3OANA

Crystal structure of the ran binding domain from the nuclear complex component nup2 from ashbya gossypii
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
116
structure length
116
Chain Sequence
ENEEVLFCEKAKLLIFDSDTKGYTSRGVGELKLLRKKDDKGKVRVLMRSEGMGHVLLNTSVVKSFKYQPIDADNENLIKWPIITDGKLETFIIKVKQKADGRRLVGAVADAQQAME
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Ran Binding Domain From The Nuclear Complex Component Nup2 From Ashbya Gossypii
rcsb
source organism Ashbya gossypii
molecule tags Transport protein
molecule keywords ABR034Wp
total genus 24
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2010-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 3oanA00
1UEFA 3AU4A 1DYNA 1TXDA 4IFSA 1U5FA 4TYZA 4EKUA 1WG7A 2DTCA 5HE3A 2YS1A 2CAYA 3DXEA 2OTXA 3SNHA 4HATB 4B6HA 1PFJA 2P0DA 3CXBB 4NY0A 1TQZA 1MK9B 1ZC3B 4GMVA 4HHVA 3QBVB 5C5BA 1M7RA 1QC6A 3SYXA 5J3QA 1AQCA 1FOEA 2YVCA 1X1FA 5FI1A 3AU5A 2VRWB 4HB4B 1UNPA 2R09A 1LB1A 1WGUA 1FGZA 2OQBA 2HE7A 2D9XA 1XODA 5DHAB 5J3YA 3ULBA 1B55A 2YS5A 2D11A 2LYDA 2J0KA 2L2IA 2YSZA 4K81A 2LULA 3ODOA 1W1GA 5KCVA 1EVHA 2DX1A 4A5KA 5KQ1A 1WJMA 3FSSA 3MDBC 4KHAA 3TVVA 2KGXB 1UNQA 4F7HA 2DLWA 2J59M 1MPHA 2CRFA 4HDOA 1UPQA 2DYQA 4HB0B 4D0NB 1V88A 3PVWA 1GC7A 4A6FA 1X11A 2RVBB 4KHOA 4CHJA 4DBBA 3M1IB 4A6KA 4H8SA 2DA0A 2DHJA 3FM8C 2EJ8A 1FGYA 4MY6A 2PZ1A 2V76A 4HAWB 5DH9B 4CYEA 2G35A 2DX5A 1WI1A 2E2XA 1H4RA 2YT0A 2DFKA 1WJ1A 1ZSQA 1W1DA 1H10A 2GS0A 2EMSA 1XCGA 3HW2B 4K2PA 1GC6A 3TW1A 2ROZB 4DX8A 1J0WA 3TFMA 4GPTB 3TCAA 2P8VA 4A6FB 3GYOA 4A6HA 1BTKA 4GN1A 1FHXA 3KRWA 5C16A 4HB2B 3PZDA 1U5EA 5DI9B 1KZ7A 1E5WA 3F0WA 1U29A 1NTVA 2HTHB 4WVFB 2IYBA 3CIKA 2ROVA 1K5GB 1KI1B 3N7CA 3PEGA 3NSUA 4ZRIA 2P0FA 2K00A 2P0HA 1DBHA 1RJ2A 1UNRA 4GMXB 4KAXB 1V5MA 1X86A 1LW3A 3A98B 2M38A 1MKEA 2I5CA 5LOPB 2DHIA 2YF0A 1N3HA 2DN6A 2W2XC 4ZRJA 3IVFA 3VIAA 3X23A 2DYNA 2VKIA 2Z0QA 4HAYB 5JHHA 2NZ8B 3MPXA 2D9ZA 5D27A 1NI2A 3VOQA 3WYFB 3D8DA 4GXBA 5L81A 4KHBB 3ULCA 2YRYA 5LONB 3PG7A 3A8QA 4F7GA 2ELBA 1Z87A 4BBKA 5HE1A 4HAXB 1P3RA 2DHKA 5JLJB 4HDQA 5JHGA 5D3YA 2Q13A 2Y8FA 2RUKB 1EAZA 3GYPA 2W2XD 2MDXA 2IFSA 3LJUX 4EMOA 1DDWA 1U5DA 2CODA 1MAIA 4Y94A 1V61A 3SUZA 1FHOA 4HAVB 2GCJA 3DXCA 2COAA 4TKNA 1K5DB 1OQNA 2JP2A 2KCJA 3U8ZA 3FEHA 2MFQA 3A8PA 4DX90 2D10A 4IAPA 3OANA 2D9YA 2K2JA 1MIXA 1TJ6A 2MKRA 1J19A 1PLSA 1V5UA 3G9WA 4P7IA 3KRXA 1P6SA 1W1HA 2ADZA 1DDVA 1OMWA 2H7EA 2J0JA 2QKMA 2RNRB 3KY9A 2Y8GA 1PMSA 2ELAA 5HE2A 3V5WA 2EMTA 4YL8A 3SV1A 4PQ0A 5CLLB 2AEHA 5J3TA 2CY5A 4HB3B 4IOYX 2UZSA 1U27A 2X18A 4MT7A 1Q67A 3T06A 3D8FA 1I7AA 3PVUA 1AWEA 3ZDTA 1XD4A 2D9WA 1OY2A 1SHCA 3PSCA 5DHFB 1MK7B 2DKPA 2NMBA 2D9VA 3D8EA 1IRSA 2Y7BA 1GG3A 5D3VA 2FJLA 2Z0OA 4PNKA 4DXAB 1V89A 4K17A 2H7DA 2KUPA 3O96A 2XQNM 2N23A 4C0AA 5DIFB 5C79A 2K2UA 3BINA 2UZRA 3BJIA 4WSFA 3U7DA 3HK0A 1FB8A 3KSYA 5EFXA 1X1GA 1FAOA 2I1JA 4K2OA 4YONA 2EC1A 5FI0A 2I5FA 2YT1A 4KVGB 5KQ4A 4F7UP 