3OAKA

Crystal structure of a spn1 (iws1)-spt6 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
151
structure length
151
Chain Sequence
GIDPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription factor IWS1
total genus 55
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3oakA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3oakA02
5AW4B 2W6AA 1NWQA 5AW1B 3L36A 3HE5A 2IPPA 3P8MC 2R32A 4C46A 1Z9EA 1GK6A 4EOTA 3F9KC 1SP4A 2W27A 3NMDA 3NXSA 4I2LC 3NTNA 2XPOA 3L35A 2WT7B 4HYTB 3VMYA 5AVQB 3U88C 2P7JA 3HE5B 3OAKA 5APUA 3TYYA 1HBWA 4I6MC 1X8YA 2Q7CA 2WTYA 5APWA 3M9BA 2VRSA 3L37A 3NFQA 5AW2B 3VMZA 1GD2E 1GTWA 2KP8A 2YO2A 5APQA 3M9HA 2R5BA 3M0AA 1OWAA 2WPSA 1KQLA 2QM7A 5AVUB 5APYA 1H88A 5AVSB 2Z5HA 5AVWB 2XU6A 1HWTC 3TNUB 2ZXEB 3UIAA 5AW3B 3SWFA 2Q5UA 1CSBA 2XPPA 3HPGG 5APVA 1WJTA 2WPRA 5AVYB 4JYCA 2P2UA 5AVTB 1FOSF 4XE5B 1H89A 3HPHE 4B86A 3IR9A 1FOSE 2ZFCA 1T2KD 5APTA 3LIDA 2C9NY 4LC1A 3V5BA 3TK1A 3LIEA 3M06A 3MGNA 3KDPB 2YO3A 4JYBA 2C9LY 2E43A 1J2JB 5AW5B 3A5TA 3V4QA 2R3CA 4M3LA 4AUWA 5AVRB 2BASA 5AW0B 2WPQA 2WT7A 4AYCA 5APXA 1HUCA 1NAFA 1FAVA 5AVVB 1A02F 1MV8A 3MD0A 2Z5IA 1YYCA 2Q3IA 1G2CB 2N9BA 2XPNA 3HE4A 1OXZA 1JUNA 4C7NA 1GK4A 2XZRA 1CI6A 3B8EB 5APSA 1S9KD 1GZLA 2YNYA 3A2AA 3M91A 3VMXA 4AQRD 1IO4A 1HJBA 1CZQA 4KHXA 3HTKA 3M0DA 4GKGA 3VYIA 1S9KE 5AVZB 1CI6B 1DH3A 3O8ZA 5AW7B 3A3YB 1A02J 5AW6B 4DZOA 2JJLA 1EO0A 1GU4A 2QM8A 1JNMA 3I5CA 3T97A 4GT1A 2XPLA 1GU5A 3P32A 3P7KA 3A7OA 2H7HA 2P67A 3TNUA 3VN0A 3VTPC 1H8AA 5AW9B 2XV5A 1T2KC 1MFZA 3HE4B 3KQGA 1MUUA 4RESB 5AW8B 1SLQA 4C7NB 2E42A 2WWWA 2N3AB 3V4WA 5AVXB 2B4JC 2R5DA 5CMZA
chains in the Genus database with same CATH superfamily
3C9IA 3H1HJ 1IZNB 3MP7B 3L70J 3L72G 2N9YB 5KAIH 3BCCE 3FWNA 2JWAA 3U59A 1JO5A 4OC5A 1SQPK 3KZIH 1BGYG 5CCGA 3NXSA 4I2LC 3CCJP 5TISE 3CXHH 5AVQB 1SQPE 2E74B 3TGUD 1N73C 3D70A 3BHXA 1HTLC 1JY2P 3L72E 1HGZA 1X22A 2Q5UA 1L0ND 3Q2YA 4H44D 4JYCA 4Z1MH 5EFWB 4MCQA 3HPHE 1VQOP 2QJKB 1KN7A 1CW5A 2IYOA 4BTFA 3SWKA 1LTAC 4W7ZA 2JDIH 1NTKE 1RF0A 1L2PA 1H0TB 4A4CA 3VROA 3OB1B 3BCCJ 4P45A 3L70E 3AEDC 2QIWA 1N7SB 3ZNIA 4UB6E 1WT6A 1BE3D 3CLQA 1SVFA 4AQRD 1LP1A 2QA4P 2AEFA 4YXDC 1EZVD 1AVYA 3N4XA 3CCSP 1GU4A 2HYNA 5CJ4A 1KD1Q 3AE3C 4C7RA 1KILE 3RBZA 1T8ZA 3FF3A 3PRJA 1MUUA 4RESB 3BUWB 2N3AB 1FC2C 1NTMG 1L0NK 1NH4A 5B5EH 2YMKA 1DD4A 4R4LA 5KJ7A 3VGOA 2WQYC 2W6BA 1X8YA 3Q5RA 1M7LA 1GTWA 4PV1D 4N78D 1KQGB 2A45G 1NTMJ 2A06G 2K9JA 2LKMA 3B4SA 1L4AB 4Y99B 2YKOA 4K3AA 1SQBE 5M1BA 4HH2A 2YO3A 5AVRB 2ZT9D 2XEJA 5ELYA 1NU1E 2OYHB 1RE4C 2A45I 3VOPA 1YQ3C 3E7KA 3HTKB 5KKZB 3I55P 1GK4A 2PP6A 4H0LB 4XA4A 1RQVA 2OOTA 3H1HD 1HGVA 1B47A 1K9MQ 3AE8C 1KILA 1M90Q 4DJGA 4D6TJ 4UB6H 1QGKB 2FXOA 4OWFA 2XNDH 2HODB 3AECC 3D7DA 2QM8A 5H2FH 3S4RA 2AXTE 2IDBA 3PP5A 1BE3J 3KQGA 3RK3B 5F13A 1KYOE 1VQMP 3OB2B 4H13D 1L0NG 1HJ0A 1NTMK 2NPSC 1XTGB 2WSFH 3CCEP 1SP4A 4A4BA 3CCUP 1PP9E 1HF9A 2J58A 1HBWA 5HKWA 2WSFJ 4I6MC 2Q7CA 1BSNA 1GD2E 3WMM0 3OW2O 1LJ2A 2ZYAA 4ZMDA 4DT0A 3E1RA 2C0XA 3BCCG 1NO4A 1KQSO 2E76D 2E75D 3H1LG 1IFNA 2AXCA 1RHZB 3A0BE 1EDKA 4JYWA 1KZUB 3EFGA 2JEEA 4NGRA 4P4DA 3M06A 4Y99C 2W83C 1K05A 2D2CB 3BUXB 1YJNP 2L5GB 1S3JA 2O01N 4N78E 5E79H 4UB8H 2H43A 1NTKJ 2XDJA 3HUSB 5KLVK 2QEXP 3AEAC 2CPSA 3H1JD 4EDFA 1S4XA 1IK7A 1LT9A 3CWBG 1HJBA 3S9LA 3L73G 3PHLA 1S5LH 1S9KE 3L74D 1MKMA 1CI6B 1VQ6P 4P4EA 2ZVNB 5AW6B 3L72J 1KILB 1BSHA 3CC7P 1PP9G 1K04A 2GA1A 2ZAEB 3V2PA 2OQQA 2D2CC 1SQQE 1KB9I 2Y0EA 2WWWA 1AQ5A 1VQNP 2ZYGA 2O1JA 2FKWB 2SPZA 3PLNA 3CX5E 2FYNB 2AXTH 3O6QB 3FXEA 1RF1C 1SQXG 1T6AA 1FZBA 2KLVA 3L35A 2IBZE 2WSEH 1EQ7A 1KFMA 3TYYA 1EDLA 1JTHB 1LTJC 3D71A 1SQXE 5APQA 2Z5HA 3C1LA 2JR8A 3PT1A 3H6PA 3U1CA 3IAOA 3Q5PA 1FZFA 5APVA 1NTKK 4D6TD 5AVTB 2KS1A 1FS0E 1IFDA 1JMMA 2JO1A 2C9NY 2I8DA 3CWBJ 3V5BA 1L0LE 1PP9D 5CHXA 3QWOC 3GLMA 3S9OA 2Q9IA 3SFEC 2CBLA 3CXHD 3MD0A 3I56P 1KB9H 1Y9BA 1SQVE 3SWYA 3RGUA 2Q3EA 4WVZA 4C7NA 1N86A 3B8EB 2V7QJ 4L75A 1SQQD 2YNYA 4L73A 5KAFH 3VRNA 1RE3C 2KIKA 4GKGA 3H1KD 1LT1A 1DEEG 2FXPA 3V2QA 1DH3A 3RL0g 3B5NB 4P4IA 1GU5A 1FZCB 2E5YA 5CCGD 4K35A 3CCQP 2WZ7A 3H1JJ 2OTJP 4H13C 3M9QA 1KMIZ 5CMZA 2W6AA 3A0BH 3F5HA 2Y1MA 1Z9EA 3E1IA 3H32A 1KC8Q 5KTBA 2CIJA 2XPOA 2R44A 2WT7B 1NTZD 3EWKA 2B89A 1URQC 1Q82Q 5AW2B 2VRSA 2W8ZA 1JY2O 1YHQP 1OWAA 3M9HA 4LGDE 1L4AA 5DJUB 5AVSB 1HWTC 4L74A 2OARA 1USDA 1LTBC 1KYOH 2LXBA 4JZ0A 2PFXA 4HJGH 3IN6A 5C39A 2WT7A 2VKZG 1HUCA 1OFCX 1X79B 4OVNF 1A02F 2K9YA 