3OAKA

Crystal structure of a spn1 (iws1)-spt6 complex
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
151
structure length
151
Chain Sequence
b'GIDPFTDDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IWS1
publication title Structure and biological importance of the spn1-spt6 interaction, and its regulatory role in nucleosome binding.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 55
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3oakA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3oakA02
1G2CB 5AVYB 3M0AA 1FOSE 1CI6A 3V5BA 4GKGA 5CMZA 2Q5UA 2JJLA 2N3AB 3T97A 1S9KD 1WJTA 1FAVA 4XE5B 4AUWA 5AW6B 5APUA 1EO0A 5AVVB 4DZOA 2R3CA 1CI6B 5APYA 1T2KD 5AVTB 1GK6A 3P7KA 3UIAA 2WT7A 5APTA 5APXA 5AVUB 3A5TA 2R5BA 3TK1A 2WPRA 2W27A 3B8EB 1CZQA 3VN0A 5AVRB 4I6MC 3HE4B 2C9LY 2XPNA 2WT7B 2XZRA 3MD0A 3P32A 4LC1A 2XU6A 5AVQB 1GD2E 3U88C 4AYCA 2WTYA 1FOSF 3M0DA 1J2JB 2YO3A 5AW7B 3A7OA 3HPHE 2YNYA 4RESB 2WWWA 1JUNA 3SWFA 3NMDA 3VMYA 1GTWA 3OAKA 1MV8A 3IR9A 3P8MC 4GT1A 2WPSA 5AW9B 1NAFA 3L37A 3KDPB 1Z9EA 1H88A 2Z5IA 4C46A 4JYCA 1A02F 3HTKA 3TYYA 3LIDA 3NFQA 3VYIA 2R32A 3A3YB 5AW2B 2XPOA 3NTNA 2KP8A 4AQRD 2B4JC 2P2UA 1MFZA 1SP4A 1HWTC 4JYBA 1OWAA 1IO4A 2BASA 2P7JA 2ZFCA 5AVZB 4C7NA 2WPQA 1H8AA 2XV5A 2VRSA 3VMZA 2W6AA 2E42A 3M91A 5APVA 1GU5A 1H89A 1DH3A 3KQGA 3F9KC 2QM7A 5AW4B 1MUUA 3O8ZA 4C7NB 3NXSA 1GU4A 1KQLA 2Z5HA 3L36A 3V4WA 2ZXEB 1HBWA 3HE5A 1NWQA 2YO2A 2XPLA 2H7HA 4B86A 3M9BA 5AW0B 5AW5B 3HPGG 1OXZA 5AVXB 1SLQA 1HJBA 2E43A 3A2AA 5AW1B 4M3LA 5AVSB 1YYCA 2N9BA 1CSBA 1JNMA 3HE5B 2XPPA 4KHXA 1GZLA 2Q7CA 5AW3B 3I5CA 3V4QA 3L35A 3M9HA 5AW8B 2Q3IA 2R5DA 3TNUA 3LIEA 1HUCA 3HE4A 5APSA 1S9KE 2QM8A 5APWA 1X8YA 5AVWB 1T2KC 2IPPA 2C9NY 3M06A 4EOTA 4I2LC 3TNUB 3MGNA 3VTPC 3VMXA 1A02J 1GK4A 5APQA 2P67A 4HYTB
chains in the Genus database with same CATH superfamily
3PT1A 2H8PD 4AUWA 3VGOA 3R2PA 1RE4A 3H1HJ 2W6BA 3P7KA 3E1IA 4OWFA 1EZVI 1SFCC 5AVUB 1RE3C 4DOJA 2WPRA 1SQVG 1NTKK 2WVRA 1SQQG 1FZAA 3L74J 1IC2A 3P32A 4IFDK 4AYCA 2ZVNB 3HD7C 4OC3A 3BUXB 1LWUB 2WSFJ 3CCVP 3HUSB 3CC4P 3D7GA 3K5BA 2HPCA 4L73A 3IN6A 4U3FG 1VQ4P 1NAYA 2QJYC 3D7FA 4AQRD 3OB1B 1P84E 2ZJSE 4JYBA 1G1JA 2CBLA 3L75D 1T6AA 5AVZB 3B71A 1L0NG 1LTAC 5KJ7D 4BRYA 4C7NA 3S9MA 3IF4A 3M91A 1M8OB 1GW3A 3SFEC 1NTZD 5AW4B 3O8ZA 2R3SA 2K9JB 4NGSA 3CX5I 1D7MA 4IL6E 2L5GB 1EXIA 1BCCE 2E43A 2B88A 1SQBK 3L71E 3PJSK 1JNMA 3HE5B 1KMIZ 1ZXGA 3EFGA 3RK3B 3TGUG 1SQVJ 1SQQJ 1IFDA 2NPSA 2G8YA 2Y0CA 2ITAA 3BATA 1YQ3C 2R5DA 1EDKA 4P4EA 2HR3A 1N73A 2QJPB 4EOTA 3CXHE 3L73G 3CPWO 4N6JA 3VTPC 1EDLA 3SFDC 1FBVA 3L75G 4U3FJ 4XE5B 1EO0A 4DZOA 5CHXA 1L0NJ 1S72P 1JY3O 1NTZG 4R4MA 1PV3A 1T3UA 2QG4A 3RK3C 1X22A 1NU1E 2WTYA 5CBOA 4W9YA 3SWFA 2JP3A 3L4FA 3G9RA 1PPJE 2XKMA 3KDPB 3TGUJ 3B5NB 3P8CD 1N7LA 5E79H 2E5TA 3HMJG 2Z4EA 2B9BA 3L73J 3L72D 1DH3A 1K73Q 1SQPE 3H1JG 1U7MA 3L75J 4PD4E 1HTLC 2CIJA 3LW5H 2BCCD 3FWLA 4I7ZB 1NTZJ 4GIFA 2RMZA 3H32A 3I5CA 1N86A 3LW5J 1SS1A 1GDTA 3H1LE 3LIEA 1Z56A 2ZT9D 3B5NC 1KB9D 2QM8A 2KNCA 4W7YA 2E75D 1KYOH 2IPPA 3VMXA 5KAFH 1FZGA 2WITA 4HYTB 1G1IA 3KASA 1G2CB 1IJDB 4LGDE 3CLQA 2Q5UA 2JJLA 2K1AA 2XEJA 4K35A 1FZCA 4WY4B 3D6ZA 1RQUA 2IZ0A 1FAVA 2R3CA 1NKNA 1T2KD 1NTMD 1VQMP 5TISH 5M1BA 5CCGD 5AVRB 3HE4B 1LGHB 2D2CC 4HH2A 3H1JJ 1SQBD 3HPHE 4OMEA 1JUNA 5KKZC 3VMYA 3A0HH 3IR9A 4MCQA 2IBZD 4PJ0H 2KYVA 2R32A 3SJGA 1VF5B 1L4AA 5CCHC 3RBZA 2O01H 4H44B 2H88C 1K9MQ 2HPCB 3VRNA 2C6GA 2FY8A 4R4LA 1ZV8A 3KZIE 4BRYB 2BEQD 4C7NB 3CWBG 1AVOA 1L0LK 2DW3A 1NTMG 1HBWA 1FZBA 5AXIA 3RBUA 5EFWB 5DJTB 1UIIA 2N9BA 2CPBA 3F89A 4NPFX 4WWIA 3E7KA 5GTIE 3FXEA 1X79B 3L35A 5B5EH 4HB1A 4OC5A 2Y0DA 3C9IA 1NH4A 3AE1C 3CMEP 4H44C 5APQA 1W2EA 2M5AA 1VQ9P 2WPVB 1EZVD 4P4FA 5L8RJ 2M8RA 4WVZA 1BE3E 1YJ9P 3RK2D 4GODA 2YMYA 3RGUA 1PZQA 1N7SD 2Q3EA 4I1LA 5D29A 1GL2B 4ASVA 2QVAA 1BGYE 1Y47A 3CWBJ 5AVQB 3CD6P 3P8CE 1S3JA 1NTMJ 1DIPA 3JSVC 1KYOI 4D6TD 1QVGO 3BUOB 1K05A 1RY3A 2NPSC 1SQQK 2YIUB 4NGMA 1IFPA 1URQC 3TYYA 3KYQA 3OW2O 2IDBA 1N73C 1S5LE 4H0LD 2P2UA 1SP4A 1ZLLA 3S9LA 2BASA 1NTKE 2FFDB 1X9VA 1EZVG 1IK7A 3BVHA 3CL3D 3CCJP 3O6QA 1SVFA 2AXTE 2N9YB 1NWQA 1L0NK 2YO2A 1LTJB 5AW5B 2P58A 2K3RA 3E1RA 3BCCG 1OW7A 3BUMB 3S9OA 2Y9ZA 4KT0J 1IFIA 2VKZG 2BEZF 1R5LA 2A06E 5KTBA 2WZ7A 1PFIA 2KNCB 4NGNA 1U7JA 2MJZA 5F09A 1CI6A 3V5BA 4PV1C 2JDIH 3T97A 3L70G 1K8AQ 3VP9A 3CCQP 3SWKA 4MN4C 1RF1C 1FZCB 2R5BA 1WMKA 2IBZE 1L0LD 1USEA 1GD2E 4OGQD 2KSJA 2WSEH 2Q6QA 1NTZK 2AEJA 2FYUD 