3OAKA

Crystal structure of a spn1 (iws1)-spt6 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
151
structure length
151
Chain Sequence
GIDPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription factor IWS1
total genus 55
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3oakA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3oakA02
3V4QA 1MUUA 4AUWA 3A2AA 1G2CB 5AW9B 2N9BA 5AW5B 2YNYA 3TNUA 3A5TA 3VTPC 3L37A 2ZXEB 3P7KA 5APUA 4EOTA 5AVVB 3SWFA 4I6MC 1JUNA 3LIEA 1JNMA 3HTKA 2VRSA 2WPRA 4AYCA 3VN0A 2XPLA 4I2LC 1T2KC 2P7JA 3HE4A 3HE5A 2YO3A 5APWA 1HWTC 1KQLA 1FAVA 1CI6A 3HE4B 5APQA 2C9NY 3HPHE 2IPPA 1HUCA 5APTA 1CZQA 2XU6A 3P8MC 3M06A 2E43A 2WWWA 3VMYA 5AVQB 1GU4A 4GKGA 1HBWA 3O8ZA 1DH3A 3NMDA 4XE5B 4AQRD 5AW1B 1OXZA 1H88A 1H8AA 2B4JC 4HYTB 3LIDA 3A7OA 1S9KD 4LC1A 5AW4B 3TYYA 2WPSA 1J2JB 3L36A 1Z9EA 5AW6B 1GD2E 4M3LA 3MGNA 1YYCA 4DZOA 2YO2A 3HE5B 2C9LY 3U88C 1NAFA 2R32A 1MV8A 5AW7B 1EO0A 1CI6B 2WT7B 3OAKA 1NWQA 2H7HA 3T97A 4JYCA 2P67A 5AVYB 3UIAA 2BASA 5AW3B 2Q5UA 3M0AA 2WT7A 1FOSE 1GU5A 5APSA 1S9KE 1CSBA 4C46A 3NFQA 5AVTB 2Z5IA 3IR9A 5AW2B 1IO4A 3M9BA 4C7NA 3KDPB 2XPOA 3A3YB 1SLQA 2XV5A 5AVRB 1HJBA 4KHXA 3MD0A 2R5DA 3NTNA 1GK6A 2W27A 3TK1A 5AW8B 5AVWB 3NXSA 2XPPA 2P2UA 3M0DA 5AVUB 2XZRA 2WPQA 3VMXA 1SP4A 3B8EB 4RESB 2JJLA 1GK4A 2Q7CA 3VYIA 2R3CA 1A02J 2E42A 3KQGA 4B86A 2XPNA 2QM7A 2R5BA 3M91A 5AVZB 3V4WA 1FOSF 2WTYA 2Z5HA 3P32A 5APVA 4JYBA 5AVXB 5APXA 5AVSB 1GTWA 3M9HA 1MFZA 5AW0B 1H89A 3VMZA 1GZLA 5APYA 2W6AA 2ZFCA 3V5BA 5CMZA 1WJTA 2QM8A 1X8YA 2KP8A 1T2KD 1A02F 3HPGG 4C7NB 2N3AB 4GT1A 3TNUB 1OWAA 3L35A 3I5CA 3F9KC 2Q3IA
chains in the Genus database with same CATH superfamily
5H2FE 3A2AA 5KLVD 1K04A 1URQA 2OYHB 4I6MC 4DOJA 1BGYD 4WY4D 5KJ7D 1BCCJ 2E5YA 4AYCA 3WU2H 2WSFH 3H1JJ 1JCCA 4N78E 1KV4A 3B4SA 3QH9A 1NHLA 4DT0A 1MKMA 3GMAA 2B9BA 3CWBE 1USDA 3KZIH 2FBWC 3L74D 3VMYA 1HBWA 1L0ND 2IBZG 4AQRD 1N73C 2C6PA 1H8AA 2WQYC 3T97B 3CWBJ 1VQKP 2WSFJ 2R32A 3SFDC 1U57A 3VRPA 1PP9D 3UIAA 5AW3B 2IYOA 4BRYB 1OMIA 1FOSE 1VF5C 5DJUB 1GW3A 1R5SA 3IR9A 3RK3E 3G6EP 2YMKA 4C7NA 3C8VA 3Q5RA 5GTIE 3HD7A 4KHXA 1VF5B 4OC2A 2R5DA 2W27A 3AEAC 2CPBA 2A06G 3B8EB 1QL1A 1AVOA 3BUXB 1AJYA 2QM7A 2KXPB 4YPCA 3AE1C 3RK2C 1GTWA 1VQ9P 5M1BA 1L0LJ 1ZV8A 2ZAEB 3Q5PA 3SWYA 5KJ7A 3HPGG 5KLIB 1PP9E 3L74J 3CCJP 2OTJP 3FX0A 2OTKE 2KI7B 3I5CA 2C9LY 2W83C 1NH4A 3RL0B 4XA4A 3C1LA 3PLNA 1FZCA 3EFGA 5KLVG 1BE3D 3HUSA 1RQUA 1SS1A 4NGRA 5AVVB 3A0BH 3Q2YA 1U7JA 4C7RA 3U1AA 4NGTA 4WY4C 1KILC 4BXLA 1NTZD 4EIJA 3HE4A 2M0BA 2Q6QA 1VQ7P 1QX8A 2JR8A 2K3RA 4BPXB 1VQ4P 1LP1B 3BATA 3OB2B 1FZBA 1YVHA 3EFFK 5CBOA 4OWFA 4Y99C 3S9MA 1KILA 3AE6C 1YJWP 3MGNA 1S5LH 3OAKA 1T8ZA 4WY4B 1PZQA 3NFQA 1L0LG 5AVTB 3L70E 3TGUE 3MTUE 1NYHA 3S1KA 2NPSD 1SQQE 2ZXXA 1PL5A 2AEMA 2FFDC 2R5BA 3V4WA 5CJ0A 5AVXB 3P8CE 3H1KD 3CXHH 5CMZA 2AXCA 4UB8H 3WU2E 1EZVI 1SQQJ 1URQD 1NU1E 1NTKK 3GG2A 1LTGC 1G2CB 4IL6X 3H1HD 3LW5H 1GL2B 1ZLLA 3EQ2A 1SVFA 1KYOE 1LTIC 3BRTB 3HTKA 4W9YA 1KQSO 3G3ZA 3PJSK 2N1TC 1KQLA 1Y8AA 1IFNA 1NTKG 1HUCA 1GMJA 1SQVJ 4LQGA 4XFJA 5AVQB 1T6AA 3Q5SA 2KLUA 2OYIB 1J2JB 1D7MA 1JY3P 1OW8A 1YYCA 3AE3C 3HE5B 1N73A 1NAFA 3U1CA 2NPSA 5AW7B 2Y1MA 2ZYAA 3KYQA 1N8RQ 1FJPA 3H1LE 1OVUA 3GLMA 3HD7D 4RR2B 3WMM0 3D7GA 2AXTH 3R2PA 2P2UA 1KYOH 5AVUB 2Q7CA 1LGHB 4NGQA 1A02J 5APVA 1JTHB 1EZVG 1KB9H 1SQBG 3VRRA 5AVSB 2M3EA 2POHA 1SQBD 1R8EA 5DJTB 1NTMK 1M56D 1OW7A 3CL3D 4R4MA 1VQ8P 3BI0A 2FYNB 3AEGC 5AW9B 2E76B 1WRGA 2N1TD 3H1HG 1NTMD 3SWFA 3LIEA 3D70A 1MZ9A 3L75G 2PP6A 3S9OA 2K1AA 1T2KC 1S5LX 2IBZE 2A45G 4BPWB 1ZN5A 2B87A 2Z4EA 2CBLA 1P84H 3HPHE 2IYPA 2HODB 2E43A 3CLQA 4PV1C 4XE5B 2ZT9D 5K5GB 1Q86Q 1RHZB 1OIPA 5AW6B 1HTLC 2HLOA 3BVHA 4OVNF 4EDFA 1NOHA 3FGAD 1JM0A 4H13C 1P84E 3RK3B 2NPSC 2B89A 2FYUE 1E5WA 1YQ4C 2G8YA 5BVZA 2FYUK 1YTZT 1LTTC 3CC2P 1Y47A 1ZW0A 2JEEA 1SP4A 1DX7A 1KD1Q 5D29A 3P32A 3H32A 5APXA 4D6TJ 2XEFA 2W6AA 4JYWA 1WJTA 3MUDC 2Y0EA 1QLED 2YKOA 2VKZG 3E1IA 1CW5A 2K9JA 1JY2P 3RL0g 3A5TA 3VTPC 1Z8LA 2C6CA 1OX3A 3L70J 1L0NE 2XPLA 4I2LC 4L76A 1JMMA 1HJ0A 1IJDB 3MHVA 1FAVA 2GM4A 5APQA 2C9NY 3GF7A 2XU6A 3F89A 3O6QA 1DEBA 3G71P 1P84I 1G2CA 1Z9EA 2E5TA 3RGUA 2N1TB 2WSEH 1SQPE 3H1JG 2WT7B 4ZMDA 3BI1A 5CCHA 2WVRA 3L73E 2WSSH 2G3AA 4YXWH 1NTKJ 4PD4E 4EYYQ 4O9BA 1UIIA 2XV5A 1RE3A 5AVRB 1PIXA 2K37A 4PD4H 1VQ5P 1YIJP 1M1KQ 2XDJA 4NPFX 1YTZI 5CJ4A 4UB6E 1MFTA 3L70G 2CIJA 2RKLA 1SQQG 1NGMB 1RQVA 1SQVK 1L0NG 3BCCJ 5TJHA 2GUVA 