1ISNA 2RGNB 1Y5OA 1V5PA 2VSZA 1ZC4B 2DKQA 2QKLA 1ZM0A 3AJ4A 2I1KA 1BWNA 3ODXA 3ML4A 3QIJA 1U5GA 3SO6A 2W2WA 3HQCA 3P7ZA 1NU2A 3QWMA 1SGHA 5GOWB 2MWNB 2CY4A 3TO1A 3ZVRA 1X05A 4HAZB 1I2HA 2RLOA 2LOXA 1WVHA 3KZ1A 1WGQA 2D2QA 1QQGA 3PP2A 1M7EA 1UPRA 5D3XA 5D3WA 5JP4A 2D4QA 1MIZB 1XR0B 2YS3A 1FHWA 2R0DA 3RCPA 4NSWA 4CHMA 1XKEA 2LOZA 3PVLA 4GZUA 4L6EA 3P6AA 5CLQB 4HAUB 1KZGA 5C6RA 2UVMA 2M14A 4Z2MB 4EJNA 1ZVRA 4MK0A 3WA0A 2BCJA 1XX0A 2LKOA 1P5TA 2COCA 2RSGA 1NTYA 1U2BA 4ZRKA 1BTNA 2GJYA 2COFA 5HE0A 1EF1A 4WJ7A 3DXDA 2ZPYA 2N0YA 2Z0PA 2LG1A 1Y19B 3UZTA 2GCLA 1DDMA 1BAKA 4XWXA 2L1CA 1RRPB 3ODWA 2J0MA 1DROA 1EGXA 2AL6A 3F5RA 5C5BB 4Z2NA
chains in the Genus database with same CATH superfamily
1UEFA 3AU4A 1DYNA 1TXDA 4IFSA 1U5FA 4TYZA 4EKUA 1WG7A 2DTCA 5HE3A 4DIXA 2YS1A 2CAYA 2Z4DA 2OTXA 3DXEA 3SNHA 4HATB 4B6HA 1PFJA 2P0DA 3CXBB 4NY0A 1TQZA 1MK9B 1ZC3B 2YT2A 4GMVA 4HHVA 4CSQA 3QBVB 5C5BA 1M7RA 1QC6A 3SYXA 5J3QA 1AQCA 1MI1A 1FOEA 2YVCA 1X1FA 5FI1A 3AU5A 4QXAB 2VRWB 4HB4B 1UNPA 2R09A 1LB1A 1WGUA 3OHMB 1FGZA 2OQBA 4KHBA 2HE7A 2Z13A 2D9XA 1XODA 5DHAB 5J3YA 3ULBA 1B55A 5LG4B 2YS5A 2D11A 2LYDA 2J0KA 2L2IA 2YSZA 4K81A 2LULA 3ODOA 1W1GA 5KCVA 1EVHA 2DX1A 1ZYIA 4A5KA 5KQ1A 1WJMA 3FSSA 3MDBC 4KHAA 3TVVA 2KGXB 1UNQA 4F7HA 2DLWA 2KIEA 2J59M 1MPHA 5I2MA 2CRFA 4HDOA 1UPQA 2DYQA 4HB0B 4D0NB 1V88A 3PVWA 1GC7A 4A6FA 1X11A 2RVBB 3HSAA 4KHOA 4CHJA 4DBBA 3M1IB 4A6KA 4H8SA 2DA0A 2DHJA 3FM8C 2EJ8A 1FGYA 4MY6A 2PZ1A 2V76A 4HAWB 5DH9B 4CYEA 2G35A 2DX5A 1WI1A 2E2XA 5IRSA 1H4RA 2YT0A 2DFKA 1WJ1A 4OSNA 1ZSQA 2Z14A 1W1DA 1H10A 2GS0A 2EMSA 1XCGA 2KR0A 3HW2B 4K2PA 1GC6A 3TW1A 2ROZB 4DX8A 1J0WA 3TFMA 4GPTB 3TCAA 2P8VA 4A6FB 3GYOA 4A6HA 1BTKA 4GN1A 1FHXA 3KRWA 5C16A 4HB2B 4QJ4B 3PZDA 1U5EA 5DI9B 1KZ7A 1E5WA 3F0WA 1U29A 1NTVA 2HTHB 4WVFB 2IYBA 3CIKA 2ROVA 1K5GB 1KI1B 3PEGA 3N7CA 3NSUA 4ZRIA 2P0FA 2K00A 2P0HA 1DBHA 1RJ2A 2FJUB 2ZKMX 1UNRA 4GMXB 4KAXB 1V5MA 1X86A 1LW3A 3A98B 2M38A 1MKEA 2I5CA 5LOPB 2DHIA 2YF0A 1N3HA 2DN6A 2W2XC 4ZRJA 3IVFA 3VIAA 3X23A 2Z59A 2DYNA 2VKIA 1T77A 2Z0QA 4HAYB 5JHHA 2NZ8B 3MPXA 4OT1A 2D9ZA 5D27A 1NI2A 3VOQA 3WYFB 3D8DA 4GXBA 5L81A 4KHBB 3ULCA 2YRYA 3NWFA 3NWAA 3FVCA 5LONB 3PG7A 4L1RA 3A8QA 4F7GA 2ELBA 1Z87A 4BBKA 5HE1A 4HAXB 1P3RA 3NW8A 2DHKA 5JLJB 4HDQA 5JHGA 5D3YA 2Q13A 2Y8FA 2RUKB 1EAZA 3GYPA 2K8EA 2W2XD 2MDXA 2IFSA 3LJUX 4EMOA 1DDWA 1U5DA 2CODA 1MAIA 4Y94A 1V61A 3SUZA 1FHOA 4HAVB 2GCJA 3DXCA 2COAA 4TKNA 1K5DB 1OQNA 2JP2A 2KCJA 3U8ZA 5I2SA 3FEHA 2MFQA 3A8PA 4DX90 2K49A 2D10A 4IAPA 3OANA 2D9YA 2K2JA 1MIXA 1TJ6A 2MKRA 1PLSA 1J19A 1V5UA 3G9WA 4P7IA 3KRXA 1P6SA 1W1HA 2ADZA 2KIGA 1DDVA 1OMWA 2H7EA 2J0JA 2QKMA 2RNRB 3KY9A 2Y8GA 1PMSA 2ELAA 5HE2A 3V5WA 2EMTA 4YL8A 3SV1A 4PQ0A 5CLLB 2AEHA 5J3TA 2CY5A 4HB3B 3A58A 4IOYX 2UZSA 1U27A 2X18A 4MT7A 1Q67A 3T06A 3D8FA 1I7AA 3PVUA 1AWEA 3ZDTA 1XD4A 2D9WA 1OY2A 1SHCA 3PSCA 5M4YB 5DHFB 1MK7B 2DKPA 2NMBA 2D9VA 3D8EA 1IRSA 2Y7BA 1GG3A 5D3VA 