1E79H 4GT1A 4JF7A 3GW6A 1NAFA 3L37A 1JB0J 4JYCA 3BCCJ 1H0TA 3USSA 2E74B 1M90Q 4TT3H 5AW2B 2GA1A 5KAIH 3BUNB 1J1EB 1L4AB 1M57D 1R5SA 5HKYA 1H8AA 3BXMA 2W6AA 2E42A 5APVA 3G6EP 2LXBA 1W5CE 5HKWA 1FZCC 4OH8B 4BTFA 1KQLA 4N78E 3CMAP 3M9BA 3L70J 4P4DA 1B47A 1L0LG 3FEDA 1S4XA 1GZLA 2K88A 5AW3B 2FYUG 5AW8B 2Q3IA 2POHA 1HUCA 1FDIA 2KIKA 3CCUP 2LR2A 4L74A 1SQQD 1KV4A 3L71G 3W67A 1J1EC 1SFCB 3MZWB 4ZKPA 1JY2P 3SJEA 2GUSA 1YIJP 3RL0D 3CCMP 1JO5A 3AE8C 5AW6B 2M5AB 3HD7B 1P84H 4D6TE 1DEBA 1DEEG 1KILE 3AECC 3GF7A 1L0ND 1JCDA 3F5HA 3PLFB 5KLVG 3A7OA 2KLUA 4HKZH 5KJ7C 4X3RA 1LP1B 3SJFA 4RO0A 1L0LJ 4IL6H 1JMBA 1RF0A 3D7DA 1SQXE 2CK3H 1PGPA 3B4SA 1AJYA 3FWNA 2FYUJ 2B4JC 3TDKA 1PIXA 3H1KD 3TGUD 1PPJG 3L71J 1OVRA 3CCLP 3AEBC 5B66E 4IL6X 3CXHH 1H89A 1Y9BA 3L73D 1KILA 5AW0B 1W2BO 1OXZA 5HKZA 2KXPB 1M1KQ 1R8EA 1IZNB 1TU3F 1Q90D 1HGVA 3ZDMA 4Z1MH 1NTMK 1SQPG 3C1LA 3QH9A 3IWWA 2E76D 5APSA 5KLVJ 2MKVA 1AV1A 1OZHA 2K37A 4I2LC 3MTUE 3Q3DA 4GDOA 5AVYB 1FDMA 3H1KG 3H1HE 3H1LG 2N3AB 1WRGA 3FEEA 3RL0g 2C6CA 2C0WA 1FU1A 2FXPA 3WU2E 4OC2A 4GPLB 3AE3C 1CI6B 4BPWB 1URQA 3WUTA 3T97B 3L74E 2Y1MA 1GW4A 3CC7P 2LXCB 2OOTA 3SJXA 2XPNA 4H13D 3MP7B 2KB7P 3EFFK 3ITKA 1LNQA 4PD4H 5J3XA 3NMDA 2OQQA 3VRRA 2XDJA 4ZNCA 2WPSA 3H1JD 3Q5PA 2Z5IA 3HTKA 2KS1A 4LQGA 4MCPA 1USDA 2V7QH 1YTZT 3H1ID 1MFZA 1S2EA 3H25A 4UB6E 2JBKA 2KZIA 1AQ5A 1P84I 3D71A 2ZFCA 3OJAB 1KQSO 3AE9C 1AFOA 3H1KJ 3Q5SA 2ZT9C 1NGMB 2E75C 3HPGG 1SQVE 4RJTA 1SQQE 3OP0A 2FXMA 2AEMA 1UIXA 2H89C 1VQPP 3V6IA 3S9NA 1RF1A 2ZYGA 1T2KC 2WSSH 3G4SP 4NGPA 4U3FE 3CXHI 3H1IG 3GHGC 2D2CB 3A0BE 1S9KD 4Y28J 1OW6A 1QL1A 1N8RQ 5KKZB 3A5TA 3RK3D 1PP9D 3B8EB 4DJGA 1JY3P 4MCRA 3KZIH 1KTMA 3HRNA 1YJNP 1HF9A 4YXWH 1YI2P 3TGUE 3VP8A 3AE6C 3CWBD 4JBZA 1A02F 3OB2B 1JCCA 3EQ2A 4NPEA 5GTIH 3AEAC 1OVUA 3CCEP 4WB4A 1VQKP 1JTHA 4OC4A 2IYPA 3M0DC 3V2RA 1YQ4C 2PFXA 3L75E 2ZVOB 3H1IJ 2UV8G 2IZ1A 3NXSA 1GU4A 3BI0A 1NTZE 4PD4I 3D70A 1SLQA 1PP9G 1EXJA 2K9YA 1CSBA 1KILB 4IFFA 3AE5C 2QA4P 2QE7H 3GLMA 1IK9A 1ZP0C 2J59M 3RK2C 4JQ0D 1X8YA 1RF0C 2O01J 4JYWA 3MUDA 3M06A 2OGUA 3W68A 1NOHA 4QMAA 2FYUK 3FECA 2QEXP 2I1JA 1ZR4A 5KJ7A 1S5LH 1VDFA 5KLIC 1FJPA 2E5YA 2NPSB 2I1KA 3H1JE 1ZRTD 5ELYA 1URQB 1KILC 2HODA 1NHLA 4H0LC 1N73B 2O01N 2O3JA 2AXTH 1JY2N 1PP9J 5H2FE 1YBKA 3P8MC 2OR4A 1LTSC 3BRTB 3PH0A 3H6PA 4K3AA 1H88A 1U57A 3FXDA 2FYNC 4LLHA 5KLVK 4WY4D 2KS1B 1HWTC 3BCCD 1AA0A 2OYIA 3VMZA 2XEFA 1DD4A 1NU1K 1J1DC 3L72E 2ZXEB 3V4WA 3ZNIA 1VQ7P 2H43A 1JOCA 2W6JH 3U1AA 2BCCE 1ZOYC 3L70D 3CX5D 1VF5D 4YTPC 1QVFO 3IFMA 3ABVC 4PV1B 4H44D 1S9KE 2C9NY 2Y0EA 3JC22 1RF1B 1KB9E 1LWUA 3QWOC 2KOGA 3HUSA 4A7PA 1SQPK 5TJHA 5CMZA 1BDCA 4OGQC 3PP5A 2QSIA 3UIAA 3C8VA 3H32B 2W27A 1NTME 4NGQA 5BY0A 2XZRA 3MD0A 1NJIQ 1HVVA 2CPSA 1J2JB 1FBMA 1HH0A 1EDIA 1NVOA 4EIJA 1HJ0A 1SQBE 1KORA 2OYHA 1Z9EA 4C46A 3Q2YA 2JO1A 4EYYQ 3A3YB 2B89A 1MFTA 2J5UA 2HFED 5GTHE 1YJWP 4OC0A 2WPQA 2VRSA 1GL2D 1JTHB 2SPZA 2QJKC 1BCCD 3L71D 5CCGA 2WSEJ 4ZMDA 1HJBA 3PLNA 3GHGA 1KB9I 1X0TA 1YYCA 2XPPA 4BPUB 4KHXA 1RH5B 4ASWA 2O1JA 2PVWA 1Q81Q 1AQTA 2GUVA 1Q86Q 4XA4A 3RL0C 3CXHD 5AVWB 1EC5A 1KQFB 3S1KA 3BHXA 1A02J 4P45A 3CCSP 4ZKUA 2OTKE 4W7ZA 5KLVD 1FOSE 5DJUB 1VQNP 3VROA 3GG2A 1FC2C 3WMM0 1VQ8P 5APUA 1MKMA 2IFNA 2PRRA 1EZVE 4A4BA 2HYNA 1BCCG 2OYOA 1NU1D 2IBZI 1T3JA 5B66H 4RR2B 1PPJD 3M0DA 1KN7A 1LT1A 2O1KA 2WWWA 3BCCE 1MV8A 2W8ZA 2A45H 2P10A 3NFQA 1OX3A 3AEDC 3MUDC 3CCRP 5F13A 4C7RA 2P7JA 2J58A 2JR8A 4UB8E 4MCSA 2JWDA 3IAOA 1SQPD 4NPDA 1JY3N 1GU5A 3KQGA 2QM7A 1LT9A 3L70E 1BSNA 3CX5E 3L36A 1K04A 1N7SA 2E76C 1FDOA 1NU1G 3WU2H 4KJMA 3VRPA 3H1LD 4NGTA 1BCCJ 3VOPA 2E74D 3SSUA 3KXDA 3HE4A 4BPXB 1KZUB 1Q2NA 2WSFH 1L4AD 3GF3A 3CC2P 2YKOA 1VPCA 3I56P 1NKZB 1L2PA 1QL2A 2OARA 2C6PA 3O6QB 5K5GB 1IFMA 1N2DC 4H13C 4P4IA 2M3BA 2N1TD 1NO4A 2OYIC 2JEEA 5APYA 2YMKA 4UB6H 4P44A 1KFMA 2B87A 1CZQA 3WUVA 4BXLA 3VN0A 3JCUE 3U88C 2KUBA 1L0LE 1NU1J 2KZJA 2QIWA 1SFCD 2FYUE 1Z8LA 2KK7A 1M7LA 2XPOA 1KYOD 2OYHB 3AE4C 4DT0A 2ZT9B 3HD7D 1LWUC 2E75B 3V2PA 3HUSC 1RQVA 2XV5A 1EDJA 4BWNA 2OTJP 2OTLP 2WQYC 4TLFA 2XPLA 1AVYA 1SQPJ 5AVXB 3A0BH 1XTGB 4M3LA 1H0TB 1JMMA 1OIPA 2A45I 3N7NA 3GHGB 5KLVE 1GL2A 3V4QA 2JBJA 3M9HA 4L76A 3AEFC 3AEGC 2V7QJ 3TNUA 1WT6A 5APWA 2OYHC 2FKWB 5BU5A 3H1LJ 2YXQB 2YKQA 1YITP 2W90A 3S4RA 4YXDC 3BASA 1BE3D 1YTZI 1ZR2A 2R44A 3KHUA 4EDFA 1QX8A 1LJ2A 3PRJA 1PGJA 2QJPC 1YHQP 1BGYD 5APTA 5APXA 3TK1A 2G3AA 3BUWB 3FX0A 4WBAA 2FFDA 5CCGC 1ZMEC 1CW5A 4LC1A 1FOSF 1LTGC 2IX7C 2XEGA 