1VQ9P 3PLFB 4RKUJ 1JB0J 1KYOD 3B71A 4XFJA 2NRGA 1R5SA 1VQKP 3TGUG 4OGQB 4PD4I 1SQBK 1NTZJ 3D7HA 4GOFA 1ZOYC 1FBMA 3L71E 3H1LD 1URQD 4KJMA 3VYIA 1IJDB 1VDFA 2NPSA 1BE3G 1OZHA 3O8ZA 4DZOA 1VQ5P 1HVVA 1JNMA 1J1DC 3S9NA 5KJ7D 3T97A 5GTIE 4WY4B 3H1KJ 2UV8G 3IF4A 2XV5A 3HD7B 5AW8B 1N7SA 2FYZA 5AW4B 3BUOB 4GOEA 5GTHE 3F9KC 3NTNA 2BCCJ 3CCRP 1ZN5A 2NPSB 1GDTA 3EQ2A 3U88C 4D6TE 3KYQA 2J59M 2WTYA 1FJPA 4UB8E 3L37A 4JF7A 1D7MA 5AVUB 3RL0B 1J1DB 1PGQA 3LW5H 2M0BA 4OMEA 1RQUA 5KLIC 4B86A 4ZNCA 1IFPA 2H89C 1JEKA 5APXA 4GODA 1JY3O 1DX7A 5AVVB 4ASWA 4OC4A 1YYCA 1VQ7P 2QG4A 1PP9J 2B88A 3L73E 1CI6A 2ZT9B 2ZVOB 2KK7A 3A2AA 4BRYA 2K9JB 3M91A 4OGQC 1CX8A 1RY3A 1SQVJ 3BVHA 2N1TD 1J1EB 3CPWO 5CJ0A 4MCRA 2MKVA 5HKZA 2A45H 3H25A 1VF5B 1ZMEC 5L8RJ 2YXRB 3RK3C 3JC22 2V4HA 3D7FA 2QJPC 3O6QA 4EIJA 3FECA 1P84E 4PD4D 1BDDA 3ABVC 2N1TA 3AE2C 2WSEJ 3H1LE 2R32A 1YJ9P 1JTHA 2HLOA 1M8OB 4DOJA 2FYUK 3V2RA 1DIPA 3VMYA 1SQQK 1OW6A 1Q7YQ 3S9MA 1U7JA 5APWA 3V6IA 3VMZA 1H0TA 2A06E 2FFDB 1JM0A 3P8CE 1SQVD 4ZKUA 1T3JA 5AW3B 1NU1G 3G71P 4W7YA 2WPRA 3B5NC 2IBZI 3K5BA 1N73B 3AE6C 2E76B 2P10A 1Y8AA 4MCPA 1L4AD 2R3CA 2K1AA 4M3LA 1Z8LA 3EFFK 2I1KA 1PPJG 3L70D 1TU3F 2RN0A 2JWDA 2QJYB 2O3JA 3JSVC 1OXZA 1LTTC 1JUNA 2FFDA 1JCCA 5BVZA 1L0LK 4R4MA 3VMXA 3MUDC 5B5EE 3M0DA 3OJAB 1P84I 1HH0A 1FE6A 1NOHA 4NPDA 1NTZE 1EZVG 2XPLA 2H7HA 3TNUA 1H8AA 4OC1A 2JBKA 3C8VA 1M57D 2ZT9C 1AQTA 5AVXB 4IFDK 3VRQA 1FZEA 4IL6X 1RF1B 4OH8B 4EOTA 1USEA 4H13B 4LLHA 3MZWB 1KV4A 3H1HG 2PRRA 2Z4EA 1N7SD 1JY2N 2R5BA 1GL2C 1LWUA 2WPSA 3AE1C 1YI2P 2GUVA 1G1IA 1G1JA 5CBOA 2XPPA 3RK2D 3IWWA 5AVYB 2E75B 2ZFCA 3RK3E 2IZ1A 3FEDA 2E43A 1BGYE 5AW5B 3BCCD 1ZXGA 2Q1KA 2BASA 1KFNA 1ZW0A 1JMBA 1MZ9A 2XPNA 1SQPD 3BUNB 2OYIC 3CCLP 3L73D 3CCVP 5APSA 1GZLA 2RH0A 3H1JG 2N1TC 4KHXA 1LTJB 2E76C 5AVZB 3Q5SA 2MJZA 1NTKG 2WSCH 3U1AA 1KB9D 3A3YB 2JJLA 3HD7A 4PV1B 2KZJA 2C0WA 4CPGA 2WSCJ 3RL0D 2QSIA 2I1JA 1PFIA 3VTPC 2FFDC 4BPUB 1KILD 1SFCD 1JY3N 3HE4B 2Y9YA 4C7NB 2E42A 1CZQA 3AE5C 1S1CX 2IPPA 1QL2A 1NTME 4U3FE 3MTUE 2CK3H 1Q81Q 3H1JE 3H1ID 3FWLA 4MCSA 2UWJE 4Y28J 1S2EA 2QM7A 5CBNA 2FYNC 1BCCG 1Q90D 2XEFA 2ZXEB 2BEZF 1W2EA 3PJSK 1CSBA 1AVOA 3GHGC 1FOSF 1AA0A 3SJGA 1Q86Q 1OVUA 3IR9A 3V4QA 1GW3A 4RO0A 4BXLA 3L74J 1NHLA 3BUMB 2Z5IA 4NGMA 1SQQJ 2Q3IA 4IL6H 1G2CB 2RKLA 1XTCC 4U3FJ 3PFVA 1VL2A 3GG2A 1S9KD 3CX5D 4EI2A 3HTKA 3BRTB 3ZDMA 2KOGA 4NGQA 4GDOA 3CL3D 3AE4C 1EO0A 2BCCG 3OA7A 1LTJA 3HMJG 3L73J 3B5ND 1EDJA 3CWBD 2HODA 2YXQB 5K5GB 3D6YA 2FY8A 2WSSH 1PGPA 1FU1A 3CXHE 1S5LE 2NZ2A 3M0DC 4C46A 3S1KA 1NTKD 5KLVD 3H1IJ 2JP3A 3H1KG 2W27A 2QJPB 1PPJD 1DD3A 3JCUH 4YTPC 1K8AQ 2XEGA 3ITKA 1M1JA 1M56D 3OAKA 2M3EA 2IBZG 1S5LX 3NFQA 2KP8A 1KQLA 2OGUA 3JCUE 2XU6A 5BU5A 3UIAA 2J5UA 2B87B 4JQ0D 3BXMA 4I7ZB 2QJYC 4NPEA 1FOSE 1Q2NA 2K37A 2YKPA 4IFMA 2GUSA 3FEEA 4WB4A 1S72P 4AUWA 4YXWH 1JY3P 1BCCJ 1BE3E 1LWUC 1L4AC 1BCCE 3AEFC 2DLAA 2KNCA 3LW5J 2C6GA 5E79E 2ZXXA 3VP9A 2OTLP 3L74E 1NJIQ 4NGTA 3L74G 3RL0C 4KT0J 3FX0A 1W5CE 3H1HE 3RK2C 3P7KA 3W68A 2KB7P 2Y0CA 1GL2A 4RR2B 1MFZA 4YPCA 3V4WA 1ZR2A 1JCDA 1RE3A 2DW3A 3HD7D 4WBAA 1PL5A 2JBJA 5CCHD 4PJ0H 3HD7C 1RH5B 2FYUE 2OYOA 3L75E 2P7JA 2IFNA 3Q3DA 1KB9E 1DEBA 2Y0DA 1OMIA 1IFIA 1LTIC 1QEXA 5APYA 1NAYA 3SFDC 1YVHA 3GHGB 4U3FG 3BI1A 1N7SC 2OYIA 3HPGG 5AXIA 3G3ZA 3IFMA 5H2FE 1VPCA 4D6TG 1SQBG 2QVAA 4W9YA 3CC4P 5APTA 4LC1A 2C6CA 1J2JB 1SQXK 3T97B 4AYCA 3V2NA 2HPCA 2Q6QA 3CD6P 1FAVA 2HR3A 3CI9A 1KQFB 2KLUA 1SFCB 1YITP 2A06D 3H1LJ 1PGOA 5CCHC 2W6JH 2OYIB 1IK9A 3RBXA 2KNCB 2ZJSE 1ZV8A 3TF5A 4H44C 1A02J 5BU8B 3A0HE 5B66E 1M1JC 4GT1A 2AEMA 2N1TB 1T3UA 3CMAP 1NTMD 2KSEA 1AV1A 2O01J 1KORA 2BCCE 2KXPB 2E74C 3TDKA 3HE5A 2Y9ZA 1Y47A 4JBZA 3HUSC 1LP1B 5KLVE 2M3BA 3GMAA 4TLFA 1NYHA 3G6EP 4HYTB 1FZGA 1PZQA 1EXJA 4OC2A 2JKVA 4OGQD 3H1KE 4H44B 1N2DC 4NGNA 1UIIA 3TNUB 3SWFA 4NGPA 3VMAA 3RK3D 1H89A 2K88A 1Z56A 1G2CA 2PGDA 1LNQA 1AJYA 3W67A 4WY4D 1SQVG 2LR2A 3CMEP 1BGYD 1MV8A 3VRRA 3USSA 1YTZT 3G9RA 5D29A 2N9BA 2XZRA 3FXDA 2IBZD 2HPCB 1BCCD 3II6A 1LTSC 3R2PA 2IX7C 3D7GA 5BY0A 1IO4A 4HB1A 1SFCA 1EXIA 2FBWC 5KJ7C 5KLVJ 4LQGA 2WVRA 3BRVB 2PVVA 3R4YA 2IFMA 1BDCA 3CXHI 1OVRA 1NVOA 2LXCB 1SS1A 1OVVA 3MIWA 4OC3A 2PAJA 1SQXD 1QVGO 2WITA 5AW9B 5HKYA 1MFTA 1ZLLA 3BASA 4GIFA 1FJKA 2PVWA 3RBUA 2BCCD 2R5DA 3WU2H 1YJWP 2FXMA 3F89A 1AFOA 3NMDA 1OW7A 3A0HH 4IFFA 5B66H 2BEQD 1GL2D 1EDIA 4QMAA 2H8PD 3HE5B 1NU1K 2M8RA 2B87A 2QRXA 3M9BA 3PH0A 1RE4A 1LGHB 3CC2P 1P84H 1SQVK 5CCHA 