3OANA

Crystal structure of the ran binding domain from the nuclear complex component nup2 from ashbya gossypii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
ENEEVLFCEKAKLLIFDSDTKGYTSRGVGELKLLRKKDDKGKVRVLMRSEGMGHVLLNTSVVKSFKYQPIDADNENLIKWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Ran Binding Domain From The Nuclear Complex Component Nup2 From Ashbya Gossypii
rcsb
source organism Ashbya gossypii
molecule tags Transport protein
molecule keywords ABR034Wp
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3oanA00
5DH9B 1BTKA 4DBBA 2DHKA 3AU4A 5KCVA 4HDOA 4C0AA 5HE2A 3PVWA 4ZRKA 4PNKA 2P0DA 5DI9B 2YS1A 1PMSA 2Y8GA 4Z2NA 1MAIA 3ODXA 3SNHA 1XKEA 1NI2A 3QBVB 1BWNA 4B6HA 2LULA 1OMWA 3KSYA 4EMOA 2P0FA 2RGNB 2N23A 4TKNA 3SO6A 1UNRA 2R0DA 2EJ8A 4GN1A 5JP4A 2J0KA 2KCJA 4XWXA 2COCA 1ZVRA 2YT1A 2DN6A 1U5GA 1AQCA 2PZ1A 5C5BB 2YT0A 1KZ7A 1OY2A 4WSFA 4HB4B 3QWMA 4HAYB 2HTHB 1DDMA 1AWEA 3HW2B 4KHBB 5FI0A 5HE0A 3DXEA 1NU2A 3KY9A 2DHJA 3SV1A 2IYBA 5J3QA 4WVFB 3UZTA 4IFSA 1J0WA 3KRWA 5LONB 2DKPA 3P6AA 3WYFB 1H4RA 3DXCA 2OQBA 3BINA 5LOPB 2OTXA 2LG1A 1RRPB 1V88A 2V76A 3BJIA 2CY4A 1ZM0A 2AL6A 3AU5A 2L2IA 4H8SA 1BTNA 2ZPYA 5D27A 2H7EA 2VSZA 5L81A 4DX8A 2HE7A 4GPTB 2J0MA 1WG7A 1FGYA 4HHVA 1FOEA 2DTCA 5JHGA 2M38A 4GMVA 4EKUA 2W2WA 4HB3B 2CODA 2EC1A 1Q67A 3A8PA 2P0HA 2K2JA 1PFJA 1Z87A 5HE3A 3PG7A 1P6SA 1N3HA 2GCJA 3LJUX 2COFA 1WGQA 2DYNA 3U7DA 2XQNM 1K5DB 3QIJA 3X23A 1NTVA 4Z2MB 1WI1A 1OQNA 1IRSA 2ELAA 3ULCA 1GC7A 2E2XA 5HE1A 1FHOA 1MKEA 1LW3A 4GXBA 4EJNA 5DIFB 5D3YA 2MDXA 4F7UP 4CHJA 2J0JA 1DDWA 3TVVA 5C16A 3ODOA 4K81A 1MK7B 3KRXA 1GC6A 1V89A 2ROZB 4GZUA 3TCAA 3D8DA 2RUKB 1EVHA 3ODWA 1MK9B 1Y19B 5DHFB 3F0WA 2AEHA 3DXDA 3A98B 1P5TA 2DYQA 3PSCA 3O96A 3HK0A 1DBHA 2Y8FA 4HB2B 2DX1A 2DX5A 1EF1A 5KQ4A 1XX0A 5JLJB 2R09A 1V61A 3IVFA 1B55A 1QC6A 4PQ0A 3FM8C 4GMXB 2UZRA 4L6EA 1K5GB 4ZRIA 1UPRA 3D8FA 2I1KA 1PLSA 1M7RA 3ZVRA 1KZGA 2D9WA 1V5UA 2NZ8B 3TFMA 2EMSA 1W1DA 1UPQA 3G9WA 2Y7BA 3VOQA 4KHAA 2YF0A 2I5FA 2RVBB 3PZDA 3ZDTA 1DROA 5CLQB 2GJYA 4K2OA 2ROVA 1SHCA 1EAZA 2CAYA 1XD4A 2P8VA 2IFSA 2YSZA 4IOYX 4KHOA 1U5FA 3KZ1A 1WVHA 2MFQA 4IAPA 4CHMA 1M7EA 5FI1A 1UNQA 2CY5A 3U8ZA 1I7AA 2DKQA 4KVGB 2D2QA 3PVUA 1U5DA 3FSSA 2I5CA 4P7IA 4A6FA 2ADZA 1MPHA 2JP2A 3A8QA 1I2HA 2D10A 1Y5OA 2J59M 3CIKA 1XODA 2LYDA 2NMBA 1RJ2A 3SUZA 2LKOA 2MKRA 4F7HA 4F7GA 5C5BA 2RNRB 3NSUA 1UEFA 3AJ4A 1V5MA 3TO1A 3RCPA 1TJ6A 4HAWB 4HATB 2DLWA 2Z0QA 3FEHA 2D9VA 1XR0B 4A6FB 1TQZA 2EMTA 4MY6A 1XCGA 4WJ7A 2DA0A 2QKLA 1DDVA 2ELBA 2UZSA 2YS5A 1LB1A 1X1GA 4HDQA 3CXBB 4HB0B 2N0YA 2K2UA 2L1CA 1TXDA 4NY0A 3GYOA 1V5PA 4DXAB 5JHHA 2G35A 3ULBA 2H7DA 2YS3A 1BAKA 2W2XD 5C79A 3ML4A 5D3WA 2GCLA 3OANA 2Z0OA 1ISNA 2LOZA 2LOXA 2D9XA 3GYPA 4A6KA 1ZSQA 3HQCA 4DX90 1ZC3B 2W2XC 1MIZB 2D9ZA 2RSGA 3T06A 1KI1B 2YVCA 3PEGA 1FHXA 2D11A 3M1IB 5CLLB 1EGXA 2DFKA 1DYNA 3F5RA 5D3XA 5D3VA 4K2PA 2KGXB 1MIXA 3MDBC 1SGHA 5J3YA 