2FJLA 2Z0OA 4PNKA 4DXAB 1V89A 4K17A 4QJ3B 2H7DA 2KUPA 3O96A 2XQNM 2R2YA 3NWDA 2N23A 4C0AA 5DIFB 5C79A 2K2UA 3BINA 2UZRA 3BJIA 4WSFA 3U7DA 3HK0A 1FB8A 3KSYA 5EFXA 1X1GA 1FAOA 2I1JA 4K2OA 4YONA 2EC1A 5FI0A 2I5FA 2YT1A 3B77A 4KVGB 5KQ4A 4F7UP 1ISNA 2RGNB 1Y5OA 1V5PA 2VSZA 1ZC4B 2DKQA 2QKLA 1ZM0A 3AJ4A 2I1KA 2KUQA 1BWNA 3ODXA 3ML4A 3QIJA 1U5GA 4QJ5B 3SO6A 2W2WA 3HQCA 3P7ZA 1NU2A 3QWMA 1SGHA 5GOWB 2MWNB 2CY4A 3HIEA 3TO1A 3ZVRA 1X05A 4HAZB 1I2HA 2RLOA 3DCXA 2LOXA 1WVHA 3KZ1A 1WGQA 2D2QA 1QQGA 3PP2A 1M7EA 1UPRA 5D3XA 5D3WA 5JP4A 2D4QA 1MIZB 1XR0B 2YS3A 1FHWA 2R0DA 3RCPA 4NSWA 4CHMA 1XKEA 2LOZA 3PVLA 4GZUA 4L6EA 3P6AA 5CLQB 4HAUB 4GNKB 1KZGA 5C6RA 2UVMA 2M14A 4Z2MB 4EJNA 1ZVRA 4MK0A 2RRFA 4HSIA 3WA0A 2BCJA 1XX0A 2LKOA 1P5TA 2COCA 2RSGA 1NTYA 1U2BA 4ZRKA 1BTNA 2GJYA 2COFA 5HE0A 1EF1A 4WJ7A 4D6WA 2NBVA 3DXDA 2ZPYA 2N0YA 2Z0PA 2LG1A 3U12A 1Y19B 3UZTA 2GCLA 1DDMA 1BAKA 4XWXA 2GUMA 2L1CA 4GOUA 1RRPB 3ODWA 2J0MA 1DROA 1EGXA 2AL6A 3F5RA 5C5BB 4Z2NA
chains in the Genus database with same CATH topology
1UEFA 3AU4A 1DYNA 1TXDA 4IFSA 1U5FA 4TYZA 4EKUA 1WG7A 2DTCA 5HE3A 2YS1A 2CAYA 3DXEA 2OTXA 3SNHA 4HATB 4B6HA 1PFJA 2P0DA 3CXBB 4NY0A 1TQZA 1MK9B 1ZC3B 4GMVA 4HHVA 3QBVB 5C5BA 1M7RA 1QC6A 3SYXA 5J3QA 1AQCA 1FOEA 2YVCA 1X1FA 5FI1A 3AU5A 2VRWB 4HB4B 1UNPA 2R09A 1LB1A 1WGUA 1FGZA 2OQBA 2HE7A 2D9XA 1XODA 5DHAB 5J3YA 3ULBA 1B55A 2YS5A 2D11A 2LYDA 2J0KA 2L2IA 2YSZA 4K81A 2LULA 3ODOA 1W1GA 5KCVA 1EVHA 2DX1A 4A5KA 5KQ1A 1WJMA 3FSSA 3MDBC 4KHAA 3TVVA 2KGXB 1UNQA 4F7HA 2DLWA 2J59M 1MPHA 2CRFA 4HDOA 1UPQA 2DYQA 4HB0B 4D0NB 1V88A 3PVWA 1GC7A 4A6FA 1X11A 2RVBB 4KHOA 4CHJA 4DBBA 3M1IB 4A6KA 4H8SA 2DA0A 2DHJA 3FM8C 2EJ8A 1FGYA 4MY6A 2PZ1A 2V76A 4HAWB 5DH9B 4CYEA 2G35A 2DX5A 1WI1A 2E2XA 1H4RA 2YT0A 2DFKA 1WJ1A 1ZSQA 1W1DA 1H10A 2GS0A 2EMSA 1XCGA 3HW2B 4K2PA 1GC6A 3TW1A 2ROZB 4DX8A 1J0WA 3TFMA 4GPTB 3TCAA 2P8VA 4A6FB 3GYOA 4A6HA 1BTKA 4GN1A 1FHXA 3KRWA 5C16A 4HB2B 3PZDA 1U5EA 5DI9B 1KZ7A 1E5WA 3F0WA 1U29A 1NTVA 2HTHB 4WVFB 2IYBA 3CIKA 2ROVA 1K5GB 1KI1B 3N7CA 3PEGA 3NSUA 4ZRIA 2P0FA 2K00A 2P0HA 1DBHA 1RJ2A 1UNRA 4GMXB 4KAXB 1V5MA 1X86A 1LW3A 3A98B 2M38A 1MKEA 2I5CA 5LOPB 2DHIA 2YF0A 1N3HA 2DN6A 2W2XC 4ZRJA 3IVFA 3VIAA 3X23A 2DYNA 2VKIA 2Z0QA 4HAYB 5JHHA 2NZ8B 3MPXA 2D9ZA 5D27A 1NI2A 3VOQA 3WYFB 3D8DA 4GXBA 5L81A 4KHBB 3ULCA 2YRYA 5LONB 3PG7A 3A8QA 4F7GA 2ELBA 1Z87A 4BBKA 5HE1A 4HAXB 1P3RA 2DHKA 5JLJB 4HDQA 5JHGA 5D3YA 2Q13A 2Y8FA 2RUKB 1EAZA 3GYPA 2W2XD 2MDXA 2IFSA 3LJUX 4EMOA 1DDWA 1U5DA 2CODA 1MAIA 4Y94A 1V61A 3SUZA 1FHOA 4HAVB 2GCJA 3DXCA 2COAA 4TKNA 1K5DB 1OQNA 2JP2A 2KCJA 3U8ZA 3FEHA 2MFQA 3A8PA 4DX90 2D10A 4IAPA 3OANA 2D9YA 2K2JA 1MIXA 1TJ6A 2MKRA 1J19A 1PLSA 1V5UA 3G9WA 4P7IA 3KRXA 1P6SA 1W1HA 2ADZA 1DDVA 1OMWA 2H7EA 2J0JA 2QKMA 2RNRB 3KY9A 2Y8GA 1PMSA 2ELAA 5HE2A 3V5WA 2EMTA 4YL8A 3SV1A 4PQ0A 5CLLB 2AEHA 5J3TA 2CY5A 4HB3B 4IOYX 2UZSA 1U27A 2X18A 4MT7A 1Q67A 3T06A 3D8FA 1I7AA 3PVUA 