1QL1A 1ZR4A 4W80A 3H1IG 1L0LG 1JOCA 1KILC 1R8EA 4IL6E 3RK2B 1OW8A 3TK1A 1VF5D 2KI7B 3LIEA 3MGNA 2G3AA 3KDPB 2C9LY 4BPWB 4N6JA 1M1KQ 4WWIA 2GM4A 4OC0A 5AW0B 4WY4C 3GF3A 4X3RA 3GF7A 3Q1MA 1DE4C 2O01H 1GW4A 2Y1NA 1L0LJ 3B5NA 1VQLP 3G4SP 2FYUJ 3L75J 1IFJA 1FZCA 3AEBC 1YIJP 5AW7B 1FDMA 1PV3A 2ITAA 3L4FA 1LWUB 1SQQG 2QE7H 2WPVB 2B9BA 1LT9C 1NKNA 2KS1B 4N3YB 3MUDA 5AW1B 3L36A 3P8MC 1EC5A 3AE9C 1GK6A 4DCKA 2G8YA 2QJKC 4A7PA 2KSJA 3KXDA 2E5TA 2POHA 1UIXA 2OYHA 1E79H 1L0NJ 5KLIB 4NPFX 2C6PA 2YO2A 3L71D 3SJXA 3P8CD 1BGYJ 3QH9A 3AE7C 3CX5H 4P44A 2KZIA 1T2KD 4P4FA 1RF1A 3WUUA 1SQXJ 3CCMP 1X0TA 1SQPJ 5TISH 3PTZA 2WPQA 5J3XA 4JPZB 3VRPA 4H0LD 1N73A 1SQBD 2H88C 2CPBA 2E74D 3KPEA 3HE4A 3KASA 4H0LC 1QLED 1NU1D 4PJ0E 3WUTA 3WUVA 4MN4C 3L72D 3H32B 4TT3H 1YTZI 3VP8A 5KAIE 1ZRTE 1R5LA 2RMZA 4U7JA 3HUSA 1X9VA 1ZP0C 5CCGC 3SJEA 2M5AB 4I1LA 2P67A 2YKQA 3VN0A 3CX5I 1T2KC 1W2BO 5KLVG 2KYVA 1SFCC 1M1JB 4L76A 2XKMA 2ZYDA 3BI0A 1SQPG 5GTIH 2YIUB 1LTGC 5APUA 1QVFO 1EZVE 2XEIA 2OR4A 5AVWB 2P1JA 1L0NE 1OIPA 3KZIE 2P58A 3GW6A 4I7ZC 1LT9B 3N7NA 2HG5D 1WJTA 3L75D 1QX8A 2FYUD 2P2UA 2XNXA 3AEEC 3L71J 4XE5B 1PIXA 1WMKA 3LIDA 1FZCC 1ZRTD 4P4JA 3TGUJ 2YIUC 1IC2A 1URQA 1NAFA 4BPXB 4GPLB 2NPSD 4BRYB 4ZKPA 1N7LA 3OP0A 1EZVI 3BATA 3GHGA 1FDOA 1NTZK 1KTMA 1SQBJ 1FZAA 5KAFE 1K73Q 2W90A 4HKZH 2V7QH 4PV1C 1VQPP 1KYOI 1IFMA 1GL2B 4P4BA 3CWBE 1RF0C 1NGMB 1VF5C 1WRGA 1SLQA 1U7MA 4EYYQ 2M5AA 1OX3A 1NWQA 1PPJE 1PGJA 2KUBA 3TSIA 1NU1J 4PD4H 1U57A 3TGUE 3SJFA 5F09A 3L70G 4ASVA 1FBVA 1YQ4C 4IOIH 4WY4A 3M0AA 1H88A 1P84D 4PD4E 1E5WA 3D6ZA 4BWNA 1FDIA 4RJTA 2FYUG 3L75G 5DJTB 5TJHA 3SSUA 4JYBA 4O9BA 3A5TA 4U3FD 1NTZG 2HFED 2R3SA 2L91A 3MHVA 3HRNA 1L0LD 2IYPA 3AEGC 3L71G 1J1EC 1N8RQ 1URQB 2O1KA 2YMYA 2AEJA 3WU2E 2K3RA 2IZ0A 1NKZB 1VQ8P 2E75C 2WMMA 3I5CA 2D2CD 3KHUA 2OYHC 3P32A 3A7OA 1GMJA 1YBKA 5KKZC 3FGAD 5GTHH 3H1IE 4NGSA 2OTKE 2B4JC 1VQ4P
chains in the Genus database with same CATH topology
3C9IA 2W6AA 2FXMA 2IPPA 1QL2A 1Z9EA 3E1IA 3H32A 3MTUE 3U59A 1JO5A 5KTBA 1SQPK 1AFOA 5CCGA 3NMDA 3NXSA 4I2LC 2XPOA 2WT7B 4IFFA 1GL2D 5AVQB 2H8PD 3HE5B 1NU1K 2M8RA 1URQC 1N73C 3M9BA 2VRSA 5AW2B 1RE4A 1JY2O 1LGHB 1HTLC 1OWAA 3M9HA 4LGDE 1L4AA 2QM7A 1JY2P 5AVSB 1HWTC 1HGZA 2ZXEB 1W2EA 2Q5UA 1CSBA 1SQVK 2OARA 3GHGC 5CCHA 1QL1A 1LTBC 4JYCA 4W80A 1ZR4A 1FOSF 3HPHE 1JOCA 1KILC 3IR9A 3RK2B 3TK1A 3LIEA 3MGNA 3KDPB 2C9LY 1CW5A 4N6JA 3V4QA 1GW3A 2GM4A 5AW0B 2WT7A 1LTAC 4W7ZA 1HUCA 1NHLA 1X79B 1A02F 2Z5IA 4WY4C 1RF0A 2Q3IA 1G2CB 1XTCC 2O01H 1GW4A 1N7SB 1SQBK 1WT6A 1S9KD 3B5NA 3CLQA 1SVFA 4AQRD 1IFJA 3HTKA 1FBMA 1URQD 3VYIA 1FZCA 3BRTB 1IJDB 2KOGA 1VDFA 2NPSA 3CL3D 3O8ZA 5AW7B 3N4XA 4DZOA 1HVVA 1FDMA 1EO0A 1GU4A 1JNMA 1J1DC 5KJ7D 2HYNA 3T97A 5CJ4A 4WY4B 3L4FA 1LWUB 1LTJA 3OA7A 4C7RA 3B5ND 2HODA 2XV5A 1T8ZA 3HD7B 1MUUA 4RESB 5AW8B 2N3AB 1FU1A 1N7SA 1L0NK 2FYZA 1LT9C 1NKNA 5AW4B 4N3YB 3MUDA 5AW1B 3L36A 1NH4A 3M0DC 3P8MC 4C46A 1GK6A 5KJ7A 3F9KC 2W27A 2KSJA 3NTNA 1GDTA 1ZN5A 2NPSB 2POHA 3EQ2A 3U88C 2W6BA 1M1JA 2OYHA 3KYQA 3OAKA 2J59M 1X8YA 2WTYA 1FJPA 3NFQA 3L37A 1M7LA 4JF7A 1GTWA 2KP8A 2YO2A 4N78D 1KQLA 5AVUB 3RL0B 2XU6A 3P8CD 2A45G 5BU5A 3UIAA 1J1DB 3LW5H 2LKMA 1L4AB 4B86A 1FOSE 1T2KD 1RF1A 2YKPA 2YKOA 4Y99B 4IFMA 2GUSA 4HH2A 2YO3A 4WB4A 4AUWA 5AVRB 2WPQA 5APXA 1JY3O 1N73A 1DX7A 5AVVB 2OYHB 1RE4C 2A45I 1JY3P 3VOPA 1LWUC 1L4AC 1YYCA 2CPBA 3KPEA 3HE4A 3HTKB 1GK4A 2PP6A 1CI6A 4XA4A 1HGVA 3A2AA 3M91A 3H32B 1KILA 1YTZI 3VP8A 3VP9A 1RY3A 3BVHA 3HUSA 1X9VA 2N1TD 1J1EB 2HODB 5CCGC 5CJ0A 3RL0C 2QM8A 2A45H 4I1LA 3RK2C 3P7KA 2KB7P 2P67A 3RK3C 2YKQA 3VN0A 1GL2A 3PP5A 1T2KC 1MFZA 3KQGA 4EIJA 3RK3B 3V4WA 2KYVA 1ZR2A 1JCDA 1RE3A 1SFCC 2N1TA 1M1JB 1NTMK 3HD7D 4WBAA 2R32A 1JTHA 2HLOA 2NPSC 1XTGB 2WSFH 2XKMA 4DOJA 1SP4A 2FYUK 5CCHD 3HD7C 3V2RA 3VMYA 1LTGC 1SQQK 2J58A 2P7JA 2IFNA 5APUA 1HBWA 4I6MC 1DEBA 2Q7CA 5APWA 1GD2E 3VMZA 1IFIA 3WMM0 1LTIC 2FFDB 5APYA 2C0XA 3P8CE 5AVWB 3GHGB 2P1JA 1NO4A 1T3JA 4ZKUA 5AW3B 1IFNA 1N7SC 2OYIA 3HPGG 4W7YA 1LT9B 3N7NA 2HG5D 1WJTA 2WPRA 2P2UA 3B5NC 2XNXA 3G3ZA 3IFMA 4XE5B 1KZUB 1VPCA 1N73B 3EFGA 2JEEA 5APTA 3LIDA 4LC1A 1FZCC 3M06A 4Y99C 1J2JB 1L4AD 2R3CA 4M3LA 1SQXK 1IC2A 2I1KA 4AYCA 3V2NA 1URQA 2L5GB 2HPCA 1NAFA 1FAVA 2NPSD 3CI9A 4N78E 4ZKPA 2H43A 2XDJA 1N7LA 1SFCB 1OXZA 1LTTC 1JUNA 2FFDA 3HUSB 5KLVK 1JCCA 3BATA 5BVZA 3GHGA 1NTZK 2CPSA 1L0LK 5CCHC 1FZAA 2OYIB 1LT9A 3VMXA 1HJBA 1IK9A 3M0DA 1S9KE 3OJAB 1CI6B 1HH0A 1ZV8A 1IFMA 