3OAKA

Crystal structure of a spn1 (iws1)-spt6 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
151
structure length
151
Chain Sequence
GIDPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IWS1
publication title Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 55
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3oakA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3oakA02
1NAFA 1IO4A 3NTNA 5APVA 5AVSB 1H8AA 1MFZA 2ZXEB 5APTA 2VRSA 4AQRD 2Q7CA 3MGNA 3HE4B 3M9HA 4AUWA 2E42A 2QM8A 2QM7A 2W27A 3HE5A 3VMZA 5APXA 1YYCA 2BASA 3LIDA 1S9KD 2YNYA 2C9NY 2IPPA 1OWAA 5AW2B 1JUNA 1KQLA 3A7OA 3O8ZA 2WT7B 1T2KC 1WJTA 5AVQB 2E43A 2R32A 1GK6A 4B86A 3M91A 5AW9B 3V4QA 2Q3IA 1JNMA 4XE5B 3HPGG 5AVYB 5AW6B 2YO2A 1CI6A 1FAVA 2YO3A 3KDPB 1EO0A 1FOSE 2Z5HA 5AVVB 3SWFA 5APWA 1HUCA 2WPSA 4DZOA 5AVTB 3VN0A 1CZQA 3P32A 1HWTC 3I5CA 3L37A 5AW1B 2Q5UA 3T97A 1SP4A 1J2JB 2W6AA 2XPNA 1GTWA 4AYCA 3M9BA 5AVRB 2XPOA 4GT1A 3TNUB 3L35A 3L36A 3M06A 3VTPC 3P8MC 2JJLA 2P67A 3V4WA 5AW3B 4LC1A 3HE4A 1MV8A 2XV5A 3B8EB 3A5TA 1S9KE 2WWWA 5AVWB 3VYIA 5AW5B 1NWQA 3TYYA 1FOSF 2XU6A 5AVXB 3P7KA 3A2AA 5APUA 1A02J 2KP8A 4C7NB 3M0DA 4C46A 3NMDA 2WT7A 3NFQA 4I2LC 1HJBA 2WPRA 3KQGA 1MUUA 1GK4A 4JYBA 5AW8B 2N3AB 2Z5IA 1H89A 4KHXA 3F9KC 2XZRA 2R5BA 2H7HA 2WPQA 1GU4A 4EOTA 3M0AA 5APSA 4RESB 3TNUA 1HBWA 1OXZA 5AVUB 3UIAA 3IR9A 4M3LA 5AW0B 4I6MC 3A3YB 1DH3A 1SLQA 4HYTB 1H88A 3HE5B 1GD2E 2P7JA 1CSBA 4C7NA 3LIEA 5AW4B 1T2KD 3MD0A 3HTKA 2N9BA 5APQA 2C9LY 5AVZB 3NXSA 2WTYA 2P2UA 1CI6B 1A02F 1X8YA 5CMZA 5APYA 2R3CA 2ZFCA 1GZLA 1Z9EA 4GKGA 2XPLA 3VMXA 1G2CB 3TK1A 3V5BA 3VMYA 3HPHE 5AW7B 3U88C 2R5DA 3OAKA 1GU5A 2B4JC 2XPPA 4JYCA
chains in the Genus database with same CATH superfamily
2GM4A 3G4SP 3FF3A 2Q7CA 2KXPB 3HE4B 2ZVOB 2N1TA 4WVZA 2QM7A 3L71J 3TGUD 3KZIH 3H32A 3CX5I 3O8ZA 1YITP 4XE5B 2W8ZA 5AW6B 1LWUB 2NPSA 3D6ZA 1RY3A 4UB8E 2M8RA 1JY3P 4OGQB 1G2CA 2O3JA 4ZNCA 3M9BA 1FC2C 1UIXA 1S9KE 1W2BO 1L0LE 4PJ0E 3TYYA 1URQB 3NFQA 2RKLA 2H88C 1GDTA 1PIXA 4JYBA 4H13C 1D7MA 1VL2A 2AEMA 3USSA 1IJDB 1M8OB 1NTME 1R5LA 1HBWA 4UB8H 5EFWB 1VQ7P 1S72P 4W9YA 5KJ7D 4MCSA 5BU8B 1FDMA 1K9MQ 1K8AQ 3FWLA 4BPWB 1JY2P 2H43A 1X22A 4PJ0H 3HUSB 1U57A 1X0TA 1DIPA 4GODA 4NGNA 3B5NA 3ABVC 1PGOA 4RO0A 2ZXEB 3BXMA 3PH0A 5B66H 4HKZH 1SQBJ 4NPEA 1BDCA 1ZMEC 2V4HA 2KS1B 2KLVA 3O6QA 4OVNF 1NTMJ 2E43A 2AEFA 1ZLLA 4DT0A 1LTJA 3KDPB 2Y9ZA 1SQXK 1KQSO 3L75D 1EZVI 3S9MA 3C1LA 1EDIA 1SQXD 1BCCE 3A0HH 2Q5UA 4NGTA 1KB9H 2Y0CA 4GT1A 2HYNA 3L36A 2WSEH 1VQPP 2WWWA 1NWQA 5AVXB 1KB9I 5HKWA 2XEGA 3HTKB 1GL2C 3PHLA 2ZT9D 1MUUA 1J1DB 1GMJA 2WPQA 3CMAP 5KLVE 1SQVG 3UIAA 2YIUC 2KZJA 4RR2B 1DEBA 4PV1D 1RF1A 5F13A 1M1JB 3LIEA 3D7GA 5AW4B 1L0LK 1BCCJ 1N7SA 1RQUA 1BE3E 1L0LD 4LQGA 2Y0EA 1PP9E 1KC8Q 3F5HA 3AEEC 1P84I 4JPZB 1GZLA 3L74G 2P1JA 1AFOA 5D29A 5AXIA 3H1JE 4X3RA 2K9JB 1QX8A 2K1AA 2YMKA 3WUVA 3OB1B 4WY4A 4PV1B 3BASA 1IK7A 2BASA 3PP5A 3AE3C 4U3FG 5KLVJ 2WSFH 4JZ0A 3B4SA 4R4LA 4JF7A 2N1TC 3VN0A 3T97A 1NKNA 3V2NA 2E75B 1KB9D 2KIKA 5AVRB 2FFDC 1AV1A 3SJXA 1BE3J 5BY0A 1ZOYC 5AVWB 1W2EA 1OVRA 3G71P 3SJGA 4IOIH 5KKZC 4IL6E 1KYOI 2Y1MA 2OGUA 1KTMA 2O1KA 2A06G 3FWNA 4BRYA 1M7LA 1KN7A 1DE4C 1LP1A 1SQPE 2GA1A 1VQOP 2FYNC 4TT3H 3RK3B 1SLQA 3EQ2A 3VMAA 1S4XA 2W83C 4DJGA 1KMIZ 4TLFA 2LXBA 3CCJP 3S9OA 4IL6H 1KZUB 5AW7B 4BPUB 2XPPA 1CX8A 5TISH 2W27A 1L4AA 3HE5A 2POHA 1EC5A 1LTAC 3M91A 3HPGG 5E79H 1SQPJ 2AXTE 4D6TG 1JCCA 4MCRA 4NPDA 1HWTC 1AJYA 1SP4A 3BI1A 4H0LB 1IFNA 2WSSH 1PP9D 1SQBG 1VF5B 3HE4A 1NTMG 3H1JD 4OC4A 5KAIH 2KP8A 4C7NB 2J5UA 3CL3D 1L2PA 2A45G 1LWUA 4GIFA 4K35A 5AW8B 1XTGB 2HG5D 2OYIC 2QJKB 4K3AA 2G3AA 3VP9A 3FEDA 2FYUJ 3L70D 3D71A 4OC5A 4A7PA 4R4MA 2C6GA 3CXHE 4BPXB 1H88A 1URQA 2M5AB 2IBZI 3L73D 5APQA 2C9LY 3AEAC 1AA0A 1HJ0A 3A0BE 4Y99B 4NGSA 5APYA 2SPZA 4I7ZC 4NPFX 3U1CA 1RF1C 1NGMB 5KAFE 2XEFA 3VMYA 4P4IA 1GU5A 1IZNB 3NTNA 1L0ND 3P8CE 1JEKA 1T3UA 3MGNA 1BCCG 1RF0C 1N8RQ 1IFDA 3LIDA 1GW3A 2WT7B 1WJTA 5AVQB 1SQVE 3U1AA 1FOSE 3CXHH 3HUSA 2JWDA 5KLIB 4W80A 5CJ0A 3P32A 3PLNA 3Q3DA 2HR3A 4MCPA 2MKVA 2WVRA 2K88A 1VQ9P 4RKUJ 4PD4E 3VYIA 3C9IA 3HD7B 1Q2NA 5KLVG 2KS1A 4U7JA 1Q90D 2OQQA 1YJNP 3W67A 4L76A 1SFCC 1FZFA 1LT9B 2R5BA 1PPJE 2XNDH 3S9NA 2HFED 2IZ1A 4U3FE 1FBVA 2IBZD 1BE3G 3JCUH 3Q2YA 1SQVJ 3KXDA 4OWFA 2M3BA 3RK2C 2QA4P 2WQYC 2OYOA 5J3XA 1GD2E 4OC0A 1LTTC 3HTKA 4UB6E 3CI9A 4OC3A 4BWNA 2HPCB 1U7JA 4PD4H 2PFXA 2KUBA 3CCUP 2R3CA 2BCCE 1FZBA 5M1BA 3CX5E 3V2QA 