1ZC4B 4BBKA 5KQ1A 4HAXB 5J3TA 3TW1A 4A5KA 1FB8A 3V5WA 2FJLA 3N7CA 1WJMA 1X1FA 3PVLA 2RLOA 4HAUB 1GG3A 1WGUA 4NSWA 5EFXA 2GS0A 1X05A 1J19A 2QKMA 1W1GA 3VIAA 3D8EA 5GOWB 1W1HA 2CRFA 1U27A 2KUPA 3P7ZA 2K00A 2D4QA 4HAVB 4KAXB 4ZRJA 1U29A 2Q13A 4YL8A 2DHIA 1FHWA 2BCJA 4D0NB 2MWNB 2D9YA 4CYEA 5C6RA 1U2BA 1X11A 1FAOA 2UVMA 5DHAB 3MPXA 1P3RA 3PP2A 2X18A 2VRWB 4MT7A 4YONA 2I1JA 3SYXA 3WA0A 4A6HA 4HAZB 1NTYA 2COAA 1WJ1A 4MK0A 2M14A 1H10A 4K17A 1QQGA 1FGZA 1UNPA 4TYZA 4Y94A 2Z0PA 1E5WA 1U5EA 1X86A 2YRYA 2VKIA
chains in the Genus database with same CATH superfamily
5DH9B 1BTKA 4DBBA 2DHKA 3AU4A 5KCVA 4D6WA 4HDOA 4C0AA 5HE2A 3PVWA 4ZRKA 4PNKA 2P0DA 5DI9B 2YS1A 1PMSA 2Y8GA 4Z2NA 1MAIA 3ODXA 3SNHA 1XKEA 1NI2A 3QBVB 1BWNA 4B6HA 2LULA 1OMWA 3NW8A 3KSYA 4EMOA 2P0FA 2RGNB 2N23A 4TKNA 3SO6A 1UNRA 2R0DA 2EJ8A 4GN1A 2KIGA 5JP4A 3FVCA 2J0KA 2KCJA 4XWXA 2COCA 1ZVRA 2YT1A 2DN6A 1U5GA 1AQCA 2PZ1A 5C5BB 2YT0A 3A58A 1KZ7A 1OY2A 1ZYIA 4WSFA 4HB4B 3QWMA 4HAYB 2HTHB 1DDMA 1AWEA 3HW2B 4KHBB 5FI0A 5HE0A 3DXEA 1NU2A 3KY9A 4CSQA 2DHJA 3SV1A 2IYBA 5J3QA 4WVFB 3UZTA 4IFSA 1J0WA 3KRWA 5LONB 2DKPA 3P6AA 3WYFB 4KHBA 1H4RA 3DXCA 2OQBA 4GNKB 3BINA 5LOPB 4L1RA 2K8EA 2OTXA 2LG1A 1RRPB 1V88A 2V76A 2GUMA 3BJIA 2CY4A 1ZM0A 2AL6A 3AU5A 2L2IA 4H8SA 1BTNA 2ZPYA 4GOUA 5D27A 2H7EA 2VSZA 5L81A 4DX8A 2HE7A 4GPTB 2J0MA 1WG7A 1FGYA 4HHVA 5M4YB 2Z4DA 1FOEA 2DTCA 5JHGA 2M38A 4GMVA 4EKUA 2W2WA 2KR0A 4HB3B 1T77A 3U12A 2CODA 2EC1A 1Q67A 3A8PA 5I2MA 2P0HA 2K2JA 1PFJA 1Z87A 5HE3A 3PG7A 1P6SA 1N3HA 2GCJA 3LJUX 2COFA 1WGQA 2DYNA 4QXAB 3U7DA 2XQNM 1K5DB 3QIJA 3X23A 1NTVA 4Z2MB 1WI1A 1OQNA 1IRSA 2ELAA 3ULCA 1GC7A 2E2XA 4QJ5B 5HE1A 1FHOA 3HIEA 2KIEA 1MKEA 2K49A 1LW3A 4GXBA 4EJNA 5DIFB 5D3YA 2MDXA 4F7UP 4CHJA 2J0JA 3B77A 1DDWA 3TVVA 5C16A 3ODOA 4K81A 1MK7B 3KRXA 1GC6A 1V89A 2ROZB 4GZUA 3TCAA 3D8DA 2RUKB 1EVHA 3ODWA 1MK9B 1Y19B 5DHFB 3F0WA 3NWDA 2AEHA 3DXDA 3A98B 1P5TA 2DYQA 3PSCA 3O96A 3HK0A 1DBHA 2Y8FA 4HB2B 2DX1A 4DIXA 2DX5A 1EF1A 5KQ4A 1XX0A 5JLJB 2R09A 1V61A 3IVFA 1B55A 1MI1A 1QC6A 4PQ0A 3FM8C 2Z14A 4GMXB 2UZRA 4L6EA 1K5GB 2RRFA 4ZRIA 1UPRA 3NWFA 3D8FA 2I1KA 1PLSA 1M7RA 3ZVRA 1KZGA 2D9WA 1V5UA 2NZ8B 2YT2A 3TFMA 2EMSA 1W1DA 1UPQA 3G9WA 2Y7BA 3VOQA 4KHAA 2YF0A 2I5FA 2RVBB 3PZDA 3ZDTA 1DROA 5CLQB 2GJYA 4K2OA 2R2YA 2ROVA 1SHCA 1EAZA 2CAYA 1XD4A 2P8VA 2IFSA 2YSZA 4IOYX 4KHOA 1U5FA 3KZ1A 1WVHA 2MFQA 4IAPA 4CHMA 1M7EA 5FI1A 1UNQA 2CY5A 3U8ZA 1I7AA 2DKQA 4KVGB 2D2QA 3PVUA 1U5DA 3FSSA 2Z59A 2I5CA 4P7IA 4A6FA 2ADZA 1MPHA 2JP2A 3A8QA 1I2HA 2D10A 1Y5OA 2J59M 2FJUB 3CIKA 1XODA 2LYDA 2NMBA 1RJ2A 3SUZA 2LKOA 2MKRA 4F7HA 4F7GA 3DCXA 5C5BA 2RNRB 3NSUA 1UEFA 3AJ4A 1V5MA 3TO1A 3RCPA 4QJ4B 1TJ6A 4HAWB 3OHMB 4HATB 4OT1A 2DLWA 2Z0QA 3FEHA 2D9VA 1XR0B 4A6FB 1TQZA 2EMTA 4MY6A 1XCGA 4WJ7A 2DA0A 2QKLA 1DDVA 2ELBA 2UZSA 2YS5A 1LB1A 1X1GA 4HDQA 3CXBB 4HB0B 2N0YA 2K2UA 2L1CA 1TXDA 4NY0A 3GYOA 1V5PA 4DXAB 5JHHA 2G35A 3ULBA 2H7DA 