1GL2B 1A02J 5AW6B 1NOHA 5BU8B 1KILB 1M1JC 4GT1A 1RF0C 2XPLA 2N1TB 2H7HA 1T3UA 3TNUA 1H8AA 1WRGA 3V2PA 1SLQA 2WWWA 1AQ5A 5AVXB 4IFDK 2O1JA 1NWQA 1FZEA 2FKWB 3HE5A 1RF1B 4OH8B 3HUSC 4EOTA 2M3BA 1RF1C 1FZBA 2KLVA 4LLHA 3TSIA 3L35A 2WSEH 4HYTB 1FZGA 1EQ7A 1KFMA 3TYYA 1JTHB 1LTJC 2Z4EA 1N7SD 1JY2N 4WY4A 5APQA 2R5BA 1GL2C 1LWUA 1N2DC 2WPSA 3M0AA 1H88A 2Z5HA 1E5WA 3TNUB 3SWFA 3H6PA 2GUVA 1G1IA 3U1CA 1G1JA 2XPPA 1FZFA 3RK2D 5APVA 5AVYB 1NTKK 5AVTB 3RK3D 1H89A 1IFDA 1JMMA 2ZFCA 2C9NY 1Z56A 1G2CA 3V5BA 2E43A 4JYBA 5CHXA 4O9BA 4WY4D 5AW5B 3A5TA 2BASA 2Q9IA 2HFED 3HRNA 1MV8A 3MD0A 1YTZT 1KFNA 2N9BA 1MZ9A 3SWYA 2XPNA 4C7NA 1N86A 2XZRA 1J1EC 2OYIC 3B8EB 5APSA 1URQB 2HPCB 2O1KA 1GZLA 2YMYA 2YNYA 3II6A 1LTSC 3R2PA 2IX7C 1IO4A 1RE3C 1SFCA 2N1TC 1CZQA 4KHXA 4GKGA 1LTJB 5AVZB 3V2QA 5KJ7C 2MJZA 2WSCH 3U1AA 1DH3A 3A3YB 1NKZB 3BRVB 2JJLA 3B5NB 3HD7A 2IFMA 3I5CA 2C0WA 2OYHC 1GU5A 3P32A 1FZCB 3A7OA 3RL0D 3MIWA 5CCGD 2I1JA 1PFIA 2WZ7A 2PAJA 3VTPC 2FFDC 1KILD 1SFCD 1JY3N 2WITA 3M9QA 5AW9B 3HE4B 4C7NB 2E42A 1ZLLA 3BASA 4GIFA 1FJKA 2B4JC 2R5DA 5CMZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW4 B;  2W6A A;  1NWQ A;  5AW1 B;  3L36 A;  3HE5 A;  2IPP A;  3P8M C;  2R32 A;  4C46 A;  1Z9E A;  1GK6 A;  4EOT A;  3F9K C;  1SP4 A;  2W27 A;  3NMD A;  3NXS A;  4I2L C;  3NTN A;  2XPO A;  3L35 A;  2WT7 B;  4HYT B;  3VMY A;  5AVQ B;  3U88 C;  2P7J A;  3HE5 B;  3OAK A;  5APU A;  3TYY A;  1HBW A;  4I6M C;  1X8Y A;  2Q7C A;  2WTY A;  5APW A;  3M9B A;  2VRS A;  3L37 A;  3NFQ A;  5AW2 B;  3VMZ A;  1GD2 E;  1GTW A;  2KP8 A;  2YO2 A;  5APQ A;  3M9H A;  2R5B A;  3M0A A;  1OWA A;  2WPS A;  1KQL A;  2QM7 A;  5AVU B;  5APY A;  1H88 A;  5AVS B;  2Z5H A;  5AVW B;  2XU6 A;  1HWT C;  3TNU B;  2ZXE B;  3UIA A;  5AW3 B;  3SWF A;  2Q5U A;  1CSB A;  2XPP A;  3HPG G;  5APV A;  1WJT A;  2WPR A;  5AVY B;  4JYC A;  2P2U A;  5AVT B;  1FOS F;  4XE5 B;  1H89 A;  3HPH E;  4B86 A;  3IR9 A;  1FOS E;  2ZFC A;  1T2K D;  5APT A;  3LID A;  2C9N Y;  4LC1 A;  3V5B A;  3TK1 A;  3LIE A;  3M06 A;  3MGN A;  3KDP B;  2YO3 A;  4JYB A;  2C9L Y;  2E43 A;  1J2J B;  5AW5 B;  3A5T A;  3V4Q A;  2R3C A;  4M3L A;  4AUW A;  5AVR B;  2BAS A;  5AW0 B;  2WPQ A;  2WT7 A;  4AYC A;  5APX A;  1HUC A;  1NAF A;  1FAV A;  5AVV B;  1A02 F;  1MV8 A;  3MD0 A;  2Z5I A;  1YYC A;  2Q3I A;  1G2C B;  2N9B A;  2XPN A;  3HE4 A;  1OXZ A;  1JUN A;  4C7N A;  1GK4 A;  2XZR A;  1CI6 A;  3B8E B;  5APS A;  1S9K D;  1GZL A;  2YNY A;  3A2A A;  3M91 A;  3VMX A;  4AQR D;  1IO4 A;  1HJB A;  1CZQ A;  4KHX A;  3HTK A;  3M0D A;  4GKG A;  3VYI A;  1S9K E;  5AVZ B;  1CI6 B;  1DH3 A;  3O8Z A;  5AW7 B;  3A3Y B;  1A02 J;  5AW6 B;  4DZO A;  2JJL A;  1EO0 A;  1GU4 A;  2QM8 A;  1JNM A;  3I5C A;  3T97 A;  4GT1 A;  2XPL A;  1GU5 A;  3P32 A;  3P7K A;  3A7O A;  2H7H A;  2P67 A;  3TNU A;  3VN0 A;  3VTP C;  1H8A A;  5AW9 B;  2XV5 A;  1T2K C;  1MFZ A;  3HE4 B;  3KQG A;  1MUU A;  4RES B;  5AW8 B;  1SLQ A;  4C7N B;  2E42 A;  2WWW A;  2N3A B;  3V4W A;  5AVX B;  2B4J C;  2R5D A;  5CMZ A; 
#chains in the Genus database with same CATH topology
 3C9I A;  3H1H J;  1IZN B;  3MP7 B;  3L70 J;  3L72 G;  2N9Y B;  5KAI H;  3BCC E;  3FWN A;  2JWA A;  3U59 A;  1JO5 A;  4OC5 A;  1SQP K;  3KZI H;  1BGY G;  5CCG A;  3NXS A;  4I2L C;  3CCJ P;  5TIS E;  3CXH H;  5AVQ B;  1SQP E;  2E74 B;  3TGU D;  1N73 C;  3D70 A;  3BHX A;  1HTL C;  1JY2 P;  3L72 E;  1HGZ A;  1X22 A;  2Q5U A;  1L0N D;  3Q2Y A;  4H44 D;  4JYC A;  4Z1M H;  5EFW B;  4MCQ A;  3HPH E;  1VQO P;  2QJK B;  1KN7 A;  1CW5 A;  2IYO A;  4BTF A;  3SWK A;  1LTA C;  4W7Z A;  2JDI H;  1NTK E;  1RF0 A;  1L2P A;  1H0T B;  4A4C A;  3VRO A;  3OB1 B;  3BCC J;  4P45 A;  3L70 E;  3AED C;  2QIW A;  1N7S B;  3ZNI A;  4UB6 E;  1WT6 A;  1BE3 D;  3CLQ A;  1SVF A;  4AQR D;  1LP1 A;  2QA4 P;  2AEF A;  4YXD C;  1EZV D;  1AVY A;  3N4X A;  3CCS P;  1GU4 A;  2HYN A;  5CJ4 A;  1KD1 Q;  3AE3 C;  4C7R A;  1KIL E;  3RBZ A;  1T8Z A;  3FF3 A;  3PRJ A;  1MUU A;  4RES B;  3BUW B;  2N3A B;  1FC2 C;  1NTM G;  1L0N K;  1NH4 A;  5B5E H;  2YMK A;  1DD4 A;  4R4L A;  5KJ7 A;  3VGO A;  2WQY C;  2W6B A;  1X8Y A;  3Q5R A;  1M7L A;  1GTW A;  4PV1 D;  4N78 D;  1KQG B;  2A45 G;  1NTM J;  2A06 G;  2K9J A;  2LKM A;  3B4S A;  1L4A B;  4Y99 B;  2YKO A;  4K3A A;  1SQB E;  5M1B A;  4HH2 A;  2YO3 A;  5AVR B;  2ZT9 D;  2XEJ A;  5ELY A;  1NU1 E;  2OYH B;  1RE4 C;  2A45 I;  3VOP A;  1YQ3 C;  3E7K A;  