5TJHA 5APVA 5H2FE 4AQRD 1DX7A 2A06E 4GOFA 1R5SA 1M1JA 2AEJA 1JOCA 4H44C 5CCHA 4U3FJ 3AEGC 2WSCH 4O9BA 3MUDA 3CXHD 1HTLC 5APWA 5CJ4A 3ZNIA 5CCGC 2WPSA 2WSCJ 1L4AC 4HH2A 1S5LE 3BRVB 4UB6H 2OYHC 2K9JA 2I1JA 3RL0C 1RE3A 1N73B 2XNXA 1ZRTE 2XV5A 2O01J 1S1CX 3P7KA 1VQMP 5APUA 1FZEA 4C7RA 3WUUA 2BCCJ 3H1HG 2HODB 1SQPG 4H13D 2PP6A 3Q1MA 2NZ2A 3M9QA 2WMMA 1SQVK 5GTIE 1KILE 1SQVD 2CPSA 4XA4A 1S2EA 3BUOB 2IX7C 4D6TE 4WB4A 3HMJG 1PZQA 4YXWH 2XKMA 3PTZA 1MFTA 1SQBE 1UIIA 3B71A 3L74D 4PD4D 2PVVA 1NO4A 1G1JA 5CMZA 3BUMB 2FYUG 4P45A 2XPLA 3H1LE 3N4XA 3SJEA 1AVYA 3PLFB 3G6EP 4YTPC 5AVSB 1H8AA 5APTA 3AE7C 3CLQA 1VPCA 1EZVE 2V7QH 2QE7H 3GHGC 3L4FA 1KFMA 1KQLA 4B86A 1ZR4A 5AW9B 3CC7P 5AVYB 2V7QJ 3I55P 4D6TJ 2ZYDA 3L71D 3MP7B 1R8EA 2QSIA 2QJYB 3CWBJ 2JKVA 3HUSC 1GL2D 2A45H 3RK3E 3U59A 1A02J 2G8YA 3AE9C 3II6A 3H1LJ 3S9LA 1HJBA 4Z1MH 2Q3EA 2UV8G 2IYOA 2Z5IA 1H89A 2ZYGA 1NTKE 2LR2A 2WPVB 4IL6X 3W68A 4L74A 1PGPA 3IR9A 1NHLA 1YQ4C 1GL2B 3VRPA 3CMEP 4EI2A 3HRNA 4C7NA 1ZRTD 2WTYA 5BU5A 2KNCB 2RH0A 1EDLA 3AE5C 4BTFA 1VQLP 1VQ8P 2QIWA 3MHVA 3TF5A 2LKMA 2I1KA 2L5GB 2W6JH 3H1IE 1KQFB 1T6AA 2I8DA 2ZT9B 1N2DC 2M5AA 1S9KD 1NTKJ 4P4JA 2R32A 4D6TD 2N1TD 3Q5SA 3C8VA 2P10A 3L72E 2Z5HA 5AVVB 1SQBK 1KFNA 1X9VA 1SQBD 1NTMK 4OC2A 3KASA 1NTMD 2JO1A 3K5BA 4HJGH 1QL2A 1CW5A 4LC1A 1PPJG 1KILC 3A5TA 3ZDMA 4DCKA 2IDBA 3BUNB 2WT7A 3SWKA 1AQ5A 1U7MA 2CK3H 1RE3C 3CCEP 2C6CA 4LLHA 3H1KE 2FFDB 3H1IJ 3VRNA 3CCMP 5L8RJ 2NPSC 1LGHB 2FY8A 4P4EA 2OOTA 5AVUB 1YHQP 1JB0J 2CBLA 3CCLP 2BCCG 3A3YB 1FU1A 3HD7A 3GF7A 3L72J 2ITAA 1QGKB 4P4FA 1AVOA 1T2KD 3IN6A 1Q86Q 2YXRB 3RBXA 3NXSA 2QRXA 1N7LA 3KYQA 1LT9A 3R4YA 3WU2E 2FXOA 2W90A 3H1HE 4L75A 2FYNB 2CPBA 5CBOA 4YXDC 3AECC 1BCCD 1GW4A 3IFMA 2OTLP 3AEDC 4JQ0D 1Y9BA 2B87B 5BVZA 5B5EE 2E5YA 2ZYAA 2E42A 3BHXA 2FYZA 3H1KJ 1YYCA 1T2KC 3SWYA 2FXPA 1GK6A 2HPCA 3AE6C 1FAVA 2JR8A 2E76D 3LW5H 4ZMDA 3BCCE 3RK3C 1IFIA 4IFDK 3I5CA 3LW5J 1J2JB 5KLVK 3IAOA 3TNUB 2BEQD 5KLVD 2JJLA 2P67A 5AW3B 2FYUE 1SQQG 4MN4C 3B5NC 4P4DA 5F09A 3M0DA 4C46A 4KJMA 1PGQA 3CCQP 3H1HJ 2PAJA 1M90Q 3Q5PA 2ZJSE 1BGYE 2E76C 1BE3D 1J1EB 1NH4A 3AE1C 1FE6A 3CWBG 1LTJC 2QJPC 1HVVA 3CCSP 1QLED 3BATA 1OXZA 1OW8A 4NGPA 1N73A 4NGQA 3H1LG 3AE4C 3VGOA 3BCCJ 1JMBA 2HODA 4HB1A 1NTZG 4ZKUA 1TU3F 3RL0g 2OYIB 3S4RA 5KTBA 1DD4A 1VF5C 1EZVG 1N7SD 3F89A 2AXTH 3QH9A 4JYCA 2D2CD 2E74D 1BGYJ 3E7KA 3VMZA 2DLAA 1VQ5P 4I7ZB 3G9RA 5DJUB 1ZR2A 1EO0A 3R2PA 1OMIA 2O01N 1CZQA 1MZ9A 1N7SC 3MTUE 1YQ3C 3FXEA 2W6AA 3BI0A 3JSVC 2Q6QA 1KQGB 3M06A 1SQPK 3D70A 2PRRA 2IYPA 5DJTB 1NTKG 2D2CC 3TGUE 1FZCB 3H1HD 4BXLA 1SQPD 2E74C 2XEJA 3QWOC 3FXDA 4I2LC 1SFCD 2JBKA 1Y47A 4WY4C 2Q1KA 4EOTA 3A0BH 1QL1A 5KJ7A 1KORA 3CXHI 3RK2D 3RBZA 3BUWB 1LTSC 5KAFH 3OA7A 5KLIC 3EWKA 3KPEA 1Z56A 1CSBA 1T3JA 2FYUK 1SFCB 3PFVA 3FECA 1EDJA 3FX0A 3H1IG 5AVZB 2FYUD 1A02F 1KD1Q 1X8YA 3E1IA 3FEEA 4OH8B 3SJFA 3HD7C 3D7HA 1IK9A 1ZV8A 3TGUJ 4N78E 2BEZF 1XTCC 3RK2B 1RE4A 3AEBC 3L72G 2KI7B 2PGDA 2C0XA 2IFMA 2VRSA 1GL2A 3AEFC 4H44D 1WT6A 5AW2B 4N3YB 5CCGD 2M3EA 4W7YA 2Z4EA 1L4AD 2KLUA 2WITA 1WRGA 2KNCA 1DEEG 1YTZI 3RL0D 2YKPA 2ZVNB 1PL5A 4PD4I 2XPOA 1JM0A 1E79H 3H1KG 3VTPC 3P8MC 1HF9A 3IF4A 2KZIA 4GDOA 3KZIE 2UWJE 2XU6A 1YTZT 2GUSA 1SVFA 3L75E 2OYHB 3EFFK 1SQXE 3WUTA 3RL0B 3F9KC 2O01H 2N9YB 2CIJA 4WWIA 3M0DC 4OGQD 1NU1G 2IFNA 4I1LA 3CX5H 4DOJA 5GTHE 3CC4P 4LGDE 5H2FH 3OJAB 2RN0A 3P8CD 5K5GB 1OZHA 1OFCX 3MD0A 1L0NG 3GG2A 1M57D 1SQQE 2R3SA 5HKYA 1N73C 1URQD 2FFDA 1LWUC 3TK1A 1LJ2A 2ZXXA 1ZXGA 2R5DA 1S5LH 3VRRA 4OGQC 3S1KA 3BCCG 1OVVA 2C0WA 2XDJA 3L75J 3AE8C 4H13B 2QM8A 1MKMA 1SQXJ 3CWBE 2YNYA 1OWAA 5HKZA 3GW6A 4XFJA 5GTHH 1NAYA 1URQC 3SWFA 1HUCA 1RHZB 1FZGA 2H8PD 1FDOA 4P4BA 5AW1B 3BRTB 1NTZE 5GTIH 2XPNA 2OARA 1PPJD 2LXCB 4AYCA 1VQNP 4U3FD 1BGYG 5B66E 3GHGB 5CBNA 1Q7YQ 2B87A 1G1IA 3B8EB 1SQQJ 1BDDA 4N78D 2IBZG 1T8ZA 1RQVA 2JBJA 1YJWP 2WPRA 3V2RA 3GF3A 1AQTA 3GLMA 1GK4A 2YXQB 4NGRA 3A0HE 1KB9E 1B47A 2Y0DA 1GU4A 5APSA 1VDFA 1JO5A 2BCCD 3SFDC 3TNUA 1M1KQ 1L0LJ 2PVWA 1H0TB 3CX5D 2Q9IA 1HGVA 3IWWA 3CD6P 3G3ZA 1YIJP 2P7JA 3SSUA 1OX3A 2A06D 2NRGA 5KJ7C 1K73Q 1FJKA 2YKOA 1HH0A 1NTZJ 4OMEA 4A4CA 2A45I 2QJYC 2P2UA 1CI6B 3VRQA 3TSIA 1Y8AA 2K3RA 3H25A 1Z9EA 1FDIA 3TDKA 1ZN5A 4IFMA 3RBUA 3OAKA 2KOGA 1FS0E 1NOHA 1P84E 1IO4A 1E5WA 4GPLB 1M56D 2YMYA 1VQ6P 4IFFA 2KB7P 1RE4C 3V4QA 2WSEJ 3TGUG 2OYIA 2YIUB 2YO3A 1W5CE 4ASVA 2H89C 5AVTB 5CCHD 1EDKA 1JCDA 1SQQK 2R44A 3JC22 3L37A 1JTHB 1GTWA 1KILD 2K37A 1SQQD 1J1DC 