO1 3KU4A 4O2AF 4BWGA 2WWTA 1WAYB 3VKHA 1GJ8B 3PC2A 1I3CA 4GMDA 1J9GA 4DDHA 2HO4A 4DREA 3KJEA 1URPA 4MIYA 4JJFA 5FTLA 2JH0D 3PL5A 1AD8H 3U4CA 4KR3A 1SVUA 1M0EA 3JWGA 3LUPA 1SURA 1PYGA 1TU4A 4EKYA 1OXBB 3CNLA 5JTUA 4BNKA 1EH5A 4M7OA 1MIOA 3P94A 3EFBA 1YA6A 2EFYA 2V3WA 3L6CA 5I8ZA 1AU8A 3JSXA 1ONOA 4OMUA 2C3MA 3ICWA 2JZOA 2XUJA 3CR3C 3OLWA 4HRXA 1W8BH 3P0RA 1FPHH 3C15C 2NU3E 1XTPA 4PC6A 2HMSA 3KIDU 5CHAB 1L5HB 5GJ4B 3QEJA 3TK9A 2YMQA 4LNHA 1ONNA 1U0HC 3DZJA 1N78A 2ORWA 1D2AA 4MI3A 3RV4A 1KQNA 5KU1A 3WSVA 5LZ7A 1SLWB 1C2TA 1U8EA 1VIYA 4RDCA 1EX3A 4E05H 1FVOA 1CZUA 4DNPA 3GEIA 1U1EA 1OH8A 2CCJA 2H29A 3BCHA 4IO1A 2ZHFH 4A26A 1NQVA 5ALHA 5CNJA 3KLBA 2RB5A 4NLLA 4FFLA 3AVYA 1NRPH 2ZS9A 2B7BA 3O9MA 1F6DA 5EQSA 2QLLA 3QYPA 2HJ9A 4HEHA 4KRYA 1U1IA 3QXXA 3MJDA 5AK3A 4A16A 2BLLA 4BRWA 4GI2A 1YFKA 3QFSA 3LA6A 2F43A 4JLAA 7LPRA 2CXHA 2YJZA 3LGSA 2BMWA 3PKJA 1CHDA 1R12A 3ZVNA 3SV9A 1KMMA 5BR4A 4WCFB 2C5FA 4KLZA 4EW1A 3EE7A 1I9CA 3K9HA 3ED1A 3FDJA 2IFTA 1YZLA 4RZXA 5JH7F 4V39A 1LRKA 1ZD9A 4M0FA 1MRZA 1KC3A 1FVFA 4LJKA 4TWRA 1AMUA 5CX4A 5ETJA 2ZANA 2ZB2A 1PQPA 4UVHA 4C07A 2FI4E 4HZUB 3EIQA 3FDIA 2V59A 1FJXA 2WLSA 3NT4A 4LJYA 2BRUC 5CBKA 4WMLA 1SBCA 2V3MA 4YT4A 3PGMA 4XLLA 5AI6A 4G67A 2VIPA 4LUCA 1QS0B 1NRNH 1KTSB 4ITVA 1WY5A 3MXTA 3I2YX 2VPQA 5T1VA 3HATH 3RXVA 4DQVA 1NVKA 1IG3A 2ZAGA 1X7XB 3DEYX 1I30A 2P0AA 1X1RA 5LB2A 5KMGA 1LKZA 2B8OH 5ITWA 1LI4A 1B6RA 4F5WA 3PROA 4ENQA 1JXMA 4M9FA 3AM4A 3M6AA 1HDZA 2QTWB 1NQTA 4BTIB 4LC9A 4J76A 4W5QA 2UAGA 4GCHG 4ZAVA 4RD2A 3A7XA 3H6KA 4XM2A 3AG6A 1BCRA 2QMEA 4ID3A 3EXHB 4C5BA 3GY6A 3IQXA 2XEXA 5ALXA 1FU4A 1SXGA 4Z0PA 3U3RA 1Q1EA 3S0JA 4W1QA 1XKLA 3WHKA 2WUBA 3BERA 5CFRA 4HUQB 4R1OA 4FVDA 3Q3VA 4C21A 4CMIA 4QU9A 5AVWA 1FS6A 4BXOA 3UW1A 3HWWA 2VRWA 3E91A 3OZFA 4YJ3B 1SBNE 1RZUA 3ATIA 1U81A 2YQ5A 4AM8A 