3OJAB 3RBXA 1YITP 1ZP0C 3TNUB 2E75C 1EDIA 4DJGA 1PGPA 3RBZA 1L2PA 1ZOYC 5AW5B 3TNUA 4W7ZA 1GL2C 2CPSA 1XTGB 3H1JD 2WPRA 2LXCB 3SFEC 3RK3D 4H0LB 5E79H 1BE3J 3AE7C 1LJ2A 3CC7P 2E76C 3G9RA 4MCRA 4OGQB 2WSEJ 1RE3C 4WY4A 1PGOA 2LXBA 2P58A 1SQVD 3U88C 1KMIZ 1HH0A 2E74D 4BRYA 2HG5D 2W6JH 2OTLP 1JY3O 1KYOD 2HPCA 2JP3A 3U59A 4N78D 3BCCG 2ZYDA 1QL2A 1BSHA 3SSUA 3TK1A 1OZHA 4ZKUA 2FYNC 3HUSC 1GDTA 2QE7H 1N7SC 4RESB 1LWUC 2BEQD 2KZIA 4RKUJ 3HTKB 1NTMJ 1FBVA 3M9HA 4WB4A 2D2CC 1FZCB 1SQQD 1EC5A 4N3YB 2GA1A 3A0HH 3L35A 5EFWB 2PVWA 1FC2C 1FZAA 5KTBA 3TGUG 1BCCG 4MCSA 1BDDA 2OYIC 5B5EH 2JDIH 2KUBA 1IFJA 1NKZB 1KILB 3V2QA 2JWDA 2XNDH 2OYIA 5CCHD 2XKMA 3E7KA 1T3JA 4P4DA 3JCUE 3CCLP 4JQ0D 3AEBC 2FYZA 3EWKA 2QJPB 3D6ZA 1R5LA 3CXHD 2KSJA 1N2DC 3LIDA 3CWBG 2QIWA 4LC1A 4MCQA 1WT6A 1ZR4A 3VGOA 3AE8C 1PPJD 1Q2NA 3GF3A 4TLFA 2XEGA 3B5NB 2O3JA 4ASWA 4H0LD 3KZIE 1S5LE 3A3YB 1GL2D 2Q9IA 1LTJA 2IDBA 3MD0A 3HD7C 2K9JB 3SJGA 1NU1J 1FDOA 2ITAA 3CX5E 1YI2P 1M1JA 3VMXA 2FXMA 1G1JA 2HYNA 2R3CA 3BASA 3M91A 2JKVA 1IC2A 2E74B 3I55P 3ITKA 3VMZA 3V5BA 1KTMA 2JO1A 2QSIA 3L75D 1K73Q 1JCDA 3H1ID 2O01N 4OGQD 4WVZA 1EXIA 2NRGA 1EQ7A 3F9KC 4R4LA 3LW5J 1L4AC 2JBJA 2ZVNB 3E1RA 4IOIH 4H0LC 1M1JC 4KT0J 3CCSP 4BWNA 1LT9A 2PRRA 3H1LG 2P7JA 4U3FE 2PVVA 4IL6E 5APWA 3S9NA 2AEFA 2O1KA 1PPJE 3I56P 2Q3EA 4P44A 3M06A 1GU4A 1S1CX 2M5AB 4HYTB 3CWBD 4JBZA 2BCCJ 5BY0A 1YJ9P 1SQPK 1NU1K 2WMMA 1BE3G 4GODA 2OGUA 2OOTA 3JC22 4U3FG 2KZJA 1S9KE 5KAFH 3H25A 1DD4A 1BCCE 3M9BA 2OYOA 3KDPB 3ZNIA 4OMEA 2OR4A 3PTZA 3VRNA 2JBKA 2IZ0A 2XPPA 1SQPG 3L73G 3PFVA 3JCUH 4L73A 4I7ZB 1L0LK 1RF0A 3SWKA 1N7SD 5APYA 2ZFCA 2QJPC 1EDJA 1A02F 4C7NB 1RF1B 1X0TA 5B5EE 1AQTA 1HGVA 1GL2A 1L0LD 2YNYA 1T3UA 3PHLA 4JZ0A 3CCQP 3B5ND 5APUA 1CX8A 1JNMA 4U7JA 2CK3H 1PGQA 1Z56A 2YO3A 4MCPA 1SQQK 3D71A 3O6QB 1SQXE 1RH5B 1CI6A 2WZ7A 3CX5D 4PV1B 2N1TA 1OXZA 3IWWA 1KILE 3C9IA 1S9KD 2HR3A 1NU1D 1GD2E 2R3SA 4MN4C 2A06E 1J1DB 2IFNA 1EO0A 4KJMA 4UB6H 3BUMB 3WUTA 1LTSC 2QJKB 2P1JA 1AQ5A 4D6TE 2V4HA 3RL0D 1IO4A 3CI9A 1SQXD 1OVVA 1UIXA 3NXSA 3G4SP 2Y0DA 2ZT9C 3W67A 1KN7A 1QVGO 3SJEA 1M7LA 4H44D 2IBZI 2KSEA 2LR2A 1PP9G 4A7PA 4B86A 4D6TG 1K8AQ 1FOSF 1FBMA 2KLVA 1SQVE 1ZRTE 2ZVOB 4L75A 1FDMA 3GW6A 1SQXJ 3K5BA 3CXHE 2QM8A 1T2KD 3L71J 2SPZA 1HVVA 2QG4A 2I1KA 1LT1A 1EDKA 1KORA 1P84D 1HF9A 3L74G 3H1HJ 1JEKA 3PLFB 1SQPD 2A45I 3HMJG 1JO5A 4TT3H 1VF5D 4WBAA 5L8RJ 4OC5A 3H1KE 1JTHA 4OGQC 2VRSA 3KXDA 2QVAA 1HGZA 4P4EA 3H1IJ 3TF5A 3H1HE 2HODA 1NVOA 2HFED 2IPPA 3D6YA 5KLIC 2WWWA 1SQBE 4NGMA 2M8RA 4OC3A 1SFCC 3BUNB 3L72D 3S9LA 1RE4A 1VL2A 4K3AA 3CMEP 2YO2A 4I7ZC 4W7YA 2HPCB 1PP9J 1CI6B 3L74E 3OA7A 1N7SB 5AVYB 4NPDA 1SQBJ 1LWUA 2V7QJ 2W6BA 4C46A 4OC4A 2FXPA 5BU5A 1SQXG 3CCRP 3L71E 1AFOA 5B66E 1GK6A 1SQXK 1BSNA 3M0DA 1KB9I 2WPQA 3OB1B 3PRJA 3CCEP 3VYIA 3F5HA 1VPCA 2E42A 3VRQA 5AVZB 2WTYA 1NTZK 3SJFA 1BE3E 5AW0B 2B88A 1GZLA 2Y9YA 2Y9ZA 3PP5A 1RE4C 4PV1D 4BTFA 1YJNP 1IK9A 3H32B 1FZGA 1OWAA 5TISE 5J3XA 3TGUD 2N9BA 3B5NA 2QEXP 1DD3A 3AE2C 1FZEA 1OW6A 2NPSB 2ZXEB 1QGKB 1PPJG 2PGDA 3BHXA 1GW4A 1ZXGA 2FYUG 1KC8Q 2A45H 1BCCD 3BCCD 4YTPC 5GTIH 1IK7A 1FZFA 3II6A 1QVFO 1VQMP 3M9QA 1K05A 3AEEC 1NTZJ 1LTAC 3L72J 3O8ZA 2P10A 4H44B 2K88A 1JY2N 1AV1A 3BUOB 1YQ3C 3L72G 2YIUC 1Q7YQ 1BDCA 4M3LA 1ZRTD 2JWAA 2BCCG 2FFDA 3T97A 2C6GA 4QMAA 2QJYB 3L72E 2O1JA 3L4FA 1KQGB 1DEEG 2E74C 3MZWB 1SLQA 4L74A 1HJBA 1VQ6P 3CCMP 2Y1NA 2L91A 1LTBC 5AVWB 4PJ0E 2E75D 2PFXA 4JPZB 2JJLA 3VOPA 1E79H 3AE5C 2UV8G 1OVRA 3OW2O 5H2FH 1VQNP 4Y99B 5B66H 3A0HE 3TDKA 1KQFB 3RK3C 3AE9C 4GPLB 1ZMEC 1B47A 3FEDA 2RH0A 2ZT9B 1OFCX 3KASA 2WSCJ 1NTZE 1MUUA 5GTHE 4HB1A 1M90Q 3CXHI 2M5AA 4A4CA 4WWIA 2Y0CA 1WMKA 2KIKA 3VN0A 4P4IA 3L71D 2V7QH 1J1DC 4I1LA 1KB9E 2MKVA 2DW3A 5HKWA 3P8MC 3GHGB 1H88A 5E79E 2D2CD 3IN6A 4P4BA 3L73D 4YXDC 2C0XA 4P4FA 5KAIH 1NTKD 3BUWB 2J58A 3N7NA 3B5NC 4NGSA 2Q5UA 3M0AA 1M1JB 1NTZG 2IZ1A 2ZJSE 3PT1A 1RF0C 3D7HA 3CCVP 1FJKA 3IF4A 2GUSA 1JB0J 2C0WA 1KYOI 2J59M 4U3FJ 1MFZA 2KNCB 3JSVC 1YHQP 2N9YB 1USEA 3BRVB 3H1JE 2BCCE 4NGPA 3WUVA 3FECA 4RJTA 5BU8B 3L73J 2W8ZA 1JMBA 3H1LD 1FDIA 2QJYC 4PJ0H 3Q1MA 2FY8A 3A0BE 1N86A 3CCUP 3HE5A 1L0LE 4NPEA 1HWTC 5HKYA 5KLVK 3HE4B 5F09A 1PGJA 1Q82Q 5GTHH 1L4AA 2XNXA 1SFCD 2E75B 3WUUA 2H88C 3MUDA 1VDFA 2B4JC 1IFDA 2WSCH 1KB9D 2OQQA 4W80A 5F13A 2XEJA 1SFCA 1FE6A 1AVYA 2P67A 1JY3N 5CHXA 3CD6P 2Z5IA 4HH2A 3AEDC 2WITA 2XPOA 5KAIE 1VQLP 1BGYE 5CCGC 2YKPA 2IBZD 3W68A 2D2CB 1FZCC 4ASVA 5TISH 2WPVB 