3OBBA

Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
295
Chain Sequence
MKQIAFIGLGHMGAPMATNLLKAGYLLNVFDLVQSAVDGLVAAGASAARSARDAVQGADVVISMLPASQHVEGLYLDDDGLLAHIAPTLVLECSTIAPTSARKIHAAARERGLAMLDAPVSGGTAGAAAGTLTFMVGGDAEALEKARPLFEAMGRNIFHAGPDGAGQVAKVCNNQLLAVLMIGTAEAMALGVANGLEAKVLAEIMRRSSGGNWALEVYNPWPGVMENAPASRDYSGGFMAQLMAKDLGLAQEAAQASASSTPMGSLALSLYRLLLKQGYAERDFSVVQKLFDPTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 3-hydroxyisobutyrate dehydrogenase
publication title Biochemical and Structural Studies of Uncharacterized Protein PA0743 from Pseudomonas aeruginosa Revealed NAD+-dependent L-Serine Dehydrogenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 99
structure length 295
sequence length 296
ec nomenclature ec 1.1.1.387: L-serine 3-dehydrogenase (NAD(+)).
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3obbA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3obbA01
3ZWVA 2J5QA 2P68A 3RFTA 2D8AA 2AE1A 2BFPA 3KRTA 3DAPA 1PJCA 2E37A 5JDCC 4NG5A 1J0XO 3V2HA 1E7RA 4RVHA 1DLIA 5FI3A 3UVEA 3PQFA 1X1TA 4RJTA 1CF2O 4MVJF 1MXHA 3GVPA 4XR9A 1V0JA 3DR3A 3Q9UA 4QFDA 2NTNA 4UVEA 1B16A 1R4MA 4R3NA 1ZEJA 2O2YA 4CM8A 4AJPA 4AJJA 1MC4A 1PJSA 4YPOA 4XKJA 2NTVA 3FF4A 4RPLA 4JJFA 4IS2A 5TNXA 4A03A 2VYVD 1C0LA 1EBFA 3C1OA 1Q0QA 4J4HA 1UXHA 2HLPA 2ZQYA 2JL1A 1Q2XA 4XGIA 4WKGA 2A9FA 1ENYA 4WNCA 3ROQA 3ICCA 3D0OA 5T5QA 4J0FA 5GMOA 2AQKA 1MLDA 4FGSA 3E03A 2Z1NA 1M6HA 1YOVA 3GG9A 2DUWA 2PZMA 1HL3A 4L4XA 3PTZA 5ENDA 3FPCA 2FZEA 1H5QA 3DAFA 3FBGA 4Q3EA 2RBEA 2CVQA 1CQJA 2QIOA 4BVAA 5ITWA 3VH1A 4UVIA 1WZEA 5IAAA 4L8VA 3AI2A 3WXBA 1GD1O 1F0YA 5F21A 4TROA 4IXTA 3GUCA 3GPDG 2X5KO 3D3WA 1ZUD1 5JAQA 3FD8A 1JDJA 3DZKA 4AJKA 3DZGA 3OJFA 1C14A 2CVOA 4WE3A 3ETEA 3AU9A 4QSMA 1LLUA 5B4VA 4IIVA 4IINA 1WWKA 2DC1A 2JJYA 4JP3A 2RIRA 4D44A 1MG0A 3IP1A 3DZIA 5HTOA 3Q2IA 4WCFA 5LDGA 3ZZNA 4JROA 3HFGA 2WYUA 2OBYA 4JXKA 3QE3A 4F46A 3PGXA 3VZSA 1GQ2A 4WPGA 2EJVA 1EUZA 4R5HA 1M67A 3P2YA 4KMSA 4FJ2A 4YBZA 3GDFA 1A9YA 1HWYA 3S2IA 3ICPA 3LDHA 2X0JA 2WD8A 3ZCXA 4LSWA 2I65A 2V6FA 2WYWA 3DEYX 3DONA 4QT0A 3VC7A 1XCBA 3KYCB 2G5CA 1GZ6A 1ZMOA 4HP8A 3DFUA 2HK7A 2IDZA 3PQEA 4I9HA 4N54A 2C2XA 4CM9D 1BMDA 1ZKMA 2EEZA 2OZPA 1K6XA 3SC4A 3HG7A 2X5JO 5A3JA 1ZK1A 3PYMA 4J16A 1T4BA 4CM6A 1HRDA 3VZQA 1UP6A 2Q99A 2PGJA 5L45A 4N5LA 1LRKA 4DUPA 1HYGA 1WDLA 3QVWA 3CINA 1DAPA 1XU7A 5KVVA 3QHAA 4CR7A 3WBFA 1Z7BA 2HK8A 1I2BA 5JYDA 5I7SA 3DXFA 2Q49A 5CFZA 4BMNA 5GZ6A 2UUOA 1B0AA 4N5NA 3DMTC 5COAA 3BMQB 1ISHA 2Y1GA 2PGLA 3E1KA 3VZRA 2JAHA 4OSPA 5ILGA 5DULA 1GYRA 1X1EA 2BFMA 2X23A 4BMSA 3NKLA 4I08A 4K26A 3T4EA 2VOEA 1T4DA 5TT0A 3FNEA 2AEFA 3SLGA 2FSSA 3E82A 4A5OA 3IJRA 4TZTA 1E6UA 3IP3A 3HWRA 5DCUA 3GH3A 4GQAA 2X6TA 4PRKA 2I66A 1WXDA 1O0SA 3LYLA 4IJVA 4C7JA 1QV6A 3IQDB 2LDBA 3H9QA 3NTQA 2EP5A 3JYLA 1Z74A 2V6MA 1I2ZA 1KBZA 4ALKA 4QTZA 1Y8RB 4BL5A 4GWKA 4MKXA 3QWBA 5CEEA 2Y67A 4UAGA 4YB8A 3VPFA 1YE3A 2D1YA 4JCOA 4KUHA 1EVJA 1EZ4A 1IB6A 2JD2A 2P91A 1KVSA 1U1IA 1PWZA 2IYOA 2VN8A 3WTBA 3EW7A 4CMGA 1VJTA 5DF1A 4W7HA 3AI1A 4F45A 5KKAA 2DFVA 4D79A 1UXJA 5TS3A 3RVDA 4BNVA 4I5GA 3ROKA 5TSDA 4BNWA 4YAIA 3IMFA 4CLRB 3INGA 3KSUA 3H9UA 1E3JA 1DHTA 2NQ8A 2X9GA 2ILTA 4WLFA 1B14A 3RASA 4Z0HO 4IDBA 2ZJ0A 3DAGA 3B1JA 3GT0A 5I8ZA 4EEZA 3C3XA 4WEOA 4BGEA 2EWMA 2W2LD 1MB4A 3LT2A 1Z82A 3L6DA 4L73A 1RM4A 1LLDA 3ZV6A 2FR1A 3RBZA 2H9IA 4ALNA 4BO9A 1E3SA 1KEVA 3P7MA 1AXGA 2YY7A 3I23A 4J1QA 4MVJH 1DC6A 2B37A 5F5NA 1R4NB 4WOKA 4BV8A 1A72A 3LLVA 4F3YA 4D0SA 3KSDO 2X22A 1MFZA 1GEEA 1X0VA 2ZK7A 1HT0A 4RQUA 1YXMA 1Z6ZA 1NPTO 3AOEC 3B1FA 3PHIA 3VH3A 4CMEC 1GTMA 4B7UA 1VJ0A 5L53A 4MVJI 2AXQA 3ZH2A 1QXSA 3W1VA 4Q3BA 1EK5A 1UP7A 1L7DA 2I67A 3VVBA 1LBEA 3U49A 2W98A 1PZEA 3PVZA 5B37A 1SC6A 4P38A 4CM1A 2AHRA 2HAEA 3WMWA 3WX0A 5EMHA 2OO5A 2GSDA 5TLSA 4NJMA 4XQGA 5DBFA 1UXKA 1UDAA 1SBYA 1DIAA 3KSZO 3JD1A 2NTJA 1QLHA 5ENVA 3DHYA 3GG2A 4WK6A 5C7IO 4YXFA 2P4QA 2B4RO 2J6IA 4CUZA 4E30A 5LDHA 1HZJA 5HBRA 1UZNA 2BRUA 4CM4A 5TC4A 3OBBA 1NR7A 2WWRA 4E2XA 1DFHA 3JQBA 3ULKA 3I9NA 1P3DA 1X7DA 4N18A 4BKOA 2O2SA 4GSKA 4ZU3A 1YH3A 4EI2A 2P4HX 2G76A 4YYZA 1B26A 2XOXA 1N9GB 3PYLA 3NJ4A 2X86A 1PL6A 3ZW8A 3IC5A 1U4OA 1PL7A 4M55A 4AJOA 4AFNA 3ZW9A 3NTOA 4ZJUA 1R0SA 2IXBA 3ENKA 2VRCA 3NT2A 4PRLA 1V8BA 1NXQA 3GAFA 1MG5A 1I8TA 1FK8A 4P22A 1JKJA 2Y1CA 3WOHA 3C7AA 3EZLA 3CE6A 4RZIA 2NU7A 4QEDA 4DMLA 3UKOA 4ZN6A 4Y8VA 4UUMA 3ASUA 5A9RA 3EGOA 2XF8A 2PA3A 1ID1A 3MJTA 1KVRA 1PQWA 1RYEA 3OHSX 3WQSB 1J5PA 3IAHA 1YWGO 2NVUA 4EUEA 5T8KA 4CLOA 1GZ3A 1IPFA 2J3JA 1PGNA 3FTNA 3G1UA 3GMDA 3MOGA 3OJEA 4FFOA 4YAJA 2BKAA 5JCJD 3HDJA 3WMXA 1VC2A 4Z6KA 4B4UA 2HK9A 4L4SA 4MPDA 3WNQA 3OECA 4CMIB 1PSDA 3PWSA 1ZCJA 3OA0A 2PZLA 4MVJP 1U2DA 4NIMA 4BNLA 3CMMA 5IFLA 3DBRA 1CJCA 2VNAA 3K9QO 1H9BA 4ND1A 3KYDA 4RF5A 2Q2VA 2EV9A 5DZSA 4A26A 4CQLA 3RQSA 2NU9A 1YL6A 3D4OA 1SO8A 3WS7A 3KHUA 5LC1A 4W6ZA 3ONDA 3PHHA 4GX5A 1GUZA 4OAQA 3UOGA 3PDJA 4L9RA 4XB2A 5A9TA 5KWEA 4MP3A 3K2EA 3WFJA 1JA9A 4BNTA 1V3VA 4AJIA 