1M1JA 2YNYA 4RESB 2HLOA 1L0NE 1LTJA 3BRVB 3LIDA 3VYIA 1QLED 1NTKD 3RBXA 2AXCA 1ZN5A 1BE3G 3H1KE 2RH0A 3TF5A 1BGYG 3RK2B 4B86A 1LT9B 3WUUA 3R4YA 3FF3A 4RKUJ 1N7SB 3L73E 1SQXK 4IOIH 1PL5A 5E79E 4YPCA 1PGOA 1LTIC 2FBWC 2A06D 2ZXXA 3L72G 4JZ0A 1HGZA 3VMAA 2Y1NA 4I7ZC 3FGAD 5KLIB 3MGNA 1FS0E 4GOFA 2BCCG 5H2FH 1NTKG 1FE6A 4H0LB 2GM4A 1DX7A 1WJTA 1PGQA 3B5ND 4Y99B 5AVVB 4HJGH 1OMIA 5AVTB 3D6YA 2WT7A 1LT9C 1BE3J 4EI2A 3GMAA 4P4JA 1E5WA 3V2NA 1N7SC 2FYZA 2C9LY 1KC8Q 2FYNB 1OW8A 2XU6A 2NZ2A 1DE4C 2B87B 4WY4C 3PFVA 1KYOE 4L75A 1BGYJ 2RN0A 2Y9YA 2N1TA 1IFNA 1EQ7A 5KAFE 1GTWA 2YXRB 3OAKA 3M9QA 1RE4C 2A06G 3AE7C 4IFMA 4OC1A 2HG5D 2KP8A 2I8DA 1J1DB 2D2CD 3L72J 1OWAA 3I55P 5TISE 1IO4A 3H1IE 2IYOA 4Y99C 2V4HA 1SQBG 4N78D 2BCCJ 2W83C 1S5LX 2AEFA 4P4BA 1KB9H 1MUUA 1NTKJ 1RE3A 1SFCA 1VF5C 2IBZG 1DD3A 5CCHD 2IFMA 3A0HE 3MHVA 2H7HA 1XTCC 4PJ0E 5AW1B 3HTKB 3SWYA 3HD7A 5AVSB 1JEKA 1M56D 1OVVA 2YKPA 4OVNF 3PHLA 1QEXA 4OGQB 1MZ9A 3U1CA 1OFCX 3AE2C 1Q7YQ 3TNUB 2UWJE 1LTTC 1GK4A 1LP1A 3N4XA 3MIWA 3G3ZA 3M0AA 4GKGA 2Q9IA 1SQVK 1T8ZA 1BDDA 3BI1A 2P1JA 1GK6A 1KFNA 5GTHH 2PVVA 1KILD 1SQBJ 5B5EE 1FZFA 3RK3E 1PP9E 4W80A 2YO3A 3AEEC 1JM0A 1SQXD 2LKMA 1FJKA 3U59A 1GL2C 4A4CA 1M1JB 1BSHA 1FZEA 3Q5RA 2QJKB 2ZYDA 3CWBE 1QGKB 1CX8A 1VL2A 1VQOP 2K9JA 2YIUC 2NPSD 3EWKA 4D6TG 1URQD 2WMMA 4NGRA 2Z5HA 4O9BA 2M3EA 1P84D 1NYHA 3HE5A 3RL0B 2KI7B 3II6A 1GMJA 2XNDH 5CBNA 2FFDC 3D7HA 2WSCH 1IFJA 5BU8B 1ZW0A 5CJ0A 1M1JC 1VQLP 1SQXG 4DCKA 2PGDA 1LTJC 1JY2O 1KD1Q 2WSCJ 4GOEA 1VQ5P 2XEIA 2FXOA 5C39A 3H1HD 2JWAA 2C0XA 2ZYAA 4XFJA 3L74D 3KPEA 4U7JA 2KSEA 2XNXA 2A45G 4D6TJ 4UB8H 4I6MC 4N3YB 2WT7B 1S1CX 2PAJA 4PV1D 1ZRTE 5AW7B 3CX5H 3PTZA 3V2QA 3B5NA 3G71P 1KQGB 5AW9B 3TSIA 2N1TB 2M0BA 3NTNA 2Q1KA 1SQXJ 2E76B 2L91A 3H1HG 3OA7A 3CI9A 1RHZB 1LTBC 2HODB 5CJ4A 1Q82Q 2E74C 3F9KC 3L74G 1Y8AA 1SQVD 4CPGA 2PP6A 4JPZB 1L4AC 3A2AA 3VRQA 5KAIE 5BVZA 2DLAA 2Q7CA 2RKLA 2ZAEB 4H13B 2N1TC 4PD4D 3Q1MA 2KLVA 3JCUH 4U3FD 2OYIB 5CCHA 2QRXA 1G2CA 1VQ6P 2JKVA 2NRGA 4WY4A 2P67A 1YVHA 2QJYB
chains in the Genus database with same CATH topology
1YTZI 2FYUK 1ZR2A 2MJZA 1CI6A 3V5BA 2I1JA 1ZR4A 5KJ7A 3T97A 2H8PD 4AUWA 3R2PA 1VDFA 1FJPA 1RE4A 3VP9A 2W6BA 3P7KA 3E1IA 1RF1C 5APTA 5APXA 1SFCC 5AVUB 1FZCB 1RE3C 2R5BA 3TK1A 2NPSB 2WPRA 4DOJA 2I1KA 1NTKK 1FZAA 4WBAA 1URQB 2FFDA 1KILC 5CCGC 2HODA 1CW5A 1IC2A 1NHLA 3P32A 4LC1A 1N73B 1GD2E 4IFDK 4AYCA 1FOSF 2KSJA 2WSEH 1LTGC 2IX7C 3HD7C 1M1JA 1NTZK 2YNYA 4RESB 2HLOA 1LWUB 1JY2N 4GT1A 3P8MC 1LTJA 3HUSB 4JF7A 3BRVB 1LTSC 1NAFA 3L37A 3BRTB 3H6PA 1H88A 4JYCA 3LIDA 3VYIA 5AW2B 2HPCA 4LLHA 5KLVK 4AQRD 4WY4D 1HWTC 4JYBA 1G1JA 1J1EB 1ZN5A 5AVZB 1L4AB 1LTAC 5KJ7D 4C7NA 2OYIA 1H8AA 3VMZA 2W6AA 2E42A 3M91A 5APVA 1GW3A 1FZCC 4OH8B 5AW4B 1NU1K 3O8ZA 1J1DC 1KQLA 4N78E 3V4WA 2ZXEB 3RK2B 4B86A 1LT9B 2L5GB 3M9BA 2H43A 2E43A 1SQBK 1N7SB 1JOCA 1SQXK 3HE5B 1JNMA 3U1AA 3EFGA 3RK3B 1GZLA 1IFDA 5AW3B 2NPSA 1LTIC 3IFMA 3BATA 5AW8B 2Q3IA 2R5DA 2POHA 1HUCA 1S9KE 1HGZA 1N73A 2C9NY 4EOTA 3MGNA 1RF1B 4N6JA 1J1EC 3VTPC 1LWUA 1SFCB 4ZKPA 2KOGA 1JY2P 3HUSA 1SQPK 2GUSA 5CMZA 2GM4A 1DX7A 3PP5A 3RL0D 1JO5A 1WJTA 3B5ND 4XE5B 5AW6B 1EO0A 3HD7B 4Y99B 5AVVB 4DZOA 5CHXA 5AVTB 3UIAA 1JY3O 2WT7A 1DEBA 1LT9C 3H32B 2W27A 1E5WA 1T3UA 3V2NA 1N7SC 2FYZA 2C9LY 3RK3C 2XZRA 3MD0A 2XU6A 1JCDA 4WY4C 1HVVA 2CPSA 2WTYA 1J2JB 1FBMA 1HH0A 3A7OA 2N1TA 1IFNA 3SWFA 1EQ7A 5KJ7C 1GTWA 3OAKA 3L4FA 4EIJA 2XKMA 3KDPB 3M9QA 1RF0A 2OYHA 1Z9EA 1RE4C 4C46A 4IFMA 3B5NB 2HG5D 3A3YB 3P8CD 2KP8A 1N7LA 1J1DB 2B4JC 2HFED 1OWAA 1IO4A 2Z4EA 4Y99C 2WPQA 2VRSA 1GL2D 4N78D 1JTHB 1H89A 1DH3A 1SFCA 1MUUA 1RE3A 5CCHD 1HTLC 2IFMA 1KILA 5CCGA 3LW5H 2H7HA 1XTCC 5AW0B 1OXZA 1HJBA 3GHGA 5AW1B 3HTKB 3SWYA 3HD7A 4GIFA 1YYCA 5AVSB 2XPPA 4KHXA 1HGVA 3H32A 3I5CA 1N86A 2O1JA 1NTMK 2YKPA 2GUVA 1GDTA 4XA4A 3RL0C 3LIEA 1Z56A 1MZ9A 3B5NC 3U1CA 5APSA 2QM8A 4W7YA 5AVWB 2IPPA 4I2LC 3TNUB 1LTTC 3MTUE 3VMXA 1A02J 1GK4A 3N4XA 2WITA 1FZGA 4ZKUA 4W7ZA 4HYTB 1G1IA 1G2CB 1IJDB 3G3ZA 3MIWA 3M0AA 4LGDE 5AVYB 1FOSE 1FDMA 3CLQA 4GKGA 2Q5UA 2JJLA 2N3AB 3WMM0 1WRGA 1FZCA 4WY4B 2Q9IA 2C0WA 1SQVK 1FAVA 1FU1A 1T8ZA 5APUA 2IFNA 2P1JA 2R3CA 1NKNA 1CI6B 1T2KD 1URQA 1GK6A 1KFNA 2HYNA 1KILD 5CCGD 1GW4A 5AVRB 1FZFA 1T3JA 3HE4B 2XPNA 1LGHB 4HH2A 2KB7P 3M0DA 4W80A 2YO3A 3HPHE 2O1KA 2WWWA 1JUNA 3NMDA 2LKMA 3VMYA 1FJKA 3U59A 1MV8A 3IR9A 2XDJA 2WPSA 1GL2C 1M1JB 2A45H 2Z5IA 1FZEA 3HTKA 3NFQA 2KYVA 2R32A 1L4AA 5CCHC 1YTZT 1MFZA 2O01H 4C7RA 1AQ5A 