2OTCA 1T2AA 1LTKA 4R8SA 2OZKA 1UPTA 2XBWA 1AXGA 2P2LA 4M0PA 4Y2QA 2EWWA 3B9PA 5GZ6A 2GPBA 4Q9JA 1JRSA 3NGXA 3SYLA 1NXQA 2RGGA 3O1LA 1O2PA 2YNBA 5DT2A 1YIOA 5IAGA 1YB1A 2WIBA 1E58A 2R87A 3OJFA 4QO8A 3M37A 5K3CA 2FWRA 2KMLA 1G8FA 1LNSA 3AR7A 4J4TA 2V4MA 4WZAA 3R3UA 3MPOA 1RXEA 4B47A 3UBTA 1PG5A 1LI7A 5KREA 1EFVA 4CLEA 3SM9A 1DAIA 3HY6A 1WBDA 2IVZA 1AKMA 3E7XA 4YJ2B 1M74A 1DV1A 3HGMA 4BO9A 3V3MA 2WIJA 1NVXQ 3DTVD 2AYZA 4JFRA 4QOHA 3GEMA 2VWNA 5DB4A 1IXKA 3RVDA 4NECA 5JZ9A 1UAYA 2G5NA 2STBE 4FILA 3UAWA 1DTWB 4C7OB 1J2UA 3UMMA 2H18A 5FHTA 3GNSA 1U2TA 4JP2A 3RO7A 1GOTA 2WKQA 4JV5B 1E6UA 4QOJA 4ZROA 4TV9A 4ZHLU 5KTOA 2J5XA 5KOHA 5AVXA 5EMJA 3Q9UA 1VJGA 4O1IA 2IYPA 4LHEA 3BH6A 2WU1A 1L5VA 2GPWA 4IPTA 4HNAA 4YGYA 2YOFA 1K97A 5DM2A 1S6LA 2GFHA 3GR6A 1NZDA 1O3EA 1X80A 2P4EA 3OIWA 5ITZB 2B8WA 4B31A 1M1ZA 1LBQA 2A5LA 4ZCMA 1A2BA 3HBLA 1LF5A 1UKAA 3RAPR 4V3BA 3M8KA 4JVOA 4PRLA 1FY8E 3CZ9A 3H5WA 3W8FA 5JBAS 3AP3A 4JQOA 2HLCA 4P0QB 3GLSA 2FXRA 3SS9X 3MGGA 3CPSA 3RU3A 1KXFA 4MJ3A 1E1QD 5E9AA 3CINA 4OQDA 2QQGA 4IH4A 1YIDA 3BUSA 1EBBA 2ZB8A 1ZOPA 1A9YA 1KFKB 2VRBA 1SXHA 1GDTA 4F9TA 5HF9A 3HVRA 3DT0H 2BN4A 2FOCA 3HR8A 1PJAA 1HXFH 4YMHA 1V47A 1SHUX 4FDTA 5LWHA 1KSJA 3I6BA 2VRCD 1A5BB 2YFHA 4JZ1A 2D1FA 2P2NA 5B4TA 1QP0A 4ZU6X 3URCA 1MEJA 2VJMB 1L0BA 2NPIA 3KV3O 4XDZA 2H8GA 2Z58A 4QXAA 3OQIA 3WLPA 2UUFB 4DIEA 3FMVA 5I8WA 4CKEB 4UTNA 2FPOA 3A88A 3GGSA 1EA7A 3TQFA 1FXUA 4QODA 3HXOA 1JV2B 4ASUA 1KY5A 1E4EA 4HNQA 2Z7FE 4LF8B 2CL5A 3MAAC 3WLSA 2PRKA 4JC8A 1NDUA 1IULA 2B37A 4CF5A 2HU2A 2XNDD 3RRMA 1BMDA 5ESXA 5J3JA 2F4LA 4GBED 1T1RA 2C5GA 1YVPA 4OYHA 3QBTA 2WFMA 3QUCA 3D6UA 5A0FA 4Z2YA 4CU5A 3DMNA 1C9KA 3UUGA 3GB9A 5TMEA 3OQNA 3CZ5A 4JFAA 1QCCA 2HDHA 1TKAA 3ZXIA 4DUGD 5I48A 1YI0A 4P82A 1A9ZA 1X7WB 1SU4A 5GP1A 3VFDA 3KSBC 2O2EA 3KWJA 3TDMA 2XNKA 