1AWEA 3ZDTA 1XD4A 2D9WA 1OY2A 1SHCA 3PSCA 5DHFB 1MK7B 2DKPA 2NMBA 2D9VA 3D8EA 1IRSA 2Y7BA 1GG3A 5D3VA 2FJLA 2Z0OA 4PNKA 4DXAB 1V89A 4K17A 2H7DA 2KUPA 3O96A 2XQNM 2N23A 4C0AA 5DIFB 5C79A 2K2UA 3BINA 2UZRA 3BJIA 4WSFA 3U7DA 3HK0A 1FB8A 3KSYA 5EFXA 1X1GA 1FAOA 2I1JA 4K2OA 4YONA 2EC1A 5FI0A 2I5FA 2YT1A 4KVGB 5KQ4A 4F7UP 1ISNA 2RGNB 1Y5OA 1V5PA 2VSZA 1ZC4B 2DKQA 2QKLA 1ZM0A 3AJ4A 2I1KA 1BWNA 3ODXA 3ML4A 3QIJA 1U5GA 3SO6A 2W2WA 3HQCA 3P7ZA 1NU2A 3QWMA 1SGHA 5GOWB 2MWNB 2CY4A 3TO1A 3ZVRA 1X05A 4HAZB 1I2HA 2RLOA 2LOXA 1WVHA 3KZ1A 1WGQA 2D2QA 1QQGA 3PP2A 1M7EA 1UPRA 5D3XA 5D3WA 5JP4A 2D4QA 1MIZB 1XR0B 2YS3A 1FHWA 2R0DA 3RCPA 4NSWA 4CHMA 1XKEA 2LOZA 3PVLA 4GZUA 4L6EA 3P6AA 5CLQB 4HAUB 1KZGA 5C6RA 2UVMA 2M14A 4Z2MB 4EJNA 1ZVRA 4MK0A 3WA0A 2BCJA 1XX0A 2LKOA 1P5TA 2COCA 2RSGA 1NTYA 1U2BA 4ZRKA 1BTNA 2GJYA 2COFA 5HE0A 1EF1A 4WJ7A 3DXDA 2ZPYA 2N0YA 2Z0PA 2LG1A 1Y19B 3UZTA 2GCLA 1DDMA 1BAKA 4XWXA 2L1CA 1RRPB 3ODWA 2J0MA 1DROA 1EGXA 2AL6A 3F5RA 5C5BB 4Z2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UEF A;  3AU4 A;  1DYN A;  1TXD A;  4IFS A;  1U5F A;  4TYZ A;  4EKU A;  1WG7 A;  2DTC A;  5HE3 A;  2YS1 A;  2CAY A;  3DXE A;  2OTX A;  3SNH A;  4HAT B;  4B6H A;  1PFJ A;  2P0D A;  3CXB B;  4NY0 A;  1TQZ A;  1MK9 B;  1ZC3 B;  4GMV A;  4HHV A;  3QBV B;  5C5B A;  1M7R A;  1QC6 A;  3SYX A;  5J3Q A;  1AQC A;  1FOE A;  2YVC A;  1X1F A;  5FI1 A;  3AU5 A;  2VRW B;  4HB4 B;  1UNP A;  2R09 A;  1LB1 A;  1WGU A;  1FGZ A;  2OQB A;  2HE7 A;  2D9X A;  1XOD A;  5DHA B;  5J3Y A;  3ULB A;  1B55 A;  2YS5 A;  2D11 A;  2LYD A;  2J0K A;  2L2I A;  2YSZ A;  4K81 A;  2LUL A;  3ODO A;  1W1G A;  5KCV A;  1EVH A;  2DX1 A;  4A5K A;  5KQ1 A;  1WJM A;  3FSS A;  3MDB C;  4KHA A;  3TVV A;  2KGX B;  1UNQ A;  4F7H A;  2DLW A;  2J59 M;  1MPH A;  2CRF A;  4HDO A;  1UPQ A;  2DYQ A;  4HB0 B;  4D0N B;  1V88 A;  3PVW A;  1GC7 A;  4A6F A;  1X11 A;  2RVB B;  4KHO A;  4CHJ A;  4DBB A;  3M1I B;  4A6K A;  4H8S A;  2DA0 A;  2DHJ A;  3FM8 C;  2EJ8 A;  1FGY A;  4MY6 A;  2PZ1 A;  2V76 A;  4HAW B;  5DH9 B;  4CYE A;  2G35 A;  2DX5 A;  1WI1 A;  2E2X A;  1H4R A;  2YT0 A;  2DFK A;  1WJ1 A;  1ZSQ A;  1W1D A;  1H10 A;  2GS0 A;  2EMS A;  1XCG A;  3HW2 B;  4K2P A;  1GC6 A;  3TW1 A;  2ROZ B;  4DX8 A;  1J0W A;  3TFM A;  4GPT B;  3TCA A;  2P8V A;  4A6F B;  3GYO A;  4A6H A;  1BTK A;  4GN1 A;  1FHX A;  3KRW A;  5C16 A;  4HB2 B;  3PZD A;  1U5E A;  5DI9 B;  1KZ7 A;  1E5W A;  3F0W A;  1U29 A;  1NTV A;  2HTH B;  4WVF B;  2IYB A;  3CIK A;  2ROV A;  1K5G B;  1KI1 B;  3N7C A;  3PEG A;  3NSU A;  4ZRI A;  2P0F A;  2K00 A;  2P0H A;  1DBH A;  1RJ2 A;  1UNR A;  4GMX B;  4KAX B;  1V5M A;  1X86 A;  1LW3 A;  3A98 B;  2M38 A;  1MKE A;  2I5C A;  5LOP B;  2DHI A;  2YF0 A;  1N3H A;  2DN6 A;  2W2X C;  4ZRJ A;  3IVF A;  3VIA A;  3X23 A;  2DYN A;  2VKI A;  2Z0Q A;  4HAY B;  5JHH A;  2NZ8 B;  3MPX A;  2D9Z A;  5D27 A;  1NI2 A;  3VOQ A;  3WYF B;  3D8D A;  