2YS3A 1BAKA 2W2XD 4OSNA 3ML4A 5C79A 5D3WA 2GCLA 3OANA 4HSIA 2Z0OA 1ISNA 2KUQA 2LOZA 2LOXA 2D9XA 3GYPA 2Z13A 4A6KA 1ZSQA 3HQCA 4DX90 1ZC3B 2W2XC 1MIZB 2D9ZA 2RSGA 3T06A 1KI1B 2YVCA 3PEGA 1FHXA 2D11A 3M1IB 5CLLB 1EGXA 2DFKA 1DYNA 3F5RA 5D3XA 5D3VA 4K2PA 2KGXB 1MIXA 3MDBC 1SGHA 5J3YA 2ZKMX 1ZC4B 4BBKA 5KQ1A 4HAXB 5J3TA 5IRSA 3TW1A 4A5KA 1FB8A 3V5WA 2FJLA 3N7CA 1WJMA 1X1FA 3PVLA 2RLOA 4HAUB 1GG3A 1WGUA 4NSWA 5EFXA 2GS0A 1X05A 1J19A 2QKMA 4QJ3B 1W1GA 3VIAA 3D8EA 5GOWB 5LG4B 1W1HA 2CRFA 1U27A 2KUPA 5I2SA 3P7ZA 2K00A 2D4QA 4HAVB 4KAXB 4ZRJA 1U29A 2Q13A 4YL8A 2DHIA 1FHWA 2BCJA 4D0NB 2MWNB 2NBVA 2D9YA 4CYEA 5C6RA 1U2BA 3NWAA 1X11A 1FAOA 2UVMA 3HSAA 5DHAB 3MPXA 1P3RA 3PP2A 2X18A 2VRWB 4MT7A 4YONA 2I1JA 3SYXA 3WA0A 4A6HA 4HAZB 1NTYA 2COAA 1WJ1A 4MK0A 2M14A 1H10A 4K17A 1QQGA 1FGZA 1UNPA 4TYZA 4Y94A 2Z0PA 1E5WA 1U5EA 1X86A 2YRYA 2VKIA
chains in the Genus database with same CATH topology
5DH9B 1BTKA 4DBBA 2DHKA 3AU4A 5KCVA 4HDOA 4C0AA 5HE2A 3PVWA 4ZRKA 4PNKA 2P0DA 5DI9B 2YS1A 1PMSA 2Y8GA 4Z2NA 1MAIA 3ODXA 3SNHA 1XKEA 1NI2A 3QBVB 1BWNA 4B6HA 2LULA 1OMWA 3KSYA 4EMOA 2P0FA 2RGNB 2N23A 4TKNA 3SO6A 1UNRA 2R0DA 2EJ8A 4GN1A 5JP4A 2J0KA 2KCJA 4XWXA 2COCA 1ZVRA 2YT1A 2DN6A 1U5GA 1AQCA 2PZ1A 5C5BB 2YT0A 1KZ7A 1OY2A 4WSFA 4HB4B 3QWMA 4HAYB 2HTHB 1DDMA 1AWEA 3HW2B 4KHBB 5FI0A 5HE0A 3DXEA 1NU2A 3KY9A 2DHJA 3SV1A 2IYBA 5J3QA 4WVFB 3UZTA 4IFSA 1J0WA 3KRWA 5LONB 2DKPA 3P6AA 3WYFB 1H4RA 3DXCA 2OQBA 3BINA 5LOPB 2OTXA 2LG1A 1RRPB 1V88A 2V76A 3BJIA 2CY4A 1ZM0A 2AL6A 3AU5A 2L2IA 4H8SA 1BTNA 2ZPYA 5D27A 2H7EA 2VSZA 5L81A 4DX8A 2HE7A 4GPTB 2J0MA 1WG7A 1FGYA 4HHVA 1FOEA 2DTCA 5JHGA 2M38A 4GMVA 4EKUA 2W2WA 4HB3B 2CODA 2EC1A 1Q67A 3A8PA 2P0HA 2K2JA 1PFJA 1Z87A 5HE3A 3PG7A 1P6SA 1N3HA 2GCJA 3LJUX 2COFA 1WGQA 2DYNA 3U7DA 2XQNM 1K5DB 3QIJA 3X23A 1NTVA 4Z2MB 1WI1A 1OQNA 1IRSA 2ELAA 3ULCA 1GC7A 2E2XA 5HE1A 1FHOA 1MKEA 1LW3A 4GXBA 4EJNA 5DIFB 5D3YA 2MDXA 4F7UP 4CHJA 2J0JA 1DDWA 3TVVA 5C16A 3ODOA 4K81A 1MK7B 3KRXA 1GC6A 1V89A 2ROZB 4GZUA 3TCAA 3D8DA 2RUKB 1EVHA 3ODWA 1MK9B 1Y19B 5DHFB 3F0WA 2AEHA 3DXDA 3A98B 1P5TA 2DYQA 3PSCA 3O96A 3HK0A 1DBHA 2Y8FA 4HB2B 2DX1A 2DX5A 1EF1A 5KQ4A 1XX0A 5JLJB 2R09A 1V61A 3IVFA 1B55A 1QC6A 4PQ0A 3FM8C 4GMXB 2UZRA 4L6EA 1K5GB 4ZRIA 1UPRA 3D8FA 2I1KA 1PLSA 1M7RA 3ZVRA 1KZGA 2D9WA 1V5UA 2NZ8B 3TFMA 2EMSA 1W1DA 1UPQA 3G9WA 2Y7BA 3VOQA 4KHAA 2YF0A 2I5FA 2RVBB 3PZDA 3ZDTA 1DROA 5CLQB 2GJYA 4K2OA 2ROVA 1SHCA 1EAZA 2CAYA 1XD4A 2P8VA 2IFSA 2YSZA 4IOYX 4KHOA 1U5FA 3KZ1A 1WVHA 2MFQA 4IAPA 4CHMA 1M7EA 5FI1A 1UNQA 2CY5A 3U8ZA 1I7AA 2DKQA 4KVGB 2D2QA 3PVUA 1U5DA 3FSSA 2I5CA 4P7IA 4A6FA 2ADZA 1MPHA 2JP2A 3A8QA 1I2HA 2D10A 1Y5OA 2J59M 3CIKA 1XODA 2LYDA 2NMBA 1RJ2A 3SUZA 2LKOA 2MKRA 4F7HA 4F7GA 5C5BA 2RNRB 3NSUA 1UEFA 3AJ4A 1V5MA 3TO1A 3RCPA 1TJ6A 4HAWB 4HATB 2DLWA 2Z0QA 3FEHA 2D9VA 1XR0B 4A6FB 1TQZA 2EMTA 4MY6A 1XCGA 4WJ7A 2DA0A 2QKLA 1DDVA 2ELBA 2UZSA 2YS5A 1LB1A 