2R00A 3QWHA 4G2NA 1KEUA 3HADA 1R16A 1UAYA 1LEHA 5JPIA 4II3A 3K92A 4IMRA 1MGOA 2C5EA 3AU8A 4H3VA 4EW6A 2E48A 5C7LO 3OIFA 1TI7A 4CM7A 4QQRA 1DFIA 2AEMA 4PZCA 3KUXA 4IDDA 4BNXA 3H9EO 1D3AA 1XWFA 1I30A 3GNQA 4LCJA 4WASA 5IDYA 5H83A 3DMYA 3AM3A 3RAJA 1I3LA 4IZIA 2NADA 2NUAA 3QA9A 5AXBA 5I9LA 1C0IA 2YQ5A 3LSYA 5ICSA 1UP4A 1ZK2A 4NPCA 3WG9A 3TZ6A 2B83A 4DWVA 4E2WA 3WWYA 4R51A 4GMFA 5H81A 5ADHA 2AE2A 1AXEA 1CEQA 2Q4BA 4NBUA 3S2GA 4BIIA 4B3IA 2CVZA 3AUUA 4W99A 1E7WA 3RI3A 1U3UA 2O4CA 4GKBA 1PJBA 1TLTA 2A92A 4NK5A 1JN0A 2JFFA 2UUPA 2ZCUA 3P19A 3M2TA 4ZD6A 4UEOA 4J90A 1YQGA 2I3GA 4GVXA 2CZCA 4P4GA 3A1NA 3H3FA 3WR5A 1WVGA 5TF4A 1R37A 3ZNOA 1E1KA 1X7HA 2GERA 1O9BA 1R12A 3G3EA 3QVTA 4HX5A 2DUUA 3PHGA 1U8FO 3H65A 4YRAA 3EC7A 5T57A 4MJLA 4E2YA 2GZ1A 5KVQA 3TFOA 2C82A 2QQ5A 1P0CA 1P1RA 1YL5A 2B5WA 3BMCB 3IKTA 1HDXA 4IPTA 4J91A 1B3BA 3H3JA 2PKQP 1ULUA 3KYBA 4IMPA 4RF2A 2R6JA 2XPCA 4O63O 1BGVA 1GPDG 1X13A 4A73A 4CJXA 4ZRNA 2JHFA 1NQOA 2I76A 3LF2A 1HEUA 3O9ZA 4MOWA 5GZ3A 1UDCA 1P1HA 4MVJD 4U7WA 3NT5A 1YKFA 6LDHA 1UAGA 4TRMA 1HSOA 5FI5A 3KV3O 2PD4A 1MP0A 2NM0A 4I5EA 2H5LA 2CMDA 4PVDA 1C0PA 2VHWA 4BO0A 1H6AA 2IE0A 2FP4A 3KYCA 4I5FA 4GVLA 1RWBA 3D64A 5F5LA 1B7GO 4S3MA 2NV6A 5F1PA 5AQ1A 2FPGA 1M76A 1IHYA 4YAGA 4D3FA 4IDAA 4ALJA 4D3SA 1N7HA 4QUKA 2I99A 3EY4A 3ZU5A 3AM5A 4IGFA 4OYRA 5JC8A 2YYYA 3K5PA 4HFJA 5T6BA 4AVYA 4E3ZA 1B8VA 2O7SA 1GADO 2QHXA 3E48A 7ADHA 4DBVO 3WGZA 3G0OA 1R0KA 2B4TO 4HFMA 4Y98A 1H6CA 1PS0A 3BZUA 4P4LA 1X0XA 5HRUA 4YWJA 5IDXA 1M6WA 4CQMD 4DIFA 2EGGA 1HDCA 2OHXA 3IL2A 3JCZA 1LRJA 2O3QA 4RVUA 3MWEB 3ZHZA 1PTJA 3NDJA 1DDOA 2J5RA 4ESOA 3BMQA 3GEGA 1UUFA 3LC7O 4RGBA 3H6KA 1VKOA 1K6JA 1PS8A 2Q3EA 3OP4A 4O6VA 4Y9DA 1HLPA 3DDNA 5G0TA 4DQUA 3EHEA 3U0BA 3O4RA 4XJSA 3DTYA 4KQWA 3R3SA 1XQ6A 2O3UA 3CZMA 3HHPA 1ONOA 2UVDA 2WDZA 4JP2A 1YJQA 3VDQA 1NP3A 1T2CA 4RLHA 4LISA 3VPGA 4CV1A 1PGPA 2CDBA 2FR8A 4A27A 4OQYA 1I3KA 1Y7TA 4DPKA 3ETDA 2PFGA 2PH5A 4WLNA 2ZB3A 2DBZA 4EUHA 5B1YA 2FPPA 2IYPA 4YEDA 1SOWA 1Y8RA 1HYHA 3JQFC 5DN9A 1ZXLA 3F1KA 5EESA 3U4HA 1KEPA 4U0KA 3UN1A 4Z0PA 2VUSA 4WNIA 3KTDA 3LF1A 2O3SA 2J3IA 1LDYA 3PJFA 1DJQA 2Y99A 2ZTLA 5JO0A 1E3LA 4FIZA 4BNHA 4BO6A 2RHCA 3VKVA 4ND3A 2PLAA 3GGOA 5IG2A 3RC1A 3VPHA 4IBOA 2AQIA 2JFHA 4CLRA 3E5RA 4NZ9A 3SJUA 3A4VA 3FRJA 3OQ1A 3BYZA 2QYTA 4CMAA 5JYEA 5KJCA 5A06A 4QO7A 1IPEA 4ITUA 2X9VA 4OXKA 3E6AA 3FSRA 3F9IA 4GGPA 1E92A 5G4KA 1O6ZA 2W8ZA 2HRZA 2QRKA 2QW8A 4DYDA 3SBOA 4NH4A 3VDRA 3KVOA 5HWSA 2PNFA 1DOHA 3MJ4A 4FJ0A 4BNZA 1E6EA 3CEAA 3OH8A 4KDFA 5L7YA 3RCBA 4BKPA 4EDFA 2DVMA 1VL6A 3AI3A 5THKA 3ZV5A 1R4NA 4HBGA 4XIJA 2DU8A 2OGUA 4IUYA 5K6AC 3KB6A 4H16A 1EK6A 4FBGA 3NX4A 1EEHA 1FJHA 4MP6A 1RM5A 1ENZA 2GZ3A 3ZHXA 1HKUA 3Q2KA 4J49A 2ZQZA 1HE5A 2VYNA 1HXHA 1O89A 3R1IA 5AXCA 2DM6A 1VI2A 3CPSA 4IIUA 4XZ3A 2GN6A 1C3VA 3MWDB 5HM8A 1T1RA 2ZB4A 4R3WA 2JFGA 3AY3A 5BSHA 4RPJA 2NVWA 2A4KA 3K30A 2NWQA 3WGHA 2GD1O 5JY1A 1XIVA 4RF3A 4FD3A 2AQHA 4JNKA 2Y1OA 2I6TA 5EL0A 4FFLA 1VJ1A 1ZK3A 2OBNA 5BNFA 3IKVA 1SEPA 3WSWA 1LU9A 4GX0A 5IZCA 1NYTA 1XLTA 1GZ4A 2G17A 3A9WA 3GZ4A 3D5TA 3TL2A 3JQ9A 1QYCA 2VWPA 1Y9AA 3W4IA 2JCYA 4E5NA 3I5MA 2IODA 1PEDA 4NI5A 4FS3A 4J1SA 2E49A 3TOZA 2VHXA 4J2OA 1F8GA 3AFNA 5JBIA 1N9GA 3L9XA 3RUEA 5ES3A 3OQBA 1BVUA 4IJKA 4R5MA 3UUWA 5G2OA 1PZHA 3HUDA 3DC2A 3WTCA 4D42A 2CDAA 1JAXA 1FDVA 4ZQFA 2RCYA 3AOGA 5G0WA 3WYBA 3T7CA 5KVSA 1E3WB 1E3EA 4XJTA 1W8DA 2GN4A 5F3RA 2GR9A 4J0EA 2GN8A 2BF7A 2VNSA 1NVGA 4WLUA 3TQHA 2W2LA 1U2GA 1NR1A 1S6YA 5CG2A 3B1KA 4LW8A 3JSAA 2IXAA 2Q45A 4LSMA 3FN4A 1SB8A 2O7QA 3T7EA 5BR7A 5L7TA 1A4UA 4D0RA 4CODB 4GWGA 5C5IA 3VHRA 4W4TA 5A5FA 1FDUA 2IZ1A 2EKPA 1XU9A 4FJ1A 5KJ1A 5COBA 1UZMA 4YT8A 3GZNB 1YRLA 3OQ6A 1YQXA 2RH4A 4CLXA 3NAQA 4HUJA 4YR9A 3OICA 1EE9A 3BAZA 3L4SO 4U8GA 1XDWA 1Y5MA 1U5CA 4UUNA 1I36A 4BNYA 1GDHA 1ZJZA 4CMIA 1T2EA 4UUPA 3WGYA 4BNMA 3K2BA 2POQX 4J9UE 2V6GA 4M49A 1DSSG 1SPXA 3W8EA 1I0ZA 2OP1A 2X0RA 1XQ1A 4K28A 4GMGA 2EJWA 2AG8A 3JQBC 1YDEA 5JAMA 1W0CA 1HDZA 4ALMA 4Z0TA 4BNUA 4BUCA 3HDHA 4C4OA 3CTVA 2B4QA 5T67A 1DLJA 3N7UA 4UEJA 2NU6A 4GX1A 1N1EA 4HNGA 2O3JA 2YJZA 4HY3A 3GMSA 4BGUA 1D1SA 3NT4A 4J3FA 1KIFA 4L75A 3ZGYA 4JN6B 1ORRA 3MTJA 5HA5A 3D5QA 3LC1O 3VPXA 1PWXA 2FY8A 4K6FA 3BMOB 2AMFA 3RU9A 1HE3A 3UFXA 4ALIA 3ENNA 5FWNA 1QYWA 2C5AA 2X5OA 2YUTA 4UVHA 1NAHA 2AEJA 1M66A 3H7AA 2J5KA 4WGGA 2D0IA 3PLNA 1E6WA 1WAMA 1EDZA 3QVXA 1UDBA 5A04A 2JHGA 4HNHA 4IDEA 4PIVA 4LMPA 4W7IA 1X14A 3WGTA 4INAA 4K6CA 4YVFA 4LVCA 2WJPA 2HDHA 4AJ4A 1DO8A 2XXBA 1NFRA 4RPKA 1YBMA 3K6JA 2DPGA 1DC4A 1RM0A 5T8KC 1MUUA 2VWHA 1ISIA 2O50A 2XAAA 5CDSA 4DIBA 1ADFA 3EAGA 2PTGA 2Z5LA 1VL0A 4RQTA 3N58A 4EZBA 5I7VA 4O0LA 4KTVE 1ZZEA 3K73O 5CAEA 4PFJA 4IXWA 4PLTA 3HB5X 1U28A 4MVJE 4YJDA 1VL8A 4FFPA 3I83A 1LLQA 2RH8A 1WNTA 5A3VA 2GDZA 3F3SA 2CFCA 4DPMA 2FWMX 3STHA 2IRWA 3CXRA 4RCVA 1QYDA 4RDIA 1T26A 3DHNA 4TZKA 3ADOA 3BMCA 5ITVA 1K3TA 2A35A 2R00C 2B36A 3LLSA 4OGWA 1ML3A 3ZI0A 4GGOA 4OJNA 2PR2A 5ER9A 4BO2A 1KVUA 4ZQBA 3NUGA 2WD7B 4XQEA 1A71A 