3GMAA 1ZW0A 3FGAD 1MV8A 2FBWC 2M0BA 1FBMA 2FXMA 1P84H 1IFPA 1YBKA 2QEXP 3CWBD 1EXIA 2NPSD 1M1JC 2AXCA 1Q81Q 5CCHC 2ZT9C 1BSHA 1KYOE 1KILB 3MUDC 1RF0A 2E5TA 2DW3A 1LT1A 3H1LD 4JBZA 1NTZK 4M3LA 2E75D 1FZCA 2JDIH 1DH3A 2N1TB 4OC1A 1NTZD 1JMMA 3MIWA 3H32B 1EZVD 1HGZA 4PV1C 4W7ZA 2NPSB 1QVGO 2ZFCA 3ITKA 1EXJA 3L70E 1G2CB 5KKZB 3RGUA 4A4BA 3H6PA 2WSFJ 1LTGC 2FKWB 3CCVP 2E75C 3M9HA 3OW2O 4AUWA 4EIJA 1KYOH 3L73E 3L71G 4L73A 2KSEA 1SFCA 2J59M 1NU1E 4N6JA 3RK3D 1PP9J 2Q3IA 1JNMA 2QVAA 2QG4A 4Y28J 4DZOA 3H1JJ 1LNQA 1NTKK 2MJZA 2OR4A 4RJTA 5TISE 1L0NE 1NTKD 3L75G 2B9BA 4JYWA 3PRJA 3L35A 1SQXG 3B5ND 2JWAA 3V2PA 3V6IA 2KK7A 3PJSK 1FOSF 1VQ4P 4EYYQ 5E79E 1DD3A 1Q82Q 1P84D 3L70J 3BVHA 1OW6A 2JP3A 2N3AB 2Y1NA 3VP8A 4KHXA 2WZ7A 3L73J 3WU2H 3B5NB 2K9YA 1NU1J 2HLOA 5KAIE 4I6MC 4H0LD 3D7DA 2RMZA 3H1ID 2E76B 5CCGA 5B5EH 3VOPA 1VF5D 3O6QB 3SFEC 1NKZB 1L0NJ 2OYHA 1LTJB 2B89A 3I56P 2QJPB 5CHXA 1OIPA 2IBZE 3PT1A 3L72D 1L0LG 1BSNA 1PGJA 3D6YA 2KSJA 2OTJP 2OTKE 3AE2C 1NAFA 3OB2B 1MFZA 3Q5RA 3WMM0 4H0LC 1J1EC 1KYOD 1JUNA 2C9NY 1K05A 2YO2A 4QMAA 1N86A 1YVHA 2JEEA 3H1KD 4ZKPA 4GOEA 4WBAA 2KYVA 3EFGA 1KV4A 2QJKC 2J58A 5AW5B 5ELYA 4EDFA 4WY4D 1IFJA 1RF1B 3KHUA 1OW7A 4P44A 1N7SB 1IFMA 1NU1K 1S3JA 2XZRA 1IC2A 2H7HA 1NU1D 3M0AA 2D2CB 1YI2P 2E74B 4Y99C 3GHGA 1S5LX 1USEA 1L0NK 1VQKP 4WY4B 1ZP0C 4HYTB 1RH5B 3HD7D 4NGMA 2VKZG 1X79B 1USDA 5C39A 1FZCC 3CC2P 4KT0J 4GKGA 3JCUE 3BCCD 1NVOA 3V5BA 3T97B 1FZAA 3HPHE 1H0TA 1WMKA 1JY3N 3N7NA 1LTIC 5APXA 2IPPA 3L74E 3A7OA 1CI6A 2Y9YA 1NYHA 3BUXB 1BGYD 1JY3O 1LTBC 1OVUA 2IZ0A 4BRYB 3OP0A 1LT9C 4ASWA 2ZAEB 1LP1B 3CCRP 3V4WA 1PP9G 2YKQA 3A2AA 1FJPA 2L91A 1Z8LA 2C6PA 3NMDA 3H1JG 2P58A 3KQGA 1PV3A 3L71E 2XEIA 1EQ7A 1JTHA 4RESB 4H44B 1JY2N 1SS1A 1K04A 3CPWO 3L74J 3E1RA 5AW0B 2O1JA 3VROA 2B88A 1PFIA 3L70G 1L4AB 3HE5B 3MZWB 4MCQA 1YJ9P 2N9BA 1QVFO 3L73G 4CPGA 2GUVA 1JY2O 2W6BA 3VMXA 1KILA 3D7FA 1NJIQ 4YPCA 3U88C 1QEXA 2B4JC
chains in the Genus database with same CATH topology
1IO4A 3NTNA 2GM4A 1E5WA 5BVZA 3P8CE 2Q7CA 1T3UA 3HE4B 3MGNA 2N1TA 2E42A 2QM7A 2FYZA 1RF0C 2YMYA 1YYCA 1IFDA 3LIDA 3H32A 4IFFA 1GW3A 2KB7P 3O8ZA 1T2KC 2WT7B 3SWYA 1WJTA 5AVQB 1GK6A 1RE4C 3V4QA 2HPCA 4XE5B 5AW6B 2OYIA 1LWUB 2NPSA 1FAVA 2YO3A 1RY3A 3U1AA 3LW5H 1FOSE 2M8RA 3HUSA 1JY3P 3RK3C 1IFIA 4W80A 5AVTB 5CCHD 4IFDK 5CJ0A 3P32A 1JCDA 1SQQK 3I5CA 1G2CA 3L37A 1J2JB 1JTHB 1GTWA 1KILD 5KLVK 3M9BA 1J1DC 3TNUB 2JJLA 2P67A 5AW3B 1MV8A 1S9KE 3VYIA 3C9IA 3HD7B 3TYYA 3B5NC 1URQB 1FBMA 3M0DA 4C46A 3NFQA 2FXMA 2PAJA 1GDTA 2NPSD 1M1JC 4JYBA 1J1EB 1SFCC 1LT9B 1FZFA 1IJDB 2R5BA 1NH4A 5CCHC 2HFED 1KILB 1LTJC 1HVVA 1RF0A 3BATA 1HBWA 1OXZA 1N73A 1NTZK 4M3LA 1FZCA 5KJ7D 2M3BA 3RK2C 5BU8B 1DH3A 1FDMA 2N1TB 1JMMA 1GD2E 3MIWA 2HODA 3H32B 1LTTC 3HTKA 3CI9A 1HGZA 4ZKUA 1JY2P 2H43A 2HPCB 4W7ZA 2OYIB 2NPSB 5KTBA 3HUSB 2R3CA 2ZFCA 1N7SD 1FZBA 1G2CB 3B5NA 3V2QA 3H6PA 1LTGC 2FKWB 4JYCA 5APVA 2ZXEB 4AQRD 1DX7A 3M9HA 4AUWA 4EIJA 3VMZA 1M1JA 1SFCA 2J59M 2KLVA 1JOCA 4N6JA 5CCHA 2E43A 3RK3D 1ZR2A 2Q3IA 1ZLLA 2WSCH 1JNMA 4O9BA 3MUDA 1LTJA 3KDPB 1EO0A 1HTLC 3R2PA 1SQXK 5APWA 5CJ4A 5CCGC 2WPSA 4DZOA 1CZQA 1MZ9A 1L4AC 1N7SC 1NTKK 2MJZA 4HH2A 3BRVB 3MTUE 2Q5UA 2W6AA 2OYHC 2I1JA 4GT1A 3RL0C 3L35A 2HYNA 3B5ND 1RE3A 3L36A 3M06A 3V2PA 1SQPK 2WSEH 1N73B 2XNXA 2XV5A 1FZCB 2WWWA 1FOSF 1NWQA 5AVXB 3P7KA 5APUA 1FZEA 4C7RA 2HODB 2PP6A 1GL2C 1SFCD 3HTKB 4I2LC 4WY4C 3BVHA 1MUUA 3M9QA 2N3AB 1SQVK 1J1DB 4KHXA 3VP8A 2WZ7A 2WPQA 4EOTA 1QL1A 5KJ7A 2CPSA 4XA4A 3RK2D 3B5NB 2IX7C 2HLOA 3UIAA 1LTSC 1GW4A 4I6MC 3OA7A 4WB4A 1DEBA 3KPEA 1Z56A 1RF1A 2XKMA 1CSBA 1T3JA 1M1JB 3LIEA 5CCGA 5AW4B 2FYUK 3VOPA 1SFCB 1L0LK 1N7SA 1NKZB 5AVZB 1A02F 2OYHA 1LTJB 1NO4A 1G1JA 1X8YA 3E1IA 5CHXA 5CMZA 4OH8B 3HD7C 1IK9A 1GZLA 1ZV8A 2P1JA 1AFOA 2XPLA 4N78E 1XTCC 3RK2B 2KSJA 3N4XA 1RE4A 2C0XA 2IFMA 1NAFA 5AVSB 1H8AA 1MFZA 5APTA 2VRSA 1GL2A 3WMM0 3CLQA 1VPCA 1J1EC 4WY4A 1WT6A 3BASA 2BASA 3GHGC 3L4FA 1KFMA 1JUNA 2C9NY 5AW2B 3PP5A 1KQLA 4N3YB 4B86A 5CCGD 1ZR4A 5AW9B 4W7YA 2Z4EA 1L4AD 5AVYB 2WITA 2WSFH 2YO2A 1WRGA 1N86A 4JF7A 1YTZI 2N1TC 3VN0A 3RL0D 2YKPA 2JEEA 3T97A 1NKNA 3V2NA 4ZKPA 5AVRB 2XPOA 2FFDC 4WBAA 3VTPC 2KYVA 3EFGA 3P8MC 3HUSC 2J58A 5AVWB 1GL2D 1W2EA 5AW5B 2XU6A 2A45H 4WY4D 3U59A 1IFJA 1YTZT 1RF1B 1A02J 2GUSA 3II6A 1N7SB 1HJBA 1SVFA 1IFMA 2OYHB 1NU1K 2O1KA 2Z5IA 1H89A 3RL0B 3F9KC 2XZRA 2O01H 1IC2A 2H7HA 3M0AA 1M7LA 3M0DC 4Y99C 3GHGA 2IFNA 4I1LA 3IR9A 1NHLA 1L0NK 1GL2B 