1U7MA 4JYBA 2KS1B 1LTJC 1S2EA 2N3AB 3VP9A 1JY2O 3KPEA 1VQOP 1DIPA 2Q3IA 1PV3A 4HJGH 2IFMA 3FXEA 3OP0A 1L4AD 1FU1A 1H0TA 2W90A 1LWUB 1JUNA 2H43A 4EI2A 5KJ7C 1YBKA 2YMYA 3L75J 1G1IA 3VROA 3V6IA 1IFMA 3AE4C 3BXMA 2J5UA 1QEXA 4IL6H 1PFIA 2M3BA 2O01H 3H1KG 1DH3A 1H0TB 1NU1G 1BGYJ 3TGUJ 1URQB 4GOEA 3D7DA 3L70D 1LP1A 3L36A 4PD4D 2YIUB 1BGYG 2KYVA 4DZOA 2FYUD 3CMAP 1EZVE 4ZKPA 1Y9BA 5CCHC 2BASA 3M0DC 3N4XA 1L0NJ 1SQBK 1XTCC 3NTNA 5AW8B 1M8OB 3P8CD 3AEFC 2PAJA 3V2NA 4H13D 1KFMA 2OYHA 1RF1A 2BCCD 4DCKA 4X3RA 4PD4I 2OYHC 3CX5H 2XPNA 1IFPA 5ELYA 3RK2B 2Z5HA 2AXTE 3H1LJ 3L71G 1Q90D 1SFCB 1H89A 4JF7A 2A06D 3FWLA 1EZVD 2KP8A 4N6JA 1RY3A 2K9YA 4GT1A 1KFNA 2YXQB 1Q81Q 1NKNA 5AW1B 3HRNA 1S3JA 4U3FD 3HD7B 3AECC 4AUWA 4P45A 1NTKE 4K35A 2FFDB 3L37A 1IZNB 4CPGA 3P7KA 2L5GB 3FXDA 1IFIA 2LKMA 4Z1MH 2KS1A 2O01J 2B87B 2KK7A 3D7FA 3S4RA 2BEZF 3CC4P 5C39A 3USSA 1CZQA 3NMDA 2RN0A 3BCCE 3A7OA 4GOFA 2FKWB 1W2EA 5AW4B 4GDOA 2IX7C 2WPSA 2RMZA 3IAOA 2E76D 1EXJA 4Y28J 1MV8A 1J1EC 1NWQA 1N7LA 4P4JA 5HKZA 2H7HA 4JYCA 1NTMG 1FS0E 3CPWO 2WT7A 1GU5A 1KILD 1W5CE 1X22A 1LT9B 1CSBA 3HUSB 4IFMA 2QRXA 5AW2B 1VQPP 1SQVG 4OC0A 4LLHA 1TU3F 1X9VA 2AEJA 1L4AB 1LT9C 3V2RA 2YKQA 4ZNCA 2FXOA 4D6TD 5AXIA 1GK4A 3VP8A 3KQGA 5CCGA 1J1EB 3H6PA 1JOCA 3B71A 2MJZA 1ZR2A 1NAYA 2R44A 4UB8E 3TSIA 3PH0A 1X8YA 1KZUB 5KLVJ 5CCGD 4IFFA 1L0NK 3V4QA 3GHGA 2NZ2A 3MIWA 2Q1KA 3VMAA 1X79B 4EOTA 2FYUJ 3RL0C 1AA0A 4BPUB 2H8PD 2ZYGA 1LTJB 3H1IG 3IFMA 2KB7P 1S4XA 1EDLA 3FWNA 5KLVE 4A4BA 4RO0A 1K9MQ 3FEEA 3RK2D 5KAFE 3KHUA 1NTME 3Q3DA 1URQC 1LNQA 1RF1C 5APTA 3ZDMA 3RBUA 1N7SA 4H13B 2I8DA 4GKGA 3V2PA 2OARA 4H44C 2KOGA 3TYYA 2KNCA 3MP7B 3QWOC 4GIFA 2I1JA 4LGDE 3GHGC 5APSA 1S72P 1M57D 4OH8B 2QA4P 4NGNA 3SJXA 3H1KJ 1NJIQ 3CX5I 2QJKC 5KKZB 2DLAA 2XZRA 3L75E 1W2BO 1DE4C 3H1IE 1SQPJ 5KKZC 2YXRB 4IFDK 3ABVC 2XEIA 4OC1A 1NO4A 3R4YA 2UWJE 2H89C 1N73B 3FF3A 4HKZH 5CBNA
chains in the Genus database with same CATH topology
3E1IA 3A2AA 1CW5A 1URQA 5BU8B 2YNYA 1JY2P 2OYHB 1T3UA 3A5TA 3VTPC 3B5ND 5APUA 4I6MC 1JNMA 4DOJA 4WY4D 5KJ7D 4AYCA 2XPLA 2WSFH 4I2LC 1JCCA 4N78E 1Z56A 1N86A 1JMMA 1NHLA 3HE5A 2YO3A 1IJDB 1SQQK 1HWTC 1FAVA 5KLVK 2GM4A 1CI6A 3HE4B 5APQA 2C9NY 2WZ7A 1L4AA 2XNXA 1SFCD 2XU6A 3VMYA 1HBWA 2N1TA 4AQRD 1N73C 3MUDA 1OXZA 1DEBA 1VDFA 1H8AA 2B4JC 1IFDA 3C9IA 1S9KD 2WSCH 1G2CA 4W80A 1Z9EA 1GD2E 1SFCA 2R32A 2N1TB 2WSEH 1J1DB 2IFNA 1EO0A 2WT7B 2P67A 1JY3N 3UIAA 5CHXA 1LTSC 5CCHA 5AW3B 2P1JA 1FOSE 1AQ5A 2Z5IA 4HH2A 1GW3A 3IR9A 3RL0D 1IO4A 2WITA 4C7NA 4O9BA 3CI9A 2XPOA 3HD7A 2XV5A 1RE3A 5AVRB 4KHXA 2R5DA 2W27A 3NXSA 2CPBA 5CCGC 1M7LA 3B8EB 1QL1A 2YKPA 2XDJA 1FZCC 1YTZI 5CJ4A 4B86A 2QM7A 1FOSF 1FBMA 2KLVA 4JYBA 3RK2C 1GTWA 1LTJC 1ZV8A 1SQVK 1FDMA 2QM8A 3SWYA 5KJ7A 1T2KD 3HPGG 2GUVA 1HVVA 2N3AB 3VP9A 2I1KA 1JY2O 3KPEA 3OJAB 3TNUB 2C9LY 3I5CA 2Q3IA 1NH4A 3RL0B 4XA4A 2IFMA 1FZCA 3EFGA 2A45I 5AW5B 3TNUA 1JO5A 1L4AD 1FU1A 3HUSA 1GL2C 4W7ZA 4WBAA 2CPSA 1JTHA 1LWUB 5AVVB 1JUNA 2H43A 4C7RA 1XTGB 2VRSA 3U1AA 5KJ7C 2WPRA 4WY4C 1KILC 3RK3D 1HGZA 2YMYA 4EIJA 3HE4A 1G1IA 2HODA 2HFED 1IFMA 2IPPA 2WWWA 1PFIA 3BATA 2M8RA 2M3BA 2O01H 1DH3A 1FZBA 1SFCC 4Y99C 1RE4A 1URQB 1KILA 1RE3C 4WY4A 3L36A 3MGNA 2KYVA 4DZOA 2YO2A 3U88C 4W7YA 2HPCB 1HH0A 1CI6B 4ZKPA 3OAKA 3OA7A 1N7SB 2HG5D 5AVYB 5CCHC 1T8ZA 4WY4B 1JY3O 2BASA 1LWUA 2W6BA 2HPCA 4C46A 3NFQA 3M0DC 5AVTB 3N4XA 5BU5A 3U59A 4N78D 3MTUE 1AFOA 1QL2A 1SQBK 1XTCC 1GK6A 3NTNA 2NPSD 5AW8B 3TK1A 1SQXK 4ZKUA 3P8CD 2PAJA 3V2NA 3M0DA 2WPQA 3HUSC 1GDTA 1KFMA 1N7SC 2OYHA 4RESB 1LWUC 1RF1A 3VYIA 1VPCA 2E42A 2OYHC 2FFDC 2XPNA 2R5BA 3HTKB 5AVZB 3V4WA 2WTYA 3RK2B 2Z5HA 1NTZK 5CJ0A 5AVXB 3M9HA 1SFCB 5AW0B 3P8CE 1H89A 4WB4A 4JF7A 1GZLA 3PP5A 1FZCB 5CMZA 1RE4C 2KP8A 4N6JA 1RY3A 4N3YB 4GT1A 1KFNA 1IK9A 3H32B 1FZGA 1NKNA 1OWAA 3L35A 1URQD 5AW1B 3HRNA 1NTKK 3HD7B 4AUWA 1LTGC 1G2CB 1FZAA 2N9BA 3LW5H 1GL2B 1ZLLA 3B5NA 2FFDB 5KTBA 3EQ2A 1FZEA 2NPSB 3L37A 1SVFA 2ZXEB 3P7KA 1LTIC 3BRTB 2L5GB 1GW4A 3HTKA 2OYIC 1IFIA 1IFJA 1NKZB 2LKMA 1KILB 2A45H 3G3ZA 3V2QA 2OYIA 5CCHD 1FZFA 2N1TC 2XKMA 3II6A 1KQLA 1T3JA 1IFNA 3M9QA 1HUCA 1CZQA 2FYZA 1LTAC 5AVQB 3O8ZA 3NMDA 2KSJA 1JY2N 1N2DC 2OYIB 3LIDA 3A7OA 2FKWB 1W2EA 4LC1A 5AW4B 2IX7C 2WPSA 1J2JB 1WT6A 1ZR4A 1JY3P 4M3LA 1YYCA 3HE5B 1N73A 1NAFA 1MV8A 1J1EC 3U1CA 2NPSA 5AW7B 1NWQA 1N7LA 3B5NB 2FFDA 2H7HA 3T97A 4JYCA 3KYQA 2WT7A 1FJPA 1GU5A 1KILD 1LT9B 1CSBA 3HUSB 4IFMA 2O1JA 3HD7D 3L4FA 5AW2B 4LLHA 3A3YB 