1ZBQA 2H6EA 3LU1A 5DBIA 3I52A 2EKLA 4GSLA 5G4KB 1A9ZA 2I5PO 4LRTB 3PDUA 1OC2A 1A4IA 1P77A 4Z9XA 1QRRA 1PX0A 2YDYA 2BHLA 3DQPA 4N7RA 3PFWO 5U1PA 3I9LA 3IDSA 4IQ8A 1LLCA 3GVHA 5G0UA 4J9VA 3TN7A 3ZNPA 1EQ2A 3W8DA 4B7CA 4DTIA 5JO9A 3E9QA 5IJZA 1T25A 4R9RA 1I5RA 3ZU3A 3BHMA 2C2YA 3TOXA 1Y5RA 2YHIB 1RPNA 1HDRA 2IEBA 1DHRA 4JLWA 1NVMB 1BSVA 1WMBA 3DL2A 1JKFA 1SAYA 2YW9A 3VVCA 2Y1EA 3F6YA 4BB5A 4DC1A 4R16A 1NVTA 1SNYA 1ZSYA 4ONEA 4U6QA 4BS9A 3KETA 4NQZA 4W82A 1KOLA 4B4WA 4A10A 3CMCO 3FR8A 3ASVA 1A5ZA 3PLRA 3F1LA 4E12A 4DXHA 2P5UA 3GLQA 4CMCA 1ARZA 3EYWA 2OUIA 4LK3A 1DRWA 4LGVA 1NHWA 3DOJA 5L40A 3FNFA 2VCYA 3KXDA 1XYGA 3M6IA 1LJ8A 1NHGA 3WJ7A 3ZHYA 2SCUA 5IXYA 3M2PA 1Z45A 3K31A 1ISMA 4HADA 2HRBA 3L77A 2HJSA 4OKNA 1EE2A 2X4GA 3WFIA 3Q6IA 3KOUA 1CYDA 4CLHA 5JC1A 4E13A 2JAPA 4XIYA 1K5HA 2GPTA 3I9KA 4J4BA 4KQXA 3SEFA 3FNHA 4Z9FA 1G0OA 1HETA 1Y9EA 4CUJA 3DZBA 3E18A 1E7YA 1XELA 1MX3A 3GVIA 4U0JA 2AG5A 3EMKA 3KO8A 3BA1A 1R0LA 5IDWA 1CERA 3H8VA 3WGGA 2PZKA 1QYVA 3TSCA 3X2EA 4ZA2A 1KY5A 3OIDA 1CETA 4JQCA 3KEQA 2BGKA 3EUWA 3PWZA 4UUOA 4ZHSA 2D3TA 2PY6A 1LA2A 2JCXA 4AJEA 1GQQA 5IN5A 2YHUA 5BSFA 3PIIA 3UF0A 5BQFA 1G6KA 4D7AA 5EN4A 3FHLA 2Q1UA 1F12A 1WP4A 2YV2A 3RJ5A 1XSEA 4Q3DA 4S1VA 4TKMA 5L4NA 2EERA 4B3JA 4PCVA 4UREA 1B2LA 1F8FA 1WDKA 3PK0A 4WLEA 4MVJM 1G1AA 3D7LA 3E9NA 2P5YA 5AYVA 1D7OA 2BFOA 3TF5A 5F1OA 3RUIA 3AM4A 5THQA 3UAGA 1MA0A 1LTHR 1SB9A 3DMTA 2ZTVA 2WM3A 4DREA 4XD2A 4J1TA 2D5AA 1U9JA 4XR4A 5KTKA 1O95A 1TXGA 4YDRA 1Z75A 3NJ8A 2DBVO 2EKQA 4PGFA 2C20A 2V7PA 3R3JA 1KC1A 4FFRA 4II2A 3MJVA 3HJAA 5EQDA 3ZWXA 4IQGA 1AE1A 5J23A 3IS3A 3UH1A 2B35A 3RFXA 4QO8A 1LSOA 3QRWA 4PLWA 5JAZA 1ZVMA 2V6BA 3WIDA 4Q3CA 4CV2A 1BRMA 2HQ1A 4GH5A 5JY6A 1E1NA 1JW9B 3G17A 4M89A 4PLZA 4ZQGA 1EFKA 1C0KA 1KVQA 4QX6A 1EUDA 3EK2A 3NEPX 4MIOA 3AUTA 4ALLA 2Q1SA 3RC7A 4OOEA 5CP8A 3V5NA 5JS6A 3NGLA 3GEDA 1GFSA 1E7QA 4ID9A 5A1TA 5U9CA 3OEWA 4ILKA 2P2SA 1KC3A 3CSDA 4OSOA 1E1MA 2Q2WA 2ZIZA 5B4UA 4KUEA 4YJFB 5L7WA 4XYEA 2GCGA 1ZSVA 2DLDA 4QXMA 2C54A 3HFSA 2QRJA 2RHRA 5FYDA 5C3MA 4KTTE 4LCEA 1Y81A 2BELA 4MIEA 3KLPX 1I32A 3AY6A 3GVXA 1JAYA 1XEAA 2Q1WA 1LRLA 3O03A 4YCAA 1IE3A 4FC6A 5CPBA 3JQDA 3O8QB 3JQGB 4I1IA 3Q1LA 2VHZA 1Y8QB 2Z1MA 3EVNA 4J7XA 1EUCA 5KKCA 2GN9A 1PS9A 1XKQA 2B0JA 3U3XA 1PJLA 4MKRA 3MOIA 1DIBA 4NNJA 1E3WA 1B3RA 4Z9YA 3JQ7B 3E5MA 3ANMA 4B4VA 1N1GA 1HE2A 3QW2A 4J6FA 4OH1A 3AFMA 4IZHA 4B4OA 4NMHA 2PD6A 5JMPA 2E4AA 1FMCA 2CSUA 2EG9A 4DYVA 3NDIA 4KDEA 1YL7A 1GUYA 2GYYA 3AOEA 4R01A 4WUVA 3QVSA 2X58A 2JD1A 3H5RA 1BXGB 1DRVA 1XG5A 3W4JA 2WYVA 4E6PA 2HO5A 1OZAA 3LT1A 4BQPA 3OM9A 3F4BA 4U5QA 3GUYA 4EEXA 4PZEA 3PJGA 1LQTA 1P31A 4IDFA 4J7CA 3GZNA 4Q3NA 4FPXA 1ZO8A 4RVFA 5GY7A 4CMHA 1HLDA 3OA2A 3GRPA 2WE8A 1Y1PA 8LDHA 1TEHA 1UZLA 3TFQA 4EGFA 1ZXBA 3QIVA 2UDPA 3M1AA 3GDOA 5TIIA 1C1DB 2WSBA 4CL8A 3N74A 4HWKA 5EIOA 3BTVA 1FDTA 4EBFA 5IZCC 4HFRA 3GAZA 1OFGA 1PJ3A 4YJGB 4RL6A 4PG8A 2TMDA 4CMBA 4YA6A 3I9OA 1P0FA 1T2DA 3RC2A 5L95A 4EUFA 3GFBA 3L6EA 4L0QA 2D5CA 4M86A 5L51A 2ET6A 1J49A 2VRCD 1D1TA 2VYVA 3RKUA 4GLLA 4LRSB 1I33A 3U4CA 1ISFA 4PG5A 3IIEA 5G4LA 1YS4A 4R4JA 1EVIA 2YFHA 5AOVA 1PU2A 3WBBA 4BNFA 4R69A 2Y66A 3MJCA 3TZHA 2QX7A 1ZNQO 4FDAA 4ZRMA 2FZWA 2ZYAA 1GYPA 1PL8A 3FR7A 3C8MA 4GLOA 5LCXA 3TL3A 5G0SA 5TX7A 4AL4A 1GR0A 3RU7A 1ULSA 4IDCA 4J1NA 5BNTA 1IYZA 5JFOA 3BMOA 5CDUA 1AGNA 3JQCA 3ZV3A 3GOHA 1JU9A 3EVTA 4E0BA 3S2FA 5A02A 3TPCA 3L4BA 1FDWA 1FXSA 4DBZA 3HZZA 3RKRA 1C1XB 4FFNA 4FSHA 3NTRA 4XB1A 1GCUA 1DEHA 1B8PA 4O5OA 1SEVA 1DIHA 1GY8A 5A03A 1M2WA 5EJ2A 1BW9B 4WCFC 3RC9A 3QV1A 2VZ9A 4FW8A 3AWDA 2DKNA 2VHYA 2VTEA 3L9WA 4RV9A 1EVYA 3RIHA 4BO5A 4OXYA 4WEQA 2NQTA 3Q9NA 5TT1A 4FQ8A 1LDGA 3GDGA 1LNQA 1QSGA 1LC0A 1O94A 2OMEA 5I9MA 2Y1DA 2R2GA 3GHYA 1H93A 2BI7A 4OM8A 1RM3A 1V6AA 4E32A 1H9AA 5KOIA 2DFDA 2OORA 1E5QA 1ZEMA 1NNUA 4TQGA 4E31A 4LVUA 3JQ8B 3JQAD 4L74A 5A9SB 4AJHA 1PR9A 1V3UA 3CZRA 1K6IA 3JD3A 1BDMA 4OIMA 5TGDA 4AJLA 4BO1A 1N8KA 2D59A 3JD2A 4PLGA 3DZHA 3JYOA 5IN4A 4I9NA 1N92A 3RBXA 3DOCA 9LDTA 3GGPA 3AUAA 1GEGA 2GF2A 1GCOA 2FPIA 3S55A 3B20A 4RDHA 4UVGA 3TZCA 4RO0A 2BMAA 1NWHA 3F5QA 4CM9A 3CH6A 1XA0A 2NU8A 1LDNA 4FB5A 3FWNA 3M1LA 1E7SA 1P1FA 2ZTMA 2UV8A 2X7HA 1H0KA 3ROMA 1ADGA 1BXKA 2BH9A 2WD7A 4RF4A 3IUPA 4C7KA 3H4VA 1QP8A 5CDTA 3RWBA 3GPIA 4I9UA 4NFYA 3PJDA 4MP8A 2FSVA 5DCWA 4Z3KA 5DNAA 5I7FA 2GLXA 1ISGA 2ZB7A 3ZDFA 3NDRA 1NQ5A 3A06A 4CQMB 1DIRA 2W2KB 1XGKA 1U8XX 5DP2A 3WGOA 3WGIA 1VSUA 3I9MA 4OO3A 1TT5B 1ZIDA 3GK3A 5ICMA 1JWBB 3OSUA 5G0VA 3VKUA 2QZZA 4HKTA 1LDEA 2J8ZA 3O38A 1SZJG 4DQVA 2EXXA 5FF9A 2NLOA 1BXZA 1O8CA 1T2AA 4IDGA 2E82A 4YRDA 3U09A 2A94A 2YHIA 3DB2A 3ZV4A 1PQPA 1I10A 1BWSA 4G5HA 3R6DA 4TVBA 2PKRA 2ZB8A 1H6DA 4GAEA 1YBAA 4TRNA 5TQVA 5A05A 3QJ5A 3WLFA 5IDQA 2Y0DA 1IOLA 2OFPA 2B69A 3OJLA 5MGBA 5DOZA 1U3WA 1LXCA 4XDYA 3U5TA 4XWYA 2O4UX 4FN4A 4BHTA 1P9LA 3LT0A 4NJOA 1LDBA 3TDKA 3RD5A 5JDIA 1X7GA 3BMNB 3ETGA 3JQAB 3JYPA 5COQA 1LSSA 2ZYDA 4RORA 4OL9A 3E8XA 3ZWMA 4BO8A 1XR3A 2O48X 2C0CA 3COSA 3BHJA 