1X1GA 4HDQA 3CXBB 4HB0B 2N0YA 2K2UA 2L1CA 1TXDA 4NY0A 3GYOA 1V5PA 4DXAB 5JHHA 2G35A 3ULBA 2H7DA 2YS3A 1BAKA 2W2XD 5C79A 3ML4A 5D3WA 2GCLA 3OANA 2Z0OA 1ISNA 2LOZA 2LOXA 2D9XA 3GYPA 4A6KA 1ZSQA 3HQCA 4DX90 1ZC3B 2W2XC 1MIZB 2D9ZA 2RSGA 3T06A 1KI1B 2YVCA 3PEGA 1FHXA 2D11A 3M1IB 5CLLB 1EGXA 2DFKA 1DYNA 3F5RA 5D3XA 5D3VA 4K2PA 2KGXB 1MIXA 3MDBC 1SGHA 5J3YA 1ZC4B 4BBKA 5KQ1A 4HAXB 5J3TA 3TW1A 4A5KA 1FB8A 3V5WA 2FJLA 3N7CA 1WJMA 1X1FA 3PVLA 2RLOA 4HAUB 1GG3A 1WGUA 4NSWA 5EFXA 2GS0A 1X05A 1J19A 2QKMA 1W1GA 3VIAA 3D8EA 5GOWB 1W1HA 2CRFA 1U27A 2KUPA 3P7ZA 2K00A 2D4QA 4HAVB 4KAXB 4ZRJA 1U29A 2Q13A 4YL8A 2DHIA 1FHWA 2BCJA 4D0NB 2MWNB 2D9YA 4CYEA 5C6RA 1U2BA 1X11A 1FAOA 2UVMA 5DHAB 3MPXA 1P3RA 3PP2A 2X18A 2VRWB 4MT7A 4YONA 2I1JA 3SYXA 3WA0A 4A6HA 4HAZB 1NTYA 2COAA 1WJ1A 4MK0A 2M14A 1H10A 4K17A 1QQGA 1FGZA 1UNPA 4TYZA 4Y94A 2Z0PA 1E5WA 1U5EA 1X86A 2YRYA 2VKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DH9 B;  1BTK A;  4DBB A;  2DHK A;  3AU4 A;  5KCV A;  4HDO A;  4C0A A;  5HE2 A;  3PVW A;  4ZRK A;  4PNK A;  2P0D A;  5DI9 B;  2YS1 A;  1PMS A;  2Y8G A;  4Z2N A;  1MAI A;  3ODX A;  3SNH A;  1XKE A;  1NI2 A;  3QBV B;  1BWN A;  4B6H A;  2LUL A;  1OMW A;  3KSY A;  4EMO A;  2P0F A;  2RGN B;  2N23 A;  4TKN A;  3SO6 A;  1UNR A;  2R0D A;  2EJ8 A;  4GN1 A;  5JP4 A;  2J0K A;  2KCJ A;  4XWX A;  2COC A;  1ZVR A;  2YT1 A;  2DN6 A;  1U5G A;  1AQC A;  2PZ1 A;  5C5B B;  2YT0 A;  1KZ7 A;  1OY2 A;  4WSF A;  4HB4 B;  3QWM A;  4HAY B;  2HTH B;  1DDM A;  1AWE A;  3HW2 B;  4KHB B;  5FI0 A;  5HE0 A;  3DXE A;  1NU2 A;  3KY9 A;  2DHJ A;  3SV1 A;  2IYB A;  5J3Q A;  4WVF B;  3UZT A;  4IFS A;  1J0W A;  3KRW A;  5LON B;  2DKP A;  3P6A A;  3WYF B;  1H4R A;  3DXC A;  2OQB A;  3BIN A;  5LOP B;  2OTX A;  2LG1 A;  1RRP B;  1V88 A;  2V76 A;  3BJI A;  2CY4 A;  1ZM0 A;  2AL6 A;  3AU5 A;  2L2I A;  4H8S A;  1BTN A;  2ZPY A;  5D27 A;  2H7E A;  2VSZ A;  5L81 A;  4DX8 A;  2HE7 A;  4GPT B;  2J0M A;  1WG7 A;  1FGY A;  4HHV A;  1FOE A;  2DTC A;  5JHG A;  2M38 A;  4GMV A;  4EKU A;  2W2W A;  4HB3 B;  2COD A;  2EC1 A;  1Q67 A;  3A8P A;  2P0H A;  2K2J A;  1PFJ A;  1Z87 A;  5HE3 A;  3PG7 A;  1P6S A;  1N3H A;  2GCJ A;  3LJU X;  2COF A;  1WGQ A;  2DYN A;  3U7D A;  2XQN M;  1K5D B;  3QIJ A;  3X23 A;  1NTV A;  4Z2M B;  1WI1 A;  1OQN A;  1IRS A;  2ELA A;  3ULC A;  1GC7 A;  2E2X A;  5HE1 A;  1FHO A;  1MKE A;  1LW3 A;  4GXB A;  4EJN A;  5DIF B;  5D3Y A;  2MDX A;  4F7U P;  4CHJ A;  2J0J A;  1DDW A;  3TVV A;  5C16 A;  3ODO A;  4K81 A;  1MK7 B;  3KRX A;  1GC6 A;  1V89 A;  2ROZ B;  4GZU A;  3TCA A;  3D8D A;  2RUK B;  1EVH A;  3ODW A;  1MK9 B;  1Y19 B;  5DHF B;  3F0W A;  2AEH A;  3DXD A;  3A98 B;  1P5T A;  2DYQ A;  3PSC A;  3O96 A;  3HK0 A;  1DBH A;  2Y8F A;  4HB2 B;  2DX1 A;  2DX5 A;  1EF1 A;  5KQ4 A;  1XX0 A;  5JLJ B;  2R09 A;  1V61 A;  3IVF A;  1B55 A;  1QC6 A;  4PQ0 A;  3FM8 C;  4GMX B;  2UZR A;  4L6E A;  1K5G B;  4ZRI A;  1UPR A;  3D8F A;  2I1K A;  1PLS A;  1M7R A;  3ZVR A;  1KZG A;  2D9W A;  1V5U A;  2NZ8 B;  3TFM A;  2EMS A;  1W1D A;  1UPQ A;  3G9W A;  2Y7B A;  3VOQ A;  4KHA A;  2YF0 A;  2I5F A;  2RVB B;  3PZD A;  3ZDT A;  1DRO A;  5CLQ B;  2GJY A;  4K2O A;  2ROV A;  1SHC A;  1EAZ A;  2CAY A;  1XD4 A;  2P8V A;  2IFS A;  2YSZ A;  4IOY X;  4KHO A;  1U5F A;  3KZ1 A;  1WVH A;  2MFQ A;  4IAP A;  4CHM A;  1M7E A;  5FI1 A;  1UNQ A;  2CY5 A;  3U8Z A;  1I7A A;  2DKQ A;  4KVG B;  2D2Q A;  3PVU A;  1U5D A;  3FSS A;  2I5C A;  4P7I A;  4A6F A;  2ADZ A;  1MPH A;  2JP2 A;  3A8Q A;  1I2H A;  2D10 A;  1Y5O A;  2J59 M;  3CIK A;  1XOD A;  2LYD A;  2NMB A;  1RJ2 A;  3SUZ A;  2LKO A;  2MKR A;  4F7H A;  4F7G A;  5C5B A;  2RNR B;  3NSU A;  1UEF A;  3AJ4 A;  1V5M A;  3TO1 A;  3RCP A;  1TJ6 A;  4HAW B;  4HAT B;  2DLW A;  2Z0Q A;  3FEH A;  2D9V A;  1XR0 B;  4A6F B;  1TQZ A;  2EMT A;  4MY6 A;  1XCG A;  4WJ7 A;  2DA0 A;  2QKL A;  1DDV A;  2ELB A;  2UZS A;  2YS5 A;  1LB1 A;  1X1G A;  4HDQ A;  3CXB B;  4HB0 B;  2N0Y A;  2K2U A;  2L1C A;  1TXD A;  4NY0 A;  3GYO A;  1V5P A;  4DXA B;  5JHH A;  2G35 A;  3ULB A;  2H7D A;  2YS3 A;  1BAK A;  2W2X D;  5C79 A;  3ML4 A;  5D3W A;  2GCL A;  3OAN A;  2Z0O A;  1ISN A;  2LOZ A;  2LOX A;  2D9X A;  3GYP A;  4A6K A;  1ZSQ A;  3HQC A;  4DX9 0;  1ZC3 B;  2W2X C;  1MIZ B;  2D9Z A;  2RSG A;  3T06 A;  1KI1 B;  2YVC A;  3PEG A;  1FHX A;  2D11 A;  3M1I B;  5CLL B;  1EGX A;  2DFK A;  1DYN A;  3F5R A;  5D3X A;  5D3V A;  4K2P A;  2KGX B;  1MIX A;  3MDB C;  1SGH A;  5J3Y A;  1ZC4 B;  4BBK A;  5KQ1 A;  4HAX B;  5J3T A;  3TW1 A;  4A5K A;  1FB8 A;  3V5W A;  2FJL A;  3N7C A;  1WJM A;  1X1F A;  3PVL A;  2RLO A;  4HAU B;  1GG3 A;  1WGU A;  4NSW A;  5EFX A;  2GS0 A;  1X05 A;  1J19 A;  2QKM A;  1W1G A;  3VIA A;  3D8E A;  5GOW B;  1W1H A;  2CRF A;  1U27 A;  2KUP A;  3P7Z A;  2K00 A;  2D4Q A;  4HAV B;  4KAX B;  4ZRJ A;  1U29 A;  2Q13 A;  4YL8 A;  2DHI A;  1FHW A;  2BCJ A;  4D0N B;  2MWN B;  2D9Y A;  4CYE A;  5C6R A;  1U2B A;  1X11 A;  1FAO A;  2UVM A;  5DHA B;  3MPX A;  1P3R A;  3PP2 A;  2X18 A;  2VRW B;  4MT7 A;  4YON A;  2I1J A;  3SYX A;  3WA0 A;  4A6H A;  4HAZ B;  1NTY A;  2COA A;  1WJ1 A;  4MK0 A;  2M14 A;  1H10 A;  4K17 A;  1QQG A;  1FGZ A;  1UNP A;  4TYZ A;  4Y94 A;  2Z0P A;  1E5W A;  1U5E A;  1X86 A;  2YRY A;  2VKI A; 
#chains in the Genus database with same CATH topology
 5DH9 B;  1BTK A;  4DBB A;  2DHK A;  3AU4 A;  5KCV A;  4D6W A;  4HDO A;  4C0A A;  5HE2 A;  3PVW A;  4ZRK A;  4PNK A;  2P0D A;  5DI9 B;  2YS1 A;  1PMS A;  2Y8G A;  4Z2N A;  1MAI A;  3ODX A;  3SNH A;  1XKE A;  1NI2 A;  3QBV B;  1BWN A;  4B6H A;  2LUL A;  1OMW A;  3NW8 A;  3KSY A;  4EMO A;  2P0F A;  2RGN B;  2N23 A;  4TKN A;  3SO6 A;  1UNR A;  2R0D A;  2EJ8 A;  4GN1 A;  2KIG A;  5JP4 A;  3FVC A;  2J0K A;  2KCJ A;  4XWX A;  2COC A;  1ZVR A;  2YT1 A;  2DN6 A;  1U5G A;  1AQC