1SLQA 1X9VA 1GL2D 1LTJA 1HJBA 1L4AB 1LT9C 3HD7C 3MD0A 2Q9IA 3WMM0 3R2PA 3V2RA 2YKQA 1LTBC 5AVWB 2P2UA 5AVUB 1M1JA 3VMXA 2FXMA 1G1JA 2JJLA 3VOPA 1GK4A 2Q7CA 2HYNA 1LGHB 3VP8A 2R3CA 1A02J 3BASA 3KQGA 3M91A 5CCGA 5APVA 1JTHB 1J1EB 1IC2A 1JOCA 3H6PA 5AVSB 2MJZA 2POHA 4Y99B 3VMZA 1ZR2A 3V5BA 3TSIA 1X8YA 3RK3C 1NTMK 3CL3D 1JCDA 1KZUB 1EQ7A 3F9KC 5CCGD 4IFFA 1L0NK 3V4QA 1MUUA 3GHGA 5AW9B 1L4AC 3MIWA 1WRGA 2N1TD 1M1JC 1X79B 4EOTA 3SWFA 3LIEA 3RL0C 1MZ9A 2H8PD 1LT9A 2PP6A 1LTJB 3VN0A 3IFMA 2KB7P 1T2KC 2P7JA 1J1DC 2A45G 5APWA 4I1LA 1ZN5A 3RK2D 2O1KA 2Z4EA 1URQC 3HPHE 1RF1C 5APTA 3P8MC 3M06A 2HODB 1N7SA 3GHGB 2E43A 1GU4A 4GKGA 3V2PA 2OARA 3CLQA 4XE5B 1H88A 4HYTB 2KOGA 2C0XA 3TYYA 5AW6B 1SQPK 1HTLC 2HLOA 3BVHA 1NU1K 2J58A 3N7NA 3B5NC 4GIFA 2I1JA 1NOHA 4LGDE 3GHGC 2Q5UA 3M0AA 5APSA 1S9KE 3RK3B 2NPSC 4OH8B 1M1JB 3M9BA 3KDPB 1E5WA 5BVZA 2FYUK 1RF0C 1YTZT 1LTTC 2XPPA 2XZRA 2JEEA 1SP4A 1DX7A 1FJKA 2GUSA 2C0WA 3P32A 3H32A 4IFDK 5APXA 1L0LK 2J59M 1MFZA 1RF0A 1N7SD 5APYA 2W6AA 2ZFCA 1NO4A 1WJTA 1A02F 3BRVB 4C7NB 1RF1B 1HGVA 1N73B 1GL2A 2YKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4Q A;  1MUU A;  4AUW A;  3A2A A;  1G2C B;  5AW9 B;  2N9B A;  5AW5 B;  2YNY A;  3TNU A;  3A5T A;  3VTP C;  3L37 A;  2ZXE B;  3P7K A;  5APU A;  4EOT A;  5AVV B;  3SWF A;  4I6M C;  1JUN A;  3LIE A;  1JNM A;  3HTK A;  2VRS A;  2WPR A;  4AYC A;  3VN0 A;  2XPL A;  4I2L C;  1T2K C;  2P7J A;  3HE4 A;  3HE5 A;  2YO3 A;  5APW A;  1HWT C;  1KQL A;  1FAV A;  1CI6 A;  3HE4 B;  5APQ A;  2C9N Y;  3HPH E;  2IPP A;  1HUC A;  5APT A;  1CZQ A;  2XU6 A;  3P8M C;  3M06 A;  2E43 A;  2WWW A;  3VMY A;  5AVQ B;  1GU4 A;  4GKG A;  1HBW A;  3O8Z A;  1DH3 A;  3NMD A;  4XE5 B;  4AQR D;  5AW1 B;  1OXZ A;  1H88 A;  1H8A A;  2B4J C;  4HYT B;  3LID A;  3A7O A;  1S9K D;  4LC1 A;  5AW4 B;  3TYY A;  2WPS A;  1J2J B;  3L36 A;  1Z9E A;  5AW6 B;  1GD2 E;  4M3L A;  3MGN A;  1YYC A;  4DZO A;  2YO2 A;  3HE5 B;  2C9L Y;  3U88 C;  1NAF A;  2R32 A;  1MV8 A;  5AW7 B;  1EO0 A;  1CI6 B;  2WT7 B;  3OAK A;  1NWQ A;  2H7H A;  3T97 A;  4JYC A;  2P67 A;  5AVY B;  3UIA A;  2BAS A;  5AW3 B;  2Q5U A;  3M0A A;  2WT7 A;  1FOS E;  1GU5 A;  5APS A;  1S9K E;  1CSB A;  4C46 A;  3NFQ A;  5AVT B;  2Z5I A;  3IR9 A;  5AW2 B;  1IO4 A;  3M9B A;  4C7N A;  3KDP B;  2XPO A;  3A3Y B;  1SLQ A;  2XV5 A;  5AVR B;  1HJB A;  4KHX A;  3MD0 A;  2R5D A;  3NTN A;  1GK6 A;  2W27 A;  3TK1 A;  5AW8 B;  5AVW B;  3NXS A;  2XPP A;  2P2U A;  3M0D A;  5AVU B;  2XZR A;  2WPQ A;  3VMX A;  1SP4 A;  3B8E B;  4RES B;  2JJL A;  1GK4 A;  2Q7C A;  3VYI A;  2R3C A;  1A02 J;  2E42 A;  3KQG A;  4B86 A;  2XPN A;  2QM7 A;  2R5B A;  3M91 A;  5AVZ B;  3V4W A;  1FOS F;  2WTY A;  2Z5H A;  3P32 A;  5APV A;  4JYB A;  5AVX B;  5APX A;  5AVS B;  1GTW A;  3M9H A;  1MFZ A;  5AW0 B;  1H89 A;  3VMZ A;  1GZL A;  5APY A;  2W6A A;  2ZFC A;  3V5B A;  5CMZ A;  1WJT A;  2QM8 A;  1X8Y A;  2KP8 A;  1T2K D;  1A02 F;  3HPG G;  4C7N B;  2N3A B;  4GT1 A;  3TNU B;  1OWA A;  3L35 A;  3I5C A;  3F9K C;  2Q3I A; 
#chains in the Genus database with same CATH topology
 5H2F E;  3A2A A;  5KLV D;  1K04 A;  1URQ A;  2OYH B;  4I6M C;  4DOJ A;  1BGY D;  4WY4 D;  5KJ7 D;  1BCC J;  2E5Y A;  4AYC A;  3WU2 H;  2WSF H;  3H1J J;  1JCC A;  4N78 E;  1KV4 A;  3B4S A;  3QH9 A;  1NHL A;  4DT0 A;  1MKM A;  3GMA A;  2B9B A;  3CWB E;  1USD A;  3KZI H;  2FBW C;  3L74 D;  3VMY A;  1HBW A;  1L0N D;  2IBZ G;  4AQR D;  1N73 C;  2C6P A;  1H8A A;  2WQY C;  3T97 B;  3CWB J;  1VQK P;  2WSF J;  2R32 A;  3SFD C;  1U57 A;  3VRP A;  1PP9 D;  3UIA A;  5AW3 B;  2IYO A;  4BRY B;  1OMI A;  1FOS E;  1VF5 C;  5DJU B;  1GW3 A;  1R5S A;  3IR9 A;  3RK3 E;  3G6E P;  2YMK A;  4C7N A;  3C8V A;  3Q5R A;  5GTI E;  3HD7 A;  4KHX A;  1VF5 B;  4OC2 A;  2R5D A;  2W27 A;  3AEA C;  2CPB A;  2A06 G;  3B8E B;  1QL1 A;  1AVO A;  3BUX B;  1AJY A;  2QM7 A;  2KXP B;  4YPC A;  3AE1 C;  3RK2 C;  1GTW A;  1VQ9 P;  5M1B A;  1L0L J;  1ZV8 A;  2ZAE B;  3Q5P A;  3SWY A;  5KJ7 A;  3HPG G;  5KLI B;  1PP9 E;  3L74 J;  3CCJ P;  2OTJ P;  3FX0 A;  2OTK E;  2KI7 B;  3I5C A;  2C9L Y;  2W83 C;  1NH4 A;  3RL0 B;  4XA4 A;  3C1L A;  3PLN A;  1FZC A;  3EFG A;  5KLV G;  1BE3 D;  3HUS A;  1RQU A;  1SS1 A;  4NGR A;  5AVV B;  3A0B H;  3Q2Y A;  1U7J A;  4C7R A;  3U1A A;  4NGT A;  4WY4 C;  1KIL C;  4BXL A;  1NTZ D;  4EIJ A;  3HE4 A;  2M0B A;  2Q6Q A;  1VQ7 P;  1QX8 A;  2JR8 A;  2K3R A;  4BPX B;  