1JQBA 5CG1A 4M54A 3ADPA 4YAKA 1FDSA 4OKIA 4MIYA 1N7GA 4W9NA 5C37A 1Z7EA 4TSKA 5K0ZA 3QSGA 1TT7A 5K9ZA 2WMDA 4Y67A 1I3MA 1NFFA 4KZPA 2HUNA 1AHHA 1K0UA 2I3AA 2HU2A 1ZFNA 3WB9A 4NU5A 2F00A 3GN2A 2QYSA 3GNSA 3K8ZA 6ADHA 2OP0A 3QQPA 1U4SA 1UJMA 2Q46A 1WPQA 3VTZA 2WEKA 3UCEA 4UEKA 1E7MA 3SLKA 4G81A 4BO4A 1QV7A 4P8RA 3TNLA 1CDOA 1DJNA 5HS4A 2Y0EA 4NK4A 4Q3AA 4R1SA 4BV9A 3QP9A 4XRRA 1ADBA 1HSZA 1QLJA 2Y05A 1YGYA 2E6UX 4XRGA 4L4RA 2Q1TA 3MEQA 1YJ8A 1Q0LA 1QG6A 2HMUA 2J3KA 3TWOA 2UYYA 3ZNQA 2VUUA 4PG4A 3WWZA 3MJEA 1IULA 1IZ9A 2YDXA 1DFGA 3V1TC 4XQ9A 3NV9A 2DPHA 4E5PA 1Q0HA 3FBTA 4PLCA 1R15A 2EGHA 3RJ9A 4DL9A 3UICA 1IHXA 4ROSA 2ZATA 2BGMA 4FC7A 5KJEA 4PLYA 4EJ6A 1U3VA 1CQIA 2DBRA 1B15A 4RPGA 4Y6SA 3SC6A 2OXIA 1VSVA 2Q2QA 4R1TA 1DIGA 4IS3A 5EINA 2PV7A 3ON5A 3BTOA 5BNIA 1YONA 4D3DA 7MDHA 1YB5A 1VPDA 5JMWA 2PK3A 3C7DB 1LUAA 1NBOA 2PWZA 3H2SA 1L1FA 3V1YA 3W6UA 1WLYA 4D46A 2NSDA 2HSDA 1KEWA 3AW9A 3Q0EA 3BHIA 4WCDA 5CPFA 1J6UA 2BI8A 3H2ZA 2QG4A 4AJ2A 3OMLA 4RVDA 1E1LA 4PG7A 1M75A 3OF2A 4UULA 1ISJA 4CV0A 1I01A 1P44A 3X2FA 1EQUA 3JQFA 4IJWA 4E5YA 5I9NA 4O1MA 1GV0A 3ZWYA 4KP7A 3CKYA 1ZMTA 1DPGA 4Z3DA 1NPDA 3A14A 1A7AA 1IUKA 3FI9A 3PYXA 2B5VA 4NBTA 3HDQA 1NASA 1YQDA 1JVBA 3K96A 2GUGA 3DWFA 1E5LA 8ADHA 3HDYA 2AQ8A 4YJFA 4HXYA 3INTA 3MZ0A 3UCXA 2VT3A 2P9CA 3I3OA 1G0NA 3ZU2A 2VTDA 3AUSA 3DOOA 1EDOA 3VPSA 3TJRA 1HF3A 4B3HA 3O8QA 1U3TA 3JQGA 1Y8QA 1EVZA 2Z95A 5KCZA 3F5SA 4DRYA 2VYND 3JQ7A 3PQDA 2GASA 5JCJA 4OMUA 1P45A 4BOYA 4DGSA 5K6AA 4YT5A 1DB3A 1JTVA 3L07A 4XA8A 1H2HA 2X0NA 3IOYA 4ND4A 4BGIA 5JLAA 2TMGA 2C07A 2FOIA 1IZ0A 1U5AA 4MDHA 1HDYA 5JDCA 4ZICA 4FFMA 5CEFA 3I9JA 1BXGA 1QMGA 1DXYA 1DRUA 3L6OO 3D4PA 3JYQA 5KJ6A 1BG6A 4JBGA 1GAEO 4JJIA 3OFSA 5T64A 4XYLA 1L7EA 4YJHB 3DZFA 5AXAA 4XDZA 1RYDA 3G79A 3SJ7A 5KNLA 3F46A 2YV3A 2VT2A 1PR3A 2CD9A 3ZHBA 2YZ7A 3TZQA 4KOAA 1CWUA 3I1JA 1GQYA 1PGOA 1C1DA 2QRLA 1CRWG 3LZ6A 4JIGA 4DPLA 2FMUA 4KWHA 3INRA 1GU7A 2BGLA 4H7PA 3PP8A 2DBQA 2X1HA 3GEMA 2Y93A 3AY7A 1I3NA 1PQUA 4YJGA 3HN2A 3PHJA 4J43A 4DLLA 3I6IA 3DBHB 4E4YA 2EHDA 4WLOA 4D41A 5JE8A 3DO5A 1MFPA 5DDIP 3D4NA 4G65A 3VOSA 4A2CA 3FNGA 3WICA 1E77A 5ER6A 1PJ2A 2JD0A 3HSKA 3ZWBA 4DMMA 1DBVO 2CUKA 1Q1NA 4JBIA 4PLPA 1ONNA 3BTUA 4R1UA 2VOJA 3F47A 3VAZA 1N2SA 3WDSA 5DBGA 1S7CA 2Y0CA 3VZPA 5IZ4A 1ONPA 1ZK0A 3WQRA 3GY0A 1JVSA 4K1LA 3Q3CA 1MC5A 2Y1FA 2JKVA 3JD0A 3LVFO 4BO7A 1YB4A 3JD4A 1D8AA 1JKIA 1O5IA 5FFFA 2FN7A 3ABIA 4ZQHA 3BTSA 4R1NA 1PGQA 2NVBA 3FTPA 4NDNE 4DLAA 1OBFO 3RUCA 2YQ4A 2GZ2A 1NQTA 2EF1A 1V3TA 4R41A 4FOSA 1ZH8A 2BFAA 4E5KA 4DA9A 5CDYA 1U7TA 3C85A 4D43A 3PGJA 1BDBA 1C1XA 1P1KA 2QZ9A 3I6QA 4XGNA 3MCVA 4CR8A 3JQEA 2PZJA 3KM0A 4TRJA 4Q39A 3PIDA 4BO3A 3E9MA 4HV4A 2P9GA 1A7KA 4E5MA 1BW9A 1LDMA 2V65A 3FPLA 3GR6A 4BKRA 4JJGA 3TZKA 1ZW1A 5EQFA 1OOEA 2OOSA 2C59A 1R4MB 2EW8A 1WW8A 1QKIA 4NFSA 1EFLA 4YTEA 4CM8B 4AJNA 3RSHA 1SOVA 4ND5A 4O59O 4CL3A 3PI7A 1ZSNA 4E33A 1HDGO 3FCOA 3PWKA 2HJRA 1E3IA 3G49A 2WTBA 4MVJG 4CMKA 1F17A 2VWQA 3L0DA 5AVOA 3ST7A 4ZGWA 5TRTA 1LSUA 3DFZA 4MVJA 1X15A 2RAFA 3ZWPA 1AN9A 1IY8A 2FR0A 1LC3A 3JQ8A 4OXNA 5H82A 1V35A 5A9SA 2X8LA 1F14A 1VKNA 4NBRA 4EYEA 1N5DA 1YOVB 2O3RA 3DBLA 3OIGA 1EBUA 2BLLA 3KBOA 3PZRA 2C7GA 4XYGA 3ZN2A 2DT5A 3SVTA 1ADCA 3W6ZA 1KVTA 1HDOA 4AJ1A 2X0IA 2CF5A 1P74A 1Y6JA 3F4LA 3GHHA 1I2CA 4BNIA 4CUKA 4GKVA 9LDBA 1ZK4A 1Z73A 4GX2A 2O3TA 3DTTA 1WZIA 1GV1A 4RVSA 3HB4X 3GF4A 1VRWA 4E21A 1K2WA 3D3WB 2GO1A 1Q7CA 1U7HA 3C24A 1NQAO 1R6DA 4NBWA 4GL4A 5L4SA 3H9JA 3ROPA 3I4FA 5EERA 4H15A 2Q50A 2FRDA 4PLFA 2NACA 3L4BC 1P1JA 3OETA 2DAPA 4F6LA 3I4CA 3JQ6A 4FGWA 4Y6PA 5KIAA 5CHEA 3PEFA 5A5EA 4NHEA 4CQMA 4XEHA 1Q7BA 1AHIA 4WCFB 2W2KA 3ONFA 3O26A 4CV3A 3QWIA 1LQUA 2H1SA 1TT5A 1LI4A 3GC6A 1VM6A 4N5MA 3GA0A 4NU6A 2ZKLA 4YAEA 3H9GA 2G0TA 3KZVA 1H6BA 3VH4A 3UHAA 4PG6A 2VQ3A 5CEJA 5DT9A 2PKQO 5IF3A 2GRAA 2EIHA 3PHLA 4PLHA 1B8UA 1BTOA 1KY4A 3UGKA 3PJEA 4R68A 1BVRA 2CY0A 5CDGA 5L4LA 3GVCA 1KYQA 3WLEA 2BD0A 4DLBA 1E0DA 2HCTA 4RZHA 4DIOA 3DBVO 3PRJA 3GFGA 4DC0A 2O23A 4GPD1 4BKUA 4PLVA 1W6UA 5JSFA 3GGGA 3UXYA 1T1SA 3P2OA 3WQQA 4NBVA 1WMAA 4WJZA 4BNGA 3BMNA 3V2UA 4JGBA 5GZ1A 3JQAA 3QWAA 5AXDA 1KETA 2ZTUA 2J3HA 4MO2A 4TMFA 2G82A 2G1UA 2VHVA 4XCVA 1ZJYA 4XYBA 4GI2A 4KWIA 1NX6A 3UCFA 3A28A 3U62A 1PJTA 3S8MA 2GNAA 5I8WA 1UR5A 1NAIA 3RUFA 1P33A 3V2GA 2FHSA 2PGDA 1PIWA 1A27A 1V9LA 3UW3A 1WDMA 2ZYGA 3D1LA 3CIFA 1BHSA 3OJOA 4BNKA 3H5AA 1MXFA 1NFQA 5JNLA 2YFQA 3IUSA 3T4XA 4AG3A 2DTEA 2IZZA 4GBJA 1T2FA 3PXXA 4WLVA 1HZZA 3D3EA 3RFVA 3TRIA 3AJRA 3WJAA 4BQRA 1FF9A 2HMWA 5JW6A 3W4KA 1R66A 2VZ8A 3QVOA 4ZVVA 3V1UA 3RROA 1F06A 4R54A 1XHLA 3ZWWA 4CMEA 3WIEA 1OC4A 3AK4A 1AUPA 3GRKA 2DTDA 4XQCA 1LX6A 4B8WA 1TA4A 4DQXA 4OQZA 4FR5A 3LK7A 1YVEI 4TVOA 3JTMA 4XX0A 2D4AA 4JK3A 4ZQEA 4FOOA 4B7XA 4CLEA 5KVCA 2UAGA 1PGJA 4IY1A 1T24A 1CIVA 4Q9NA 5B4TA 3OJ0A 4U6SA 1NTOA 2VRBA 4WECA 1K89A 4K9DA 1NWCA 1PJQA 3RUHA 4LMRA 5JDIC 3LT4A 2W90A 3HN7A 4BB6A 4DVJA 1NPYA 4IJUA 5L3ZA 5C7OO 4A7PA 3ZWNA 3MTGA 1JLLA 1UH5A 1TVEA 3RUDA 