2XNSA 2IEAA 3EVEA 2WWHA 4MPUA 4MV3A 3E2PA 5GJCA 3EDXB 1ZJJA 2FYTA 5DYTA 2QVCA 3R3WA 1EFHA 5F6MA 3AU9A 2WNIA 4X6NA 2AMJA 1G38A 3CLSC 2WVJA 3M2PA 2AERH 5ALOA 1YQEA 1N2BA 5FWNA 5DYYA 2F59A 3LHKA 4LDRA 1N33B 3I32A 4CTNA 1GI3A 1YOVB 2QN7A 4FYXA 1W36D 1GHBF 2A33A 3NHWA 1AC5A 2PVPA 1Z6EA 4KV7A 3LY9A 5E7QA 4UTZA 1MMFB 4KTSA 3D7MA 5T6FA 1DXPA 1WQ1R 5E6SA 2ONKA 4GOMD 3ROZA 4L5BA 4KP0A 5GJWC 4EJ6A 3ICEA 1V6SA 5EESA 3BTGE 1PT8A 2ACWA 1NP6A 1Y4AE 3COWA 1W4AA 5C5NA 2IS2A 5COBA 4ZEOA 1P1IA 1VGQA 3D7KA 3G1UA 5AM2A 4KACA 4OS6A 3PC4A 5IG2A 1A04A 1GFSA 1PR9A 3QOYA 2GYYA 5LBTA 3RSSA 5GONF 2DT5A 2UYGA 3V1MA 2GJGA 1EJNA 1LPPA 3IRVA 2JW5A 5C7YA 2TGDA 1TYAE 5JS8A 2NYAA 3MH4A 3EA8A 4CM4A 1Z6YA 2YV1A 3AUTA 3K09C 4JB3A 4D1YA 1YTUA 1P5ZB 3CU5A 4KGXA 3SO3A 1A71A 3D7RA 1XUOA 1GGDC 3VI4B 2G83A 4ZOAA 3KTAB 5AHXA 2WYWA 3E0QA 3PCRB 4MUAA 3N6RA 3WIEA 4IIUA 2BUCA 4JODA 2FG5A 3A1VA 4GPAA 1Q0RA 1P7YA 3PTZA 1KAHA 4NYJR 3OE1A 1YHYA 1XQXA 2Y81A 1LVGA 1K5GA 2QXJA 4CFZA 1KHTA 3CXUA 1OREA 1ZK4A 1JEEA 3EEFA 2PLWA 4U01A 5I4KA 3VR5A 5KYNA 4WCFA 3OQJA 3HPTB 2P6RA 1DCFA 3DA8A 4J2HA 5LP6A 4TYYA 1RHMA 5CA0F 3PIRA 3CONA 5JI3E 5CYGA 3CUSA 3K6SA 4WLFA 3EIFA 3M5CA 1XAHA 4J49A 1XCOA 2YC4C 1PIWA 1BKDR 3EBLA 1EXWA 3VX3A 5DHUA 3IS3A 4ITRC 1DRJA 1V3QE 3E58A 5JJBA 2P2GA 4HD8A 1YPKH 5EIEA 4D9JA 4YP9A 3OF2A 2FPIB 5K03A 4EX7A 3KQCA 3LLSA 2WUVA 2K4MA 3EDMA 3QSGA 2X14A 5ALUA 3ZCQA 5SYNA 3BXFA 4QOSA 1R6AA 2AHME 1XQWA 4XCVA 4ZEVA 1SBIA 1HA3A 3TOZA 3H9QA 1NN3A 5C8YB 2VJAA 2X22A 4CI0B 4R9VA 2O8BB 2BYAX 1TTQB 5TVGA 1U4SA 3ZZ1A 1UAAA 1S0QA 1X7XA 3DFMA 5C37A 1TE2A 1E3DA 7GCHG 2Y1OA 4EVIA 3HSSA 2XKBA 3UC5A 1UHBB 1K92A 5B6OA 2AD5A 4R6XA 3NBQA 4INAA 1AF7A 1NYRA 2WWRA 4KNVA 4HZIA 1V25A 3GZ4A 2DJ5A 2BI8A 1SHYA 5KB3A 1KL7A 4CKCB 4D5EA 5HIAA 3GLVA 2RKWA 3LD9A 4RFLA 2I3GA 2P78A 4ZHSA 4PSDA 3PJDA 