1VQ4 P;  1LP1 B;  3BAT A;  3OB2 B;  1FZB A;  1YVH A;  3EFF K;  5CBO A;  4OWF A;  4Y99 C;  3S9M A;  1KIL A;  3AE6 C;  1YJW P;  3MGN A;  1S5L H;  3OAK A;  1T8Z A;  4WY4 B;  1PZQ A;  3NFQ A;  1L0L G;  5AVT B;  3L70 E;  3TGU E;  3MTU E;  1NYH A;  3S1K A;  2NPS D;  1SQQ E;  2ZXX A;  1PL5 A;  2AEM A;  2FFD C;  2R5B A;  3V4W A;  5CJ0 A;  5AVX B;  3P8C E;  3H1K D;  3CXH H;  5CMZ A;  2AXC A;  4UB8 H;  3WU2 E;  1EZV I;  1SQQ J;  1URQ D;  1NU1 E;  1NTK K;  3GG2 A;  1LTG C;  1G2C B;  4IL6 X;  3H1H D;  3LW5 H;  1GL2 B;  1ZLL A;  3EQ2 A;  1SVF A;  1KYO E;  1LTI C;  3BRT B;  3HTK A;  4W9Y A;  1KQS O;  3G3Z A;  3PJS K;  2N1T C;  1KQL A;  1Y8A A;  1IFN A;  1NTK G;  1HUC A;  1GMJ A;  1SQV J;  4LQG A;  4XFJ A;  5AVQ B;  1T6A A;  3Q5S A;  2KLU A;  2OYI B;  1J2J B;  1D7M A;  1JY3 P;  1OW8 A;  1YYC A;  3AE3 C;  3HE5 B;  1N73 A;  1NAF A;  3U1C A;  2NPS A;  5AW7 B;  2Y1M A;  2ZYA A;  3KYQ A;  1N8R Q;  1FJP A;  3H1L E;  1OVU A;  3GLM A;  3HD7 D;  4RR2 B;  3WMM 0;  3D7G A;  2AXT H;  3R2P A;  2P2U A;  1KYO H;  5AVU B;  2Q7C A;  1LGH B;  4NGQ A;  1A02 J;  5APV A;  1JTH B;  1EZV G;  1KB9 H;  1SQB G;  3VRR A;  5AVS B;  2M3E A;  2POH A;  1SQB D;  1R8E A;  5DJT B;  1NTM K;  1M56 D;  1OW7 A;  3CL3 D;  4R4M A;  1VQ8 P;  3BI0 A;  2FYN B;  3AEG C;  5AW9 B;  2E76 B;  1WRG A;  2N1T D;  3H1H G;  1NTM D;  3SWF A;  3LIE A;  3D70 A;  1MZ9 A;  3L75 G;  2PP6 A;  3S9O A;  2K1A A;  1T2K C;  1S5L X;  2IBZ E;  2A45 G;  4BPW B;  1ZN5 A;  2B87 A;  2Z4E A;  2CBL A;  1P84 H;  3HPH E;  2IYP A;  2HOD B;  2E43 A;  3CLQ A;  4PV1 C;  4XE5 B;  2ZT9 D;  5K5G B;  1Q86 Q;  1RHZ B;  1OIP A;  5AW6 B;  1HTL C;  2HLO A;  3BVH A;  4OVN F;  4EDF A;  1NOH A;  3FGA D;  1JM0 A;  4H13 C;  1P84 E;  3RK3 B;  2NPS C;  2B89 A;  2FYU E;  1E5W A;  1YQ4 C;  2G8Y A;  5BVZ A;  2FYU K;  1YTZ T;  1LTT C;  3CC2 P;  1Y47 A;  1ZW0 A;  2JEE A;  1SP4 A;  1DX7 A;  1KD1 Q;  5D29 A;  3P32 A;  3H32 A;  5APX A;  4D6T J;  2XEF A;  2W6A A;  4JYW A;  1WJT A;  3MUD C;  2Y0E A;  1QLE D;  2YKO A;  2VKZ G;  3E1I A;  1CW5 A;  2K9J A;  1JY2 P;  3RL0 g;  3A5T A;  3VTP C;  1Z8L A;  2C6C A;  1OX3 A;  3L70 J;  1L0N E;  2XPL A;  4I2L C;  4L76 A;  1JMM A;  1HJ0 A;  1IJD B;  3MHV A;  1FAV A;  2GM4 A;  5APQ A;  2C9N Y;  3GF7 A;  2XU6 A;  3F89 A;  3O6Q A;  1DEB A;  3G71 P;  1P84 I;  1G2C A;  1Z9E A;  2E5T A;  3RGU A;  2N1T B;  2WSE H;  1SQP E;  3H1J G;  2WT7 B;  4ZMD A;  3BI1 A;  5CCH A;  2WVR A;  3L73 E;  2WSS H;  2G3A A;  4YXW H;  1NTK J;  4PD4 E;  4EYY Q;  4O9B A;  1UII A;  2XV5 A;  1RE3 A;  5AVR B;  1PIX A;  2K37 A;  4PD4 H;  1VQ5 P;  1YIJ P;  1M1K Q;  2XDJ A;  4NPF X;  1YTZ I;  5CJ4 A;  4UB6 E;  1MFT A;  3L70 G;  2CIJ A;  2RKL A;  1SQQ G;  1NGM B;  1RQV A;  1SQV K;  1L0N G;  3BCC J;  5TJH A;  2GUV A;  3OJA B;  3RBX A;  1YIT P;  1ZP0 C;  3TNU B;  2E75 C;  1EDI A;  4DJG A;  1PGP A;  3RBZ A;  1L2P A;  1ZOY C;  5AW5 B;  3TNU A;  4W7Z A;  1GL2 C;  2CPS A;  1XTG B;  3H1J D;  2WPR A;  2LXC B;  3SFE C;  3RK3 D;  4H0L B;  5E79 H;  1BE3 J;  3AE7 C;  1LJ2 A;  3CC7 P;  2E76 C;  3G9R A;  4MCR A;  4OGQ B;  2WSE J;  1RE3 C;  4WY4 A;  1PGO A;  2LXB A;  2P58 A;  1SQV D;  3U88 C;  1KMI Z;  1HH0 A;  2E74 D;  4BRY A;  2HG5 D;  2W6J H;  2OTL P;  1JY3 O;  1KYO D;  2HPC A;  2JP3 A;  3U59 A;  4N78 D;  3BCC G;  2ZYD A;  1QL2 A;  1BSH A;  3SSU A;  3TK1 A;  1OZH A;  4ZKU A;  2FYN C;  3HUS C;  1GDT A;  2QE7 H;  1N7S C;  4RES B;  1LWU C;  2BEQ D;  2KZI A;  4RKU J;  3HTK B;  1NTM J;  1FBV A;  3M9H A;  4WB4 A;  2D2C C;  1FZC B;  1SQQ D;  1EC5 A;  4N3Y B;  2GA1 A;  3A0H H;  3L35 A;  5EFW B;  2PVW A;  1FC2 C;  1FZA A;  5KTB A;  3TGU G;  1BCC G;  4MCS A;  1BDD A;  2OYI C;  5B5E H;  2JDI H;  2KUB A;  1IFJ A;  1NKZ B;  1KIL B;  3V2Q A;  2JWD A;  2XND H;  2OYI A;  5CCH D;  2XKM A;  3E7K A;  1T3J A;  4P4D A;  3JCU E;  3CCL P;  4JQ0 D;  3AEB C;  2FYZ A;  3EWK A;  2QJP B;  3D6Z A;  1R5L A;  3CXH D;  2KSJ A;  1N2D C;  3LID A;  3CWB G;  2QIW A;  4LC1 A;  4MCQ A;  1WT6 A;  1ZR4 A;  3VGO A;  3AE8 C;  1PPJ D;  1Q2N A;  3GF3 A;  4TLF A;  2XEG A;  3B5N B;  2O3J A;  4ASW A;  4H0L D;  3KZI E;  1S5L E;  3A3Y B;  1GL2 D;  2Q9I A;  1LTJ A;  2IDB A;  3MD0 A;  3HD7 C;  2K9J B;  3SJG A;  1NU1 J;  1FDO A;  2ITA A;  3CX5 E;  1YI2 P;  1M1J A;  3VMX A;  2FXM A;  1G1J A;  2HYN A;  2R3C A;  3BAS A;  3M91 A;  2JKV A;  1IC2 A;  2E74 B;  3I55 P;  3ITK A;  3VMZ A;  3V5B A;  1KTM A;  2JO1 A;  2QSI A;  3L75 D;  1K73 Q;  