2P7JA 2ZFCA 2HPCB 2J58A 3OJAB 2NPSD 1JY3N 1GU5A 1ZV8A 1URQD 3KQGA 1AFOA 2QM7A 1LT9A 4C7NB 1L0LK 2Z5HA 4O9BA 3L36A 1HBWA 1N7SA 3HE5A 1FZBA 3RL0B 1NOHA 3II6A 3HPGG 2FFDC 2N9BA 2FXMA 2WSCH 2CPBA 1IFJA 5BU8B 3VOPA 1X79B 5CJ0A 3L35A 1M1JC 1RF1A 3HE4A 1LTJC 1JY2O 1KZUB 3C9IA 2WSFH 1NH4A 1T2KC 1L4AD 2YKOA 1VPCA 1NKZB 5APQA 1W2EA 1QL2A 2OARA 3GHGC 1IFMA 1N2DC 2C0XA 2M3BA 2N1TD 1NO4A 2M8RA 1S9KD 2OYIC 3RK2D 1QL1A 2JEEA 2YMYA 5APYA 3KPEA 1N7SD 4I1LA 3A5TA 1KFMA 3RK3D 1GL2B 2XNXA 3B8EB 1CZQA 2A45G 3VN0A 4I6MC 4N3YB 2WT7B 5AVQB 1JY3P 3U88C 2PAJA 3P8CE 5AW7B 3HRNA 3V2QA 3VP8A 1RY3A 3B5NA 2NPSC 5AW9B 1SFCD 1SQQK 3TSIA 1A02F 2N1TB 1URQC 3TYYA 3KYQA 1JCCA 3EQ2A 1M7LA 1N73C 2XPOA 3NTNA 2OYHB 2P2UA 1SP4A 3HD7D 4WB4A 1ZLLA 1LWUC 2BASA 1JTHA 3V2PA 3HUSC 3OA7A 3CI9A 3M0DC 3V2RA 2XV5A 2FFDB 1X9VA 1LTBC 2HODB 5CJ4A 3F9KC 3BVHA 3NXSA 1GU4A 3CL3D 2PP6A 1SVFA 1NWQA 1L0NK 2YO2A 2XPLA 1LTJB 5AW5B 1L4AC 5AVXB 1SLQA 1XTGB 3A2AA 4M3LA 1JMMA 1CSBA 1KILB 2A45I 4IFFA 3N7NA 5BVZA 2Q7CA 3GHGB 1GL2A 3V4QA 1IFIA 2N1TC 3M9HA 1IK9A 2KLVA 3TNUA 1WT6A 2J59M 3RK2C 5APWA 1X8YA 2OYIB 1RF0C 5CCHA 2OYHC 2FKWB 5BU5A 3MUDA 1G2CA 2YKQA 3M06A 5KTBA 2WZ7A 1PFIA 4WY4A 2P67A 3BASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2C B;  5AVY B;  3M0A A;  1FOS E;  1CI6 A;  3V5B A;  4GKG A;  5CMZ A;  2Q5U A;  2JJL A;  2N3A B;  3T97 A;  1S9K D;  1WJT A;  1FAV A;  4XE5 B;  4AUW A;  5AW6 B;  5APU A;  1EO0 A;  5AVV B;  4DZO A;  2R3C A;  1CI6 B;  5APY A;  1T2K D;  5AVT B;  1GK6 A;  3P7K A;  3UIA A;  2WT7 A;  5APT A;  5APX A;  5AVU B;  3A5T A;  2R5B A;  3TK1 A;  2WPR A;  2W27 A;  3B8E B;  1CZQ A;  3VN0 A;  5AVR B;  4I6M C;  3HE4 B;  2C9L Y;  2XPN A;  2WT7 B;  2XZR A;  3MD0 A;  3P32 A;  4LC1 A;  2XU6 A;  5AVQ B;  1GD2 E;  3U88 C;  4AYC A;  2WTY A;  1FOS F;  3M0D A;  1J2J B;  2YO3 A;  5AW7 B;  3A7O A;  3HPH E;  2YNY A;  4RES B;  2WWW A;  1JUN A;  3SWF A;  3NMD A;  3VMY A;  1GTW A;  3OAK A;  1MV8 A;  3IR9 A;  3P8M C;  4GT1 A;  2WPS A;  5AW9 B;  1NAF A;  3L37 A;  3KDP B;  1Z9E A;  1H88 A;  2Z5I A;  4C46 A;  4JYC A;  1A02 F;  3HTK A;  3TYY A;  3LID A;  3NFQ A;  3VYI A;  2R32 A;  3A3Y B;  5AW2 B;  2XPO A;  3NTN A;  2KP8 A;  4AQR D;  2B4J C;  2P2U A;  1MFZ A;  1SP4 A;  1HWT C;  4JYB A;  1OWA A;  1IO4 A;  2BAS A;  2P7J A;  2ZFC A;  5AVZ B;  4C7N A;  2WPQ A;  1H8A A;  2XV5 A;  2VRS A;  3VMZ A;  2W6A A;  2E42 A;  3M91 A;  5APV A;  1GU5 A;  1H89 A;  1DH3 A;  3KQG A;  3F9K C;  2QM7 A;  5AW4 B;  1MUU A;  3O8Z A;  4C7N B;  3NXS A;  1GU4 A;  1KQL A;  2Z5H A;  3L36 A;  3V4W A;  2ZXE B;  1HBW A;  3HE5 A;  1NWQ A;  2YO2 A;  2XPL A;  2H7H A;  4B86 A;  3M9B A;  5AW0 B;  5AW5 B;  3HPG G;  1OXZ A;  5AVX B;  1SLQ A;  1HJB A;  2E43 A;  3A2A A;  5AW1 B;  4M3L A;  5AVS B;  1YYC A;  2N9B A;  1CSB A;  1JNM A;  3HE5 B;  2XPP A;  4KHX A;  1GZL A;  2Q7C A;  5AW3 B;  3I5C A;  3V4Q A;  3L35 A;  3M9H A;  5AW8 B;  2Q3I A;  2R5D A;  3TNU A;  3LIE A;  1HUC A;  3HE4 A;  5APS A;  1S9K E;  2QM8 A;  5APW A;  1X8Y A;  5AVW B;  1T2K C;  2IPP A;  2C9N Y;  3M06 A;  4EOT A;  4I2L C;  3TNU B;  3MGN A;  3VTP C;  3VMX A;  1A02 J;  1GK4 A;  5APQ A;  2P67 A;  4HYT B; 
#chains in the Genus database with same CATH topology
 3PT1 A;  2H8P D;  4AUW A;  3VGO A;  3R2P A;  1RE4 A;  3H1H J;  2W6B A;  3P7K A;  3E1I A;  4OWF A;  1EZV I;  1SFC C;  5AVU B;  1RE3 C;  4DOJ A;  2WPR A;  1SQV G;  1NTK K;  2WVR A;  1SQQ G;  1FZA A;  3L74 J;  1IC2 A;  3P32 A;  4IFD K;  4AYC A;  2ZVN B;  3HD7 C;  4OC3 A;  3BUX B;  1LWU B;  2WSF J;  3CCV P;  3HUS B;  3CC4 P;  3D7G A;  3K5B A;  2HPC A;  4L73 A;  3IN6 A;  4U3F G;  1VQ4 P;  1NAY A;  2QJY C;  3D7F A;  4AQR D;  3OB1 B;  1P84 E;  2ZJS E;  4JYB A;  1G1J A;  2CBL A;  3L75 D;  1T6A A;  5AVZ B;  3B71 A;  1L0N G;  1LTA C;  5KJ7 D;  4BRY A;  4C7N A;  3S9M A;  3IF4 A;  3M91 A;  1M8O B;  1GW3 A;  3SFE C;  1NTZ D;  5AW4 B;  3O8Z A;  2R3S A;  2K9J B;  4NGS A;  3CX5 I;  1D7M A;  4IL6 E;  2L5G B;  1EXI A;  1BCC E;  2E43 A;  2B88 A;  1SQB K;  3L71 E;  3PJS K;  1JNM A;  3HE5 B;  1KMI Z;  1ZXG A;  3EFG A;  3RK3 B;  3TGU G;  1SQV J;  1SQQ J;  1IFD A;  2NPS A;  2G8Y A;  2Y0C A;  2ITA A;  3BAT A;  1YQ3 C;  2R5D A;  1EDK A;  4P4E A;  2HR3 A;  1N73 A;  2QJP B;  4EOT A;  3CXH E;  3L73 G;  3CPW O;  4N6J A;  3VTP C;  1EDL A;  3SFD C;  1FBV A;  3L75 G;  4U3F J;  4XE5 B;  1EO0 A;  4DZO A;  5CHX A;  1L0N J;  1S72 P;  1JY3 O;  1NTZ G;  4R4M A;  1PV3 A;  1T3U A;  2QG4 A;  3RK3 C;  1X22 