4DOJA 3RK3B 4LGDE 1SLQA 4WY4B 3OJAB 4HYTB 3P8CD 3EQ2A 3HRNA 4C7NA 3MD0A 3HD7D 2WTYA 5BU5A 1N73C 1URQD 1X79B 1FZCC 2FFDA 4GKGA 1LWUC 3TK1A 3V5BA 1FZAA 1KZUB 5AW7B 3HPHE 2R5DA 2XPPA 2LKMA 2I1KA 2C0WA 2L5GB 1JY3N 2XDJA 3N7NA 2QM8A 1LTIC 2W27A 1L4AA 3HE5A 2POHA 5APXA 1N2DC 1S9KD 2YNYA 2IPPA 1OWAA 3A7OA 1LTAC 2R32A 3M91A 2N1TD 3HPGG 1CI6A 2Z5HA 5AVVB 1URQC 3SWFA 1SQBK 1HUCA 1FZGA 2H8PD 1JCCA 1KFNA 1X9VA 1NTMK 1HWTC 5AW1B 1JY3O 1LTBC 3BRTB 1SP4A 2XPNA 2OARA 4AYCA 1IFNA 1LT9C 3GHGB 1QL2A 3V4WA 1CW5A 4LC1A 3HE4A 1G1IA 1KILC 3B8EB 3A5TA 4N78D 2YKQA 3A2AA 1T8ZA 1FJPA 2KP8A 4C7NB 3CL3D 3NMDA 2WT7A 1AQ5A 2A45G 2WPRA 1LWUA 4GIFA 3KQGA 1RE3C 3V2RA 1GK4A 4LLHA 5AW8B 2FFDB 1XTGB 1GU4A 5APSA 2HG5D 1VDFA 1EQ7A 1JTHA 2OYIC 2NPSC 4RESB 1JO5A 1LGHB 3VP9A 1JY2N 3TNUA 5AVUB 5AW0B 2Q9IA 3A3YB 1FU1A 1HGVA 2O1JA 3HD7A 1PFIA 3G3ZA 1H88A 1L4AB 3HE5B 1URQA 2P7JA 1T2KD 5KJ7C 1FJKA 2YKOA 1HH0A 2N9BA 5APQA 2C9LY 2A45I 3NXSA 2P2UA 1CI6B 1N7LA 3KYQA 2GUVA 3TSIA 1JY2O 4Y99B 1LT9A 5APYA 1Z9EA 2W6BA 3VMXA 3U1CA 1KILA 1RF1C 1ZN5A 2CPBA 4IFMA 3VMYA 3U88C 2B4JC 3OAKA 2KOGA 1GU5A 1NOHA 3IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAF A;  1IO4 A;  3NTN A;  5APV A;  5AVS B;  1H8A A;  1MFZ A;  2ZXE B;  5APT A;  2VRS A;  4AQR D;  2Q7C A;  3MGN A;  3HE4 B;  3M9H A;  4AUW A;  2E42 A;  2QM8 A;  2QM7 A;  2W27 A;  3HE5 A;  3VMZ A;  5APX A;  1YYC A;  2BAS A;  3LID A;  1S9K D;  2YNY A;  2C9N Y;  2IPP A;  1OWA A;  5AW2 B;  1JUN A;  1KQL A;  3A7O A;  3O8Z A;  2WT7 B;  1T2K C;  1WJT A;  5AVQ B;  2E43 A;  2R32 A;  1GK6 A;  4B86 A;  3M91 A;  5AW9 B;  3V4Q A;  2Q3I A;  1JNM A;  4XE5 B;  3HPG G;  5AVY B;  5AW6 B;  2YO2 A;  1CI6 A;  1FAV A;  2YO3 A;  3KDP B;  1EO0 A;  1FOS E;  2Z5H A;  5AVV B;  3SWF A;  5APW A;  1HUC A;  2WPS A;  4DZO A;  5AVT B;  3VN0 A;  1CZQ A;  3P32 A;  1HWT C;  3I5C A;  3L37 A;  5AW1 B;  2Q5U A;  3T97 A;  1SP4 A;  1J2J B;  2W6A A;  2XPN A;  1GTW A;  4AYC A;  3M9B A;  5AVR B;  2XPO A;  4GT1 A;  3TNU B;  3L35 A;  3L36 A;  3M06 A;  3VTP C;  3P8M C;  2JJL A;  2P67 A;  3V4W A;  5AW3 B;  4LC1 A;  3HE4 A;  1MV8 A;  2XV5 A;  3B8E B;  3A5T A;  1S9K E;  2WWW A;  5AVW B;  3VYI A;  5AW5 B;  1NWQ A;  3TYY A;  1FOS F;  2XU6 A;  5AVX B;  3P7K A;  3A2A A;  5APU A;  1A02 J;  2KP8 A;  4C7N B;  3M0D A;  4C46 A;  3NMD A;  2WT7 A;  3NFQ A;  4I2L C;  1HJB A;  2WPR A;  3KQG A;  1MUU A;  1GK4 A;  4JYB A;  5AW8 B;  2N3A B;  2Z5I A;  1H89 A;  4KHX A;  3F9K C;  2XZR A;  2R5B A;  2H7H A;  2WPQ A;  1GU4 A;  4EOT A;  3M0A A;  5APS A;  4RES B;  3TNU A;  1HBW A;  1OXZ A;  5AVU B;  3UIA A;  3IR9 A;  4M3L A;  5AW0 B;  4I6M C;  3A3Y B;  1DH3 A;  1SLQ A;  4HYT B;  1H88 A;  3HE5 B;  1GD2 E;  2P7J A;  1CSB A;  4C7N A;  3LIE A;  5AW4 B;  1T2K D;  3MD0 A;  3HTK A;  2N9B A;  5APQ A;  2C9L Y;  5AVZ B;  3NXS A;  2WTY A;  2P2U A;  1CI6 B;  1A02 F;  1X8Y A;  5CMZ A;  5APY A;  2R3C A;  2ZFC A;  1GZL A;  1Z9E A;  4GKG A;  2XPL A;  3VMX A;  1G2C B;  3TK1 A;  3V5B A;  3VMY A;  3HPH E;  5AW7 B;  3U88 C;  2R5D A;  3OAK A;  1GU5 A;  2B4J C;  2XPP A;  4JYC A; 
#chains in the Genus database with same CATH topology
 2GM4 A;  3G4S P;  3FF3 A;  2Q7C A;  2KXP B;  3HE4 B;  2ZVO B;  2N1T A;  4WVZ A;  2QM7 A;  3L71 J;  3TGU D;  3KZI H;  3H32 A;  3CX5 I;  3O8Z A;  1YIT P;  4XE5 B;  2W8Z A;  5AW6 B;  1LWU B;  2NPS A;  3D6Z A;  1RY3 A;  4UB8 E;  2M8R A;  1JY3 P;  4OGQ B;  1G2C A;  2O3J A;  4ZNC A;  3M9B A;  1FC2 C;  1UIX A;  1S9K E;  1W2B O;  1L0L E;  4PJ0 E;  3TYY A;  1URQ B;  3NFQ A;  2RKL A;  2H88 C;  1GDT A;  1PIX A;  4JYB A;  4H13 C;  1D7M A;  1VL2 A;  2AEM A;  3USS A;  1IJD B;  1M8O B;  1NTM E;  1R5L A;  1HBW A;  4UB8 H;  5EFW B;  1VQ7 P;  1S72 P;  4W9Y A;  5KJ7 D;  4MCS A;  5BU8 B;  1FDM A;  1K9M Q;  1K8A Q;  3FWL A;  4BPW B;  1JY2 P;  2H43 A;  1X22 A;  4PJ0 H;  3HUS B;  1U57 A;  1X0T A;  1DIP A;  4GOD A;  4NGN A;  3B5N A;  3ABV C;  1PGO A;  4RO0 A;  2ZXE B;  3BXM A;  3PH0 A;  5B66 H;  4HKZ H;  1SQB J;  4NPE A;  1BDC A;  1ZME C;  2V4H A;  2KS1 B;  2KLV A;  3O6Q A;  4OVN F;  1NTM J;  2E43 A;  2AEF A;  1ZLL A;  4DT0 A;  1LTJ A;  3KDP B;  2Y9Z A;  1SQX K;  1KQS O;  3L75 D;  1EZV I;  3S9M A;  3C1L A;  1EDI A;  1SQX D;  1BCC E;  3A0H H;  2Q5U A;  4NGT A;  1KB9 H;  2Y0C A;  4GT1 A;  2HYN A;  3L36 A;  2WSE H;  1VQP P;  2WWW A;  1NWQ A;  5AVX B;  1KB9 I;  5HKW A;  2XEG A;  3HTK B;  1GL2 C;  3PHL A;  2ZT9 D;  1MUU A;  1J1D B;  1GMJ A;  2WPQ A;  3CMA