1HR0B 2G70A 2F1IA 3D4OA 1U9JA 1FP2A 1D9IA 1S89A 4PBTA 2UZAA 3BL6A 4M9UA 4HT3B 3OP1A 1XUGA 3L1JA 4ZV9A 4DHWA 5JXGA 1F2SE 4D9RA 2YYSA 4ESHA 4HX9A 5FWDA 1KI2A 3PC3A 1VB3A 2CLLB 1EGVB 5JAMA 3UT0A 2OC8A 5CB6A 1NXVA 1WUHS 5J1TB 3SQNA 4B3DA 3M89A 3TQTA 3IALA 4K9PA 1S84A 2WUDA 4ZHQF 1QTIA 4RZIA 2HWWA 2BGKA 2AVDA 3VR1A 5HSGA 2GN0A 1SC1A 4AL4A 1W4LA 4MV4A 5JAHA 1PJ2A 4ARUA 3DE5X 4B4WA 4HAUA 2KZ4A 2DR3A 4FMCB 5B64A 1YR3A 2NU4E 2ZDQA 2WHPA 5L3SB 2JGNA 3MSCA 1AUVA 3MOCA 1KGDA 1U2DC 5LCXA 5CDFE 1A88A 3F3KA 3HO8A 4ZN6A 3AF2A 5B7PA 3OURA 2XAUA 4I81A 1WCV1 1PP4A 2VIIA 1O31A 3FI0A 4B3TB 3KUDA 2FYRA 2AYWA 4AZTA 2HM7A 1XMOB 3B89A 1XRPA 1V3UA 4N5HX 3TGWA 2B1GA 4C7OA 2RGBA 2VHVA 1AHHA 3PWCA 5JPMH 3AM5A 1AWHB 4R83A 4NDAA 3FVFB 4OAOA 1Z39A 4Y2SA 4BAKB 4BEBA 4N7RA 3RXOA 5LOVF 3TZCA 4XVRA 4FFBA 1RMYA 1MC1A 2HUNA 4X66B 5JBTA 2RK6A 4GQIA 3OLCX 4B74A 1C4U2 1C4V2 4PQFA 4E12A 1JP7A 1FP4A 1SZJG 2CUNA 1NBOA 4OG2A 1P2KA 1KIFA 3NWOA 1QP8A 2Z8YM 3K2UA 1J90A 5ITZA 5ITVA 1BE1A 3GUYA 1Y98A 5CDGA 2CXQA 2W6MA 3G9XA 3PYMA 1UCFA 4H60A 2E4AA 4ZVQA 1S7GA 3VB3A 1Y6FA 1BFUA 1GVZA 2W4QA 2YN0A 3ONVA 2VBIA 1IEWA 3BXPA 4D7GA 4Z8YA 5DK1A 4QOIA 1UFQA 4XCXA 4Y3UA 4U6SA 3U44B 1BVUA 4H7KA 4AWXA 2AX3A 1OA0A 5DSFA 3KOOA 3TZ6A 4ABGA 3LYHA 5C80A 2FNAA 4HJRA 4HB2A 5BRRE 4EGCB 1EFRA 2QTLA 1DKRA 3T9AA 3G68A 4LHWA 1P2TA 4RF5A 4TQAA 1V9SA 2BWJA 2W11A 3JTMA 4UBKA 2XVAA 4GR5A 2QAGA 2G82A 1JHQA 5EJGA 5DMXA 5I7VA 4EBFA 4R5MA 1GP2A 3BL5A 4OTZA 4EJSC 3EGCA 1QH1B 1QDLB 1ELVA 1LDTT 1T2NA 2G6BA 1LLFA 3OQHA 3USCS 2XVZA 5THKA 4M86A 4GKAA 4L9RA 2VDKB 2CN0H 4XJSA 1D03A 4MH0R 5TARA 2YOGA 3HB4X 4XBCA 3TBHA 1C4XA 4NV1A 1SPJA 4IDEA 2ATXA 3MCZA 4YALA 1RXPA 3GFTA 5C0TA 1PPCE 2P8JA 4BVAA 4OL9A 4Q19A 3ZEAA 1GHXH 1E3EA 1CDEA 3DM5A 3HJHA 3PFWO 3SBDA 1QQ7A 1GNVA 1CR1A 2Y2UA 4UQPA 3VTAA 3ADCA 2CHUA 1LDGA 1B2LA 