1JCD A;  3H1I D;  2O01 N;  4OGQ D;  4WVZ A;  1EXI A;  2NRG A;  1EQ7 A;  3F9K C;  4R4L A;  3LW5 J;  1L4A C;  2JBJ A;  2ZVN B;  3E1R A;  4IOI H;  4H0L C;  1M1J C;  4KT0 J;  3CCS P;  4BWN A;  1LT9 A;  2PRR A;  3H1L G;  2P7J A;  4U3F E;  2PVV A;  4IL6 E;  5APW A;  3S9N A;  2AEF A;  2O1K A;  1PPJ E;  3I56 P;  2Q3E A;  4P44 A;  3M06 A;  1GU4 A;  1S1C X;  2M5A B;  4HYT B;  3CWB D;  4JBZ A;  2BCC J;  5BY0 A;  1YJ9 P;  1SQP K;  1NU1 K;  2WMM A;  1BE3 G;  4GOD A;  2OGU A;  2OOT A;  3JC2 2;  4U3F G;  2KZJ A;  1S9K E;  5KAF H;  3H25 A;  1DD4 A;  1BCC E;  3M9B A;  2OYO A;  3KDP B;  3ZNI A;  4OME A;  2OR4 A;  3PTZ A;  3VRN A;  2JBK A;  2IZ0 A;  2XPP A;  1SQP G;  3L73 G;  3PFV A;  3JCU H;  4L73 A;  4I7Z B;  1L0L K;  1RF0 A;  3SWK A;  1N7S D;  5APY A;  2ZFC A;  2QJP C;  1EDJ A;  1A02 F;  4C7N B;  1RF1 B;  1X0T A;  5B5E E;  1AQT A;  1HGV A;  1GL2 A;  1L0L D;  2YNY A;  1T3U A;  3PHL A;  4JZ0 A;  3CCQ P;  3B5N D;  5APU A;  1CX8 A;  1JNM A;  4U7J A;  2CK3 H;  1PGQ A;  1Z56 A;  2YO3 A;  4MCP A;  1SQQ K;  3D71 A;  3O6Q B;  1SQX E;  1RH5 B;  1CI6 A;  2WZ7 A;  3CX5 D;  4PV1 B;  2N1T A;  1OXZ A;  3IWW A;  1KIL E;  3C9I A;  1S9K D;  2HR3 A;  1NU1 D;  1GD2 E;  2R3S A;  4MN4 C;  2A06 E;  1J1D B;  2IFN A;  1EO0 A;  4KJM A;  4UB6 H;  3BUM B;  3WUT A;  1LTS C;  2QJK B;  2P1J A;  1AQ5 A;  4D6T E;  2V4H A;  3RL0 D;  1IO4 A;  3CI9 A;  1SQX D;  1OVV A;  1UIX A;  3NXS A;  3G4S P;  2Y0D A;  2ZT9 C;  3W67 A;  1KN7 A;  1QVG O;  3SJE A;  1M7L A;  4H44 D;  2IBZ I;  2KSE A;  2LR2 A;  1PP9 G;  4A7P A;  4B86 A;  4D6T G;  1K8A Q;  1FOS F;  1FBM A;  2KLV A;  1SQV E;  1ZRT E;  2ZVO B;  4L75 A;  1FDM A;  3GW6 A;  1SQX J;  3K5B A;  3CXH E;  2QM8 A;  1T2K D;  3L71 J;  2SPZ A;  1HVV A;  2QG4 A;  2I1K A;  1LT1 A;  1EDK A;  1KOR A;  1P84 D;  1HF9 A;  3L74 G;  3H1H J;  1JEK A;  3PLF B;  1SQP D;  2A45 I;  3HMJ G;  1JO5 A;  4TT3 H;  1VF5 D;  4WBA A;  5L8R J;  4OC5 A;  3H1K E;  1JTH A;  4OGQ C;  2VRS A;  3KXD A;  2QVA A;  1HGZ A;  4P4E A;  3H1I J;  3TF5 A;  3H1H E;  2HOD A;  1NVO A;  2HFE D;  2IPP A;  3D6Y A;  5KLI C;  2WWW A;  1SQB E;  4NGM A;  2M8R A;  4OC3 A;  1SFC C;  3BUN B;  3L72 D;  3S9L A;  1RE4 A;  1VL2 A;  4K3A A;  3CME P;  2YO2 A;  4I7Z C;  4W7Y A;  2HPC B;  1PP9 J;  1CI6 B;  3L74 E;  3OA7 A;  1N7S B;  5AVY B;  4NPD A;  1SQB J;  1LWU A;  2V7Q J;  2W6B A;  4C46 A;  4OC4 A;  2FXP A;  5BU5 A;  1SQX G;  3CCR P;  3L71 E;  1AFO A;  5B66 E;  1GK6 A;  1SQX K;  1BSN A;  3M0D A;  1KB9 I;  2WPQ A;  3OB1 B;  3PRJ A;  3CCE P;  3VYI A;  3F5H A;  1VPC A;  2E42 A;  3VRQ A;  5AVZ B;  2WTY A;  1NTZ K;  3SJF A;  1BE3 E;  5AW0 B;  2B88 A;  1GZL A;  2Y9Y A;  2Y9Z A;  3PP5 A;  1RE4 C;  4PV1 D;  4BTF A;  1YJN P;  1IK9 A;  3H32 B;  1FZG A;  1OWA A;  5TIS E;  5J3X A;  3TGU D;  2N9B A;  3B5N A;  2QEX P;  1DD3 A;  3AE2 C;  1FZE A;  1OW6 A;  2NPS B;  2ZXE B;  1QGK B;  1PPJ G;  2PGD A;  3BHX A;  1GW4 A;  1ZXG A;  2FYU G;  1KC8 Q;  2A45 H;  1BCC D;  3BCC D;  4YTP C;  5GTI H;  1IK7 A;  1FZF A;  3II6 A;  1QVF O;  1VQM P;  3M9Q A;  1K05 A;  3AEE C;  1NTZ J;  1LTA C;  3L72 J;  3O8Z A;  2P10 A;  4H44 B;  2K88 A;  1JY2 N;  1AV1 A;  3BUO B;  1YQ3 C;  3L72 G;  2YIU C;  1Q7Y Q;  1BDC A;  4M3L A;  1ZRT D;  2JWA A;  2BCC G;  2FFD A;  3T97 A;  2C6G A;  4QMA A;  2QJY B;  3L72 E;  2O1J A;  3L4F A;  1KQG B;  1DEE G;  2E74 C;  3MZW B;  1SLQ A;  4L74 A;  1HJB A;  1VQ6 P;  3CCM P;  2Y1N A;  2L91 A;  1LTB C;  5AVW B;  4PJ0 E;  2E75 D;  2PFX A;  4JPZ B;  2JJL A;  3VOP A;  1E79 H;  3AE5 C;  2UV8 G;  1OVR A;  3OW2 O;  5H2F H;  1VQN P;  4Y99 B;  5B66 H;  3A0H E;  3TDK A;  1KQF B;  3RK3 C;  3AE9 C;  4GPL B;  1ZME C;  1B47 A;  3FED A;  2RH0 A;  2ZT9 B;  1OFC X;  3KAS A;  2WSC J;  1NTZ E;  1MUU A;  5GTH E;  4HB1 A;  1M90 Q;  3CXH I;  2M5A A;  4A4C A;  4WWI A;  2Y0C A;  1WMK A;  2KIK A;  3VN0 A;  4P4I A;  3L71 D;  2V7Q H;  1J1D C;  4I1L A;  1KB9 E;  2MKV A;  2DW3 A;  5HKW A;  3P8M C;  3GHG B;  1H88 A;  5E79 E;  2D2C D;  3IN6 A;  4P4B A;  3L73 D;  4YXD C;  2C0X A;  4P4F A;  5KAI H;  1NTK D;  3BUW B;  2J58 A;  3N7N A;  3B5N C;  4NGS A;  2Q5U A;  3M0A A;  1M1J B;  1NTZ G;  2IZ1 A;  2ZJS E;  3PT1 A;  1RF0 C;  3D7H A;  3CCV P;  1FJK A;  3IF4 A;  2GUS A;  1JB0 J;  2C0W A;  1KYO I;  2J59 M;  4U3F J;  1MFZ A;  2KNC B;  3JSV C;  1YHQ P;  2N9Y B;  1USE A;  3BRV B;  3H1J E;  2BCC E;  4NGP A;  3WUV A;  3FEC A;  4RJT A;  5BU8 B;  3L73 J;  2W8Z A;  1JMB A;  3H1L D;  