A;  1NU1 E;  2WTY A;  5CBO A;  4W9Y A;  3SWF A;  2JP3 A;  3L4F A;  3G9R A;  1PPJ E;  2XKM A;  3KDP B;  3TGU J;  3B5N B;  3P8C D;  1N7L A;  5E79 H;  2E5T A;  3HMJ G;  2Z4E A;  2B9B A;  3L73 J;  3L72 D;  1DH3 A;  1K73 Q;  1SQP E;  3H1J G;  1U7M A;  3L75 J;  4PD4 E;  1HTL C;  2CIJ A;  3LW5 H;  2BCC D;  3FWL A;  4I7Z B;  1NTZ J;  4GIF A;  2RMZ A;  3H32 A;  3I5C A;  1N86 A;  3LW5 J;  1SS1 A;  1GDT A;  3H1L E;  3LIE A;  1Z56 A;  2ZT9 D;  3B5N C;  1KB9 D;  2QM8 A;  2KNC A;  4W7Y A;  2E75 D;  1KYO H;  2IPP A;  3VMX A;  5KAF H;  1FZG A;  2WIT A;  4HYT B;  1G1I A;  3KAS A;  1G2C B;  1IJD B;  4LGD E;  3CLQ A;  2Q5U A;  2JJL A;  2K1A A;  2XEJ A;  4K35 A;  1FZC A;  4WY4 B;  3D6Z A;  1RQU A;  2IZ0 A;  1FAV A;  2R3C A;  1NKN A;  1T2K D;  1NTM D;  1VQM P;  5TIS H;  5M1B A;  5CCG D;  5AVR B;  3HE4 B;  1LGH B;  2D2C C;  4HH2 A;  3H1J J;  1SQB D;  3HPH E;  4OME A;  1JUN A;  5KKZ C;  3VMY A;  3A0H H;  3IR9 A;  4MCQ A;  2IBZ D;  4PJ0 H;  2KYV A;  2R32 A;  3SJG A;  1VF5 B;  1L4A A;  5CCH C;  3RBZ A;  2O01 H;  4H44 B;  2H88 C;  1K9M Q;  2HPC B;  3VRN A;  2C6G A;  2FY8 A;  4R4L A;  1ZV8 A;  3KZI E;  4BRY B;  2BEQ D;  4C7N B;  3CWB G;  1AVO A;  1L0L K;  2DW3 A;  1NTM G;  1HBW A;  1FZB A;  5AXI A;  3RBU A;  5EFW B;  5DJT B;  1UII A;  2N9B A;  2CPB A;  3F89 A;  4NPF X;  4WWI A;  3E7K A;  5GTI E;  3FXE A;  1X79 B;  3L35 A;  5B5E H;  4HB1 A;  4OC5 A;  2Y0D A;  3C9I A;  1NH4 A;  3AE1 C;  3CME P;  4H44 C;  5APQ A;  1W2E A;  2M5A A;  1VQ9 P;  2WPV B;  1EZV D;  4P4F A;  5L8R J;  2M8R A;  4WVZ A;  1BE3 E;  1YJ9 P;  3RK2 D;  4GOD A;  2YMY A;  3RGU A;  1PZQ A;  1N7S D;  2Q3E A;  4I1L A;  5D29 A;  1GL2 B;  4ASV A;  2QVA A;  1BGY E;  1Y47 A;  3CWB J;  5AVQ B;  3CD6 P;  3P8C E;  1S3J A;  1NTM J;  1DIP A;  3JSV C;  1KYO I;  4D6T D;  1QVG O;  3BUO B;  1K05 A;  1RY3 A;  2NPS C;  1SQQ K;  2YIU B;  4NGM A;  1IFP A;  1URQ C;  3TYY A;  3KYQ A;  3OW2 O;  2IDB A;  1N73 C;  1S5L E;  4H0L D;  2P2U A;  1SP4 A;  1ZLL A;  3S9L A;  2BAS A;  1NTK E;  2FFD B;  1X9V A;  1EZV G;  1IK7 A;  3BVH A;  3CL3 D;  3CCJ P;  3O6Q A;  1SVF A;  2AXT E;  2N9Y B;  1NWQ A;  1L0N K;  2YO2 A;  1LTJ B;  5AW5 B;  2P58 A;  2K3R A;  3E1R A;  3BCC G;  1OW7 A;  3BUM B;  3S9O A;  2Y9Z A;  4KT0 J;  1IFI A;  2VKZ G;  2BEZ F;  1R5L A;  2A06 E;  5KTB A;  2WZ7 A;  1PFI A;  2KNC B;  4NGN A;  1U7J A;  2MJZ A;  5F09 A;  1CI6 A;  3V5B A;  4PV1 C;  2JDI H;  3T97 A;  3L70 G;  1K8A Q;  3VP9 A;  3CCQ P;  3SWK A;  4MN4 C;  1RF1 C;  1FZC B;  2R5B A;  1WMK A;  2IBZ E;  1L0L D;  1USE A;  1GD2 E;  4OGQ D;  2KSJ A;  2WSE H;  2Q6Q A;  1NTZ K;  2AEJ A;  2FYU D;  1E79 H;  4GT1 A;  4JF7 A;  3GW6 A;  1NAF A;  3L37 A;  1JB0 J;  4JYC A;  3BCC J;  1H0T A;  3USS A;  2E74 B;  1M90 Q;  4TT3 H;  5AW2 B;  2GA1 A;  5KAI H;  3BUN B;  1J1E B;  1L4A B;  1M57 D;  1R5S A;  5HKY A;  1H8A A;  3BXM A;  2W6A A;  2E42 A;  5APV A;  3G6E P;  2LXB A;  1W5C E;  5HKW A;  1FZC C;  4OH8 B;  4BTF A;  1KQL A;  4N78 E;  3CMA P;  3M9B A;  3L70 J;  4P4D A;  1B47 A;  1L0L G;  3FED A;  1S4X A;  1GZL A;  2K88 A;  5AW3 B;  2FYU G;  5AW8 B;  2Q3I A;  2POH A;  1HUC A;  1FDI A;  2KIK A;  3CCU P;  2LR2 A;  4L74 A;  1SQQ D;  1KV4 A;  3L71 G;  3W67 A;  1J1E C;  1SFC B;  3MZW B;  4ZKP A;  1JY2 P;  3SJE A;  2GUS A;  1YIJ P;  3RL0 D;  3CCM P;  1JO5 A;  3AE8 C;  5AW6 B;  2M5A B;  3HD7 B;  1P84 H;  4D6T E;  1DEB A;  1DEE G;  1KIL E;  3AEC C;  3GF7 A;  1L0N D;  1JCD A;  3F5H A;  3PLF B;  5KLV G;  3A7O A;  2KLU A;  4HKZ H;  5KJ7 C;  4X3R A;  1LP1 B;  3SJF A;  4RO0 A;  1L0L J;  4IL6 H;  1JMB A;  1RF0 A;  3D7D A;  1SQX E;  2CK3 H;  1PGP A;  3B4S A;  1AJY A;  3FWN A;  2FYU J;  2B4J C;  3TDK A;  1PIX A;  3H1K D;  3TGU D;  1PPJ G;  3L71 J;  1OVR A;  3CCL P;  3AEB C;  5B66 E;  4IL6 X;  3CXH H;  1H89 A;  1Y9B A;  3L73 D;  1KIL A;  5AW0 B;  1W2B O;  1OXZ A;  5HKZ A;  2KXP B;  1M1K Q;  1R8E A;  1IZN B;  1TU3 F;  1Q90 D;  1HGV A;  3ZDM A;  4Z1M H;  1NTM K;  1SQP G;  3C1L A;  3QH9 A;  3IWW A;  2E76 D;  5APS A;  5KLV J;  2MKV A;  1AV1 A;  1OZH A;  2K37 A;  4I2L C;  3MTU E;  3Q3D A;  4GDO A;  5AVY B;  1FDM A;  3H1K G;  3H1H E;  3H1L G;  2N3A B;  1WRG A;  3FEE A;  3RL0 g;  2C6C A;  2C0W A;  1FU1 A;  2FXP A;  3WU2 E;  4OC2 A;  4GPL B;  3AE3 C;  1CI6 B;  4BPW B;  1URQ A;  3WUT A;  3T97 B;  3L74 E;  2Y1M A;  1GW4 A;  3CC7 P;  2LXC B;  2OOT A;  3SJX A;  2XPN A;  4H13 D;  3MP7 B;  2KB7 P;  3EFF K;  3ITK A;  1LNQ A;  4PD4 H;  5J3X A;  3NMD