P;  5KLV E;  1SQV G;  3UIA A;  2YIU C;  2KZJ A;  4RR2 B;  1DEB A;  4PV1 D;  1RF1 A;  5F13 A;  1M1J B;  3LIE A;  3D7G A;  5AW4 B;  1L0L K;  1BCC J;  1N7S A;  1RQU A;  1BE3 E;  1L0L D;  4LQG A;  2Y0E A;  1PP9 E;  1KC8 Q;  3F5H A;  3AEE C;  1P84 I;  4JPZ B;  1GZL A;  3L74 G;  2P1J A;  1AFO A;  5D29 A;  5AXI A;  3H1J E;  4X3R A;  2K9J B;  1QX8 A;  2K1A A;  2YMK A;  3WUV A;  3OB1 B;  4WY4 A;  4PV1 B;  3BAS A;  1IK7 A;  2BAS A;  3PP5 A;  3AE3 C;  4U3F G;  5KLV J;  2WSF H;  4JZ0 A;  3B4S A;  4R4L A;  4JF7 A;  2N1T C;  3VN0 A;  3T97 A;  1NKN A;  3V2N A;  2E75 B;  1KB9 D;  2KIK A;  5AVR B;  2FFD C;  1AV1 A;  3SJX A;  1BE3 J;  5BY0 A;  1ZOY C;  5AVW B;  1W2E A;  1OVR A;  3G71 P;  3SJG A;  4IOI H;  5KKZ C;  4IL6 E;  1KYO I;  2Y1M A;  2OGU A;  1KTM A;  2O1K A;  2A06 G;  3FWN A;  4BRY A;  1M7L A;  1KN7 A;  1DE4 C;  1LP1 A;  1SQP E;  2GA1 A;  1VQO P;  2FYN C;  4TT3 H;  3RK3 B;  1SLQ A;  3EQ2 A;  3VMA A;  1S4X A;  2W83 C;  4DJG A;  1KMI Z;  4TLF A;  2LXB A;  3CCJ P;  3S9O A;  4IL6 H;  1KZU B;  5AW7 B;  4BPU B;  2XPP A;  1CX8 A;  5TIS H;  2W27 A;  1L4A A;  3HE5 A;  2POH A;  1EC5 A;  1LTA C;  3M91 A;  3HPG G;  5E79 H;  1SQP J;  2AXT E;  4D6T G;  1JCC A;  4MCR A;  4NPD A;  1HWT C;  1AJY A;  1SP4 A;  3BI1 A;  4H0L B;  1IFN A;  2WSS H;  1PP9 D;  1SQB G;  1VF5 B;  3HE4 A;  1NTM G;  3H1J D;  4OC4 A;  5KAI H;  2KP8 A;  4C7N B;  2J5U A;  3CL3 D;  1L2P A;  2A45 G;  1LWU A;  4GIF A;  4K35 A;  5AW8 B;  1XTG B;  2HG5 D;  2OYI C;  2QJK B;  4K3A A;  2G3A A;  3VP9 A;  3FED A;  2FYU J;  3L70 D;  3D71 A;  4OC5 A;  4A7P A;  4R4M A;  2C6G A;  3CXH E;  4BPX B;  1H88 A;  1URQ A;  2M5A B;  2IBZ I;  3L73 D;  5APQ A;  2C9L Y;  3AEA C;  1AA0 A;  1HJ0 A;  3A0B E;  4Y99 B;  4NGS A;  5APY A;  2SPZ A;  4I7Z C;  4NPF X;  3U1C A;  1RF1 C;  1NGM B;  5KAF E;  2XEF A;  3VMY A;  4P4I A;  1GU5 A;  1IZN B;  3NTN A;  1L0N D;  3P8C E;  1JEK A;  1T3U A;  3MGN A;  1BCC G;  1RF0 C;  1N8R Q;  1IFD A;  3LID A;  1GW3 A;  2WT7 B;  1WJT A;  5AVQ B;  1SQV E;  3U1A A;  1FOS E;  3CXH H;  3HUS A;  2JWD A;  5KLI B;  4W80 A;  5CJ0 A;  3P32 A;  3PLN A;  3Q3D A;  2HR3 A;  4MCP A;  2MKV A;  2WVR A;  2K88 A;  1VQ9 P;  4RKU J;  4PD4 E;  3VYI A;  3C9I A;  3HD7 B;  1Q2N A;  5KLV G;  2KS1 A;  4U7J A;  1Q90 D;  2OQQ A;  1YJN P;  3W67 A;  4L76 A;  1SFC C;  1FZF A;  1LT9 B;  2R5B A;  1PPJ E;  2XND H;  3S9N A;  2HFE D;  2IZ1 A;  4U3F E;  1FBV A;  2IBZ D;  1BE3 G;  3JCU H;  3Q2Y A;  1SQV J;  3KXD A;  4OWF A;  2M3B A;  3RK2 C;  2QA4 P;  2WQY C;  2OYO A;  5J3X A;  1GD2 E;  4OC0 A;  1LTT C;  3HTK A;  4UB6 E;  3CI9 A;  4OC3 A;  4BWN A;  2HPC B;  1U7J A;  4PD4 H;  2PFX A;  2KUB A;  3CCU P;  2R3C A;  2BCC E;  1FZB A;  5M1B A;  3CX5 E;  3V2Q A;  5TJH A;  5APV A;  5H2F E;  4AQR D;  1DX7 A;  2A06 E;  4GOF A;  1R5S A;  1M1J A;  2AEJ A;  1JOC A;  4H44 C;  5CCH A;  4U3F J;  3AEG C;  2WSC H;  4O9B A;  3MUD A;  3CXH D;  1HTL C;  5APW A;  5CJ4 A;  3ZNI A;  5CCG C;  2WPS A;  2WSC J;  1L4A C;  4HH2 A;  1S5L E;  3BRV B;  4UB6 H;  2OYH C;  2K9J A;  2I1J A;  3RL0 C;  1RE3 A;  1N73 B;  2XNX A;  1ZRT E;  2XV5 A;  2O01 J;  1S1C X;  3P7K A;  1VQM P;  5APU A;  1FZE A;  4C7R A;  3WUU A;  2BCC J;  3H1H G;  2HOD B;  1SQP G;  4H13 D;  2PP6 A;  3Q1M A;  2NZ2 A;  3M9Q A;  2WMM A;  1SQV K;  5GTI E;  1KIL E;  1SQV D;  2CPS A;  4XA4 A;  1S2E A;  3BUO B;  2IX7 C;  4D6T E;  4WB4 A;  3HMJ G;  1PZQ A;  4YXW H;  2XKM A;  3PTZ A;  1MFT A;  1SQB E;  1UII A;  3B71 A;  3L74 D;  4PD4 D;  2PVV A;  1NO4 A;  1G1J A;  5CMZ A;  3BUM B;  2FYU G;  4P45 A;  2XPL A;  3H1L E;  3N4X A;  3SJE A;  1AVY A;  3PLF B;  3G6E P;  4YTP C;  5AVS B;  1H8A A;  5APT A;  3AE7 C;  3CLQ A;  1VPC A;  1EZV E;  2V7Q H;  2QE7 H;  3GHG C;  3L4F A;  1KFM A;  1KQL A;  4B86 A;  1ZR4 A;  5AW9 B;  3CC7 P;  5AVY B;  2V7Q J;  3I55 P;  4D6T J;  2ZYD A;  3L71 D;  3MP7 B;  1R8E A;  2QSI A;  2QJY B;  3CWB J;  2JKV A;  3HUS C;  1GL2 D;  2A45 H;  3RK3 E;  3U59 A;  1A02 J;  2G8Y A;  3AE9 C;  3II6 A;  3H1L J;  3S9L A;  1HJB A;  4Z1M H;  2Q3E A;  2UV8 G;  2IYO A;  2Z5I A;  1H89 A;  2ZYG A;  1NTK E;  2LR2 A;  2WPV B;  4IL6 X;  3W68 A;  4L74 A;  1PGP A;  3IR9 A;  1NHL A;  1YQ4 C;  1GL2 B;  3VRP A;  3CME P;  4EI2 A;  3HRN A;  4C7N A;  1ZRT D;  2WTY A;  5BU5 A;  2KNC B;  2RH0 A;  1EDL A;  3AE5 C;  4BTF A;  1VQL P;  1VQ8 P;  2QIW A;  3MHV A;  3TF5 A;  2LKM A;  2I1K A;  2L5G B;  2W6J H;  3H1I E;  1KQF B;  1T6A A;  2I8D A;  2ZT9 B;  