A;  2PZ1 A;  5C5B B;  2YT0 A;  3A58 A;  1KZ7 A;  1OY2 A;  1ZYI A;  4WSF A;  4HB4 B;  3QWM A;  4HAY B;  2HTH B;  1DDM A;  1AWE A;  3HW2 B;  4KHB B;  5FI0 A;  5HE0 A;  3DXE A;  1NU2 A;  3KY9 A;  4CSQ A;  2DHJ A;  3SV1 A;  2IYB A;  5J3Q A;  4WVF B;  3UZT A;  4IFS A;  1J0W A;  3KRW A;  5LON B;  2DKP A;  3P6A A;  3WYF B;  4KHB A;  1H4R A;  3DXC A;  2OQB A;  4GNK B;  3BIN A;  5LOP B;  4L1R A;  2K8E A;  2OTX A;  2LG1 A;  1RRP B;  1V88 A;  2V76 A;  2GUM A;  3BJI A;  2CY4 A;  1ZM0 A;  2AL6 A;  3AU5 A;  2L2I A;  4H8S A;  1BTN A;  2ZPY A;  4GOU A;  5D27 A;  2H7E A;  2VSZ A;  5L81 A;  4DX8 A;  2HE7 A;  4GPT B;  2J0M A;  1WG7 A;  1FGY A;  4HHV A;  5M4Y B;  2Z4D A;  1FOE A;  2DTC A;  5JHG A;  2M38 A;  4GMV A;  4EKU A;  2W2W A;  2KR0 A;  4HB3 B;  1T77 A;  3U12 A;  2COD A;  2EC1 A;  1Q67 A;  3A8P A;  5I2M A;  2P0H A;  2K2J A;  1PFJ A;  1Z87 A;  5HE3 A;  3PG7 A;  1P6S A;  1N3H A;  2GCJ A;  3LJU X;  2COF A;  1WGQ A;  2DYN A;  4QXA B;  3U7D A;  2XQN M;  1K5D B;  3QIJ A;  3X23 A;  1NTV A;  4Z2M B;  1WI1 A;  1OQN A;  1IRS A;  2ELA A;  3ULC A;  1GC7 A;  2E2X A;  4QJ5 B;  5HE1 A;  1FHO A;  3HIE A;  2KIE A;  1MKE A;  2K49 A;  1LW3 A;  4GXB A;  4EJN A;  5DIF B;  5D3Y A;  2MDX A;  4F7U P;  4CHJ A;  2J0J A;  3B77 A;  1DDW A;  3TVV A;  5C16 A;  3ODO A;  4K81 A;  1MK7 B;  3KRX A;  1GC6 A;  1V89 A;  2ROZ B;  4GZU A;  3TCA A;  3D8D A;  2RUK B;  1EVH A;  3ODW A;  1MK9 B;  1Y19 B;  5DHF B;  3F0W A;  3NWD A;  2AEH A;  3DXD A;  3A98 B;  1P5T A;  2DYQ A;  3PSC A;  3O96 A;  3HK0 A;  1DBH A;  2Y8F A;  4HB2 B;  2DX1 A;  4DIX A;  2DX5 A;  1EF1 A;  5KQ4 A;  1XX0 A;  5JLJ B;  2R09 A;  1V61 A;  3IVF A;  1B55 A;  1MI1 A;  1QC6 A;  4PQ0 A;  3FM8 C;  2Z14 A;  4GMX B;  2UZR A;  4L6E A;  1K5G B;  2RRF A;  4ZRI A;  1UPR A;  3NWF A;  3D8F A;  2I1K A;  1PLS A;  1M7R A;  3ZVR A;  1KZG A;  2D9W A;  1V5U A;  2NZ8 B;  2YT2 A;  3TFM A;  2EMS A;  1W1D A;  1UPQ A;  3G9W A;  2Y7B A;  3VOQ A;  4KHA A;  2YF0 A;  2I5F A;  2RVB B;  3PZD A;  3ZDT A;  1DRO A;  5CLQ B;  2GJY A;  4K2O A;  2R2Y A;  2ROV A;  1SHC A;  1EAZ A;  2CAY A;  1XD4 A;  2P8V A;  2IFS A;  2YSZ A;  4IOY X;  4KHO A;  1U5F A;  3KZ1 A;  1WVH A;  2MFQ A;  4IAP A;  4CHM A;  1M7E A;  5FI1 A;  1UNQ A;  2CY5 A;  3U8Z A;  1I7A A;  2DKQ A;  4KVG B;  2D2Q A;  3PVU A;  1U5D A;  3FSS A;  2Z59 A;  2I5C A;  4P7I A;  4A6F A;  2ADZ A;  1MPH A;  2JP2 A;  3A8Q A;  1I2H A;  2D10 A;  1Y5O A;  2J59 M;  2FJU B;  3CIK A;  1XOD A;  2LYD A;  2NMB A;  1RJ2 A;  3SUZ A;  2LKO A;  2MKR A;  4F7H A;  4F7G A;  3DCX A;  5C5B A;  2RNR B;  3NSU A;  1UEF A;  3AJ4 A;  1V5M A;  3TO1 A;  3RCP A;  4QJ4 B;  1TJ6 A;  4HAW B;  3OHM B;  4HAT B;  4OT1 A;  2DLW A;  2Z0Q A;  3FEH A;  2D9V A;  1XR0 B;  4A6F B;  1TQZ A;  2EMT A;  4MY6 A;  1XCG A;  4WJ7 A;  2DA0 A;  2QKL A;  1DDV A;  2ELB A;  2UZS A;  2YS5 A;  1LB1 A;  1X1G A;  4HDQ A;  3CXB B;  4HB0 B;  2N0Y A;  2K2U A;  2L1C A;  