3HTK B;  5KKZ B;  3I55 P;  1GK4 A;  2PP6 A;  4H0L B;  4XA4 A;  1RQV A;  2OOT A;  3H1H D;  1HGV A;  1B47 A;  1K9M Q;  3AE8 C;  1KIL A;  1M90 Q;  4DJG A;  4D6T J;  4UB6 H;  1QGK B;  2FXO A;  4OWF A;  2XND H;  2HOD B;  3AEC C;  3D7D A;  2QM8 A;  5H2F H;  3S4R A;  2AXT E;  2IDB A;  3PP5 A;  1BE3 J;  3KQG A;  3RK3 B;  5F13 A;  1KYO E;  1VQM P;  3OB2 B;  4H13 D;  1L0N G;  1HJ0 A;  1NTM K;  2NPS C;  1XTG B;  2WSF H;  3CCE P;  1SP4 A;  4A4B A;  3CCU P;  1PP9 E;  1HF9 A;  2J58 A;  1HBW A;  5HKW A;  2WSF J;  4I6M C;  2Q7C A;  1BSN A;  1GD2 E;  3WMM 0;  3OW2 O;  1LJ2 A;  2ZYA A;  4ZMD A;  4DT0 A;  3E1R A;  2C0X A;  3BCC G;  1NO4 A;  1KQS O;  2E76 D;  2E75 D;  3H1L G;  1IFN A;  2AXC A;  1RHZ B;  3A0B E;  1EDK A;  4JYW A;  1KZU B;  3EFG A;  2JEE A;  4NGR A;  4P4D A;  3M06 A;  4Y99 C;  2W83 C;  1K05 A;  2D2C B;  3BUX B;  1YJN P;  2L5G B;  1S3J A;  2O01 N;  4N78 E;  5E79 H;  4UB8 H;  2H43 A;  1NTK J;  2XDJ A;  3HUS B;  5KLV K;  2QEX P;  3AEA C;  2CPS A;  3H1J D;  4EDF A;  1S4X A;  1IK7 A;  1LT9 A;  3CWB G;  1HJB A;  3S9L A;  3L73 G;  3PHL A;  1S5L H;  1S9K E;  3L74 D;  1MKM A;  1CI6 B;  1VQ6 P;  4P4E A;  2ZVN B;  5AW6 B;  3L72 J;  1KIL B;  1BSH A;  3CC7 P;  1PP9 G;  1K04 A;  2GA1 A;  2ZAE B;  3V2P A;  2OQQ A;  2D2C C;  1SQQ E;  1KB9 I;  2Y0E A;  2WWW A;  1AQ5 A;  1VQN P;  2ZYG A;  2O1J A;  2FKW B;  2SPZ A;  3PLN A;  3CX5 E;  2FYN B;  2AXT H;  3O6Q B;  3FXE A;  1RF1 C;  1SQX G;  1T6A A;  1FZB A;  2KLV A;  3L35 A;  2IBZ E;  2WSE H;  1EQ7 A;  1KFM A;  3TYY A;  1EDL A;  1JTH B;  1LTJ C;  3D71 A;  1SQX E;  5APQ A;  2Z5H A;  3C1L A;  2JR8 A;  3PT1 A;  3H6P A;  3U1C A;  3IAO A;  3Q5P A;  1FZF A;  5APV A;  1NTK K;  4D6T D;  5AVT B;  2KS1 A;  1FS0 E;  1IFD A;  1JMM A;  2JO1 A;  2C9N Y;  2I8D A;  3CWB J;  3V5B A;  1L0L E;  1PP9 D;  5CHX A;  3QWO C;  3GLM A;  3S9O A;  2Q9I A;  3SFE C;  2CBL A;  3CXH D;  3MD0 A;  3I56 P;  1KB9 H;  1Y9B A;  1SQV E;  3SWY A;  3RGU A;  2Q3E A;  4WVZ A;  4C7N A;  1N86 A;  3B8E B;  2V7Q J;  4L75 A;  1SQQ D;  2YNY A;  4L73 A;  5KAF H;  3VRN A;  1RE3 C;  2KIK A;  4GKG A;  3H1K D;  1LT1 A;  1DEE G;  2FXP A;  3V2Q A;  1DH3 A;  3RL0 g;  3B5N B;  4P4I A;  1GU5 A;  1FZC B;  2E5Y A;  5CCG D;  4K35 A;  3CCQ P;  2WZ7 A;  3H1J J;  2OTJ P;  4H13 C;  3M9Q A;  1KMI Z;  5CMZ A;  2W6A A;  3A0B H;  3F5H A;  2Y1M A;  1Z9E A;  3E1I A;  3H32 A;  1KC8 Q;  5KTB A;  2CIJ A;  2XPO A;  2R44 A;  2WT7 B;  1NTZ D;  3EWK A;  2B89 A;  1URQ C;  1Q82 Q;  5AW2 B;  2VRS A;  2W8Z A;  1JY2 O;  1YHQ P;  1OWA A;  3M9H A;  4LGD E;  1L4A A;  5DJU B;  5AVS B;  1HWT C;  4L74 A;  2OAR A;  1USD A;  1LTB C;  1KYO H;  2LXB A;  4JZ0 A;  2PFX A;  4HJG H;  3IN6 A;  5C39 A;  2WT7 A;  2VKZ G;  1HUC A;  1OFC X;  1X79 B;  4OVN F;  1A02 F;  2K9Y A;  1VQ9 P;  3PLF B;  4RKU J;  1JB0 J;  1KYO D;  3B71 A;  4XFJ A;  2NRG A;  1R5S A;  1VQK P;  3TGU G;  4OGQ B;  4PD4 I;  1SQB K;  1NTZ J;  3D7H A;  4GOF A;  1ZOY C;  1FBM A;  3L71 E;  3H1L D;  1URQ D;  4KJM A;  3VYI A;  1IJD B;  1VDF A;  2NPS A;  1BE3 G;  1OZH A;  3O8Z A;  4DZO A;  1VQ5 P;  1HVV A;  1JNM A;  1J1D C;  3S9N A;  5KJ7 D;  3T97 A;  5GTI E;  4WY4 B;  3H1K J;  2UV8 G;  3IF4 A;  2XV5 A;  3HD7 B;  5AW8 B;  1N7S A;  2FYZ A;  5AW4 B;  3BUO B;  4GOE A;  5GTH E;  3F9K C;  3NTN A;  2BCC J;  3CCR P;  1ZN5 A;  2NPS B;  1GDT A;  3EQ2 A;  3U88 C;  4D6T E;  3KYQ A;  2J59 M;  2WTY A;  1FJP A;  4UB8 E;  3L37 A;  4JF7 A;  1D7M A;  5AVU B;  3RL0 B;  1J1D B;  1PGQ A;  3LW5 H;  2M0B A;  4OME A;  1RQU A;  5KLI C;  4B86 A;  4ZNC A;  1IFP A;  2H89 C;  1JEK A;  5APX A;  4GOD A;  1JY3 O;  1DX7 A;  5AVV B;  4ASW A;  4OC4 A;  1YYC A;  1VQ7 P;  2QG4 A;  1PP9 J;  2B88 A;  3L73 E;  1CI6 A;  2ZT9 B;  2ZVO B;  2KK7 A;  3A2A A;  4BRY A;  2K9J B;  3M91 A;  4OGQ C;  1CX8 A;  1RY3 A;  1SQV J;  3BVH A;  2N1T D;  1J1E B;  3CPW O;  5CJ0 A;  4MCR A;  2MKV A;  5HKZ A;  2A45 H;  3H25 A;  1VF5 B;  1ZME C;  5L8R J;  2YXR B;  3RK3 C;  3JC2 2;  2V4H A;  3D7F A;  2QJP C;  3O6Q A;  4EIJ A;  3FEC A;  1P84 E;  4PD4 D;  1BDD A;  3ABV C;  2N1T A;  3AE2 C;  2WSE J;  3H1L E;  2R32 A;  1YJ9 P;  1JTH A;  2HLO A;  1M8O B;  4DOJ A;  2FYU K;  3V2R A;  1DIP A;  3VMY A;  1SQQ K;  1OW6 A;  1Q7Y Q;  3S9M A;  1U7J A;  5APW A;  3V6I A;  3VMZ A;  1H0T A;  2A06 E;  2FFD B;  1JM0 A;  3P8C E;  1SQV D;  4ZKU A;  1T3J A;  5AW3 B;  1NU1 G;  3G71 P;  4W7Y A;  2WPR A;  3B5N C;  2IBZ I;  3K5B A;  1N73 B;  3AE6 C;  2E76 B;  