1O5GH 1IQMA 2OXEA 1QO0D 1NT1A 1TI7A 3F78A 1L7EA 3WYEA 3IYLW 1USGA 2GCOA 4FINA 1UZLA 3CUYA 3KUCA 2I71A 2PX6A 3KQYA 1KPGA 2OYRA 3V6MA 4CRCA 2XE7A 2HIMA 4AFNA 1V7QA 1F8FA 1X7WA 2ZSIA 2OFFA 3SU4A 2CYAA 3EOZA 3RXTA 5TVKA 2HMTA 2FLVA 1YPHE 2AFIB 2POCA 2QQFA 3E5NA 1BT7A 2EP5A 5GOTA 3ZVBA 5JARA 2ZR0A 1JPVA 3KQHA 2BFBA 1R8XA 3IKLA 3D81A 1KLTA 1YC5A 2XVYA 2PZAA 2Q2QA 3M3VA 3UTDA 3X2EA 3VUEA 3Q7TA 3EAJA 3DHNA 2Q7XA 2EHDA 1N57A 4X92A 4EDFA 1W49A 9LDTA 4JT8A 1G3UA 2HTFA 5BRNA 2NVUA 4B3HA 1MLDA 1ECLA 5BPHA 2C2WA 2I4OA 4M21A 4Y11E 3VR5H 5A8XA 1GA4A 2MSCB 4DANA 3UJHA 4EJFA 1CWUA 3C27B 1FP6A 2WHXA 3KEQA 4LYGA 1A8IA 3MF4A 3QMWA 4IXMA 3ZHRA 3N2YA 1QHNA 4TLCA 1A46H 4Z99A 2W6OA 2CLSA 2NSLA 1JHAA 1JR4A 1U0EA 3TLGB 4BPRA 2IX9A 4R1UA 4C30A 5JB8S 3EJWA 4F46A 1YZGA 4JYZA 4MQFB 1WSSH 3R7NA 1XZJA 2XD9A 2XQVA 3QEMB 4I5DA 4YX9A 1G2OA 1QOPB 3GRRA 2UV8A 3OMWA 1P2VA 2C4KA 4QPDA 2C94A 3NAMA 2IOQA 5BRAA 3A9SA 4AF6A 5F5LA 5K0JA 3AVPA 1GL6A 3D6JA 4AZSA 2PBRA 1QQAA 1EOLA 1AZTA 4QNMA 4ZVSA 3MMXA 1N2ZA 1RCUA 3NM5A 4C7VA 3KYGA 1QQ4A 2YY7A 2Q1WA 4L75A 5IUJC 2VKQA 1J2RA 2RFLA 4ZVTA 1O89A 3DB2A 2D4AA 3GRPA 3A7DA 3HADA 1SOWA 3VNQA 1UTNA 4ATNA 5K3OA 2OSBA 1VE7A 5E38A 5B2EA 1E6CA 3ZZ9A 1O2NA 1XZEA 1CFJA 4XEHA 2VG8A 3K0BA 2B25A 2OYCA 1A4RA 2Q1JA 3UJ6A 5LYJB 4FC6A 4X2WA 1UQTA 2FW0A 3BMXA 1CUUA 4XRRA 4CTMA 3R5JA 3O4VA 4Z3DA 3S5JA 5B36A 1PS9A 2CFSA 1E6MA 3MS4A 3ZGOA 1TW3A 3DMHA 2Q6TA 1WXIA 2HYIC 4V24A 1F2VA 4GVXA 3SR4A 2ZDGA 4IEEA 5IARA 4FGUA 5THXA 3K0FB 4N8SA 5LD2B 1NJFA 4YPVA 1W7AA 3QUQA 3NP9A 4IS5A 1NFUA 1NASA 2H1IA 1T6ZA 2BZGA 2CNBA 2FW1A 2CBXA 3O9ZA 4PYRA 1LGYA 4LISA 4CMCA 3RRXA 1OYYA 3OU0A 1G5TA 2FZKA 4AO6A 4AZ3B 1IYZA 4TXJA 1XMSA 3ZW8A 3VC3A 3W1VA 3W5AA 1JQ3A 1G37A 2ZRMA 5JVDA 4U2BA 1G42A 3U4GA 3TQQA 3C74A 1ETSH 2IBSA 2W8ZA 2VSOA 2R2GA 5C8YA 2Q3BA 1DQYA 2O8BA 