A;  2OQQ A;  3VRR A;  2XDJ A;  4ZNC A;  2WPS A;  3H1J D;  3Q5P A;  2Z5I A;  3HTK A;  2KS1 A;  4LQG A;  4MCP A;  1USD A;  2V7Q H;  1YTZ T;  3H1I D;  1MFZ A;  1S2E A;  3H25 A;  4UB6 E;  2JBK A;  2KZI A;  1AQ5 A;  1P84 I;  3D71 A;  2ZFC A;  3OJA B;  1KQS O;  3AE9 C;  1AFO A;  3H1K J;  3Q5S A;  2ZT9 C;  1NGM B;  2E75 C;  3HPG G;  1SQV E;  4RJT A;  1SQQ E;  3OP0 A;  2FXM A;  2AEM A;  1UIX A;  2H89 C;  1VQP P;  3V6I A;  3S9N A;  1RF1 A;  2ZYG A;  1T2K C;  2WSS H;  3G4S P;  4NGP A;  4U3F E;  3CXH I;  3H1I G;  3GHG C;  2D2C B;  3A0B E;  1S9K D;  4Y28 J;  1OW6 A;  1QL1 A;  1N8R Q;  5KKZ B;  3A5T A;  3RK3 D;  1PP9 D;  3B8E B;  4DJG A;  1JY3 P;  4MCR A;  3KZI H;  1KTM A;  3HRN A;  1YJN P;  1HF9 A;  4YXW H;  1YI2 P;  3TGU E;  3VP8 A;  3AE6 C;  3CWB D;  4JBZ A;  1A02 F;  3OB2 B;  1JCC A;  3EQ2 A;  4NPE A;  5GTI H;  3AEA C;  1OVU A;  3CCE P;  4WB4 A;  1VQK P;  1JTH A;  4OC4 A;  2IYP A;  3M0D C;  3V2R A;  1YQ4 C;  2PFX A;  3L75 E;  2ZVO B;  3H1I J;  2UV8 G;  2IZ1 A;  3NXS A;  1GU4 A;  3BI0 A;  1NTZ E;  4PD4 I;  3D70 A;  1SLQ A;  1PP9 G;  1EXJ A;  2K9Y A;  1CSB A;  1KIL B;  4IFF A;  3AE5 C;  2QA4 P;  2QE7 H;  3GLM A;  1IK9 A;  1ZP0 C;  2J59 M;  3RK2 C;  4JQ0 D;  1X8Y A;  1RF0 C;  2O01 J;  4JYW A;  3MUD A;  3M06 A;  2OGU A;  3W68 A;  1NOH A;  4QMA A;  2FYU K;  3FEC A;  2QEX P;  2I1J A;  1ZR4 A;  5KJ7 A;  1S5L H;  1VDF A;  5KLI C;  1FJP A;  2E5Y A;  2NPS B;  2I1K A;  3H1J E;  1ZRT D;  5ELY A;  1URQ B;  1KIL C;  2HOD A;  1NHL A;  4H0L C;  1N73 B;  2O01 N;  2O3J A;  2AXT H;  1JY2 N;  1PP9 J;  5H2F E;  1YBK A;  3P8M C;  2OR4 A;  1LTS C;  3BRT B;  3PH0 A;  3H6P A;  4K3A A;  1H88 A;  1U57 A;  3FXD A;  2FYN C;  4LLH A;  5KLV K;  4WY4 D;  2KS1 B;  1HWT C;  3BCC D;  1AA0 A;  2OYI A;  3VMZ A;  2XEF A;  1DD4 A;  1NU1 K;  1J1D C;  3L72 E;  2ZXE B;  3V4W A;  3ZNI A;  1VQ7 P;  2H43 A;  1JOC A;  2W6J H;  3U1A A;  2BCC E;  1ZOY C;  3L70 D;  3CX5 D;  1VF5 D;  4YTP C;  1QVF O;  3IFM A;  3ABV C;  4PV1 B;  4H44 D;  1S9K E;  2C9N Y;  2Y0E A;  3JC2 2;  1RF1 B;  1KB9 E;  1LWU A;  3QWO C;  2KOG A;  3HUS A;  4A7P A;  1SQP K;  5TJH A;  5CMZ A;  1BDC A;  4OGQ C;  3PP5 A;  2QSI A;  3UIA A;  3C8V A;  3H32 B;  2W27 A;  1NTM E;  4NGQ A;  5BY0 A;  2XZR A;  3MD0 A;  1NJI Q;  1HVV A;  2CPS A;  1J2J B;  1FBM A;  1HH0 A;  1EDI A;  1NVO A;  4EIJ A;  1HJ0 A;  1SQB E;  1KOR A;  2OYH A;  1Z9E A;  4C46 A;  3Q2Y A;  2JO1 A;  4EYY Q;  3A3Y B;  2B89 A;  1MFT A;  2J5U A;  2HFE D;  5GTH E;  1YJW P;  4OC0 A;  2WPQ A;  2VRS A;  1GL2 D;  1JTH B;  2SPZ A;  2QJK C;  1BCC D;  3L71 D;  5CCG A;  2WSE J;  4ZMD A;  1HJB A;  3PLN A;  3GHG A;  1KB9 I;  1X0T A;  1YYC A;  2XPP A;  4BPU B;  4KHX A;  1RH5 B;  4ASW A;  2O1J A;  2PVW A;  1Q81 Q;  1AQT A;  2GUV A;  1Q86 Q;  4XA4 A;  3RL0 C;  3CXH D;  5AVW B;  1EC5 A;  1KQF B;  3S1K A;  3BHX A;  1A02 J;  4P45 A;  3CCS P;  4ZKU A;  2OTK E;  4W7Z A;  5KLV D;  1FOS E;  5DJU B;  1VQN P;  3VRO A;  3GG2 A;  1FC2 C;  3WMM 0;  1VQ8 P;  5APU A;  1MKM A;  2IFN A;  2PRR A;  1EZV E;  4A4B A;  2HYN A;  1BCC G;  2OYO A;  1NU1 D;  2IBZ I;  1T3J A;  5B66 H;  4RR2 B;  1PPJ D;  3M0D A;  1KN7 A;  1LT1 A;  2O1K A;  2WWW A;  3BCC E;  1MV8 A;  2W8Z A;  2A45 H;  2P10 A;  3NFQ A;  1OX3 A;  3AED C;  3MUD C;  3CCR P;  5F13 A;  4C7R A;  2P7J A;  2J58 A;  2JR8 A;  4UB8 E;  4MCS A;  2JWD A;  3IAO A;  1SQP D;  4NPD A;  1JY3 N;  1GU5 A;  3KQG A;  2QM7 A;  1LT9 A;  3L70 E;  1BSN A;  3CX5 E;  3L36 A;  1K04 A;  1N7S A;  2E76 C;  1FDO A;  1NU1 G;  3WU2 H;  4KJM A;  3VRP A;  3H1L D;  4NGT A;  1BCC J;  3VOP A;  2E74 D;  3SSU A;  3KXD A;  3HE4 A;  4BPX B;  1KZU B;  1Q2N A;  2WSF H;  1L4A D;  3GF3 A;  3CC2 P;  2YKO A;  1VPC A;  3I56 P;  1NKZ B;  1L2P A;  1QL2 A;  2OAR A;  2C6P A;  3O6Q B;  5K5G B;  1IFM A;  1N2D C;  4H13 C;  4P4I A;  2M3B A;  2N1T D;  1NO4 A;  2OYI C;  2JEE A;  5APY A;  2YMK A;  4UB6 H;  4P44 A;  1KFM A;  2B87 A;  1CZQ A;  3WUV A;  4BXL A;  3VN0 A;  3JCU E;  3U88 C;  2KUB A;  1L0L E;  1NU1 J;  2KZJ A;  2QIW A;  1SFC D;  2FYU E;  1Z8L A;  2KK7 A;  1M7L A;  2XPO A;  1KYO D;  2OYH B;  3AE4 C;  4DT0 A;  2ZT9 B;  3HD7 D;  1LWU C;  2E75 B;  3V2P A;  3HUS C;  1RQV A;  2XV5 A;  1EDJ A;  4BWN A;  2OTJ P;  2OTL P;  2WQY C;  4TLF A;  2XPL A;  1AVY A;  1SQP J;  5AVX B;  3A0B H;  1XTG B;  4M3L A;  1H0T B;  1JMM A;  1OIP A;  2A45 I;  3N7N A;  3GHG B;  5KLV E;  1GL2 A;  3V4Q A;  2JBJ A;  3M9H A;  4L76 A;  3AEF C;  3AEG C;  2V7Q J;  3TNU A;  