2P10 A;  1Y8A A;  4MCP A;  1L4A D;  2R3C A;  2K1A A;  4M3L A;  1Z8L A;  3EFF K;  2I1K A;  1PPJ G;  3L70 D;  1TU3 F;  2RN0 A;  2JWD A;  2QJY B;  2O3J A;  3JSV C;  1OXZ A;  1LTT C;  1JUN A;  2FFD A;  1JCC A;  5BVZ A;  1L0L K;  4R4M A;  3VMX A;  3MUD C;  5B5E E;  3M0D A;  3OJA B;  1P84 I;  1HH0 A;  1FE6 A;  1NOH A;  4NPD A;  1NTZ E;  1EZV G;  2XPL A;  2H7H A;  3TNU A;  1H8A A;  4OC1 A;  2JBK A;  3C8V A;  1M57 D;  2ZT9 C;  1AQT A;  5AVX B;  4IFD K;  3VRQ A;  1FZE A;  4IL6 X;  1RF1 B;  4OH8 B;  4EOT A;  1USE A;  4H13 B;  4LLH A;  3MZW B;  1KV4 A;  3H1H G;  2PRR A;  2Z4E A;  1N7S D;  1JY2 N;  2R5B A;  1GL2 C;  1LWU A;  2WPS A;  3AE1 C;  1YI2 P;  2GUV A;  1G1I A;  1G1J A;  5CBO A;  2XPP A;  3RK2 D;  3IWW A;  5AVY B;  2E75 B;  2ZFC A;  3RK3 E;  2IZ1 A;  3FED A;  2E43 A;  1BGY E;  5AW5 B;  3BCC D;  1ZXG A;  2Q1K A;  2BAS A;  1KFN A;  1ZW0 A;  1JMB A;  1MZ9 A;  2XPN A;  1SQP D;  3BUN B;  2OYI C;  3CCL P;  3L73 D;  3CCV P;  5APS A;  1GZL A;  2RH0 A;  3H1J G;  2N1T C;  4KHX A;  1LTJ B;  2E76 C;  5AVZ B;  3Q5S A;  2MJZ A;  1NTK G;  2WSC H;  3U1A A;  1KB9 D;  3A3Y B;  2JJL A;  3HD7 A;  4PV1 B;  2KZJ A;  2C0W A;  4CPG A;  2WSC J;  3RL0 D;  2QSI A;  2I1J A;  1PFI A;  3VTP C;  2FFD C;  4BPU B;  1KIL D;  1SFC D;  1JY3 N;  3HE4 B;  2Y9Y A;  4C7N B;  2E42 A;  1CZQ A;  3AE5 C;  1S1C X;  2IPP A;  1QL2 A;  1NTM E;  4U3F E;  3MTU E;  2CK3 H;  1Q81 Q;  3H1J E;  3H1I D;  3FWL A;  4MCS A;  2UWJ E;  4Y28 J;  1S2E A;  2QM7 A;  5CBN A;  2FYN C;  1BCC G;  1Q90 D;  2XEF A;  2ZXE B;  2BEZ F;  1W2E A;  3PJS K;  1CSB A;  1AVO A;  3GHG C;  1FOS F;  1AA0 A;  3SJG A;  1Q86 Q;  1OVU A;  3IR9 A;  3V4Q A;  1GW3 A;  4RO0 A;  4BXL A;  3L74 J;  1NHL A;  3BUM B;  2Z5I A;  4NGM A;  1SQQ J;  2Q3I A;  4IL6 H;  1G2C B;  2RKL A;  1XTC C;  4U3F J;  3PFV A;  1VL2 A;  3GG2 A;  1S9K D;  3CX5 D;  4EI2 A;  3HTK A;  3BRT B;  3ZDM A;  2KOG A;  4NGQ A;  4GDO A;  3CL3 D;  3AE4 C;  1EO0 A;  2BCC G;  3OA7 A;  1LTJ A;  3HMJ G;  3L73 J;  3B5N D;  1EDJ A;  3CWB D;  2HOD A;  2YXQ B;  5K5G B;  3D6Y A;  2FY8 A;  2WSS H;  1PGP A;  1FU1 A;  3CXH E;  1S5L E;  2NZ2 A;  3M0D C;  4C46 A;  3S1K A;  1NTK D;  5KLV D;  3H1I J;  2JP3 A;  3H1K G;  2W27 A;  2QJP B;  1PPJ D;  1DD3 A;  3JCU H;  4YTP C;  1K8A Q;  2XEG A;  3ITK A;  1M1J A;  1M56 D;  3OAK A;  2M3E A;  2IBZ G;  1S5L X;  3NFQ A;  2KP8 A;  1KQL A;  2OGU A;  3JCU E;  2XU6 A;  5BU5 A;  3UIA A;  2J5U A;  2B87 B;  4JQ0 D;  3BXM A;  4I7Z B;  2QJY C;  4NPE A;  1FOS E;  1Q2N A;  2K37 A;  2YKP A;  4IFM A;  2GUS A;  3FEE A;  4WB4 A;  1S72 P;  4AUW A;  4YXW H;  1JY3 P;  1BCC J;  1BE3 E;  1LWU C;  1L4A C;  1BCC E;  3AEF C;  2DLA A;  2KNC A;  3LW5 J;  2C6G A;  5E79 E;  2ZXX A;  3VP9 A;  2OTL P;  3L74 E;  1NJI Q;  4NGT A;  3L74 G;  3RL0 C;  4KT0 J;  3FX0 A;  1W5C E;  3H1H E;  3RK2 C;  3P7K A;  3W68 A;  2KB7 P;  2Y0C A;  1GL2 A;  4RR2 B;  1MFZ A;  4YPC A;  3V4W A;  1ZR2 A;  1JCD A;  1RE3 A;  2DW3 A;  3HD7 D;  4WBA A;  1PL5 A;  2JBJ A;  5CCH D;  4PJ0 H;  3HD7 C;  1RH5 B;  2FYU E;  2OYO A;  3L75 E;  2P7J A;  2IFN A;  3Q3D A;  1KB9 E;  1DEB A;  2Y0D A;  1OMI A;  1IFI A;  1LTI C;  1QEX A;  5APY A;  1NAY A;  3SFD C;  1YVH A;  3GHG B;  4U3F G;  3BI1 A;  1N7S C;  2OYI A;  3HPG G;  5AXI A;  3G3Z A;  3IFM A;  5H2F E;  1VPC A;  4D6T G;  1SQB G;  2QVA A;  4W9Y A;  3CC4 P;  5APT A;  4LC1 A;  2C6C A;  1J2J B;  1SQX K;  3T97 B;  4AYC A;  3V2N A;  2HPC A;  2Q6Q A;  3CD6 P;  1FAV A;  2HR3 A;  3CI9 A;  1KQF B;  2KLU A;  1SFC B;  1YIT P;  2A06 D;  3H1L J;  1PGO A;  5CCH C;  2W6J H;  2OYI B;  1IK9 A;  3RBX A;  2KNC B;  2ZJS E;  1ZV8 A;  3TF5 A;  4H44 C;  1A02 J;  5BU8 B;  3A0H E;  5B66 E;  1M1J C;  4GT1 A;  2AEM A;  2N1T B;  1T3U A;  3CMA P;  1NTM D;  2KSE A;  1AV1 A;  2O01 J;  1KOR A;  2BCC E;  2KXP B;  2E74 C;  3TDK A;  3HE5 A;  2Y9Z A;  1Y47 A;  4JBZ A;  3HUS C;  1LP1 B;  5KLV E;  2M3B A;  3GMA A;  4TLF A;  1NYH A;  3G6E P;  4HYT B;  1FZG A;  1PZQ A;  1EXJ A;  4OC2 A;  2JKV A;  4OGQ D;  3H1K E;  4H44 B;  1N2D C;  4NGN A;  1UII A;  3TNU B;  3SWF A;  4NGP A;  3VMA A;  3RK3 D;  1H89 A;  2K88 A;  1Z56 A;  1G2C A;  2PGD A;  1LNQ A;  1AJY A;  3W67 A;  4WY4 D;  1SQV G;  2LR2 A;  3CME P;  1BGY D;  1MV8 A;  3VRR A;  3USS A;  1YTZ T;  3G9R A;  5D29 A;  2N9B A;  2XZR A;  3FXD A;  2IBZ D;  2HPC B;  1BCC D;  3II6 A;  1LTS C;  3R2P A;  2IX7 C;  3D7G A;  5BY0 A;  1IO4 A;  4HB1 A;  1SFC A;  1EXI A;  2FBW C;  5KJ7 C;  