3LL7A 3I61A 3HFJA 3QNUA 2QL7A 3G9TA 3B85A 1M2WA 1O0SA 1TUIA 1TO2E 4PPQA 1KSGA 1OZHA 3GY2A 4X20B 3GK3A 2BD3A 3OO1A 3HUUA 3VYRB 3SZGA 2GCNA 2VIQA 2IHBA 3DGEC 2FQQA 1R6TA 3RMMH 3A32A 5BYAA 1Y7LA 4ZANA 3WZ2A 3I58A 3OZWA 2B2NA 4WTOA 4FGLA 2REQB 3VZRA 1RBQA 1XKXA 3EIEA 4MEBA 3LZCA 2G6TA 4JEIA 4GNRA 3JS5A 4Z0KA 4BBPA 3R76A 3PFFA 4X6LA 2GMTC 2HK7A 1Z7KA 2RHGB 2RGXA 2IEIA 3DEZA 3LT0A 5B53A 3O8LA 4MYCA 3CEMA 1FZTA 1YPJH 4MRSA 2EFEB 2PE5A 3KJZA 1ZRKA 3BG4B 2V6GA 4OU5A 3DNFA 1RM5A 3R0ZA 1NAHA 4IXTA 1EKXA 3CR8A 1U2ZA 5FUXA 1RKXA 1OUMA 2ZS8A 1PLLA 2NXJA 1A8QA 3QKUA 4EF4A 1NGSA 2CLMB 3A6DA 1L4LA 1Y9JA 1FDVA 2W2MA 3PMHB 4A0FA 5JROA 5FL7A 3GRAA 5LMNB 1P9NA 1UJNA 1IVYA 3F3BA 1YQTA 1JR3D 4UEKA 2C20A 4G81A 1BMLA 3OU6A 1ZONA 4BJ6A 2I1WA 2C9OA 5L3SA 3RIXA 3UMRA 1RRKA 3CJTA 4EEKA 4IUCS 1TCCA 3O2QB 1SOAA 1FNIA 2R4TA 2IT1A 4PHFA 4QAJA 4AP6A 1T0PA 4BQEA 4IIHA 3DZCA 3RWOA 1YRBA 1J21A 1A69A 2B0CA 2QUKA 3AI2A 4P00A 3L7BA 4F91B 3DAOA 2OCKA 4B79A 2F9LA 2I03A 4AG6A 1JHVA 2B5TB 5DGXA 4K9DA 4DDWA 3QTTA 3K7EA 4HI0E 4S1PA 5ERYA 1SXJC 2PJRA 4ADSG 2JFBA 3FTNA 3UHPA 3IHWA 1PVVA 3QU5A 3AOEC 1KK1A 1XLWA 4F1KA 2WB4A 3V1YA 2Q5LA 3LQ2A 4O8CA 1UF9A 5DISB 1Z5OA 4LZAA 1RXVA 2W2XA 1VSQA 1NRWA 3EWIA 4TYNA 4NESA 4QG7A 4FPXA 1QF7A 4RBNA 2CNLA 2C3OA 4KG7A 1HAVA 4V0MA 4XBDA 2Q27A 3V97A 4BLSA 4HI3A 4ZMSA 3O26A 1Z4NA 4Q1CA 3TIGA 3A3KA 1ZPDA 3UJDA 3WLKX 1BA2A 2WFLB 5TPWB 2SBTA 4E3WA 3L46A 4DIHH 1M1XB 3RTEA 3OTGA 4KGAA 1A27A 1TFRA 4QTYA 4N5NA 4M9QA 3ILXA 3O31A 2G77B 1NU6A 1Z0KA 4OD0A 2GSWA 2FZLA 3E9RA 1R0BA 1E92A 5ESWA 4XIFA 1HQKA 2O2IA 3TXAA 1GU0A 1CY0A 1NFRA 3QZQA 4K9NA 5ESDA 2YIDA 3TUZC 5AJUA 2GCHG 4F93B 2RAPA 1KYIA 2F43B 3HVIA 3DFZA 3E3AA 2WAXA 3R7BA 2RI6A 2QGNA 2OCVB 2LKCA 5A4JA 4ABTA 2Q3EA 1X70A 2WPMS 5KYTA 5HZKA 3OQPA 3SJ9A 2ZYSA 4R2XA 1FYWA 1UXJA 4M8NE 4RMHA 5LBUA 