1WT6 A;  5APW A;  2OYH C;  2FKW B;  5BU5 A;  3H1L J;  2YXQ B;  2YKQ A;  1YIT P;  2W90 A;  3S4R A;  4YXD C;  3BAS A;  1BE3 D;  1YTZ I;  1ZR2 A;  2R44 A;  3KHU A;  4EDF A;  1QX8 A;  1LJ2 A;  3PRJ A;  1PGJ A;  2QJP C;  1YHQ P;  1BGY D;  5APT A;  5APX A;  3TK1 A;  2G3A A;  3BUW B;  3FX0 A;  4WBA A;  2FFD A;  5CCG C;  1ZME C;  1CW5 A;  4LC1 A;  1FOS F;  1LTG C;  2IX7 C;  2XEG A;  1M1J A;  2YNY A;  4RES B;  2HLO A;  1L0N E;  1LTJ A;  3BRV B;  3LID A;  3VYI A;  1QLE D;  1NTK D;  3RBX A;  2AXC A;  1ZN5 A;  1BE3 G;  3H1K E;  2RH0 A;  3TF5 A;  1BGY G;  3RK2 B;  4B86 A;  1LT9 B;  3WUU A;  3R4Y A;  3FF3 A;  4RKU J;  1N7S B;  3L73 E;  1SQX K;  4IOI H;  1PL5 A;  5E79 E;  4YPC A;  1PGO A;  1LTI C;  2FBW C;  2A06 D;  2ZXX A;  3L72 G;  4JZ0 A;  1HGZ A;  3VMA A;  2Y1N A;  4I7Z C;  3FGA D;  5KLI B;  3MGN A;  1FS0 E;  4GOF A;  2BCC G;  5H2F H;  1NTK G;  1FE6 A;  4H0L B;  2GM4 A;  1DX7 A;  1WJT A;  1PGQ A;  3B5N D;  4Y99 B;  5AVV B;  4HJG H;  1OMI A;  5AVT B;  3D6Y A;  2WT7 A;  1LT9 C;  1BE3 J;  4EI2 A;  3GMA A;  4P4J A;  1E5W A;  3V2N A;  1N7S C;  2FYZ A;  2C9L Y;  1KC8 Q;  2FYN B;  1OW8 A;  2XU6 A;  2NZ2 A;  1DE4 C;  2B87 B;  4WY4 C;  3PFV A;  1KYO E;  4L75 A;  1BGY J;  2RN0 A;  2Y9Y A;  2N1T A;  1IFN A;  1EQ7 A;  5KAF E;  1GTW A;  2YXR B;  3OAK A;  3M9Q A;  1RE4 C;  2A06 G;  3AE7 C;  4IFM A;  4OC1 A;  2HG5 D;  2KP8 A;  2I8D A;  1J1D B;  2D2C D;  3L72 J;  1OWA A;  3I55 P;  5TIS E;  1IO4 A;  3H1I E;  2IYO A;  4Y99 C;  2V4H A;  1SQB G;  4N78 D;  2BCC J;  2W83 C;  1S5L X;  2AEF A;  4P4B A;  1KB9 H;  1MUU A;  1NTK J;  1RE3 A;  1SFC A;  1VF5 C;  2IBZ G;  1DD3 A;  5CCH D;  2IFM A;  3A0H E;  3MHV A;  2H7H A;  1XTC C;  4PJ0 E;  5AW1 B;  3HTK B;  3SWY A;  3HD7 A;  5AVS B;  1JEK A;  1M56 D;  1OVV A;  2YKP A;  4OVN F;  3PHL A;  1QEX A;  4OGQ B;  1MZ9 A;  3U1C A;  1OFC X;  3AE2 C;  1Q7Y Q;  3TNU B;  2UWJ E;  1LTT C;  1GK4 A;  1LP1 A;  3N4X A;  3MIW A;  3G3Z A;  3M0A A;  4GKG A;  2Q9I A;  1SQV K;  1T8Z A;  1BDD A;  3BI1 A;  2P1J A;  1GK6 A;  1KFN A;  5GTH H;  2PVV A;  1KIL D;  1SQB J;  5B5E E;  1FZF A;  3RK3 E;  1PP9 E;  4W80 A;  2YO3 A;  3AEE C;  1JM0 A;  1SQX D;  2LKM A;  1FJK A;  3U59 A;  1GL2 C;  4A4C A;  1M1J B;  1BSH A;  1FZE A;  3Q5R A;  2QJK B;  2ZYD A;  3CWB E;  1QGK B;  1CX8 A;  1VL2 A;  1VQO P;  2K9J A;  2YIU C;  2NPS D;  3EWK A;  4D6T G;  1URQ D;  2WMM A;  4NGR A;  2Z5H A;  4O9B A;  2M3E A;  1P84 D;  1NYH A;  3HE5 A;  3RL0 B;  2KI7 B;  3II6 A;  1GMJ A;  2XND H;  5CBN A;  2FFD C;  3D7H A;  2WSC H;  1IFJ A;  5BU8 B;  1ZW0 A;  5CJ0 A;  1M1J C;  1VQL P;  1SQX G;  4DCK A;  2PGD A;  1LTJ C;  1JY2 O;  1KD1 Q;  2WSC J;  4GOE A;  1VQ5 P;  2XEI A;  2FXO A;  5C39 A;  3H1H D;  2JWA A;  2C0X A;  2ZYA A;  4XFJ A;  3L74 D;  3KPE A;  4U7J A;  2KSE A;  2XNX A;  2A45 G;  4D6T J;  4UB8 H;  4I6M C;  4N3Y B;  2WT7 B;  1S1C X;  2PAJ A;  4PV1 D;  1ZRT E;  5AW7 B;  3CX5 H;  3PTZ A;  3V2Q A;  3B5N A;  3G71 P;  1KQG B;  5AW9 B;  3TSI A;  2N1T B;  2M0B A;  3NTN A;  2Q1K A;  1SQX J;  2E76 B;  2L91 A;  3H1H G;  3OA7 A;  3CI9 A;  1RHZ B;  1LTB C;  2HOD B;  5CJ4 A;  1Q82 Q;  2E74 C;  3F9K C;  3L74 G;  1Y8A A;  1SQV D;  4CPG A;  2PP6 A;  4JPZ B;  1L4A C;  3A2A A;  3VRQ A;  5KAI E;  5BVZ A;  2DLA A;  2Q7C A;  2RKL A;  2ZAE B;  4H13 B;  2N1T C;  4PD4 D;  3Q1M A;  2KLV A;  3JCU H;  4U3F D;  2OYI B;  5CCH A;  2QRX A;  1G2C A;  1VQ6 P;  2JKV A;  2NRG A;  4WY4 A;  2P67 A;  1YVH A;  2QJY B; 
#chains in the Genus database with same CATH homology
 1YTZ I;  2FYU K;  1ZR2 A;  2MJZ A;  1CI6 A;  3V5B A;  2I1J A;  1ZR4 A;  5KJ7 A;  3T97 A;  2H8P D;  4AUW A;  3R2P A;  1VDF A;  1FJP A;  1RE4 A;  3VP9 A;  2W6B A;  3P7K A;  3E1I A;  1RF1 C;  5APT A;  5APX A;  1SFC C;  5AVU B;  1FZC B;  1RE3 C;  2R5B A;  3TK1 A;  2NPS B;  2WPR A;  4DOJ A;  2I1K A;  1NTK K;  1FZA A;  4WBA A;  1URQ B;  2FFD A;  1KIL C;  5CCG C;  2HOD A;  1CW5 A;  1IC2 A;  1NHL A;  3P32 A;  4LC1 A;  1N73 B;  1GD2 E;  4IFD K;  4AYC A;  1FOS F;  2KSJ A;  2WSE H;  1LTG C;  2IX7 C;  3HD7 C;  1M1J A;  1NTZ K;  2YNY A;  4RES B;  2HLO A;  1LWU B;  1JY2 N;  4GT1 A;  3P8M C;  1LTJ A;  3HUS B;  4JF7 A;  3BRV B;  1LTS C;  1NAF A;  3L37 A;  3BRT B;  3H6P A;  1H88 A;  4JYC A;  3LID A;  3VYI A;  5AW2 B;  2HPC A;  4LLH A;  5KLV K;  4AQR D;  4WY4 D;  1HWT C;  4JYB A;  1G1J A;  1J1E B;  1ZN5 A;  5AVZ B;  1L4A B;  1LTA C;  5KJ7 D;  4C7N A;  2OYI A;  1H8A A;  3VMZ A;  2W6A A;  2E42 A;  3M91 A;  