5KLV J;  4LQG A;  2WVR A;  3BRV B;  2PVV A;  3R4Y A;  2IFM A;  1BDC A;  3CXH I;  1OVR A;  1NVO A;  2LXC B;  1SS1 A;  1OVV A;  3MIW A;  4OC3 A;  2PAJ A;  1SQX D;  1QVG O;  2WIT A;  5AW9 B;  5HKY A;  1MFT A;  1ZLL A;  3BAS A;  4GIF A;  1FJK A;  2PVW A;  3RBU A;  2BCC D;  2R5D A;  3WU2 H;  1YJW P;  2FXM A;  3F89 A;  1AFO A;  3NMD A;  1OW7 A;  3A0H H;  4IFF A;  5B66 H;  2BEQ D;  1GL2 D;  1EDI A;  4QMA A;  2H8P D;  3HE5 B;  1NU1 K;  2M8R A;  2B87 A;  2QRX A;  3M9B A;  3PH0 A;  1RE4 A;  1LGH B;  3CC2 P;  1P84 H;  1SQV K;  5CCH A;  1QL1 A;  1ZR4 A;  4W80 A;  3H1I G;  1L0L G;  1JOC A;  1KIL C;  1R8E A;  4IL6 E;  3RK2 B;  1OW8 A;  3TK1 A;  1VF5 D;  2KI7 B;  3LIE A;  3MGN A;  2G3A A;  3KDP B;  2C9L Y;  4BPW B;  4N6J A;  1M1K Q;  4WWI A;  2GM4 A;  4OC0 A;  5AW0 B;  4WY4 C;  3GF3 A;  4X3R A;  3GF7 A;  3Q1M A;  1DE4 C;  2O01 H;  1GW4 A;  2Y1N A;  1L0L J;  3B5N A;  1VQL P;  3G4S P;  2FYU J;  3L75 J;  1IFJ A;  1FZC A;  3AEB C;  1YIJ P;  5AW7 B;  1FDM A;  1PV3 A;  2ITA A;  3L4F A;  1LWU B;  1SQQ G;  2QE7 H;  2WPV B;  2B9B A;  1LT9 C;  1NKN A;  2KS1 B;  4N3Y B;  3MUD A;  5AW1 B;  3L36 A;  3P8M C;  1EC5 A;  3AE9 C;  1GK6 A;  4DCK A;  2G8Y A;  2QJK C;  4A7P A;  2KSJ A;  3KXD A;  2E5T A;  2POH A;  1UIX A;  2OYH A;  1E79 H;  1L0N J;  5KLI B;  4NPF X;  2C6P A;  2YO2 A;  3L71 D;  3SJX A;  3P8C D;  1BGY J;  3QH9 A;  3AE7 C;  3CX5 H;  4P44 A;  2KZI A;  1T2K D;  4P4F A;  1RF1 A;  3WUU A;  1SQX J;  3CCM P;  1X0T A;  1SQP J;  5TIS H;  3PTZ A;  2WPQ A;  5J3X A;  4JPZ B;  3VRP A;  4H0L D;  1N73 A;  1SQB D;  2H88 C;  2CPB A;  2E74 D;  3KPE A;  3HE4 A;  3KAS A;  4H0L C;  1QLE D;  1NU1 D;  4PJ0 E;  3WUT A;  3WUV A;  4MN4 C;  3L72 D;  3H32 B;  4TT3 H;  1YTZ I;  3VP8 A;  5KAI E;  1ZRT E;  1R5L A;  2RMZ A;  4U7J A;  3HUS A;  1X9V A;  1ZP0 C;  5CCG C;  3SJE A;  2M5A B;  4I1L A;  2P67 A;  2YKQ A;  3VN0 A;  3CX5 I;  1T2K C;  1W2B O;  5KLV G;  2KYV A;  1SFC C;  1M1J B;  4L76 A;  2XKM A;  2ZYD A;  3BI0 A;  1SQP G;  5GTI H;  2YIU B;  1LTG C;  5APU A;  1QVF O;  1EZV E;  2XEI A;  2OR4 A;  5AVW B;  2P1J A;  1L0N E;  1OIP A;  3KZI E;  2P58 A;  3GW6 A;  4I7Z C;  1LT9 B;  3N7N A;  2HG5 D;  1WJT A;  3L75 D;  1QX8 A;  2FYU D;  2P2U A;  2XNX A;  3AEE C;  3L71 J;  4XE5 B;  1PIX A;  1WMK A;  3LID A;  1FZC C;  1ZRT D;  4P4J A;  3TGU J;  2YIU C;  1IC2 A;  1URQ A;  1NAF A;  4BPX B;  4GPL B;  2NPS D;  4BRY B;  4ZKP A;  1N7L A;  3OP0 A;  1EZV I;  3BAT A;  3GHG A;  1FDO A;  1NTZ K;  1KTM A;  1SQB J;  1FZA A;  5KAF E;  1K73 Q;  2W90 A;  4HKZ H;  2V7Q H;  4PV1 C;  1VQP P;  1KYO I;  1IFM A;  1GL2 B;  4P4B A;  3CWB E;  1RF0 C;  1NGM B;  1VF5 C;  1WRG A;  1SLQ A;  1U7M A;  4EYY Q;  2M5A A;  1OX3 A;  1NWQ A;  1PPJ E;  1PGJ A;  2KUB A;  3TSI A;  1NU1 J;  4PD4 H;  1U57 A;  3TGU E;  3SJF A;  5F09 A;  3L70 G;  4ASV A;  1FBV A;  1YQ4 C;  4IOI H;  4WY4 A;  3M0A A;  1H88 A;  1P84 D;  4PD4 E;  1E5W A;  3D6Z A;  4BWN A;  1FDI A;  4RJT A;  2FYU G;  3L75 G;  5DJT B;  5TJH A;  3SSU A;  4JYB A;  4O9B A;  3A5T A;  4U3F D;  1NTZ G;  2HFE D;  2R3S A;  2L91 A;  3MHV A;  3HRN A;  1L0L D;  2IYP A;  3AEG C;  3L71 G;  1J1E C;  1N8R Q;  1URQ B;  2O1K A;  2YMY A;  2AEJ A;  3WU2 E;  2K3R A;  2IZ0 A;  1NKZ B;  1VQ8 P;  2E75 C;  2WMM A;  3I5C A;  2D2C D;  3KHU A;  2OYH C;  3P32 A;  3A7O A;  1GMJ A;  1YBK A;  5KKZ C;  3FGA D;  5GTH H;  3H1I E;  4NGS A;  2OTK E;  2B4J C;  1VQ4 P; 
#chains in the Genus database with same CATH homology
 3C9I A;  2W6A A;  2FXM A;  2IPP A;  1QL2 A;  1Z9E A;  3E1I A;  3H32 A;  3MTU E;  3U59 A;  1JO5 A;  5KTB A;  1SQP K;  1AFO A;  5CCG A;  3NMD A;  3NXS A;  4I2L C;  2XPO A;  2WT7 B;  4IFF A;  1GL2 D;  5AVQ B;  2H8P D;  3HE5 B;  1NU1 K;  2M8R A;  1URQ C;  1N73 C;  3M9B A;  2VRS A;  5AW2 B;  1RE4 A;  1JY2 O;  1LGH B;  1HTL C;  1OWA A;  3M9H A;  4LGD E;  1L4A A;  2QM7 A;  1JY2 P;  5AVS B;  1HWT C;  1HGZ A;  2ZXE B;  1W2E A;  2Q5U A;  1CSB A;  1SQV K;  2OAR A;  3GHG C;  5CCH A;  1QL1 A;  1LTB C;  4JYC A;  4W80 A;  1ZR4 A;  1FOS F;  3HPH E;  1JOC A;  1KIL C;  3IR9 A;  3RK2 B;  3TK1 A;  3LIE A;  3MGN A;  3KDP B;  2C9L Y;  1CW5 A;  4N6J A;  3V4Q A;  1GW3 A;  2GM4 A;  5AW0 B;  2WT7 A;  1LTA C;  4W7Z A;  1HUC A;  1NHL A;  1X79 B;  1A02 F;  2Z5I A;  4WY4 C;  1RF0 A;  2Q3I A;  1G2C B;  1XTC C;  2O01 H;  1GW4 A;  1N7S B;  1SQB K;  1WT6 A;  1S9K D;  3B5N A;  3CLQ A;  1SVF A;  4AQR D;  1IFJ A;  3HTK A;  1FBM A;  1URQ D;  3VYI