2X9NA 2ZJ1A 4FCCA 3JQ9C 4Y6RA 3Q11A 1PZGA 3C1TA 1TB4A 2EW2A 1OAAA 4KUGA 4W9NC 3U4IA 1KERA 3ZWCA 1HTBA 4URFA 4IQ0A 2HMVA 1KS9A 4M8SA 4BNJA 5TJHA 3ONEA 5JAIA 3ZU4A 2VZ0A 4EITA 2CF6A 1NM5A 3ANLA 4HFNA 4XGKA 2D2IA 3W8FA 2HKIA 3NRCA 1GUFA 3DZJA 2DTXA 2AW5A 3P5SA 3WSVA 2OL4A 3ANNA 4PVCA 3QWFA 4MKZA 3NGXA 2YV1A 4LN1A 1RKXA 2GGSA 2IZ0A 4XYMA 4CM3A 3QY9A 4M1QA 5BSEA 4OHUA 3B70A 1PZFA 4L76A 2Y68A 3SXPA 3LQFA 1IL0A 3LC2O 2AA3A 3WNVA 4CR6A 3S1LA 2XXJA 2C29D 3H5NA 2VUTA 4E2ZA 4BMVA 3WYCA 3B6ZA 3HQ4O 4QFCA 2EP7A 4M87A 4NR0A 5IXSA 1HYEA 3KEOA 2VWGA 4I5DA 1J4AA 1HE4A 2C7VA 5BT9A 3EZYA 2W4QA 3OEYA 3VTFA 4CMJA 4NJMB 1W4ZA 4RPHA 3R0IA 5I7EA 5JXWA 1GYQA 1VLLA 4P4NA 3GNTA 5TJ9A 5EPOA 3ZWAA 3ITKA 3GQVA 5DP1A 2IEDA 3CTMA 4CM5A 4NFHA 4BNNA 1ENPA 2Q4EA 4CM4B 3WGQA 5ILOA 1YB1A 4OOFA 4X54A 1Q7GA 3PFFA 2PD3A 3C7CB 2H63A 3CUKA 3DBLB 2WE7A 3FWZA 1YBVA 3WYEA 4TRRA 4R9SA 4AICA 5HS6A 4YT4A 3BIOA 3ORFA 4PZDA 4IGEA 3C1AA 3V8BA 1QORA 3SX2A 3HE3A 4F6CA 1OI7A 4YACA 3ITDA 1SMKA 2P9EA 2CNBA 5U4QA 2NNLD 3EDMA 5JCXA 5DOVA 3S2EA 4EJMA 5B12A 1SCUA 4YQYA 2PH3A 2HMSA 1MV8A 1UXGA 4BGVA 5DCYA 1QYXA 4J2HA 3VH2A 3MJSA 2CDCA 3HNPA 4YJHA 1H2BA 2I9PA 2LDXA 3PPIA 4J7UA 1VE9A 4J4TA 1DAOA 2DQ4A 3U4DA 4B79A 3QLJA 1JWAB 1YDWA 4YQZA 4PN3A 3KLMX 4BKQA 4TWRA 4A0SA 1LSJA 5MDHA 1ENOA 4QECA 5F1KA 4YT2A 2ZCVA 3PZBA 4JBHA 4JX8A 4D45A 1EMDA 1DC5A 3ZWOA 2JCVA 2NVUB 1D4FA 3JV7A 3RUAA 1PJ4A 3DBHA 3DHEA 4EJ0A 5A4DA 4ND2A 4WOJA 1P1IA 4CLOB 5L9AA 4I8XA 4CPDA 3BXXA 3U9LA 1I24A 5BSGA 4MINA 1RJWA 4YRBA 3ZNNA 1YO6A 2HMTA 4RVGA 4B8ZA 3G1TA 1DC3A 4UVDA 3NYWA 4RLSA 4CLDA 2F1KA 3DBRB 3KYDB 3GN1A 1GPJA 4CQLB 5FEUA 1QR6A 4IM7A 1H94A 1OMOA 5KJFA 1W73A 3JYNA 1GL3A 3RBVA 1UXIA 3IJPA 4TKLA
chains in the Genus database with same CATH superfamily
1YZTA 2BFCA 3FPKA 3MQ2A 1MPXA 2YWBA 3ZTWA 5FBVB 3QFRA 1E61A 2JK0A 2BFPA 2NZUG 2POCA 1G7TA 4EECA 4FX5A 2H0AA 4P83A 2F8SA 1T5IA 5JDCC 4UQPA 2RGNA 3BWMA 4NG5A 2O8CB 2O2CA 3K0CA 1M1YE 4F5EA 2TYSB 4KBYA 1W0JD 1E7RA 1XMSA 1XCPA 1VL2A 5FI3A 4RJTA 4YAGA 4M0EA 1JQJC 4HB2A 1MXHA 1O9GA 2A3NA 2WFAA 2X8AA 3EXHC 2C4TA 4LY6A 2LIVA 4WERA 3RVOA 3AUJB 1I13A 3TFWA 1EG2A 3V32A 4HDKB 4MLZA 3KEMA 2QP9X 4QFDA 2NTNA 2ORIA 2DBYA 1B16A 1R4MA 2KBEA 2Q27A 3P2MA 4R3NA 4P7BA 5GTDA 2B8JA 2W83A 4L3WA 4R0MA 4Z49A 3PKJA 4YPOA 4CIBA 3FF4A 4L9AA 2VYVD 4KO3S 3K70B 1EBFA 2P9JA 4JCCA 3H6HA 4YRMA 4ZDIA 3RS2A 1QE5A 4KRXA 4F6RB 4URVR 2WU1A 1JMKC 3ONNA 4WESA 3CRMA 3ESRA 4F9EA 1J8MF 3ROQA 3KPYA 4WKGA 1KPGA 2GH1A 4KH1A 4LHYA 4P92A 4WNCA 1WV0A 3V8RA 1EWVA 4YJ2A 3IKLA 2P2NA 5GMOA 5FL3A 2AQKA 2QZJA 3E03A 3LGXA 3PQ7A 3Q5DA 4NE7A 1SGWA 5F12A 3SSOA 3KP1A 2W6PA 3DVSX 3CJRA 5E6RA 1HL3A 2G1JA 5SZHB 4OU4A 5C5CA 3LD9A 3GLFE 3INNA 1E64A 1ZOLA 2PYDA 1H5QA 2P8SA 1ZIPA 2MSWA 3BDIA 2CYBA 3FBGA 2BR5A 1PP4A 2QIOA 1KZ6A 2RHHA 5ITWA 5LQRA 3VH1A 2HJGA 3IDQA 3GJ0A 5DPMA 4BQNA 4LX8A 1DJPA 5AW1A 1Z5VA 2HRRA 3DVAB 4G8BA 4D57A 4LJSA 3K5HA 4QPDA 1F0YA 2ZZKA 2NXEA 3GPDG 2X5KO 3ZUGA 2UYGA 1ZUD1 1U6JA 2YN0A 5JAQA 1OI2A 4RXTA 2PMDA 4KDCA 2A9PA 3OJFA 1XVVA 3C3MA 1IJFA 2BJVA 4MA5A 2ZJ7A 4XSGA 2WV9A 2C88A 3AU9A 2AT1A 2P6NA 1C3JA 1VKHA 2BUBA 2EBHX 3TTUA 2LKCA 4IIVA 3EIXA 1M3SA 4MRRA 1L5NA 2ZUUA 1M6VB 4EPVA 2PMEA 4TYMA 4YXWD 1XRPA 1RQ2A 3HGTA 5CA0F 1N36B 5TVGA 5LDGA 4QUGA 4BAGA 2VDUE 2QP4A 4JXKA 3SC3A 1PSWA 5CVVA 2G80A 1CNMA 1S3IA 4F97A 5E9WA 4KMSA 4YBZA 1T0IA 1DBQA 3N0WA 5GONA 3ZCXA 1H66A 1MH9A 2X0JA 2Q5CA 2XNSA 4H31A 1BNCA 2D5IA 3CWCA 2WYWA 2YWXA 1NBMD 3DEYX 4AX4A 5FNVF 2AYYA 2ACWA 2FSFA 4F2WA 2IPAB 1ZMOA 3CN9A 1I0IA 4FYYA 5ARDA 4R9VA 1NVAA 5CFRA 4JI7B 2VDWB 2QGFA 4PHHA 4CM9D 1BMDA 1I1OA 1LPBB 2FPGB 4CN8A 5H3LA 1ZKMA 2EEZA 3ZY3A 4Z7OB 3PTLA 1PYGA 2JF0A 1A76A 3P0IA 3R7FA 2W37A 2X5JO 3OUTA 5A3JA 4LF5B 4J16A 3REOA 1KYWA 1M5UA 3EPPA 4QKQA 2QTBA 1AQIA 2AI1A 4AQ7A 1YB6A 2M6RA 3TRDA 1K9VF 1YZLA 1PYDA 4EATA 4ZVQA 4N5LA 5EZQA 5IJXA 1MPTA 4DSOA 1HYGA 3EVBA 1MEOA 4D0GA 4KXFB 2Z6AA 3N3BC 4N01A 3DDCA 1VIMA 3QHAA 3IBSA 2BF4A 4MAFA 1TAHA 1YUNA 4URZR 5CT4A 1KRXA 3ZWKA 2DHRA 1SA0A 2FMXA 2X1MA 1T1JA 3I32A 3R7SA 1M10A 3FPJA 4C7BA 4BMNA 2Y77A 1VFPA 5AKLA 2PA0A 4C01A 2P3OA 3D6TB 4D8UA 2CEAA 3RRYA 1Y1SA 2CLLB 3BRWD 3DMTC 1XLWA 4YK7A 1C9DB 4ND6A 4MUKA 3TLGB 1BX1A 3M9WA 3QPBA 2N1BA 2XTAA 2VPQA 1NP6A 3B53X 2HJVA 4QYSA 4UW9A 3E1KA 3U40A 1N5JA 1T91A 1WXIA 1O95C 1E4EB 3D6MA 4H1HA 3TKAA 1N6HA 5J43A 5DYWA 2JVJA 5DULA 4MI3A 1X1EA 3TE6A 5MHTA 3DCYA 1JBKA 4DOMA 2VOEA 3LYAA 4WKCA 2F55A 1RWKA 2Q7OE 3HCWA 1G20A 3FNEA 4M8LA 2B98A 4N8DA 5KYXB 3E82A 2FW6A 2X0FA 3HWRA 3HS3A 5FV7A 2VXCA 2X6TA 2I66A 5CB4A 3V97A 2DPLA 2AD5A 1R18A 1E2PA 3WGLA 1U1EA 3G23A 5GV8A 1N2EA 1XRMA 3G8AA 4GU5A 4HDSB 1TTPB 2H1RA 4RMNA 3WLTA 2PFSA 1QV6A 3IQDB 2OY0A 1JEOA 3NTQA 4K8RB 4TV9F 1RDFA 2HO4A 1I2ZA 2WP0A 1EG7A 1AQ6A 1V2HE 2JAOA 2GOYA 1Y8RB 2PBRA 2IW3A 1DVRA 1NMXA 1VG0B 4GWKA 3LXMA 4ITVA 3OZRA 4O2AB 4D4KA 4WGFA 5TPWA 2QQFA 4YB8A 2NIPA 4JLJA 1EFAA 4QICA 1G7SA 1YE3A 1YK0A 3VPFA 4F4UA 1XCLA 2G3YA 4GMKA 2Q4DA 5KINB 4KUHA 3JRWA 4V1CB 3R0QA 3FDXA 3E22B 