5APV A;  1GW3 A;  1FZC C;  4OH8 B;  5AW4 B;  1NU1 K;  3O8Z A;  1J1D C;  1KQL A;  4N78 E;  3V4W A;  2ZXE B;  3RK2 B;  4B86 A;  1LT9 B;  2L5G B;  3M9B A;  2H43 A;  2E43 A;  1SQB K;  1N7S B;  1JOC A;  1SQX K;  3HE5 B;  1JNM A;  3U1A A;  3EFG A;  3RK3 B;  1GZL A;  1IFD A;  5AW3 B;  2NPS A;  1LTI C;  3IFM A;  3BAT A;  5AW8 B;  2Q3I A;  2R5D A;  2POH A;  1HUC A;  1S9K E;  1HGZ A;  1N73 A;  2C9N Y;  4EOT A;  3MGN A;  1RF1 B;  4N6J A;  1J1E C;  3VTP C;  1LWU A;  1SFC B;  4ZKP A;  2KOG A;  1JY2 P;  3HUS A;  1SQP K;  2GUS A;  5CMZ A;  2GM4 A;  1DX7 A;  3PP5 A;  3RL0 D;  1JO5 A;  1WJT A;  3B5N D;  4XE5 B;  5AW6 B;  1EO0 A;  3HD7 B;  4Y99 B;  5AVV B;  4DZO A;  5CHX A;  5AVT B;  3UIA A;  1JY3 O;  2WT7 A;  1DEB A;  1LT9 C;  3H32 B;  2W27 A;  1E5W A;  1T3U A;  3V2N A;  1N7S C;  2FYZ A;  2C9L Y;  3RK3 C;  2XZR A;  3MD0 A;  2XU6 A;  1JCD A;  4WY4 C;  1HVV A;  2CPS A;  2WTY A;  1J2J B;  1FBM A;  1HH0 A;  3A7O A;  2N1T A;  1IFN A;  3SWF A;  1EQ7 A;  5KJ7 C;  1GTW A;  3OAK A;  3L4F A;  4EIJ A;  2XKM A;  3KDP B;  3M9Q A;  1RF0 A;  2OYH A;  1Z9E A;  1RE4 C;  4C46 A;  4IFM A;  3B5N B;  2HG5 D;  3A3Y B;  3P8C D;  2KP8 A;  1N7L A;  1J1D B;  2B4J C;  2HFE D;  1OWA A;  1IO4 A;  2Z4E A;  4Y99 C;  2WPQ A;  2VRS A;  1GL2 D;  4N78 D;  1JTH B;  1H89 A;  1DH3 A;  1SFC A;  1MUU A;  1RE3 A;  5CCH D;  1HTL C;  2IFM A;  1KIL A;  5CCG A;  3LW5 H;  2H7H A;  1XTC C;  5AW0 B;  1OXZ A;  1HJB A;  3GHG A;  5AW1 B;  3HTK B;  3SWY A;  3HD7 A;  4GIF A;  1YYC A;  5AVS B;  2XPP A;  4KHX A;  1HGV A;  3H32 A;  3I5C A;  1N86 A;  2O1J A;  1NTM K;  2YKP A;  2GUV A;  1GDT A;  4XA4 A;  3RL0 C;  3LIE A;  1Z56 A;  1MZ9 A;  3B5N C;  3U1C A;  5APS A;  2QM8 A;  4W7Y A;  5AVW B;  2IPP A;  4I2L C;  3TNU B;  1LTT C;  3MTU E;  3VMX A;  1A02 J;  1GK4 A;  3N4X A;  2WIT A;  1FZG A;  4ZKU A;  4W7Z A;  4HYT B;  1G1I A;  1G2C B;  1IJD B;  3G3Z A;  3MIW A;  3M0A A;  4LGD E;  5AVY B;  1FOS E;  1FDM A;  3CLQ A;  4GKG A;  2Q5U A;  2JJL A;  2N3A B;  3WMM 0;  1WRG A;  1FZC A;  4WY4 B;  2Q9I A;  2C0W A;  1SQV K;  1FAV A;  1FU1 A;  1T8Z A;  5APU A;  2IFN A;  2P1J A;  2R3C A;  1NKN A;  1CI6 B;  1T2K D;  1URQ A;  1GK6 A;  1KFN A;  2HYN A;  1KIL D;  5CCG D;  1GW4 A;  5AVR B;  1FZF A;  1T3J A;  3HE4 B;  2XPN A;  1LGH B;  4HH2 A;  2KB7 P;  3M0D A;  4W80 A;  2YO3 A;  3HPH E;  2O1K A;  2WWW A;  1JUN A;  3NMD A;  2LKM A;  3VMY A;  1FJK A;  3U59 A;  1MV8 A;  3IR9 A;  2XDJ A;  2WPS A;  1GL2 C;  1M1J B;  2A45 H;  2Z5I A;  1FZE A;  3HTK A;  3NFQ A;  2KYV A;  2R32 A;  1L4A A;  5CCH C;  1YTZ T;  1MFZ A;  2O01 H;  4C7R A;  1AQ5 A;  2P7J A;  2ZFC A;  2HPC B;  2J58 A;  3OJA B;  2NPS D;  1JY3 N;  1GU5 A;  1ZV8 A;  1URQ D;  3KQG A;  1AFO A;  2QM7 A;  1LT9 A;  4C7N B;  1L0L K;  2Z5H A;  4O9B A;  3L36 A;  1HBW A;  1N7S A;  3HE5 A;  1FZB A;  3RL0 B;  1NOH A;  3II6 A;  3HPG G;  2FFD C;  2N9B A;  2FXM A;  2WSC H;  2CPB A;  1IFJ A;  5BU8 B;  3VOP A;  1X79 B;  5CJ0 A;  3L35 A;  1M1J C;  1RF1 A;  3HE4 A;  1LTJ C;  1JY2 O;  1KZU B;  3C9I A;  2WSF H;  1NH4 A;  1T2K C;  1L4A D;  2YKO A;  1VPC A;  1NKZ B;  5APQ A;  1W2E A;  1QL2 A;  2OAR A;  3GHG C;  1IFM A;  1N2D C;  2C0X A;  2M3B A;  2N1T D;  1NO4 A;  2M8R A;  1S9K D;  2OYI C;  3RK2 D;  1QL1 A;  2JEE A;  2YMY A;  5APY A;  3KPE A;  1N7S D;  4I1L A;  3A5T A;  1KFM A;  3RK3 D;  1GL2 B;  2XNX A;  3B8E B;  1CZQ A;  2A45 G;  3VN0 A;  4I6M C;  4N3Y B;  2WT7 B;  5AVQ B;  1JY3 P;  3U88 C;  2PAJ A;  3P8C E;  5AW7 B;  3HRN A;  3V2Q A;  3VP8 A;  1RY3 A;  3B5N A;  2NPS C;  5AW9 B;  1SFC D;  1SQQ K;  3TSI A;  1A02 F;  2N1T B;  1URQ C;  3TYY A;  3KYQ A;  1JCC A;  3EQ2 A;  1M7L A;  1N73 C;  2XPO A;  3NTN A;  2OYH B;  2P2U A;  1SP4 A;  3HD7 D;  4WB4 A;  1ZLL A;  1LWU C;  2BAS A;  1JTH A;  3V2P A;  3HUS C;  3OA7 A;  3CI9 A;  3M0D C;  3V2R A;  2XV5 A;  2FFD B;  1X9V A;  1LTB C;  2HOD B;  5CJ4 A;  3F9K C;  3BVH A;  3NXS A;  1GU4 A;  3CL3 D;  2PP6 A;  1SVF A;  1NWQ A;  1L0N K;  2YO2 A;  2XPL A;  1LTJ B;  5AW5 B;  1L4A C;  5AVX B;  1SLQ A;  1XTG B;  3A2A A;  4M3L A;  1JMM A;  1CSB A;  1KIL B;  2A45 I;  4IFF A;  3N7N A;  5BVZ A;  2Q7C A;  3GHG B;  1GL2 A;  3V4Q A;  1IFI A;  2N1T C;  3M9H A;  1IK9 A;  2KLV A;  3TNU A;  1WT6 A;  2J59 M;  3RK2 C;  5APW A;  1X8Y A;  2OYI B;  1RF0 C;  5CCH A;  2OYH C;  2FKW B;  5BU5 A;  3MUD A;  1G2C A;  2YKQ A;  3M06 A;  5KTB A;  2WZ7 A;  1PFI A;  4WY4 A;  2P67 A;  3BAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...