1N2D C;  2M5A A;  1S9K D;  1NTK J;  4P4J A;  2R32 A;  4D6T D;  2N1T D;  3Q5S A;  3C8V A;  2P10 A;  3L72 E;  2Z5H A;  5AVV B;  1SQB K;  1KFN A;  1X9V A;  1SQB D;  1NTM K;  4OC2 A;  3KAS A;  1NTM D;  2JO1 A;  3K5B A;  4HJG H;  1QL2 A;  1CW5 A;  4LC1 A;  1PPJ G;  1KIL C;  3A5T A;  3ZDM A;  4DCK A;  2IDB A;  3BUN B;  2WT7 A;  3SWK A;  1AQ5 A;  1U7M A;  2CK3 H;  1RE3 C;  3CCE P;  2C6C A;  4LLH A;  3H1K E;  2FFD B;  3H1I J;  3VRN A;  3CCM P;  5L8R J;  2NPS C;  1LGH B;  2FY8 A;  4P4E A;  2OOT A;  5AVU B;  1YHQ P;  1JB0 J;  2CBL A;  3CCL P;  2BCC G;  3A3Y B;  1FU1 A;  3HD7 A;  3GF7 A;  3L72 J;  2ITA A;  1QGK B;  4P4F A;  1AVO A;  1T2K D;  3IN6 A;  1Q86 Q;  2YXR B;  3RBX A;  3NXS A;  2QRX A;  1N7L A;  3KYQ A;  1LT9 A;  3R4Y A;  3WU2 E;  2FXO A;  2W90 A;  3H1H E;  4L75 A;  2FYN B;  2CPB A;  5CBO A;  4YXD C;  3AEC C;  1BCC D;  1GW4 A;  3IFM A;  2OTL P;  3AED C;  4JQ0 D;  1Y9B A;  2B87 B;  5BVZ A;  5B5E E;  2E5Y A;  2ZYA A;  2E42 A;  3BHX A;  2FYZ A;  3H1K J;  1YYC A;  1T2K C;  3SWY A;  2FXP A;  1GK6 A;  2HPC A;  3AE6 C;  1FAV A;  2JR8 A;  2E76 D;  3LW5 H;  4ZMD A;  3BCC E;  3RK3 C;  1IFI A;  4IFD K;  3I5C A;  3LW5 J;  1J2J B;  5KLV K;  3IAO A;  3TNU B;  2BEQ D;  5KLV D;  2JJL A;  2P67 A;  5AW3 B;  2FYU E;  1SQQ G;  4MN4 C;  3B5N C;  4P4D A;  5F09 A;  3M0D A;  4C46 A;  4KJM A;  1PGQ A;  3CCQ P;  3H1H J;  2PAJ A;  1M90 Q;  3Q5P A;  2ZJS E;  1BGY E;  2E76 C;  1BE3 D;  1J1E B;  1NH4 A;  3AE1 C;  1FE6 A;  3CWB G;  1LTJ C;  2QJP C;  1HVV A;  3CCS P;  1QLE D;  3BAT A;  1OXZ A;  1OW8 A;  4NGP A;  1N73 A;  4NGQ A;  3H1L G;  3AE4 C;  3VGO A;  3BCC J;  1JMB A;  2HOD A;  4HB1 A;  1NTZ G;  4ZKU A;  1TU3 F;  3RL0 g;  2OYI B;  3S4R A;  5KTB A;  1DD4 A;  1VF5 C;  1EZV G;  1N7S D;  3F89 A;  2AXT H;  3QH9 A;  4JYC A;  2D2C D;  2E74 D;  1BGY J;  3E7K A;  3VMZ A;  2DLA A;  1VQ5 P;  4I7Z B;  3G9R A;  5DJU B;  1ZR2 A;  1EO0 A;  3R2P A;  1OMI A;  2O01 N;  1CZQ A;  1MZ9 A;  1N7S C;  3MTU E;  1YQ3 C;  3FXE A;  2W6A A;  3BI0 A;  3JSV C;  2Q6Q A;  1KQG B;  3M06 A;  1SQP K;  3D70 A;  2PRR A;  2IYP A;  5DJT B;  1NTK G;  2D2C C;  3TGU E;  1FZC B;  3H1H D;  4BXL A;  1SQP D;  2E74 C;  2XEJ A;  3QWO C;  3FXD A;  4I2L C;  1SFC D;  2JBK A;  1Y47 A;  4WY4 C;  2Q1K A;  4EOT A;  3A0B H;  1QL1 A;  5KJ7 A;  1KOR A;  3CXH I;  3RK2 D;  3RBZ A;  3BUW B;  1LTS C;  5KAF H;  3OA7 A;  5KLI C;  3EWK A;  3KPE A;  1Z56 A;  1CSB A;  1T3J A;  2FYU K;  1SFC B;  3PFV A;  3FEC A;  1EDJ A;  3FX0 A;  3H1I G;  5AVZ B;  2FYU D;  1A02 F;  1KD1 Q;  1X8Y A;  3E1I A;  3FEE A;  4OH8 B;  3SJF A;  3HD7 C;  3D7H A;  1IK9 A;  1ZV8 A;  3TGU J;  4N78 E;  2BEZ F;  1XTC C;  3RK2 B;  1RE4 A;  3AEB C;  3L72 G;  2KI7 B;  2PGD A;  2C0X A;  2IFM A;  2VRS A;  1GL2 A;  3AEF C;  4H44 D;  1WT6 A;  5AW2 B;  4N3Y B;  5CCG D;  2M3E A;  4W7Y A;  2Z4E A;  1L4A D;  2KLU A;  2WIT A;  1WRG A;  2KNC A;  1DEE G;  1YTZ I;  3RL0 D;  2YKP A;  2ZVN B;  1PL5 A;  4PD4 I;  2XPO A;  1JM0 A;  1E79 H;  3H1K G;  3VTP C;  3P8M C;  1HF9 A;  3IF4 A;  2KZI A;  4GDO A;  3KZI E;  2UWJ E;  2XU6 A;  1YTZ T;  2GUS A;  1SVF A;  3L75 E;  2OYH B;  3EFF K;  1SQX E;  3WUT A;  3RL0 B;  3F9K C;  2O01 H;  2N9Y B;  2CIJ A;  4WWI A;  3M0D C;  4OGQ D;  1NU1 G;  2IFN A;  4I1L A;  3CX5 H;  4DOJ A;  5GTH E;  3CC4 P;  4LGD E;  5H2F H;  3OJA B;  2RN0 A;  3P8C D;  5K5G B;  1OZH A;  1OFC X;  3MD0 A;  1L0N G;  3GG2 A;  1M57 D;  1SQQ E;  2R3S A;  5HKY A;  1N73 C;  1URQ D;  2FFD A;  1LWU C;  3TK1 A;  1LJ2 A;  2ZXX A;  1ZXG A;  2R5D A;  1S5L H;  3VRR A;  4OGQ C;  3S1K A;  3BCC G;  1OVV A;  2C0W A;  2XDJ A;  3L75 J;  3AE8 C;  4H13 B;  2QM8 A;  1MKM A;  1SQX J;  3CWB E;  2YNY A;  1OWA A;  5HKZ A;  3GW6 A;  4XFJ A;  5GTH H;  1NAY A;  1URQ C;  3SWF A;  1HUC A;  1RHZ B;  1FZG A;  2H8P D;  1FDO A;  4P4B A;  5AW1 B;  3BRT B;  1NTZ E;  5GTI H;  2XPN A;  2OAR A;  1PPJ D;  2LXC B;  4AYC A;  1VQN P;  4U3F D;  1BGY G;  5B66 E;  3GHG B;  5CBN A;  1Q7Y Q;  2B87 A;  1G1I A;  3B8E B;  1SQQ J;  1BDD A;  4N78 D;  2IBZ G;  1T8Z A;  1RQV A;  2JBJ A;  1YJW P;  2WPR A;  3V2R A;  3GF3 A;  1AQT A;  3GLM A;  1GK4 A;  2YXQ B;  4NGR A;  3A0H E;  1KB9 E;  1B47 A;  2Y0D A;  1GU4 A;  5APS A;  1VDF A;  1JO5 A;  2BCC D;  3SFD C;  3TNU A;  1M1K Q;  1L0L J;  2PVW A;  1H0T B;  3CX5 D;  2Q9I A;  1HGV A;  3IWW A;  3CD6 P;  3G3Z A;  1YIJ P;  2P7J A;  3SSU A;  1OX3 A;  2A06 D;  2NRG A;  5KJ7 C;  1K73 Q;  1FJK A;  2YKO A;  1HH0 A;  1NTZ J;  4OME A;  4A4C A;  2A45 I;  2QJY C;  2P2U A;  1CI6 B;  3VRQ A;  3TSI A;  1Y8A A;  2K3R A;  3H25 A;  1Z9E A;  1FDI A;  3TDK A;  1ZN5 A;  4IFM A;  3RBU A;  3OAK A;  2KOG A;  1FS0 E;  1NOH A;  1P84 E;  1IO4 A;  1E5W A;  4GPL B;  1M56 D;  2YMY A;  1VQ6 P;  4IFF A;  2KB7 P;  1RE4 C;  3V4Q A;  2WSE J;  3TGU G;  2OYI A;  2YIU B;  2YO3 A;  1W5C E;  4ASV A;  2H89 C;  5AVT B;  5CCH D;  1EDK A;  1JCD A;  1SQQ K;  2R44 A;  3JC2 2;  3L37 A;  1JTH B;  1GTW A;  1KIL D;  2K37 A;  1SQQ D;  1J1D C;  3GMA A;  1ZW0 A;  3FGA D;  1MV8 A;  2FBW C;  2M0B A;  1FBM A;  2FXM A;  1P84 H;  1IFP A;  1YBK A;  2QEX P;  3CWB D;  1EXI A;  2NPS D;  1M1J C;  2AXC A;  1Q81 Q;  5CCH C;  2ZT9 C;  1BSH A;  1KYO E;  1KIL B;  3MUD C;  1RF0 A;  2E5T A;  2DW3 A;  1LT1 A;  3H1L D;  4JBZ A;  1NTZ K;  4M3L A;  2E75 D;  1FZC A;  2JDI H;  1DH3 A;  2N1T B;  4OC1 A;  1NTZ D;  1JMM A;  3MIW A;  3H32 B;  1EZV D;  1HGZ A;  4PV1 C;  4W7Z A;  2NPS B;  1QVG O;  2ZFC A;  3ITK A;  1EXJ A;  3L70 E;  1G2C B;  5KKZ B;  3RGU A;  4A4B A;  3H6P A;  2WSF J;  1LTG C;  2FKW B;  3CCV P;  2E75 C;  3M9H A;  3OW2 O;  4AUW A;  4EIJ A;  1KYO H;  3L73 E;  3L71 G;  4L73 A;  2KSE A;  1SFC A;  2J59 M;  1NU1 E;  4N6J A;  3RK3 D;  1PP9 J;  2Q3I A;  1JNM A;  2QVA A;  2QG4 A;  4Y28 J;  4DZO A;  3H1J J;  1LNQ A;  1NTK K;  2MJZ A;  2OR4 A;  4RJT A;  5TIS E;  1L0N E;  1NTK D;  3L75 G;  2B9B A;  4JYW A;  3PRJ A;  3L35 A;  1SQX G;  3B5N D;  2JWA A;  3V2P A;  3V6I A;  2KK7 A;  3PJS K;  1FOS F;  1VQ4 P;  4EYY Q;  5E79 E;  1DD3 A;  1Q82 Q;  1P84 D;  3L70 J;  3BVH A;  1OW6 A;  2JP3 A;  2N3A B;  2Y1N A;  3VP8 A;  4KHX A;  2WZ7 A;  3L73 J;  3WU2 H;  3B5N B;  2K9Y A;  1NU1 J;  2HLO A;  5KAI E;  4I6M C;  4H0L D;  3D7D A;  2RMZ A;  3H1I D;  2E76 B;  5CCG A;  5B5E H;  3VOP A;  1VF5 D;  3O6Q B;  3SFE C;  1NKZ B;  1L0N J;  2OYH A;  1LTJ B;  2B89 A;  3I56 P;  2QJP B;  5CHX A;  1OIP A;  2IBZ E;  3PT1 A;  3L72 D;  1L0L G;  1BSN A;  1PGJ A;  3D6Y A;  2KSJ A;  2OTJ P;  2OTK E;  3AE2 C;  1NAF A;  3OB2 B;  1MFZ A;  3Q5R A;  3WMM 0;  4H0L C;  1J1E C;  1KYO D;  1JUN A;  2C9N Y;  1K05 A;  2YO2 A;  4QMA A;  1N86 A;  1YVH A;  2JEE A;  3H1K D;  4ZKP A;  4GOE A;  4WBA A;  2KYV A;  3EFG A;  1KV4 A;  2QJK C;  2J58 A;  5AW5 B;  5ELY A;  4EDF A;  4WY4 D;  1IFJ A;  1RF1 B;  3KHU A;  1OW7 A;  4P44 A;  1N7S B;  1IFM A;  1NU1 K;  1S3J A;  2XZR A;  1IC2 A;  2H7H A;  1NU1 D;  3M0A A;  2D2C B;  1YI2 P;  2E74 B;  4Y99 C;  3GHG A;  1S5L X;  1USE A;  1L0N K;  1VQK P;  4WY4 B;  1ZP0 C;  4HYT B;  1RH5 B;  3HD7 D;  4NGM A;  2VKZ G;  1X79 B;  1USD A;  5C39 A;  1FZC C;  3CC2 P;  4KT0 J;  4GKG A;  3JCU E;  3BCC D;  1NVO A;  3V5B A;  3T97 B;  1FZA A;  3HPH E;  1H0T A;  1WMK A;  1JY3 N;  3N7N A;  1LTI C;  5APX A;  2IPP A;  3L74 E;  3A7O A;  1CI6 A;  2Y9Y A;  1NYH A;  3BUX B;  1BGY D;  1JY3 O;  1LTB C;  1OVU A;  2IZ0 A;  4BRY B;  3OP0 A;  1LT9 C;  4ASW A;  2ZAE B;  1LP1 B;  3CCR P;  3V4W A;  1PP9 G;  2YKQ A;  3A2A A;  1FJP A;  2L91 A;  1Z8L A;  2C6P A;  3NMD A;  3H1J G;  2P58 A;  3KQG A;  1PV3 A;  3L71 E;  2XEI A;  1EQ7 A;  1JTH A;  4RES B;  4H44 B;  1JY2 N;  1SS1 A;  1K04 A;  3CPW O;  3L74 J;  3E1R A;  5AW0 B;  2O1J A;  3VRO A;  2B88 A;  1PFI A;  3L70 G;  1L4A B;  3HE5 B;  3MZW B;  4MCQ A;  1YJ9 P;  2N9B A;  1QVF O;  3L73 G;  4CPG A;  2GUV A;  1JY2 O;  2W6B A;  3VMX A;  1KIL A;  3D7F A;  1NJI Q;  4YPC A;  3U88 C;  1QEX A;  2B4J C; 
#chains in the Genus database with same CATH homology
 1IO4 A;  3NTN A;  2GM4 A;  1E5W A;  5BVZ A;  3P8C E;  2Q7C A;  1T3U A;  3HE4 B;  3MGN A;  2N1T A;  2E42 A;  2QM7 A;  2FYZ A;  1RF0 C;  2YMY A;  1YYC A;  1IFD A;  3LID A;  3H32 A;  4IFF A;  1GW3 A;  2KB7 P;  3O8Z A;  1T2K C;  2WT7 B;  3SWY A;  1WJT A;  5AVQ B;  1GK6 A;  1RE4 C;  3V4Q A;  2HPC A;  4XE5 B;  5AW6 B;  2OYI A;  1LWU B;  2NPS A;  1FAV A;  2YO3 A;  1RY3 A;  3U1A A;  3LW5 H;  1FOS E;  2M8R A;  3HUS A;  1JY3 P;  3RK3 C;  1IFI A;  4W80 A;  5AVT B;  5CCH D;  4IFD K;  5CJ0 A;  3P32 A;  1JCD A;  1SQQ K;  3I5C A;  1G2C A;  3L37 A;  1J2J B;  1JTH B;  1GTW A;  1KIL D;  5KLV K;  3M9B A;  1J1D C;  3TNU B;  2JJL A;  2P67 A;  5AW3 B;  1MV8 A;  1S9K E;  3VYI A;  3C9I A;  3HD7 B;  3TYY A;  3B5N C;  1URQ B;  1FBM A;  3M0D A;  4C46 A;  3NFQ A;  2FXM A;  2PAJ A;  1GDT A;  2NPS D;  1M1J C;  4JYB A;  1J1E B;  1SFC C;  1LT9 B;  1FZF A;  1IJD B;  2R5B A;  1NH4 A;  5CCH C;  2HFE D;  1KIL B;  1LTJ C;  1HVV A;  1RF0 A;  