1QK5A 4JAVC 1K7CA 2G25A 3ELWA 1TCCA 3AI1A 1OTYA 3HU2A 4TTPA 4EFLA 5TSDA 3EIQA 4RYLA 2JGNA 1NY5A 4K9SA 3DL7A 3L7CA 2K2WA 3TO5A 3UK6A 4CLRB 4EG7A 2XQVA 3G0BA 3H9UA 4UTPA 5I48A 1E3JA 1FX0B 4B6FA 1NKVA 5L3VA 1EVEA 4WLFA 5HIIA 3HUTA 3OURA 1A82A 3QENA 4HVLA 3PHCA 4M0LA 1UF9A 1KJQA 4RZ3A 5I8ZA 4BGEA 1B6SA 2W2LD 2FN9A 2IEYA 4HI0E 4O02B 2VP4A 2PUWA 1Z82A 1IN4A 3C3YA 4N82A 3GW8A 2YMQA 3RVRA 5EJ6A 1FVXA 5A4AA 3L6DA 3PJRA 3LRXA 4ZZIA 1UOPA 2XUQA 1ZZGA 3NH6A 2JI7A 3RBZA 3AUXA 3UM9A 1J2EA 1W581 1KEVA 1U3DA 3I23A 1RWMA 2YY7A 3UB2A 4MVJH 3BK2A 3PD1A 5B64A 1DC6A 4YAOA 1C2TA 3KAJA 5K8CA 3O8OB 3GLTA 2H06A 4OB7A 3W5BA 2QGZA 2WTAA 3EIUA 1OWPA 2RK4A 3HRIA 3IESA 4D0SA 5FTWA 1DCMA 4MLDA 1B74A 1IVNA 1U0RA 4XUGB 4OHKA 5HIJA 3WLRA 1AF4A 2X22A 4RSMA 5HUJA 2HUPA 5E6SB 1T5OA 4B6SA 2ZK7A 2Q9UA 2YVKA 2AI3A 3ZIUA 1Z6ZA 4R8KA 1NPTO 3SCZA 3H4MA 1UKEA 4CMEC 1PV2A 1QCCA 4B7UA 1VJ0A 1XK7A 3RG8A 5ALYA 2A0FA 3LIIA 4AF6A 1Y42X 1UP7A 2J32A 3VVBA 3DEAA 3EFEA 4LZWA 2ZJ3A 1V96A 2ZT8A 3Q88A 4OB8A 3U49A 4TXNA 3GJ7A 2W98A 5HMLA 3RK4A 4X62B 1LVGA 3WX0A 2GJSA 3EIOA 3ZDCA 2IHUA 2HGZA 1SUAA 3BD6A 1UDAA 2OK7A 2ZANA 1SBYA 1DIAA 3E05A 4IEFB 3QE4A 1U8CB 2ALJA 1P2FA 3NC0C 3JD1A 4W5JA 5DM4A 2QD5A 3FUUA 3DE6X 1HORA 4JLOA 4IIHA 4RANA 2FW1A 5C35A 2P4QA 4TYWA 4QOIA 5A4IS 4E4TA 4EO7A 1OJ7A 4GIBA 2B4RO 2BBSA 1Q7TA 4ZVKA 3QF4B 4E30A 1P4AA 1VBKA 3MCZA 2C3YA 3KVNA 4ID3A 4C7MA 2JFWA 1UZNA 2OXFA 5HBRA 1DQNA 5I9BA 1QV9A 3KEFA 2WZCA 4H17A 2ODNA 4ODIA 4YFVA 4E2XA 1SUPA 4ABTA 1ODLA 5IP5A 1M33A 3CVOA 2O2SA 4GSKA 2BHNA 3M5PA 3QIAA 4ZU3A 2DKOA 3R5TA 2G76A 1KF0A 2BJHA 2GD2A 2HRDA 1R0ZA 3M7IA 4MH0R 3NJ4A 4W5RA 3T1TA 4I14A 2P1DA 2HHLA 4I8DA 4AYTA 1O2DA 3IC5A 1QJCA 1PL7A 1U4OA 4AFNA 4GRDA 4ZRDA 1R0SA 1M0EA 2Y1KA 4PRLA 5HFJA 5K4GA 2XDWA 2FN3A 3LH5A 2W2VA 4JI6B 1A98A 2HA4A 4QFMA 1FK8A 1C29B 3DV0B 4P22A 2F1OA 1GZHB 4N5DA 4BMCA 3C7AA 4JSYA 1NULA 4D0LB 4G07A 1FLDA 4RZIA 4WXHA 1ZU5A 2QUIA 4P1ZA 4FB4A 4QEDA 3NP7A 4OLFA 1QAQA 3OCYA 3UKOA 4E5SA 4ZN6A 1YDFA 3BWXA 1F2TB 4I4LA 2FAXA 2ZRIA 3BEOA 3P2EA 5IJ9B 2VI5A 3OM8A 2V9CA 4L08A 1XQWA 1ZNWA 3G89A 4Q7EA 4O4LB 2FZVA 3NHJA 2WAXA 3TK1A 4ZI7A 4GXNA 2EFEB 2Z6UA 1P61B 4O4IF 5C1IA 4Q00A 5GAJA 2C7QA 1SXJB 1Z4IA 3IAHA 4HMQA 1NW8A 4IWNA 3EA0A 3LA8A 5T8KA 5BW5A 4U3JB 1ORHA 1IPFA 2DYKA 1PGNA 1JF8A 3G1UA 3HB7A 1Z0KA 4HATA 4JBNA 2MSNA 4YAJA 1M2OB 1QDUA 1ZINA 2FUKA 1VC2A 2UXBB 2QXUA 1RAFA 4P58A 5CGQB 1QBGA 1XUOA 2HK9A 4A8PA 3OECA 2BGJA 1RTTA 2V58A 1VKJA 3MJDA 4OH7A 3PWSA 1ZCJA 3ZGXA 2OD7A 4JOBA 2O19A 2PZLA 1VSQA 3U48A 4CZ2A 4GP7A 1XXHB 3CMMA 1T34A 2EJBA 2WDPA 1CJCA 3C5WP 3DBRA 3KJXA 7MDHA 3EG9B 4A26A 3KJEA 3RQSA 2NU9A 1EP9A 1GOTA 2NNWB 2O8BA 3KPVA 2A0UA 3WS7A 4EDFA 5A4KA 5LC1A 2B9VA 4JOCA 4E70A 3O8CA 4W6ZA 3K8OE 2ABWA 3CVUA 2Z9BA 3ONDA 2QPLA 5DTIA 3V33A 1GUZA 1ZUIA 3HSYA 1M1YB 1M0SA 2EQ5A 2R62A 3EDOA 3PX3A 4LDZA 4MP3A 3K2EA 3WFJA 1JA9A 1E6KA 4W63A 4R2IA 4K9KA 5EQTA 4AJIA 1W36B 3CLSC 2EYQA 4ZARA 2IP2A 4MUBA 3GROA 3NAMA 2ZEJA 2FG5A 1G5IA 1QKJA 3NWOA 3TD9A 5CIWA 3K92A 3AU8A 1TI7A 4QQRA 2AEMA 3TG2A 2IIBA 1GNVA 3KUXA 1KKUA 2ZG6A 3H9EO 5AKGA 4KGXA 3GBVA 4G0WA 1TM2A 3GNQA 1XQ9A 1Z33A 3K1TA 3NWEA 2W2XA 1DL5A 5H83A 1NOKA 3AM3A 9GPBA 1I3LA 4K0KB 2F8MA 2NXWA 1BU5A 1BU8A 3ICWA 1I6MA 3BB1A 2ZYHA 1QPGA 5AXBA 3AJ8A 2YC4C 1C0IA 2YQ5A 3UW1A 2XA9A 3TZ6A 3DTVA 3WLJA 4B4KA 3WWYA 4C29A 4DWVA 3ZTTA 3K6SA 5ERGB 3Q1KA 3GLFB 2AE2A 3S2GA 1CB7A 4O3MA 1PJRA 2Q1XA 3AUUA 4YP0A 4DWJA 5EIBC 3VR6A 4ARAA 2Q4TA 3EEOA 5BURA 1CZUA 2PUHA 3G2OA 1PJBA 2FF7A 3UHFA 4NK5A 4RDXA 5IT4A 5FTNA 2ZCUA 4F3CA 2WG1A 1TIKA 1YRQA 4ZD6A 1JLKA 2YFYA 4K46A 5HFNA 3PA8A 5TF4A 2DCUA 3RLIA 1BEUB 2H4JA 1GSHA 2VF2A 3D2CA 3L40A 3ZE6A 2YWFA 3GJXC 3KQMA 4JR0A 2DUUA 4LCBA 1U8FO 4YRAA 2BZGA 4FGKA 3L7KA 4YP6A 2GZ1A 5KVQA 4IHJF 4BMDA 1EFPA 2R7LA 3W2HA 2RGNC 3HYNA 2XSZD 3F8TA 5DYYA 3TLCA 4RJKA 1HDXA 2R87A 4J91A 1B3BA 3H3JA 2PKQP 1RPJA 1ULUA 2FPRA 2OUKA 2XIQA 2XPCA 4RF2A 3ZDEA 5ICGA 1X13A 1GPDG 1YRYE 3EXHB 3TRHA 4CJXA 3O8LA 3GJZA 4NZMA 4RY0A 1NLFA 1NQOA 5C1DA 1YV9A 3LF2A 1HEUA 4MOWA 1PV4A 1UDCA 5B30A 5LR6A 3KU1A 4BTVA 4IJ6A 2GA8A 1MOQA 4MUIA 6LDHA 4TRMA 3TLMA 3SGLA 4G5QA 5EWMB 3ZLTA 1HFKA 3KV3O 2F9FA 2PD4A 1XHFA 1KTVA 3ABSB 3NBFA 3QV2A 4LTMA 1EU1A 2CMDA 4LDRA 4CIAA 3MMPA 2VXOA 4BO0A 1BJKA 1H6AA 2AR0A 4IIJA 1HT3A 5GOTA 4I5FA 1YRAA 2GM9A 3LYUA 3PE4A 1L8XA 4XIGS 3BQ9A 1M54A 1TUGA 3X1MA 4HWTA 4G0UA 1FBTA 1U7XA 3QUTA 3LVRE 4XFJA 3L0YA 5T4EA 1CEEA 2REOA 2O57A 1FFSA 4JUAA 2R48A 2F90A 4J8PA 4PF1A 3VDMA 2F1JA 1N7HA 2X42A 5E0OA 4KQHA 3PR3A 4RTLA 2BFWA 4M8IA 4UE2A 2FUG6 1DTEA 5FIUA 3WADA 4JQSA 5FDFA 1VRCA 2O2GA 3E48A 3PSHA 7ADHA 3A9UA 1GL7A 3SHWA 5ALOA 1K3FA 4EI9A 4FZ5A 3B9BA 3G0OA 2OAGA 3WGZA 4P4LA 1W30A 1O95D 4HB0A 5EKXA 3IL2A 3TGPA 3U7HB 3B85A 4ZO4A 4TPKA 4CU5A 3SXUB 3MWEB 5BR8B 1U2EA 3ZHZA 4BLTA 3U1BA 2ES4A 1YIOA 4Y1RB 4YRKA 3RV4A 1RIFA 3L8ZA 3AL3A 2PT5A 3GEGA 3ZOKA 4RGBA 2JJ1A 4DJ5X 3H6KA 3QBEA 2O59A 1VKOA 1K6JA 1YCFA 2GJ9A 3CN7A 3O7MA 4IQ4A 5TMBA 5TB5A 3LPCA 4JLBA 1P81A 4EF4A 4ENPA 4X5OA 