4KGZA 3KHUA 4B40A 3CLTD 4U8HA 4MMXB 3FNBA 4OIFA 4POOA 5FV7A 2AFVA 3EUWA 2CL7X 1CERA 1AKUA 4TWBA 3BXXA 2KX4A 1GBFA 2GHIA 4YIHA 4GOKA 1Z63A 1QB9A 3MLEA 1FA9A 1HG0A 3O2NA 4PPFA 3STVA 2QB5A 1TQ4A 3N0TA 2WG1A 1SNYA 1T1IA 2QORA 4U63A 1PQUA 2XUKA 1MV8A 1YNSA 5BSWA 1SQ0A 2IUSA 4FNAA 2LV8A 4RN6A 4RKWA 3GYGA 1QANA 2QD2A 3OFJA 1DXWA 3AZOA 3FFGA 4DLYA 5KNBH 5IS2A 4EKNB 1EHIA 5KQGA 3A2LA 4I5IA 3ZCUA 3B1JA 2CXOA 4MDHA 4F5ZA 1ZVVA 4M36A 4L8LA 2VJOA 4P53A 6GPBA 1WPGA 2AFIA 1Q3XA 3M3SA 1Y1RA 4O4LF 2VDRB 2NU6A 4B87A 4URVR 3IJEB 2X8BA 3HFRA 1SQFA 2ILNA 1T2CA 3KQQA 1A4WH 1D8AA 4WZAE 1XZDA 4ZVLA 2C8KA 2RA3A 4A8PA 5AHGH 1K98A 2IUUA 3MA0A 4R1QA 2PTHA 2G4TA 2Q9CA 4PFJA 3PX2A 3CNOA 4ZGWA 1B6GA 3OX7U 2I4RA 3T7SA 4HFJA 4MUNA 4NX2A 3KN2A 5DVZA 1KY4A 3RKRA 3UT6A 1F8XA 4YRTA 1CZLA 3AUJB 1WUTA 4ZJYA 2Q7DA 2HVYB 3ZWKA 2XQIA 3QK7A 1R0SA 5JNUA 3P0EA 1M3SA 1W0CA 2IP1A 4GPTA 4M1YA 4NMWA 4RS4A 2FZ5A 1CHOG 2W22A 4WV3A 3R75A 5E7MA 3OOWA 2D2IA 1XVMA 3PFHA 3QX5H 2AMVA 4HLUA 3CLKA 3TOSA 5GCHG 4JROA 4XWWA 5TPZA 3SEZA 1L7NA 3QG1A 5G1PA 3DUFA 2C0CA 1XA4A 1I36A 1ESDA 1FYDA 1R1DA 2JBHA 1VL8A 4IJ6A 4XA8A 3JZ1B 1M7HA 4QVKA 5TQ0A 2DB3A 4XIJA 3C6YA 3FSRA 4WASA 3IBGA 1YCFA 3IEXA 3VC7A 3OG9A 1V5EA 2QX6A 2OOKA 1JBUH 4X2YA 5HTKA 4K6KA 2F1OA 1M8PA 4R7GA 4BNVA 1F06A 4ZZ0A 4WZAB 1X9IA 2CN1A 2NADA 5A0TA 1QZUA 1EFVB 2VF8A 4CIYA 3BWEA 4RZ2A 4JJAA 3WB0A 3IQWA 3STHA 1P2UA 3UNRA 5EU8A 1R5BA 1XTBA 1NXSA 9ATCA 1SSXA 1T9HA 1WB5A 3EGIA 4AKEA 1N0VC 1RJDA 4LFAB 5KQRA 5JNSA 5BRJA 4X3OA 1FSGA 2DPMA 5FHQA 5HILA 4IS2A 4JQCA 2AD1A 3ZZBA 1WXXA 4PZCA 1EFDN 3UFAA 4RSRA 1OZGA 3CLRC 4GOXA 3REOA 4I4LA 3YASA 1E1MA 4UHHA 5DDIP 4TV9B 2XCNA 3NUGA 5KOHB 1C4Y2 2GD0A 1L7DA 4PLYA 5AI8A 3HUFA 2WIFA 4A36A 4X64B 3SMVA 1C50A 2H00A 4GH5A 5BQ5A 2QT9A 1O1YA 4RZ3A 2FK7A 2GAFA 5FQOA 3TLXA 3LS2A 3CJRA 1VITG 3NKVA 1TU3