1TXD A;  4NY0 A;  3GYO A;  1V5P A;  4DXA B;  5JHH A;  2G35 A;  3ULB A;  2H7D A;  2YS3 A;  1BAK A;  2W2X D;  4OSN A;  3ML4 A;  5C79 A;  5D3W A;  2GCL A;  3OAN A;  4HSI A;  2Z0O A;  1ISN A;  2KUQ A;  2LOZ A;  2LOX A;  2D9X A;  3GYP A;  2Z13 A;  4A6K A;  1ZSQ A;  3HQC A;  4DX9 0;  1ZC3 B;  2W2X C;  1MIZ B;  2D9Z A;  2RSG A;  3T06 A;  1KI1 B;  2YVC A;  3PEG A;  1FHX A;  2D11 A;  3M1I B;  5CLL B;  1EGX A;  2DFK A;  1DYN A;  3F5R A;  5D3X A;  5D3V A;  4K2P A;  2KGX B;  1MIX A;  3MDB C;  1SGH A;  5J3Y A;  2ZKM X;  1ZC4 B;  4BBK A;  5KQ1 A;  4HAX B;  5J3T A;  5IRS A;  3TW1 A;  4A5K A;  1FB8 A;  3V5W A;  2FJL A;  3N7C A;  1WJM A;  1X1F A;  3PVL A;  2RLO A;  4HAU B;  1GG3 A;  1WGU A;  4NSW A;  5EFX A;  2GS0 A;  1X05 A;  1J19 A;  2QKM A;  4QJ3 B;  1W1G A;  3VIA A;  3D8E A;  5GOW B;  5LG4 B;  1W1H A;  2CRF A;  1U27 A;  2KUP A;  5I2S A;  3P7Z A;  2K00 A;  2D4Q A;  4HAV B;  4KAX B;  4ZRJ A;  1U29 A;  2Q13 A;  4YL8 A;  2DHI A;  1FHW A;  2BCJ A;  4D0N B;  2MWN B;  2NBV A;  2D9Y A;  4CYE A;  5C6R A;  1U2B A;  3NWA A;  1X11 A;  1FAO A;  2UVM A;  3HSA A;  5DHA B;  3MPX A;  1P3R A;  3PP2 A;  2X18 A;  2VRW B;  4MT7 A;  4YON A;  2I1J A;  3SYX A;  3WA0 A;  4A6H A;  4HAZ B;  1NTY A;  2COA A;  1WJ1 A;  4MK0 A;  2M14 A;  1H10 A;  4K17 A;  1QQG A;  1FGZ A;  1UNP A;  4TYZ A;  4Y94 A;  2Z0P A;  1E5W A;  1U5E A;  1X86 A;  2YRY A;  2VKI A; 
#chains in the Genus database with same CATH homology
 5DH9 B;  1BTK A;  4DBB A;  2DHK A;  3AU4 A;  5KCV A;  4HDO A;  4C0A A;  5HE2 A;  3PVW A;  4ZRK A;  4PNK A;  2P0D A;  5DI9 B;  2YS1 A;  1PMS A;  2Y8G A;  4Z2N A;  1MAI A;  3ODX A;  3SNH A;  1XKE A;  1NI2 A;  3QBV B;  1BWN A;  4B6H A;  2LUL A;  1OMW A;  3KSY A;  4EMO A;  2P0F A;  2RGN B;  2N23 A;  4TKN A;  3SO6 A;  1UNR A;  2R0D A;  2EJ8 A;  4GN1 A;  5JP4 A;  2J0K A;  2KCJ A;  4XWX A;  2COC A;  1ZVR A;  2YT1 A;  2DN6 A;  1U5G A;  1AQC A;  2PZ1 A;  5C5B B;  2YT0 A;  1KZ7 A;  1OY2 A;  4WSF A;  4HB4 B;  3QWM A;  4HAY B;  2HTH B;  1DDM A;  1AWE A;  3HW2 B;  4KHB B;  5FI0 A;  5HE0 A;  3DXE A;  1NU2 A;  3KY9 A;  2DHJ A;  3SV1 A;  2IYB A;  5J3Q A;  4WVF B;  3UZT A;  4IFS A;  1J0W A;  3KRW A;  5LON B;  2DKP A;  3P6A A;  3WYF B;  1H4R A;  3DXC A;  2OQB A;  3BIN A;  5LOP B;  2OTX A;  2LG1 A;  1RRP B;  1V88 A;  2V76 A;  3BJI A;  2CY4 A;  1ZM0 A;  2AL6 A;  3AU5 A;  2L2I A;  4H8S A;  1BTN A;  2ZPY A;  5D27 A;  2H7E A;  2VSZ A;  5L81 A;  4DX8 A;  2HE7 A;  4GPT B;  2J0M A;  1WG7 A;  1FGY A;  4HHV A;  1FOE A;  2DTC A;  5JHG A;  2M38 A;  4GMV A;  4EKU A;  2W2W A;  4HB3 B;  2COD A;  2EC1 A;  1Q67 A;  3A8P A;  2P0H A;  2K2J A;  1PFJ A;  1Z87 A;  5HE3 A;  3PG7 A;  1P6S A;  1N3H A;  2GCJ A;  3LJU X;  2COF A;  1WGQ A;  2DYN A;  3U7D A;  2XQN M;  1K5D B;  3QIJ A;  3X23 A;  1NTV A;  4Z2M B;  1WI1 A;  1OQN A;  1IRS A;  2ELA A;  3ULC A;  1GC7 A;  2E2X A;  5HE1 A;  1FHO A;  1MKE A;  1LW3 A;  4GXB A;  