1FDI A;  2QJY C;  4PJ0 H;  3Q1M A;  2FY8 A;  3A0B E;  1N86 A;  3CCU P;  3HE5 A;  1L0L E;  4NPE A;  1HWT C;  5HKY A;  5KLV K;  3HE4 B;  5F09 A;  1PGJ A;  1Q82 Q;  5GTH H;  1L4A A;  2XNX A;  1SFC D;  2E75 B;  3WUU A;  2H88 C;  3MUD A;  1VDF A;  2B4J C;  1IFD A;  2WSC H;  1KB9 D;  2OQQ A;  4W80 A;  5F13 A;  2XEJ A;  1SFC A;  1FE6 A;  1AVY A;  2P67 A;  1JY3 N;  5CHX A;  3CD6 P;  2Z5I A;  4HH2 A;  3AED C;  2WIT A;  2XPO A;  5KAI E;  1VQL P;  1BGY E;  5CCG C;  2YKP A;  2IBZ D;  3W68 A;  2D2C B;  1FZC C;  4ASV A;  5TIS H;  2WPV B;  1U7M A;  4JYB A;  2KS1 B;  1LTJ C;  1S2E A;  2N3A B;  3VP9 A;  1JY2 O;  3KPE A;  1VQO P;  1DIP A;  2Q3I A;  1PV3 A;  4HJG H;  2IFM A;  3FXE A;  3OP0 A;  1L4A D;  1FU1 A;  1H0T A;  2W90 A;  1LWU B;  1JUN A;  2H43 A;  4EI2 A;  5KJ7 C;  1YBK A;  2YMY A;  3L75 J;  1G1I A;  3VRO A;  3V6I A;  1IFM A;  3AE4 C;  3BXM A;  2J5U A;  1QEX A;  4IL6 H;  1PFI A;  2M3B A;  2O01 H;  3H1K G;  1DH3 A;  1H0T B;  1NU1 G;  1BGY J;  3TGU J;  1URQ B;  4GOE A;  3D7D A;  3L70 D;  1LP1 A;  3L36 A;  4PD4 D;  2YIU B;  1BGY G;  2KYV A;  4DZO A;  2FYU D;  3CMA P;  1EZV E;  4ZKP A;  1Y9B A;  5CCH C;  2BAS A;  3M0D C;  3N4X A;  1L0N J;  1SQB K;  1XTC C;  3NTN A;  5AW8 B;  1M8O B;  3P8C D;  3AEF C;  2PAJ A;  3V2N A;  4H13 D;  1KFM A;  2OYH A;  1RF1 A;  2BCC D;  4DCK A;  4X3R A;  4PD4 I;  2OYH C;  3CX5 H;  2XPN A;  1IFP A;  5ELY A;  3RK2 B;  2Z5H A;  2AXT E;  3H1L J;  3L71 G;  1Q90 D;  1SFC B;  1H89 A;  4JF7 A;  2A06 D;  3FWL A;  1EZV D;  2KP8 A;  4N6J A;  1RY3 A;  2K9Y A;  4GT1 A;  1KFN A;  2YXQ B;  1Q81 Q;  1NKN A;  5AW1 B;  3HRN A;  1S3J A;  4U3F D;  3HD7 B;  3AEC C;  4AUW A;  4P45 A;  1NTK E;  4K35 A;  2FFD B;  3L37 A;  1IZN B;  4CPG A;  3P7K A;  2L5G B;  3FXD A;  1IFI A;  2LKM A;  4Z1M H;  2KS1 A;  2O01 J;  2B87 B;  2KK7 A;  3D7F A;  3S4R A;  2BEZ F;  3CC4 P;  5C39 A;  3USS A;  1CZQ A;  3NMD A;  2RN0 A;  3BCC E;  3A7O A;  4GOF A;  2FKW B;  1W2E A;  5AW4 B;  4GDO A;  2IX7 C;  2WPS A;  2RMZ A;  3IAO A;  2E76 D;  1EXJ A;  4Y28 J;  1MV8 A;  1J1E C;  1NWQ A;  1N7L A;  4P4J A;  5HKZ A;  2H7H A;  4JYC A;  1NTM G;  1FS0 E;  3CPW O;  2WT7 A;  1GU5 A;  1KIL D;  1W5C E;  1X22 A;  1LT9 B;  1CSB A;  3HUS B;  4IFM A;  2QRX A;  5AW2 B;  1VQP P;  1SQV G;  4OC0 A;  4LLH A;  1TU3 F;  1X9V A;  2AEJ A;  1L4A B;  1LT9 C;  3V2R A;  2YKQ A;  4ZNC A;  2FXO A;  4D6T D;  5AXI A;  1GK4 A;  3VP8 A;  3KQG A;  5CCG A;  1J1E B;  3H6P A;  1JOC A;  3B71 A;  2MJZ A;  1ZR2 A;  1NAY A;  2R44 A;  4UB8 E;  3TSI A;  3PH0 A;  1X8Y A;  1KZU B;  5KLV J;  5CCG D;  4IFF A;  1L0N K;  3V4Q A;  3GHG A;  2NZ2 A;  3MIW A;  2Q1K A;  3VMA A;  1X79 B;  4EOT A;  2FYU J;  3RL0 C;  1AA0 A;  4BPU B;  2H8P D;  2ZYG A;  1LTJ B;  3H1I G;  3IFM A;  2KB7 P;  1S4X A;  1EDL A;  3FWN A;  5KLV E;  4A4B A;  4RO0 A;  1K9M Q;  3FEE A;  3RK2 D;  5KAF E;  3KHU A;  1NTM E;  3Q3D A;  1URQ C;  1LNQ A;  1RF1 C;  5APT A;  3ZDM A;  3RBU A;  1N7S A;  4H13 B;  2I8D A;  4GKG A;  3V2P A;  2OAR A;  4H44 C;  2KOG A;  3TYY A;  2KNC A;  3MP7 B;  3QWO C;  4GIF A;  2I1J A;  4LGD E;  3GHG C;  5APS A;  1S72 P;  1M57 D;  4OH8 B;  2QA4 P;  4NGN A;  3SJX A;  3H1K J;  1NJI Q;  3CX5 I;  2QJK C;  5KKZ B;  2DLA A;  2XZR A;  3L75 E;  1W2B O;  1DE4 C;  3H1I E;  1SQP J;  5KKZ C;  2YXR B;  4IFD K;  3ABV C;  2XEI A;  4OC1 A;  1NO4 A;  3R4Y A;  2UWJ E;  2H89 C;  1N73 B;  3FF3 A;  4HKZ H;  5CBN A; 
#chains in the Genus database with same CATH homology
 3E1I A;  3A2A A;  1CW5 A;  1URQ A;  5BU8 B;  2YNY A;  1JY2 P;  2OYH B;  1T3U A;  3A5T A;  3VTP C;  3B5N D;  5APU A;  4I6M C;  1JNM A;  4DOJ A;  4WY4 D;  5KJ7 D;  4AYC A;  2XPL A;  2WSF H;  4I2L C;  1JCC A;  4N78 E;  1Z56 A;  1N86 A;  1JMM A;  1NHL A;  3HE5 A;  2YO3 A;  1IJD B;  1SQQ K;  1HWT C;  1FAV A;  5KLV K;  2GM4 A;  1CI6 A;  3HE4 B;  5APQ A;  2C9N Y;  2WZ7 A;  1L4A A;  2XNX A;  1SFC D;  2XU6 A;  3VMY A;  1HBW A;  2N1T A;  4AQR D;  1N73 C;  3MUD A;  1OXZ A;  1DEB A;  1VDF A;  1H8A A;  2B4J C;  1IFD A;  3C9I A;  1S9K D;  2WSC H;  1G2C A;  4W80 A;  1Z9E A;  1GD2 E;  1SFC A;  2R32 A;  2N1T B;  2WSE H;  1J1D B;  2IFN A;  1EO0 A;  2WT7 B;  2P67 A;  1JY3 N;  3UIA A;  5CHX A;  1LTS C;  5CCH A;  5AW3 B;  2P1J A;  1FOS E;  1AQ5 A;  2Z5I A;  4HH2 A;  1GW3 A;  3IR9 A;  3RL0 D;  1IO4 A;  2WIT A;  4C7N A;  4O9B A;  3CI9 A;  2XPO A;  3HD7 A;  2XV5 A;  1RE3 A;  5AVR B;  4KHX A;  2R5D A;  2W27 A;  3NXS A;  2CPB A;  5CCG