4GXB A;  5L81 A;  4KHB B;  3ULC A;  2YRY A;  5LON B;  3PG7 A;  3A8Q A;  4F7G A;  2ELB A;  1Z87 A;  4BBK A;  5HE1 A;  4HAX B;  1P3R A;  2DHK A;  5JLJ B;  4HDQ A;  5JHG A;  5D3Y A;  2Q13 A;  2Y8F A;  2RUK B;  1EAZ A;  3GYP A;  2W2X D;  2MDX A;  2IFS A;  3LJU X;  4EMO A;  1DDW A;  1U5D A;  2COD A;  1MAI A;  4Y94 A;  1V61 A;  3SUZ A;  1FHO A;  4HAV B;  2GCJ A;  3DXC A;  2COA A;  4TKN A;  1K5D B;  1OQN A;  2JP2 A;  2KCJ A;  3U8Z A;  3FEH A;  2MFQ A;  3A8P A;  4DX9 0;  2D10 A;  4IAP A;  3OAN A;  2D9Y A;  2K2J A;  1MIX A;  1TJ6 A;  2MKR A;  1J19 A;  1PLS A;  1V5U A;  3G9W A;  4P7I A;  3KRX A;  1P6S A;  1W1H A;  2ADZ A;  1DDV A;  1OMW A;  2H7E A;  2J0J A;  2QKM A;  2RNR B;  3KY9 A;  2Y8G A;  1PMS A;  2ELA A;  5HE2 A;  3V5W A;  2EMT A;  4YL8 A;  3SV1 A;  4PQ0 A;  5CLL B;  2AEH A;  5J3T A;  2CY5 A;  4HB3 B;  4IOY X;  2UZS A;  1U27 A;  2X18 A;  4MT7 A;  1Q67 A;  3T06 A;  3D8F A;  1I7A A;  3PVU A;  1AWE A;  3ZDT A;  1XD4 A;  2D9W A;  1OY2 A;  1SHC A;  3PSC A;  5DHF B;  1MK7 B;  2DKP A;  2NMB A;  2D9V A;  3D8E A;  1IRS A;  2Y7B A;  1GG3 A;  5D3V A;  2FJL A;  2Z0O A;  4PNK A;  4DXA B;  1V89 A;  4K17 A;  2H7D A;  2KUP A;  3O96 A;  2XQN M;  2N23 A;  4C0A A;  5DIF B;  5C79 A;  2K2U A;  3BIN A;  2UZR A;  3BJI A;  4WSF A;  3U7D A;  3HK0 A;  1FB8 A;  3KSY A;  5EFX A;  1X1G A;  1FAO A;  2I1J A;  4K2O A;  4YON A;  2EC1 A;  5FI0 A;  2I5F A;  2YT1 A;  4KVG B;  5KQ4 A;  4F7U P;  1ISN A;  2RGN B;  1Y5O A;  1V5P A;  2VSZ A;  1ZC4 B;  2DKQ A;  2QKL A;  1ZM0 A;  3AJ4 A;  2I1K A;  1BWN A;  3ODX A;  3ML4 A;  3QIJ A;  1U5G A;  3SO6 A;  2W2W A;  3HQC A;  3P7Z A;  1NU2 A;  3QWM A;  1SGH A;  5GOW B;  2MWN B;  2CY4 A;  3TO1 A;  3ZVR A;  1X05 A;  4HAZ B;  1I2H A;  2RLO A;  2LOX A;  1WVH A;  3KZ1 A;  1WGQ A;  2D2Q A;  1QQG A;  3PP2 A;  1M7E A;  1UPR A;  5D3X A;  5D3W A;  5JP4 A;  2D4Q A;  1MIZ B;  1XR0 B;  2YS3 A;  1FHW A;  2R0D A;  3RCP A;  4NSW A;  4CHM A;  1XKE A;  2LOZ A;  3PVL A;  4GZU A;  4L6E A;  3P6A A;  5CLQ B;  4HAU B;  1KZG A;  5C6R A;  2UVM A;  2M14 A;  4Z2M B;  4EJN A;  1ZVR A;  4MK0 A;  3WA0 A;  2BCJ A;  1XX0 A;  2LKO A;  1P5T A;  2COC A;  2RSG A;  1NTY A;  1U2B A;  4ZRK A;  1BTN A;  2GJY A;  2COF A;  5HE0 A;  1EF1 A;  4WJ7 A;  3DXD A;  2ZPY A;  2N0Y A;  2Z0P A;  2LG1 A;  1Y19 B;  3UZT A;  2GCL A;  1DDM A;  1BAK A;  4XWX A;  2L1C A;  1RRP B;  3ODW A;  2J0M A;  1DRO A;  1EGX A;  2AL6 A;  3F5R A;  5C5B B;  4Z2N A; 
#chains in the Genus database with same CATH topology