5JWHA 1G21E 3HCDA 3DDNA 1C7IA 4DQUA 1J1UA 2V9ZA 1E2DA 1LPMA 2PX6A 3L06A 4S12A 2O3UA 1K5DA 1P1BA 4GM0A 4XTCS 3QXGA 4ZPJA 3T1OA 1R4ZA 3VDQA 2WJZB 1YJQA 2Y4NA 4JP2A 5EG5A 1NP3A 1T2CA 4G5XA 1CUSA 3PUIA 3TNJA 1Z6YA 3CY6A 2I62A 2CDBA 4DQDA 1P60A 1Q17A 1Y7TA 3W7BA 4WLNA 5HJ5A 4UMDA 4GKAA 1AV7A 5FBRB 2DBZA 4I50F 3RNOA 1G3UA 2BEUB 1T4CB 3I2KA 2G4VA 1HYHA 1TIPA 2MYPA 3IPLA 2J7KA 4HJXA 1P0QA 4PO9A 3I5UA 4MYHA 1EFUA 1CJMA 2JGDA 2DJIA 4NBSA 1DIOB 5IHPA 4QGFA 2KJQA 2GNPA 4BZQA 3AZPA 1Z5OA 2COUA 3GGJA 4KXMA 4J16C 1PL0A 1C3XA 4BQSA 1LDYA 1I2DA 1U1FA 2AZTA 1GG2A 1LJUA 2ZTLA 3BL5A 3NHPA 4FIZA 3EE6A 2CB9A 3CT6A 3QITA 4I4CA 5EEGA 1JXMA 3OIWA 5K99A 4E08A 3H5VA 3DMPA 4JJEA 5IABA 3A6LA 2A58A 1J2TA 2YKGA 1VDMA 5E8RA 1FYFA 1UBKS 3SJUA 1NSYA 4HQRA 1WEKA 1X86B 3HI6A 2QYTA 3OQ1A 5AP9A 4DCPA 4UOEA 4G1FA 5A06A 4N49A 1IPEA 3CZCA 2AN1A 5BMVA 4GGPA 1N3YA 1UBCA 1P7ZA 1T8SA 1O6ZA 1Q57A 1GG8A 1ZUWA 2W8ZA 4Y6LA 3VKWA 3ZHOA 4DYDA 4NICA 4QTYA 5ELXA 5HWSA 3OZCA 3KWJA 2V55B 2PO7A 1AB6A 3P32A 3HO1A 4A16A 4ZOLB 4BNZA 1SM4A 2GCOA 2REQA 3GFSA 2EZ4A 4TMYA 3JVIA 3KKNA 3GUZA 4OBBA 2XOKA 2C98A 1E2QA 2Z08A 3K0EA 5EE3A 1CDEA 4YR7A 1RQ7A 1P5ZB 1R4NA 4HBGA 4L8GA 3AYXB 5DNCA 3KB6A 3X1DA 3MMXA 1EK6A 3INYA 2WM8A 1T9BA 5JR3A 5K8JB 3DE0X 3I6MA 2H00A 3NX4A 5EJ8A 5FWDA 5GIOE 4MP6A 4P0PB 1U31A 2LE0A 2P40A 2E4UA 3S44A 3Q2KA 4PSKA 4AULA 1W49A 3JWIA 3TQOA 3RRXA 5IH7A 5L3QA 5TV2A 1N8SA 3IT0A 4XZ3A 4HWRA 3SBDA 4OA5A 4BB6A 1SC3A 3CF4A 1LPOA 4L6CA 5EC8A 1KBQA 3MYRA 3J80A 3THWA 4AKGA 1T2NA 2NVWA 3KE9A 3K30A 1EUDB 3QF7A 1P0PA 2AOXA 3D1JA 4MICA 3CYFA 4INPA 1C3OB 1MTZA 1XIVA 5IH3A 4RF3A 3HGMA 1QHIA 2JJ2A 3PKIA 2IYYA 4M2LA 5E1DA 2Y1OA 4O5AA 1X74A 4RKWA 4YYEA 4C6TB 4CN9A 2PE5A 2DP4E 4FFLA 1QH0A 1XNJA 4MZXA 3L8YA 4KGVA 5D1HA 2HBYA 5BNFA 4BZPA 3NZEA 2YZNA 4H27A 4LTDA 4IRMA 5T4BA 4GM4A 3RPEA 3WSWA 3O94A 3I0MA 3OLQA 5BNZA 2G17A 5LD2B 1SURA 3GZ4A 3D5TA 1US8A 4Z4HA 1NMSA 3RS9A 2CHGA 1NF9A 1KQGA 2HWYA 2JCYA 1AZLA 3QFHA 3I5MA 4FYXA 4AZWA 4E5NA 4Y7DA 2DH6A 4L0DA 2QIPA 4O4JF 2P5TB 1PEDA 1EJ6A 1NJSA 1V71A 2NQ2C 4MR7B 2QAGC 4TS1A 3P8ZA 3V4LA 3R3HA 3VA7A 4IIFA 3PCXA 3OE1A 1WR8A 5LSAA 1F8GA 2V5UA 1RLUA 3AFNA 1OU4A 5E7MA 1ABBA 3IVXA 5JBIA 3DUFB 1EUCB 1N9GA 1X2EA 1QF7A 3A4IA 2V7QA 4BLWA 2CXTA 4R5MA 4H2DA 1GZDA 2JA2A 3AETB 2JJQA 3MK31 4TMWA 2CDAA 3QVMA 3U2QA 1U0TA 4ZQFA 4G37A 3WYBA 3ZHCA 3T7CA 3IVAA 3U31A 4BFYA 4WA7A 4ER7A 1W85B 4D9NA 3FX2A 2H2IA 4OEHA 1UBMS 2BF7A 2H57A 3EGIA 5DK6A 3FNBA 4HRVA 4QPZA 3IQHX 3JW8A 1S6YA 4LW8A 3L93A 4GS5A 2Q45A 4LSMA 4PICA 1S3SA 3CR7A 4YASA 4PQGA 3AR6A 5CDFA 4CT5A 1CRLA 1P91A 1I5EA 3HVIA 1JYFA 5E2BA 5MN5A 2FPMA 2EAUA 3FOBA 4GWGA 2FPOA 4CODB 5C5IA 5K20A 1G6Q1 4AQYB 4MW7A 3O2JA 5FOXA 3A0RB 2IZ1A 4IXMA 3D8SA 2YY5A 4BLVA 2QPOA 4FJ1A 2ZSUA 3BJZA 1IPHA 1GT6A 1X7XB 3L3BA 1JE1A 3L7DA 7ABPA 4MRNA 4KPEC 1Q7EA 1WSWA 2Z2XA 1DZ3A 2VBIA 3WKDA 1K9SA 1PT5A 4B85A 4PC2A 4ASUA 1KZ7B 1SRRA 3GQBA 1AHNA 1W87A 3LCJA 4MROA 4KOEC 2PVCA 4I1SA 3ZJUA 1Y4UA 4ZJZA 1EE9A 2ZW9A 4AY2A 1WO8A 3Q3VA 1MENA 1TU4A 3C43A 2IYEA 4BFWA 4F5YA 1Y5MA 1CJVC 3NW9A 2WF6A 4C7OB 3DYVA 3DDUA 1K8XB 3I2YX 3QNUA 4XB6B 2H52A 1U0HC 1GDHA 4G4GA 4J0DA 1DKMA 4G8JA 1Z56C 4HL6A 3PGLA 1T2EA 4UUPA 3VMFA 3WGYA 4AZVA 4BNMA 3R8FA 3U26A 1JDUA 3DZ8A 3PC3A 1F0PA 2VJCA 1YRWA 2PZFA 3AUYA 4M49A 4S2EA 1SPXA 1I0ZA 1O57A 3W78A 4DJEC 2ZJBA 2EKZA 3GBSA 1XZJA 3CLSD 1Y3DE 2C5FA 2W6ID 3N5CA 2Y6VA 4CKBB 5CM2Z 3H5WA 4XCQA 2C2ZA 4BUCA 3FVRA 1TTTA 1AKYA 4EPTA 3HDHA 3OQMA 1RHJA 3PC8A 4MV5A 1D2GA 1GCIA 5CNIA 5K0CA 2NU6A 3PXAA 1KWGA 4GX1A 2O3JA 2ID9A 5SZIA 1GFWA 3KYIB 1RRCA 2PJZA 4KO2S 3NT4A 3E3OA 2QLMA 2W2PA 4OHOA 1KIFA 2WJ3A 3MTJA 3DG9A 4HSEA 2P3QA 5F35A 4MW5A 2G04A 3V8VA 7MHTA 3RU9A 3FOZA 1HE3A 3UFXA 5I7HA 3WQSB 4RHFA 2X5OA 5CNKA 8ABPA 1Z37A 3WIUA 5LYJA 4AUNA 2ZUFA 3PLNA 4BEWA 1NXTA 3M3DA 1C8KA 3RVSA 5A04A 5JNRA 4IDEA 5BSMA 2ASEA 1NP7A 4PIVA 3FXAA 5EIBD 4W7IA 4EJFA 3WGTA 5BQ3A 3DV9A 5K8TA 4YVFA 3RG2A 4LE1A 5BSUA 1DO8A 1G5FA 4NYIQ 2OWDA 3SLRA 1N78A 3HMKA 1CDZA 2QGNA 4RPKA 1TM5E 3K6JA 3GGSA 2DPGA 4IDHA 3HR8A 3SIWA 2PRZA 5T8KC 1MUUA 1ISIA 3A9SA 3O4GA 1BAPA 1ADFA 3EAGA 4BUZA 3KQKA 2IPLA 3U61B 2Z5LA 3QLUC 2M6KA 1IEWA 1ZJWA 4DLWA 5EWJB 5ARCA 1BE6A 3P52A 4LXGA 4DSTA 3WLNA 2IIVA 1L4FA 4ROTA 4REQA 2VHCA 2GBPA 4UHJA 2ZVPX 1DAMA 2PM8A 4HDCA 1JIKA 3IXMA 4O0LA 4OI4A 1ZHOA 3PDWA 4JLAA 3NWPA 4DARA 1T36A 3FDZB 3QPDA 3LE8A 3IXQA 5LZ4A 5M2QA 3DMNA 1U28A 3AEQB 1I4TD 1EM8A 3OCCA 1GPUA 2PS1A 3LY7A 2IYNA 4EB6A 4ZCMA 2Q6OA 2WVGA 1GPAA 4X63A 4BTEA 3DCIA 3EEIA 4F56A 2CFCA 3VGPA 6CHYA 4KHZA 1WBDA 1Z13A 2I4IA 1JIXA 1TA0A 1ZWLA 2FWMX 3STHA 3VKFA 4ZK6A 4QEZA 1QYDA 2VP5A 4M6WA 1T26A 4MUFA 1IU9A 4XUCA 3DHNA 4RACA 5CB6A 1K3UB 2PX2A 3REQB 3VKHA 4DDHA 3BMCA 4JSRA 1XKLA 2Z4RA 3V8QA 4GMHA 3O91A 1APBA 4I4NA 3FFTA 5DXFA 3ZI0A 1MJGA 1GXSB 4EW3A 2QZPA 2O8FB 4TS4A 2YXPX 3U16A 5CK4A 3C16C 4NV0A 1AVTA 3M70A 4ZQBA 5EP4A 3E9ZA 4OHRA 5CITA 4OFBA 4XH9B 1I1QB 2WD7B 4BVLA 4W1QA 4R1PA 4XX1A 1A71A 1ZBQA 3CX6A 1EP3B 1GQOA 2IOYA 3I52A 3R5JA 2QVCA 