C;  1M7L A;  3B8E B;  1QL1 A;  2YKP A;  2XDJ A;  1FZC C;  1YTZ I;  5CJ4 A;  4B86 A;  2QM7 A;  1FOS F;  1FBM A;  2KLV A;  4JYB A;  3RK2 C;  1GTW A;  1LTJ C;  1ZV8 A;  1SQV K;  1FDM A;  2QM8 A;  3SWY A;  5KJ7 A;  1T2K D;  3HPG G;  2GUV A;  1HVV A;  2N3A B;  3VP9 A;  2I1K A;  1JY2 O;  3KPE A;  3OJA B;  3TNU B;  2C9L Y;  3I5C A;  2Q3I A;  1NH4 A;  3RL0 B;  4XA4 A;  2IFM A;  1FZC A;  3EFG A;  2A45 I;  5AW5 B;  3TNU A;  1JO5 A;  1L4A D;  1FU1 A;  3HUS A;  1GL2 C;  4W7Z A;  4WBA A;  2CPS A;  1JTH A;  1LWU B;  5AVV B;  1JUN A;  2H43 A;  4C7R A;  1XTG B;  2VRS A;  3U1A A;  5KJ7 C;  2WPR A;  4WY4 C;  1KIL C;  3RK3 D;  1HGZ A;  2YMY A;  4EIJ A;  3HE4 A;  1G1I A;  2HOD A;  2HFE D;  1IFM A;  2IPP A;  2WWW A;  1PFI A;  3BAT A;  2M8R A;  2M3B A;  2O01 H;  1DH3 A;  1FZB A;  1SFC C;  4Y99 C;  1RE4 A;  1URQ B;  1KIL A;  1RE3 C;  4WY4 A;  3L36 A;  3MGN A;  2KYV A;  4DZO A;  2YO2 A;  3U88 C;  4W7Y A;  2HPC B;  1HH0 A;  1CI6 B;  4ZKP A;  3OAK A;  3OA7 A;  1N7S B;  2HG5 D;  5AVY B;  5CCH C;  1T8Z A;  4WY4 B;  1JY3 O;  2BAS A;  1LWU A;  2W6B A;  2HPC A;  4C46 A;  3NFQ A;  3M0D C;  5AVT B;  3N4X A;  5BU5 A;  3U59 A;  4N78 D;  3MTU E;  1AFO A;  1QL2 A;  1SQB K;  1XTC C;  1GK6 A;  3NTN A;  2NPS D;  5AW8 B;  3TK1 A;  1SQX K;  4ZKU A;  3P8C D;  2PAJ A;  3V2N A;  3M0D A;  2WPQ A;  3HUS C;  1GDT A;  1KFM A;  1N7S C;  2OYH A;  4RES B;  1LWU C;  1RF1 A;  3VYI A;  1VPC A;  2E42 A;  2OYH C;  2FFD C;  2XPN A;  2R5B A;  3HTK B;  5AVZ B;  3V4W A;  2WTY A;  3RK2 B;  2Z5H A;  1NTZ K;  5CJ0 A;  5AVX B;  3M9H A;  1SFC B;  5AW0 B;  3P8C E;  1H89 A;  4WB4 A;  4JF7 A;  1GZL A;  3PP5 A;  1FZC B;  5CMZ A;  1RE4 C;  2KP8 A;  4N6J A;  1RY3 A;  4N3Y B;  4GT1 A;  1KFN A;  1IK9 A;  3H32 B;  1FZG A;  1NKN A;  1OWA A;  3L35 A;  1URQ D;  5AW1 B;  3HRN A;  1NTK K;  3HD7 B;  4AUW A;  1LTG C;  1G2C B;  1FZA A;  2N9B A;  3LW5 H;  1GL2 B;  1ZLL A;  3B5N A;  2FFD B;  5KTB A;  3EQ2 A;  1FZE A;  2NPS B;  3L37 A;  1SVF A;  2ZXE B;  3P7K A;  1LTI C;  3BRT B;  2L5G B;  1GW4 A;  3HTK A;  2OYI C;  1IFI A;  1IFJ A;  1NKZ B;  2LKM A;  1KIL B;  2A45 H;  3G3Z A;  3V2Q A;  2OYI A;  5CCH D;  1FZF A;  2N1T C;  2XKM A;  3II6 A;  1KQL A;  1T3J A;  1IFN A;  3M9Q A;  1HUC A;  1CZQ A;  2FYZ A;  1LTA C;  5AVQ B;  3O8Z A;  3NMD A;  2KSJ A;  1JY2 N;  1N2D C;  2OYI B;  3LID A;  3A7O A;  2FKW B;  1W2E A;  4LC1 A;  5AW4 B;  2IX7 C;  2WPS A;  1J2J B;  1WT6 A;  1ZR4 A;  1JY3 P;  4M3L A;  1YYC A;  3HE5 B;  1N73 A;  1NAF A;  1MV8 A;  1J1E C;  3U1C A;  2NPS A;  5AW7 B;  1NWQ A;  1N7L A;  3B5N B;  2FFD A;  2H7H A;  3T97 A;  4JYC A;  3KYQ A;  2WT7 A;  1FJP A;  1GU5 A;  1KIL D;  1LT9 B;  1CSB A;  3HUS B;  4IFM A;  2O1J A;  3HD7 D;  3L4F A;  5AW2 B;  4LLH A;  3A3Y B;  1SLQ A;  1X9V A;  1GL2 D;  1LTJ A;  1HJB A;  1L4A B;  1LT9 C;  3HD7 C;  3MD0 A;  2Q9I A;  3WMM 0;  3R2P A;  3V2R A;  2YKQ A;  1LTB C;  5AVW B;  2P2U A;  5AVU B;  1M1J A;  3VMX A;  2FXM A;  1G1J A;  2JJL A;  3VOP A;  1GK4 A;  2Q7C A;  2HYN A;  1LGH B;  3VP8 A;  2R3C A;  1A02 J;  3BAS A;  3KQG A;  3M91 A;  5CCG A;  5APV A;  1JTH B;  1J1E B;  1IC2 A;  1JOC A;  3H6P A;  5AVS B;  2MJZ A;  2POH A;  4Y99 B;  3VMZ A;  1ZR2 A;  3V5B A;  3TSI A;  1X8Y A;  3RK3 C;  1NTM K;  3CL3 D;  1JCD A;  1KZU B;  1EQ7 A;  3F9K C;  5CCG D;  4IFF A;  1L0N K;  3V4Q A;  1MUU A;  3GHG A;  5AW9 B;  1L4A C;  3MIW A;  1WRG A;  2N1T D;  1M1J C;  1X79 B;  4EOT A;  3SWF A;  3LIE A;  3RL0 C;  1MZ9 A;  2H8P D;  1LT9 A;  2PP6 A;  1LTJ B;  3VN0 A;  3IFM A;  2KB7 P;  1T2K C;  2P7J A;  1J1D C;  2A45 G;  5APW A;  4I1L A;  1ZN5 A;  3RK2 D;  2O1K A;  2Z4E A;  1URQ C;  3HPH E;  1RF1 C;  5APT A;  3P8M C;  3M06 A;  2HOD B;  1N7S A;  3GHG B;  2E43 A;  1GU4 A;  4GKG A;  3V2P A;  2OAR A;  3CLQ A;  4XE5 B;  1H88 A;  4HYT B;  2KOG A;  2C0X A;  3TYY A;  5AW6 B;  1SQP K;  1HTL C;  2HLO A;  3BVH A;  1NU1 K;  2J58 A;  3N7N A;  3B5N C;  4GIF A;  2I1J A;  1NOH A;  4LGD E;  3GHG C;  2Q5U A;  3M0A A;  5APS A;  1S9K E;  3RK3 B;  2NPS C;  4OH8 B;  1M1J B;  3M9B A;  3KDP B;  1E5W A;  5BVZ A;  2FYU K;  1RF0 C;  1YTZ T;  1LTT C;  2XPP A;  2XZR A;  2JEE A;  1SP4 A;  1DX7 A;  1FJK A;  2GUS A;  2C0W A;  3P32 A;  3H32 A;  4IFD K;  5APX A;  1L0L K;  2J59 M;  1MFZ A;  1RF0 A;  1N7S D;  5APY A;  2W6A A;  2ZFC A;  1NO4 A;  1WJT A;  1A02 F;  3BRV B;  4C7N B;  1RF1 B;  1HGV A;  1N73 B;  1GL2 A;  2YKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...