 1UEF A;  3AU4 A;  1DYN A;  1TXD A;  4IFS A;  1U5F A;  4TYZ A;  4EKU A;  1WG7 A;  2DTC A;  5HE3 A;  4DIX A;  2YS1 A;  2CAY A;  2Z4D A;  2OTX A;  3DXE A;  3SNH A;  4HAT B;  4B6H A;  1PFJ A;  2P0D A;  3CXB B;  4NY0 A;  1TQZ A;  1MK9 B;  1ZC3 B;  2YT2 A;  4GMV A;  4HHV A;  4CSQ A;  3QBV B;  5C5B A;  1M7R A;  1QC6 A;  3SYX A;  5J3Q A;  1AQC A;  1MI1 A;  1FOE A;  2YVC A;  1X1F A;  5FI1 A;  3AU5 A;  4QXA B;  2VRW B;  4HB4 B;  1UNP A;  2R09 A;  1LB1 A;  1WGU A;  3OHM B;  1FGZ A;  2OQB A;  4KHB A;  2HE7 A;  2Z13 A;  2D9X A;  1XOD A;  5DHA B;  5J3Y A;  3ULB A;  1B55 A;  5LG4 B;  2YS5 A;  2D11 A;  2LYD A;  2J0K A;  2L2I A;  2YSZ A;  4K81 A;  2LUL A;  3ODO A;  1W1G A;  5KCV A;  1EVH A;  2DX1 A;  1ZYI A;  4A5K A;  5KQ1 A;  1WJM A;  3FSS A;  3MDB C;  4KHA A;  3TVV A;  2KGX B;  1UNQ A;  4F7H A;  2DLW A;  2KIE A;  2J59 M;  1MPH A;  5I2M A;  2CRF A;  4HDO A;  1UPQ A;  2DYQ A;  4HB0 B;  4D0N B;  1V88 A;  3PVW A;  1GC7 A;  4A6F A;  1X11 A;  2RVB B;  3HSA A;  4KHO A;  4CHJ A;  4DBB A;  3M1I B;  4A6K A;  4H8S A;  2DA0 A;  2DHJ A;  3FM8 C;  2EJ8 A;  1FGY A;  4MY6 A;  2PZ1 A;  2V76 A;  4HAW B;  5DH9 B;  4CYE A;  2G35 A;  2DX5 A;  1WI1 A;  2E2X A;  5IRS A;  1H4R A;  2YT0 A;  2DFK A;  1WJ1 A;  4OSN A;  1ZSQ A;  2Z14 A;  1W1D A;  1H10 A;  2GS0 A;  2EMS A;  1XCG A;  2KR0 A;  3HW2 B;  4K2P A;  1GC6 A;  3TW1 A;  2ROZ B;  4DX8 A;  1J0W A;  3TFM A;  4GPT B;  3TCA A;  2P8V A;  4A6F B;  3GYO A;  4A6H A;  1BTK A;  4GN1 A;  1FHX A;  3KRW A;  5C16 A;  4HB2 B;  4QJ4 B;  3PZD A;  1U5E A;  5DI9 B;  1KZ7 A;  1E5W A;  3F0W A;  1U29 A;  1NTV A;  2HTH B;  4WVF B;  2IYB A;  3CIK A;  2ROV A;  1K5G B;  1KI1 B;  3PEG A;  3N7C A;  3NSU A;  4ZRI A;  2P0F A;  2K00 A;  2P0H A;  1DBH A;  1RJ2 A;  2FJU B;  2ZKM X;  1UNR A;  4GMX B;  4KAX B;  1V5M A;  1X86 A;  1LW3 A;  3A98 B;  2M38 A;  1MKE A;  2I5C A;  5LOP B;  2DHI A;  2YF0 A;  1N3H A;  2DN6 A;  2W2X C;  4ZRJ A;  3IVF A;  3VIA A;  3X23 A;  2Z59 A;  2DYN A;  2VKI A;  1T77 A;  2Z0Q A;  4HAY B;  5JHH A;  2NZ8 B;  3MPX A;  4OT1 A;  2D9Z A;  5D27 A;  1NI2 A;  3VOQ A;  3WYF B;  3D8D A;  4GXB A;  5L81 A;  4KHB B;  3ULC A;  2YRY A;  3NWF A;  3NWA A;  3FVC A;  5LON B;  3PG7 A;  4L1R A;  3A8Q A;  4F7G A;  2ELB A;  1Z87 A;  4BBK A;  5HE1 A;  4HAX B;  1P3R A;  3NW8 A;  2DHK A;  5JLJ B;  4HDQ A;  5JHG A;  5D3Y A;  2Q13 A;  2Y8F A;  2RUK B;  1EAZ A;  3GYP A;  2K8E A;  2W2X D;  2MDX A;  2IFS A;  3LJU X;  4EMO A;  1DDW A;  1U5D A;  2COD A;  1MAI A;  4Y94 A;  1V61 A;  3SUZ A;  1FHO A;  4HAV B;  2GCJ A;  3DXC A;  2COA A;  4TKN A;  1K5D B;  1OQN A;  2JP2 A;  2KCJ A;  3U8Z A;  5I2S A;  3FEH A;  2MFQ A;  3A8P A;  4DX9 0;  2K49 A;  2D10 A;  4IAP A;  3OAN A;  2D9Y A;  2K2J A;  1MIX A;  1TJ6 A;  2MKR A;  1PLS A;  1J19 A;  1V5U A;  3G9W A;  4P7I A;  3KRX A;  1P6S A;  1W1H A;  2ADZ A;  2KIG A;  1DDV A;  1OMW A;  2H7E A;  2J0J A;  2QKM A;  2RNR B;  3KY9 A;  2Y8G A;  1PMS A;  2ELA A;  5HE2 A;  3V5W A;  2EMT A;  4YL8 A;  3SV1 A;  4PQ0 A;  5CLL B;  2AEH A;  5J3T A;  2CY5 A;  4HB3 B;  3A58 A;  4IOY X;  2UZS A;  1U27 A;  2X18 A;  4MT7 A;  1Q67 A;  3T06 A;  3D8F A;  1I7A A;  3PVU A;  1AWE A;  3ZDT A;  1XD4 A;  2D9W A;  1OY2 A;  1SHC A;  3PSC A;  5M4Y B;  5DHF B;  1MK7 B;  2DKP A;  2NMB A;  2D9V A;  3D8E A;  1IRS A;  2Y7B A;  1GG3 A;  5D3V A;  2FJL A;  2Z0O A;  4PNK A;  4DXA B;  1V89 A;  4K17 