3BAT A;  1HBW A;  1OXZ A;  1N73 A;  1NTZ K;  4M3L A;  1FZC A;  5KJ7 D;  2M3B A;  3RK2 C;  5BU8 B;  1DH3 A;  1FDM A;  2N1T B;  1JMM A;  1GD2 E;  3MIW A;  2HOD A;  3H32 B;  1LTT C;  3HTK A;  3CI9 A;  1HGZ A;  4ZKU A;  1JY2 P;  2H43 A;  2HPC B;  4W7Z A;  2OYI B;  2NPS B;  5KTB A;  3HUS B;  2R3C A;  2ZFC A;  1N7S D;  1FZB A;  1G2C B;  3B5N A;  3V2Q A;  3H6P A;  1LTG C;  2FKW B;  4JYC A;  5APV A;  2ZXE B;  4AQR D;  1DX7 A;  3M9H A;  4AUW A;  4EIJ A;  3VMZ A;  1M1J A;  1SFC A;  2J59 M;  2KLV A;  1JOC A;  4N6J A;  5CCH A;  2E43 A;  3RK3 D;  1ZR2 A;  2Q3I A;  1ZLL A;  2WSC H;  1JNM A;  4O9B A;  3MUD A;  1LTJ A;  3KDP B;  1EO0 A;  1HTL C;  3R2P A;  1SQX K;  5APW A;  5CJ4 A;  5CCG C;  2WPS A;  4DZO A;  1CZQ A;  1MZ9 A;  1L4A C;  1N7S C;  1NTK K;  2MJZ A;  4HH2 A;  3BRV B;  3MTU E;  2Q5U A;  2W6A A;  2OYH C;  2I1J A;  4GT1 A;  3RL0 C;  3L35 A;  2HYN A;  3B5N D;  1RE3 A;  3L36 A;  3M06 A;  3V2P A;  1SQP K;  2WSE H;  1N73 B;  2XNX A;  2XV5 A;  1FZC B;  2WWW A;  1FOS F;  1NWQ A;  5AVX B;  3P7K A;  5APU A;  1FZE A;  4C7R A;  2HOD B;  2PP6 A;  1GL2 C;  1SFC D;  3HTK B;  4I2L C;  4WY4 C;  3BVH A;  1MUU A;  3M9Q A;  2N3A B;  1SQV K;  1J1D B;  4KHX A;  3VP8 A;  2WZ7 A;  2WPQ A;  4EOT A;  1QL1 A;  5KJ7 A;  2CPS A;  4XA4 A;  3RK2 D;  3B5N B;  2IX7 C;  2HLO A;  3UIA A;  1LTS C;  1GW4 A;  4I6M C;  3OA7 A;  4WB4 A;  1DEB A;  3KPE A;  1Z56 A;  1RF1 A;  2XKM A;  1CSB A;  1T3J A;  1M1J B;  3LIE A;  5CCG A;  5AW4 B;  2FYU K;  3VOP A;  1SFC B;  1L0L K;  1N7S A;  1NKZ B;  5AVZ B;  1A02 F;  2OYH A;  1LTJ B;  1NO4 A;  1G1J A;  1X8Y A;  3E1I A;  5CHX A;  5CMZ A;  4OH8 B;  3HD7 C;  1IK9 A;  1GZL A;  1ZV8 A;  2P1J A;  1AFO A;  2XPL A;  4N78 E;  1XTC C;  3RK2 B;  2KSJ A;  3N4X A;  1RE4 A;  2C0X A;  2IFM A;  1NAF A;  5AVS B;  1H8A A;  1MFZ A;  5APT A;  2VRS A;  1GL2 A;  3WMM 0;  3CLQ A;  1VPC A;  1J1E C;  4WY4 A;  1WT6 A;  3BAS A;  2BAS A;  3GHG C;  3L4F A;  1KFM A;  1JUN A;  2C9N Y;  5AW2 B;  3PP5 A;  1KQL A;  4N3Y B;  4B86 A;  5CCG D;  1ZR4 A;  5AW9 B;  4W7Y A;  2Z4E A;  1L4A D;  5AVY B;  2WIT A;  2WSF H;  2YO2 A;  1WRG A;  1N86 A;  4JF7 A;  1YTZ I;  2N1T C;  3VN0 A;  3RL0 D;  2YKP A;  2JEE A;  3T97 A;  1NKN A;  3V2N A;  4ZKP A;  5AVR B;  2XPO A;  2FFD C;  4WBA A;  3VTP C;  2KYV A;  3EFG A;  3P8M C;  3HUS C;  2J58 A;  5AVW B;  1GL2 D;  1W2E A;  5AW5 B;  2XU6 A;  2A45 H;  4WY4 D;  3U59 A;  1IFJ A;  1YTZ T;  1RF1 B;  1A02 J;  2GUS A;  3II6 A;  1N7S B;  1HJB A;  1SVF A;  1IFM A;  2OYH B;  1NU1 K;  2O1K A;  2Z5I A;  1H89 A;  3RL0 B;  3F9K C;  2XZR A;  2O01 H;  1IC2 A;  2H7H A;  3M0A A;  1M7L A;  3M0D C;  4Y99 C;  3GHG A;  2IFN A;  4I1L A;  3IR9 A;  1NHL A;  1L0N K;  1GL2 B;  4DOJ A;  3RK3 B;  4LGD E;  1SLQ A;  4WY4 B;  3OJA B;  4HYT B;  3P8C D;  3EQ2 A;  3HRN A;  4C7N A;  3MD0 A;  3HD7 D;  2WTY A;  5BU5 A;  1N73 C;  1URQ D;  1X79 B;  1FZC C;  2FFD A;  4GKG A;  1LWU C;  3TK1 A;  3V5B A;  1FZA A;  1KZU B;  5AW7 B;  3HPH E;  2R5D A;  2XPP A;  2LKM A;  2I1K A;  2C0W A;  2L5G B;  1JY3 N;  2XDJ A;  3N7N A;  2QM8 A;  1LTI C;  2W27 A;  1L4A A;  3HE5 A;  2POH A;  5APX A;  1N2D C;  1S9K D;  2YNY A;  2IPP A;  1OWA A;  3A7O A;  1LTA C;  2R32 A;  3M91 A;  2N1T D;  3HPG G;  1CI6 A;  2Z5H A;  5AVV B;  1URQ C;  3SWF A;  1SQB K;  1HUC A;  1FZG A;  2H8P D;  1JCC A;  1KFN A;  1X9V A;  1NTM K;  1HWT C;  5AW1 B;  1JY3 O;  1LTB C;  3BRT B;  1SP4 A;  2XPN A;  2OAR A;  4AYC A;  1IFN A;  1LT9 C;  3GHG B;  1QL2 A;  3V4W A;  1CW5 A;  4LC1 A;  3HE4 A;  1G1I A;  1KIL C;  3B8E B;  3A5T A;  4N78 D;  2YKQ A;  3A2A A;  1T8Z A;  1FJP A;  2KP8 A;  4C7N B;  3CL3 D;  3NMD A;  2WT7 A;  1AQ5 A;  2A45 G;  2WPR A;  1LWU A;  4GIF A;  3KQG A;  1RE3 C;  3V2R A;  1GK4 A;  4LLH A;  5AW8 B;  2FFD B;  1XTG B;  1GU4 A;  5APS A;  2HG5 D;  1VDF A;  1EQ7 A;  1JTH A;  2OYI C;  2NPS C;  4RES B;  1JO5 A;  1LGH B;  3VP9 A;  1JY2 N;  3TNU A;  5AVU B;  5AW0 B;  2Q9I A;  3A3Y B;  1FU1 A;  1HGV A;  2O1J A;  3HD7 A;  1PFI A;  3G3Z A;  1H88 A;  1L4A B;  3HE5 B;  1URQ A;  2P7J A;  1T2K D;  5KJ7 C;  1FJK A;  2YKO A;  1HH0 A;  2N9B A;  5APQ A;  2C9L Y;  2A45 I;  3NXS A;  2P2U A;  1CI6 B;  1N7L A;  3KYQ A;  2GUV A;  3TSI A;  1JY2 O;  4Y99 B;  1LT9 A;  5APY A;  1Z9E A;  2W6B A;  3VMX A;  3U1C A;  1KIL A;  1RF1 C;  1ZN5 A;  2CPB A;  4IFM A;  3VMY A;  3U88 C;  2B4J C;  3OAK A;  2KOG A;  1GU5 A;  1NOH A;  3IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...