A;  1FZC A;  3BRT B;  1IJD B;  2KOG A;  1VDF A;  2NPS A;  3CL3 D;  3O8Z A;  5AW7 B;  3N4X A;  4DZO A;  1HVV A;  1FDM A;  1EO0 A;  1GU4 A;  1JNM A;  1J1D C;  5KJ7 D;  2HYN A;  3T97 A;  5CJ4 A;  4WY4 B;  3L4F A;  1LWU B;  1LTJ A;  3OA7 A;  4C7R A;  3B5N D;  2HOD A;  2XV5 A;  1T8Z A;  3HD7 B;  1MUU A;  4RES B;  5AW8 B;  2N3A B;  1FU1 A;  1N7S A;  1L0N K;  2FYZ A;  1LT9 C;  1NKN A;  5AW4 B;  4N3Y B;  3MUD A;  5AW1 B;  3L36 A;  1NH4 A;  3M0D C;  3P8M C;  4C46 A;  1GK6 A;  5KJ7 A;  3F9K C;  2W27 A;  2KSJ A;  3NTN A;  1GDT A;  1ZN5 A;  2NPS B;  2POH A;  3EQ2 A;  3U88 C;  2W6B A;  1M1J A;  2OYH A;  3KYQ A;  3OAK A;  2J59 M;  1X8Y A;  2WTY A;  1FJP A;  3NFQ A;  3L37 A;  1M7L A;  4JF7 A;  1GTW A;  2KP8 A;  2YO2 A;  4N78 D;  1KQL A;  5AVU B;  3RL0 B;  2XU6 A;  3P8C D;  2A45 G;  5BU5 A;  3UIA A;  1J1D B;  3LW5 H;  2LKM A;  1L4A B;  4B86 A;  1FOS E;  1T2K D;  1RF1 A;  2YKP A;  2YKO A;  4Y99 B;  4IFM A;  2GUS A;  4HH2 A;  2YO3 A;  4WB4 A;  4AUW A;  5AVR B;  2WPQ A;  5APX A;  1JY3 O;  1N73 A;  1DX7 A;  5AVV B;  2OYH B;  1RE4 C;  2A45 I;  1JY3 P;  3VOP A;  1LWU C;  1L4A C;  1YYC A;  2CPB A;  3KPE A;  3HE4 A;  3HTK B;  1GK4 A;  2PP6 A;  1CI6 A;  4XA4 A;  1HGV A;  3A2A A;  3M91 A;  3H32 B;  1KIL A;  1YTZ I;  3VP8 A;  3VP9 A;  1RY3 A;  3BVH A;  3HUS A;  1X9V A;  2N1T D;  1J1E B;  2HOD B;  5CCG C;  5CJ0 A;  3RL0 C;  2QM8 A;  2A45 H;  4I1L A;  3RK2 C;  3P7K A;  2KB7 P;  2P67 A;  3RK3 C;  2YKQ A;  3VN0 A;  1GL2 A;  3PP5 A;  1T2K C;  1MFZ A;  3KQG A;  4EIJ A;  3RK3 B;  3V4W A;  2KYV A;  1ZR2 A;  1JCD A;  1RE3 A;  1SFC C;  2N1T A;  1M1J B;  1NTM K;  3HD7 D;  4WBA A;  2R32 A;  1JTH A;  2HLO A;  2NPS C;  1XTG B;  2WSF H;  2XKM A;  4DOJ A;  1SP4 A;  2FYU K;  5CCH D;  3HD7 C;  3V2R A;  3VMY A;  1LTG C;  1SQQ K;  2J58 A;  2P7J A;  2IFN A;  5APU A;  1HBW A;  4I6M C;  1DEB A;  2Q7C A;  5APW A;  1GD2 E;  3VMZ A;  1IFI A;  3WMM 0;  1LTI C;  2FFD B;  5APY A;  2C0X A;  3P8C E;  5AVW B;  3GHG B;  2P1J A;  1NO4 A;  1T3J A;  4ZKU A;  5AW3 B;  1IFN A;  1N7S C;  2OYI A;  3HPG G;  4W7Y A;  1LT9 B;  3N7N A;  2HG5 D;  1WJT A;  2WPR A;  2P2U A;  3B5N C;  2XNX A;  3G3Z A;  3IFM A;  4XE5 B;  1KZU B;  1VPC A;  1N73 B;  3EFG A;  2JEE A;  5APT A;  3LID A;  4LC1 A;  1FZC C;  3M06 A;  4Y99 C;  1J2J B;  1L4A D;  2R3C A;  4M3L A;  1SQX K;  1IC2 A;  2I1K A;  4AYC A;  3V2N A;  1URQ A;  2L5G B;  2HPC A;  1NAF A;  1FAV A;  2NPS D;  3CI9 A;  4N78 E;  4ZKP A;  2H43 A;  2XDJ A;  1N7L A;  1SFC B;  1OXZ A;  1LTT C;  1JUN A;  2FFD A;  3HUS B;  5KLV K;  1JCC A;  3BAT A;  5BVZ A;  3GHG A;  1NTZ K;  2CPS A;  1L0L K;  5CCH C;  1FZA A;  2OYI B;  1LT9 A;  3VMX A;  1HJB A;  1IK9 A;  3M0D A;  1S9K E;  3OJA B;  1CI6 B;  1HH0 A;  1ZV8 A;  1IFM A;  1GL2 B;  1A02 J;  5AW6 B;  1NOH A;  5BU8 B;  1KIL B;  1M1J C;  4GT1 A;  1RF0 C;  2XPL A;  2N1T B;  2H7H A;  1T3U A;  3TNU A;  1H8A A;  1WRG A;  3V2P A;  1SLQ A;  2WWW A;  1AQ5 A;  5AVX B;  4IFD K;  2O1J A;  1NWQ A;  1FZE A;  2FKW B;  3HE5 A;  1RF1 B;  4OH8 B;  3HUS C;  4EOT A;  2M3B A;  1RF1 C;  1FZB A;  2KLV A;  4LLH A;  3TSI A;  3L35 A;  2WSE H;  4HYT B;  1FZG A;  1EQ7 A;  1KFM A;  3TYY A;  1JTH B;  1LTJ C;  2Z4E A;  1N7S D;  1JY2 N;  4WY4 A;  5APQ A;  2R5B A;  1GL2 C;  1LWU A;  1N2D C;  2WPS A;  3M0A A;  1H88 A;  2Z5H A;  1E5W A;  3TNU B;  3SWF A;  3H6P A;  2GUV A;  1G1I A;  3U1C A;  1G1J A;  2XPP A;  1FZF A;  3RK2 D;  5APV A;  5AVY B;  1NTK K;  5AVT B;  3RK3 D;  1H89 A;  1IFD A;  1JMM A;  2ZFC A;  2C9N Y;  1Z56 A;  1G2C A;  3V5B A;  2E43 A;  4JYB A;  5CHX A;  4O9B A;  4WY4 D;  5AW5 B;  3A5T A;  2BAS A;  2Q9I A;  2HFE D;  3HRN A;  1MV8 A;  3MD0 A;  1YTZ T;  1KFN A;  2N9B A;  1MZ9 A;  3SWY A;  2XPN A;  4C7N A;  1N86 A;  2XZR A;  1J1E C;  2OYI C;  3B8E B;  5APS A;  1URQ B;  2HPC B;  2O1K A;  1GZL A;  2YMY A;  2YNY A;  3II6 A;  1LTS C;  3R2P A;  2IX7 C;  1IO4 A;  1RE3 C;  1SFC A;  2N1T C;  1CZQ A;  4KHX A;  4GKG A;  1LTJ B;  5AVZ B;  3V2Q A;  5KJ7 C;  2MJZ A;  2WSC H;  3U1A A;  1DH3 A;  3A3Y B;  1NKZ B;  3BRV B;  2JJL A;  3B5N B;  3HD7 A;  2IFM A;  3I5C A;  2C0W A;  2OYH C;  1GU5 A;  3P32 A;  1FZC B;  3A7O A;  3RL0 D;  3MIW A;  5CCG D;  2I1J A;  1PFI A;  2WZ7 A;  2PAJ A;  3VTP C;  2FFD C;  1KIL D;  1SFC D;  1JY3 N;  2WIT A;  3M9Q A;  5AW9 B;  3HE4 B;  4C7N B;  2E42 A;  1ZLL A;  3BAS A;  4GIF A;  1FJK A;  2B4J C;  2R5D A;  5CMZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...