A;  4QJ3 B;  2H7D A;  2KUP A;  3O96 A;  2XQN M;  2R2Y A;  3NWD A;  2N23 A;  4C0A A;  5DIF B;  5C79 A;  2K2U A;  3BIN A;  2UZR A;  3BJI A;  4WSF A;  3U7D A;  3HK0 A;  1FB8 A;  3KSY A;  5EFX A;  1X1G A;  1FAO A;  2I1J A;  4K2O A;  4YON A;  2EC1 A;  5FI0 A;  2I5F A;  2YT1 A;  3B77 A;  4KVG B;  5KQ4 A;  4F7U P;  1ISN A;  2RGN B;  1Y5O A;  1V5P A;  2VSZ A;  1ZC4 B;  2DKQ A;  2QKL A;  1ZM0 A;  3AJ4 A;  2I1K A;  2KUQ A;  1BWN A;  3ODX A;  3ML4 A;  3QIJ A;  1U5G A;  4QJ5 B;  3SO6 A;  2W2W A;  3HQC A;  3P7Z A;  1NU2 A;  3QWM A;  1SGH A;  5GOW B;  2MWN B;  2CY4 A;  3HIE A;  3TO1 A;  3ZVR A;  1X05 A;  4HAZ B;  1I2H A;  2RLO A;  3DCX A;  2LOX A;  1WVH A;  3KZ1 A;  1WGQ A;  2D2Q A;  1QQG A;  3PP2 A;  1M7E A;  1UPR A;  5D3X A;  5D3W A;  5JP4 A;  2D4Q A;  1MIZ B;  1XR0 B;  2YS3 A;  1FHW A;  2R0D A;  3RCP A;  4NSW A;  4CHM A;  1XKE A;  2LOZ A;  3PVL A;  4GZU A;  4L6E A;  3P6A A;  5CLQ B;  4HAU B;  4GNK B;  1KZG A;  5C6R A;  2UVM A;  2M14 A;  4Z2M B;  4EJN A;  1ZVR A;  4MK0 A;  2RRF A;  4HSI A;  3WA0 A;  2BCJ A;  1XX0 A;  2LKO A;  1P5T A;  2COC A;  2RSG A;  1NTY A;  1U2B A;  4ZRK A;  1BTN A;  2GJY A;  2COF A;  5HE0 A;  1EF1 A;  4WJ7 A;  4D6W A;  2NBV A;  3DXD A;  2ZPY A;  2N0Y A;  2Z0P A;  2LG1 A;  3U12 A;  1Y19 B;  3UZT A;  2GCL A;  1DDM A;  1BAK A;  4XWX A;  2GUM A;  2L1C A;  4GOU A;  1RRP B;  3ODW A;  2J0M A;  1DRO A;  1EGX A;  2AL6 A;  3F5R A;  5C5B B;  4Z2N A; 
#chains in the Genus database with same CATH homology
 1UEF A;  3AU4 A;  1DYN A;  1TXD A;  4IFS A;  1U5F A;  4TYZ A;  4EKU A;  1WG7 A;  2DTC A;  5HE3 A;  2YS1 A;  2CAY A;  3DXE A;  2OTX A;  3SNH A;  4HAT B;  4B6H A;  1PFJ A;  2P0D A;  3CXB B;  4NY0 A;  1TQZ A;  1MK9 B;  1ZC3 B;  4GMV A;  4HHV A;  3QBV B;  5C5B A;  1M7R A;  1QC6 A;  3SYX A;  5J3Q A;  1AQC A;  1FOE A;  2YVC A;  1X1F A;  5FI1 A;  3AU5 A;  2VRW B;  4HB4 B;  1UNP A;  2R09 A;  1LB1 A;  1WGU A;  1FGZ A;  2OQB A;  2HE7 A;  2D9X A;  1XOD A;  5DHA B;  5J3Y A;  3ULB A;  1B55 A;  2YS5 A;  2D11 A;  2LYD A;  2J0K A;  2L2I A;  2YSZ A;  4K81 A;  2LUL A;  3ODO A;  1W1G A;  5KCV A;  1EVH A;  2DX1 A;  4A5K A;  5KQ1 A;  1WJM A;  3FSS A;  3MDB C;  4KHA A;  3TVV A;  2KGX B;  1UNQ A;  4F7H A;  2DLW A;  2J59 M;  1MPH A;  2CRF A;  4HDO A;  1UPQ A;  2DYQ A;  4HB0 B;  4D0N B;  1V88 A;  3PVW A;  1GC7 A;  4A6F A;  1X11 A;  2RVB B;  4KHO A;  4CHJ A;  4DBB A;  3M1I B;  4A6K A;  4H8S A;  2DA0 A;  2DHJ A;  3FM8 C;  2EJ8 A;  1FGY A;  4MY6 A;  2PZ1 A;  2V76 A;  4HAW B;  5DH9 B;  4CYE A;  2G35 A;  2DX5 A;  1WI1 A;  2E2X A;  1H4R A;  2YT0 A;  2DFK A;  1WJ1 A;  1ZSQ A;  1W1D A;  1H10 A;  2GS0 A;  2EMS A;  1XCG A;  3HW2 B;  4K2P A;  1GC6 A;  3TW1 A;  2ROZ B;  4DX8 A;  1J0W A;  3TFM A;  4GPT B;  3TCA A;  2P8V A;  4A6F B;  3GYO A;  4A6H A;  1BTK A;  4GN1 A;  1FHX A;  3KRW A;  5C16 A;  4HB2 B;  3PZD A;  1U5E A;  5DI9 B;  1KZ7 A;  1E5W A;  3F0W A;  1U29 A;  1NTV A;  2HTH B;  4WVF B;  