4EJN A;  5DIF B;  5D3Y A;  2MDX A;  4F7U P;  4CHJ A;  2J0J A;  1DDW A;  3TVV A;  5C16 A;  3ODO A;  4K81 A;  1MK7 B;  3KRX A;  1GC6 A;  1V89 A;  2ROZ B;  4GZU A;  3TCA A;  3D8D A;  2RUK B;  1EVH A;  3ODW A;  1MK9 B;  1Y19 B;  5DHF B;  3F0W A;  2AEH A;  3DXD A;  3A98 B;  1P5T A;  2DYQ A;  3PSC A;  3O96 A;  3HK0 A;  1DBH A;  2Y8F A;  4HB2 B;  2DX1 A;  2DX5 A;  1EF1 A;  5KQ4 A;  1XX0 A;  5JLJ B;  2R09 A;  1V61 A;  3IVF A;  1B55 A;  1QC6 A;  4PQ0 A;  3FM8 C;  4GMX B;  2UZR A;  4L6E A;  1K5G B;  4ZRI A;  1UPR A;  3D8F A;  2I1K A;  1PLS A;  1M7R A;  3ZVR A;  1KZG A;  2D9W A;  1V5U A;  2NZ8 B;  3TFM A;  2EMS A;  1W1D A;  1UPQ A;  3G9W A;  2Y7B A;  3VOQ A;  4KHA A;  2YF0 A;  2I5F A;  2RVB B;  3PZD A;  3ZDT A;  1DRO A;  5CLQ B;  2GJY A;  4K2O A;  2ROV A;  1SHC A;  1EAZ A;  2CAY A;  1XD4 A;  2P8V A;  2IFS A;  2YSZ A;  4IOY X;  4KHO A;  1U5F A;  3KZ1 A;  1WVH A;  2MFQ A;  4IAP A;  4CHM A;  1M7E A;  5FI1 A;  1UNQ A;  2CY5 A;  3U8Z A;  1I7A A;  2DKQ A;  4KVG B;  2D2Q A;  3PVU A;  1U5D A;  3FSS A;  2I5C A;  4P7I A;  4A6F A;  2ADZ A;  1MPH A;  2JP2 A;  3A8Q A;  1I2H A;  2D10 A;  1Y5O A;  2J59 M;  3CIK A;  1XOD A;  2LYD A;  2NMB A;  1RJ2 A;  3SUZ A;  2LKO A;  2MKR A;  4F7H A;  4F7G A;  5C5B A;  2RNR B;  3NSU A;  1UEF A;  3AJ4 A;  1V5M A;  3TO1 A;  3RCP A;  1TJ6 A;  4HAW B;  4HAT B;  2DLW A;  2Z0Q A;  3FEH A;  2D9V A;  1XR0 B;  4A6F B;  1TQZ A;  2EMT A;  4MY6 A;  1XCG A;  4WJ7 A;  2DA0 A;  2QKL A;  1DDV A;  2ELB A;  2UZS A;  2YS5 A;  1LB1 A;  1X1G A;  4HDQ A;  3CXB B;  4HB0 B;  2N0Y A;  2K2U A;  2L1C A;  1TXD A;  4NY0 A;  3GYO A;  1V5P A;  4DXA B;  5JHH A;  2G35 A;  3ULB A;  2H7D A;  2YS3 A;  1BAK A;  2W2X D;  5C79 A;  3ML4 A;  5D3W A;  2GCL A;  3OAN A;  2Z0O A;  1ISN A;  2LOZ A;  2LOX A;  2D9X A;  3GYP A;  4A6K A;  1ZSQ A;  3HQC A;  4DX9 0;  1ZC3 B;  2W2X C;  1MIZ B;  2D9Z A;  2RSG A;  3T06 A;  1KI1 B;  2YVC A;  3PEG A;  1FHX A;  2D11 A;  3M1I B;  5CLL B;  1EGX A;  2DFK A;  1DYN A;  3F5R A;  5D3X A;  5D3V A;  4K2P A;  2KGX B;  1MIX A;  3MDB C;  1SGH A;  5J3Y A;  1ZC4 B;  4BBK A;  5KQ1 A;  4HAX B;  5J3T A;  3TW1 A;  4A5K A;  1FB8 A;  3V5W A;  2FJL A;  3N7C A;  1WJM A;  1X1F A;  3PVL A;  2RLO A;  4HAU B;  1GG3 A;  1WGU A;  4NSW A;  5EFX A;  2GS0 A;  1X05 A;  1J19 A;  2QKM A;  1W1G A;  3VIA A;  3D8E A;  5GOW B;  1W1H A;  2CRF A;  1U27 A;  2KUP A;  3P7Z A;  2K00 A;  2D4Q A;  4HAV B;  4KAX B;  4ZRJ A;  1U29 A;  2Q13 A;  4YL8 A;  2DHI A;  1FHW A;  2BCJ A;  4D0N B;  2MWN B;  2D9Y A;  4CYE A;  5C6R A;  1U2B A;  1X11 A;  1FAO A;  2UVM A;  5DHA B;  3MPX A;  1P3R A;  3PP2 A;  2X18 A;  2VRW B;  4MT7 A;  4YON A;  2I1J A;  3SYX A;  3WA0 A;  4A6H A;  4HAZ B;  1NTY A;  2COA A;  1WJ1 A;  4MK0 A;  2M14 A;  1H10 A;  4K17 A;  1QQG A;  1FGZ A;  1UNP A;  4TYZ A;  4Y94 A;  2Z0P A;  1E5W A;  1U5E A;  1X86 A;  2YRY A;  2VKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...