2IYB A;  3CIK A;  2ROV A;  1K5G B;  1KI1 B;  3N7C A;  3PEG A;  3NSU A;  4ZRI A;  2P0F A;  2K00 A;  2P0H A;  1DBH A;  1RJ2 A;  1UNR A;  4GMX B;  4KAX B;  1V5M A;  1X86 A;  1LW3 A;  3A98 B;  2M38 A;  1MKE A;  2I5C A;  5LOP B;  2DHI A;  2YF0 A;  1N3H A;  2DN6 A;  2W2X C;  4ZRJ A;  3IVF A;  3VIA A;  3X23 A;  2DYN A;  2VKI A;  2Z0Q A;  4HAY B;  5JHH A;  2NZ8 B;  3MPX A;  2D9Z A;  5D27 A;  1NI2 A;  3VOQ A;  3WYF B;  3D8D A;  4GXB A;  5L81 A;  4KHB B;  3ULC A;  2YRY A;  5LON B;  3PG7 A;  3A8Q A;  4F7G A;  2ELB A;  1Z87 A;  4BBK A;  5HE1 A;  4HAX B;  1P3R A;  2DHK A;  5JLJ B;  4HDQ A;  5JHG A;  5D3Y A;  2Q13 A;  2Y8F A;  2RUK B;  1EAZ A;  3GYP A;  2W2X D;  2MDX A;  2IFS A;  3LJU X;  4EMO A;  1DDW A;  1U5D A;  2COD A;  1MAI A;  4Y94 A;  1V61 A;  3SUZ A;  1FHO A;  4HAV B;  2GCJ A;  3DXC A;  2COA A;  4TKN A;  1K5D B;  1OQN A;  2JP2 A;  2KCJ A;  3U8Z A;  3FEH A;  2MFQ A;  3A8P A;  4DX9 0;  2D10 A;  4IAP A;  3OAN A;  2D9Y A;  2K2J A;  1MIX A;  1TJ6 A;  2MKR A;  1J19 A;  1PLS A;  1V5U A;  3G9W A;  4P7I A;  3KRX A;  1P6S A;  1W1H A;  2ADZ A;  1DDV A;  1OMW A;  2H7E A;  2J0J A;  2QKM A;  2RNR B;  3KY9 A;  2Y8G A;  1PMS A;  2ELA A;  5HE2 A;  3V5W A;  2EMT A;  4YL8 A;  3SV1 A;  4PQ0 A;  5CLL B;  2AEH A;  5J3T A;  2CY5 A;  4HB3 B;  4IOY X;  2UZS A;  1U27 A;  2X18 A;  4MT7 A;  1Q67 A;  3T06 A;  3D8F A;  1I7A A;  3PVU A;  1AWE A;  3ZDT A;  1XD4 A;  2D9W A;  1OY2 A;  1SHC A;  3PSC A;  5DHF B;  1MK7 B;  2DKP A;  2NMB A;  2D9V A;  3D8E A;  1IRS A;  2Y7B A;  1GG3 A;  5D3V A;  2FJL A;  2Z0O A;  4PNK A;  4DXA B;  1V89 A;  4K17 A;  2H7D A;  2KUP A;  3O96 A;  2XQN M;  2N23 A;  4C0A A;  5DIF B;  5C79 A;  2K2U A;  3BIN A;  2UZR A;  3BJI A;  4WSF A;  3U7D A;  3HK0 A;  1FB8 A;  3KSY A;  5EFX A;  1X1G A;  1FAO A;  2I1J A;  4K2O A;  4YON A;  2EC1 A;  5FI0 A;  2I5F A;  2YT1 A;  4KVG B;  5KQ4 A;  4F7U P;  1ISN A;  2RGN B;  1Y5O A;  1V5P A;  2VSZ A;  1ZC4 B;  2DKQ A;  2QKL A;  1ZM0 A;  3AJ4 A;  2I1K A;  1BWN A;  3ODX A;  3ML4 A;  3QIJ A;  1U5G A;  3SO6 A;  2W2W A;  3HQC A;  3P7Z A;  1NU2 A;  3QWM A;  1SGH A;  5GOW B;  2MWN B;  2CY4 A;  3TO1 A;  3ZVR A;  1X05 A;  4HAZ B;  1I2H A;  2RLO A;  2LOX A;  1WVH A;  3KZ1 A;  1WGQ A;  2D2Q A;  1QQG A;  3PP2 A;  1M7E A;  1UPR A;  5D3X A;  5D3W A;  5JP4 A;  2D4Q A;  1MIZ B;  1XR0 B;  2YS3 A;  1FHW A;  2R0D A;  3RCP A;  4NSW A;  4CHM A;  1XKE A;  2LOZ A;  3PVL A;  4GZU A;  4L6E A;  3P6A A;  5CLQ B;  4HAU B;  1KZG A;  5C6R A;  2UVM A;  2M14 A;  4Z2M B;  4EJN A;  1ZVR A;  4MK0 A;  3WA0 A;  2BCJ A;  1XX0 A;  2LKO A;  1P5T A;  2COC A;  2RSG A;  1NTY A;  1U2B A;  4ZRK A;  1BTN A;  2GJY A;  2COF A;  5HE0 A;  1EF1 A;  4WJ7 A;  3DXD A;  2ZPY A;  2N0Y A;  2Z0P A;  2LG1 A;  1Y19 B;  3UZT A;  2GCL A;  1DDM A;  1BAK A;  4XWX A;  2L1C A;  1RRP B;  3ODW A;  2J0M A;  1DRO A;  1EGX A;  2AL6 A;  3F5R A;  5C5B B;  4Z2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...