4GSLA 5G4KB 4XJXA 5GP1A 3RVNA 1T15A 1G5HA 2DQSA 1HI9A 2YWRA 2X9QA 2R8PA 1P77A 4WCVA 1KAOA 1TEXA 1XD2B 3KHTA 1GITA 2EZTA 3QEOA 2V9PA 1SELA 2BM1A 2QN2A 4TXLA 3OT1A 3RE1A 1R1DA 1VI6A 5I4KA 3F2VA 4JJ4A 3MUNA 3T5TA 2LD4A 2ZM6B 1P62B 3I9LA 3Q7SA 4JB8A 1R8SA 3JVDA 4RZ2A 4LDNA 4DLZA 1LLCA 4YJ3F 3Q72A 5G0UA 1T9AA 4B7CA 1NDUA 2ZJ2A 2WWWA 4RXMA 1AKUA 3THOA 3T3IA 5IJZA 3TOXA 1KI8A 1Y5RA 2AOTA 2YHIB 4HDAA 3TX2A 3PR1A 4Y0NA 3KUCA 2O7VA 1NQXA 2WTMA 3DL2A 3JALB 1R0YA 5JY1A 4LFAB 1B41A 3VVCA 1XVUA 3B52X 2Y1EA 4X7PA 3CLRC 4RZUA 1TVCA 1SNYA 4BS9A 3P9PA 3SBEA 3LQYA 5INTA 4W82A 1G64A 2UZAA 1FXUA 4KYIB 1KOLA 4A10A 4KAAA 4B4WA 3BH0A 2GKGA 4GEKA 4UNQA 2BKLA 2W42A 5M5BA 1OZFA 4QAJA 2QK4A 3O2SB 2PQMA 2PUJA 3PNPA 4NOLA 4G4SO 2OUIA 1DRWA 2RGGA 3DJYA 1UEXC 3DOJA 2BZ1A 3A2NA 1PR5A 3EB9A 3A8TA 2FUG1 3FNFA 3I72A 3N39C 1NUPA 2L19A 1UFRA 3Q85A 5M04A 1Q3KA 3E0QA 3S8EA 3M2PA 4WBNB 2FLVA 1G21B 4HHEA 5HRCA 3AHCA 3TOCA 2Q6KA 3AESA 3EN0A 1EDBA 1CK4A 1EVKA 2HJSA 4BEVA 4YRIA 2DE0X 3DS8A 2JFYA 5IVDA 2ZUTA 3WFIA 2JIDA 1CYDA 2B99A 5JC1A 2JAPA 3R20A 1TF7A 4J4BA 1SHZA 3A36A 3EF3A 3MUEA 4KQXA 3FNHA 2AJLI 3SEFA 1F9AA 4DHWA 4MW2A 4CUJA 1HTTA 2OECA 4A6EA 1MX3A 3GVIA 5C8XA 3RO7A 3CVWA 4MJ3A 5IDWA 5CR9A 4NONA 4PHTA 2NO5A 1QRAA 2VHJA 4I8IA 1G9SA 1HBJA 1NUSA 2GK7A 2PZKA 3QBDA 4PBSA 5AVUA 5JOQA 1Z06A 3KJHA 4ZA2A 4LJ7A 1NV8A 1X3LA 1QHNA 3GDHA 3T3MB 1CETA 1N0VC 3WIBA 2BIFA 4X3PA 4ZHSA 4RLQA 1KMNA 1G5TA 1GL6A 1GQQA 1IATA 1ZKDA 5IN5A 5BSFA 4GRAA 5BQFA 4N76A 1LV8A 4M0UA 1GA4A 1I3CA 3GA5A 5EN4A 1XX6A 1ZI6A 2GZRA 3FHLA 4D7AA 2NSHA 1MJNA 3EJ6A 3VR4H 4AS2A 4G85A 1B0PA 3SYMA 4EKGA 1S2NA 3PQ8A 4ZAGA 1ZRHA 1BS1A 3UJDA 3T1VA 3PLAE 2A0YA 2I8AA 1VRVA 2R68A 4UREA 1TD9A 1GGEA 2ACVA 1FTNA 4MVJM 1G1AA 2A1TS 3EOZA 2VQFB 3V4RA 5FUYA 2BUCA 3SX4A 3PC2A 1BCRA 3G5MA 1GZSA 1CEXA 1D7OA 1Z0ZA 2JGKA 2QMOA 3EW9A 3OWOA 3ROFA 4I1YA 1G2IA 4NEGA 5PNTA 1O5TA 4F9GA 4HEQA 2C99A 1YDGA 2X7JA 1NMQA 2HA2A 1SB9A 2YXBA 3OF5A 2ZTVA 4DREA 5ULLA 2G40A 4XD2A 3U7RA 3PNSA 3HCOA 2A30A 2WUGA 5K8UA 4XR4A 1WUYA 2HR1A 2FEMA 3GFQA 3L02A 3Q0IA 2QJOA 4FW9A 2GNOA 3CNBA 4EELA 1M9NA 4XARA 4Z1MA 1Z75A 1FYXA 2P0YA 2YICA 1ZC4A 3SICE 3LWBA 2C20A 1QE0A 3R3JA 4CRWB 2XMRA 4YDQA 1KAEA 3G02A 4II2A 3GCXA 4B2IA 1BKYA 3F7OA 4XSVA 4ARVA 1FZQA 5KNDH 2PKCA 2FQ1A 3C8ZA 1H2WA 4IQGA 4QBHA 5HF6A 2E1RA 4NBUA 4Q1FA 5KDDA 1NYRA 2D2EA 4QO8A 3I6ZA 4PLWA 1DUIA 2C2KA 3SZLA 3QNWA 2BTQB 2HV9A 3WIDA 1BMQA 4CFZA 1FTGA 4Q48A 3L1KA 4NZOA 3G17A 3MWDA 3OPYA 4M89A 2RAPA 2FK7A 3TJZA 3L79A 3C3PA 4O29A 4ZQGA 4YJ2F 3QKSB 5BYAA 2EOAA 3LW8A 4JYCA 5I01A 2H31A 4DQLA 1NUUA 2QMZA 3AUTA 2CHVA 1MVNA 1X3SA 5KOYA 2VPIA 4OOEA 1FRFS 5CP8A 1E2JA 4IEIA 1DQPA 4RD4A 1F8UA 3UWOA 4GPBA 4P80A 3ND7A 4LOKA 5B3JA 3CZQA 5A1TA 2P11A 1NXSA 4F93B 2BHRA 4ARCA 5EJ9A 1KC3A 1YZKA 2A9KA 2Q2WA 1E96A 5CM8B 1LI7A 4EB3A 4KUEA 1A5BB 1CPYA 1CUZA 1ZSVA 3E15A 3U7QB 2HMYB 4ENVA 1POWA 2C54A 1K6MA 1Y3HA 2BJWA 2RHRA 3PUVA 2V8BA 4ZI3A 5C3MA 4DUYB 5ALDA 3SK0A 3W9SA 1G6HA 4MIEA 4TQAA 3KLPX 3RFFA 4BMYA 4XXHA 1XEAA 2QVLA 4WUTA 4CIYA 1RI2A 2QTFA 3D2AA 3O03A 4YCAA 4FC6A 3O9VA 2B92A 3JQDA 4ZYTA 1TYCA 1V4VA 1XNQB 5F9MA 1VI5A 5JSZA 4V3BA 4JC0A 5KKCA 4PV7A 2PSEA 3AKYA 3KDAA 2DERA 3JAKA 2PCLA 2B0JA 5C81A 4XTRA 2IL1A 1ADYA 2NZXA 1DIBA 3MOIA 4LKOA 4UUBA 4URXR 3E1SA 1XA4A 2UZ0A 1T6BY 4RENA 3PFBA 4CDRA 4HDRA 2BUAA 2C8LA 2I71A 2PSDA 1N1GA 1XRRA 1W6RA 2W9XA 1ACMA 2HZ7A 2VSOA 3H2JA 4OH1A 3AFMA 4H18A 4QGGA 4C21A 4Q7KA 4B4OA 4DR5B 5AHKA 1MO6A 1XTBA 2H1WA 1F1JA 2UZ1A 4OAPA 3DE2X 1UAAA 2OLJA 4QYIB 1DP4A 2BISA 4CHGA 4ZYWA 3LL4A 2P2YA 1DWQA 1NBME 1G8MA 2CGEA 2D1RA 5GONF 1YL7A 5FL7A 1DKPA 4C20A 3I6BA 3HO6A 3P4YA 4MWOA 3THXB 4HPJB 1FFYA 1ZCAA 3TTWA 4AIRA 1ZMRA 2WYVA 5DX8A 4E6PA 5KS2A 1OH5A 3LTNC 2M2IA 2WHPA 5B3AA 4YP1A 4PZEA 3PJGA 3GZNA 4Q3NA 1UMCB 4RVFA 1T5BA 3HWWA 3ZS9A 2JIMA 4Q6WA 2NV2B 3VQTA 3WLSA 1J25A 4LOAA 4AP9A 4WI1A 5C5DA 4Q1BA 4QT4A 3UJNA 1QP0A 2YZKA 3NV7A 4Q12A 1G3QA 1EH5A 1D4AA 3GDOA 5EJIA 4ZU6X 1MABB 1IXZA 5G1OA 5TIIA 2R6HA 2WF7A 1TJ3A 2UVQA 2X9LA 1Z28A 2WSBA 3ANSA 3HMQA 3Q0TA 4CL8A 3K2IA 4HWKA 2ZYUX 2NZJA 3LZCA 4HFRA 4QZVA 2PKWA 3DDZX 1EDEA 2C97A 4YJGB 5I51A 4XVRA 4PG8A 2TMDA 2GBCA 4M7RA 4HLUA 5B1DA 3HA3A 5FPKA 5HKOA 1GM5A 1EFRA 4ECEA 3I9OA 4C0WA 2VP3A 3N6RA 4DVJA 5I8PA 2LTAA 1WZUA 4FYHA 3TL3A 3FETA 1R6UA 1TC2A 2HREA 1FNNA 2IE8A 4KQJA 1WTAA 4X6LA 2KB0A 2O06A 5T3YA 2QAGB 1D1TA 1XCOA 1UPFA 2OHVA 2QY6A 3RSSA 3BREA 2DB3A 1JECA 1IWPB 5GJBA 1I33A 4KJXA 4HUTA 3I12A 3QVGB 5G4LA 5B7PA 3P45A 1KI6A 1JPVA 1ZH6A 4YN3A 5M3BA 2QE7D 1YS4A 3AYZB 2K4MA 1YACA 2FWJA 4W7SA 1PU2A 4BNFA 4BZWA 4JWKA 3MJCA 4KIFA 5BRJA 2QX7A 3UBMA 4DR2B 1QIDA 5DKFA 2HA5A 1G98A 3EC2A 4AUEA 2ZYAA 1GYPA 1QR2A 2MINB 2JLRA 4K1XA 2PGOA 3U5ZB 2WOJA 4ARZB 5LN1A 3EBLA 3A1CA 3L1VA 2C7RA 1NW6A 4OLHA 5BNTA 5JAOA 1WF3A 4FHDA 1OFIA 3LUAA 1JU9A 3EVTA 1EFVB 5DGDA 2RKWA 1ATIA 2XRZA 2JLBA 4Q16A 3L4BA 2FQWA 3LX8A 5D3MB 2Q9BA 2R9VA 2VAMA 1OFVA 4Q9IA 5CB4F 3RKRA 1VLQA 1C1XB 4KXWA 2ODBA 4LZZA 3FPFA 1RYYA 2MYNA 1MVLA 4M8NE 3WHKA 1B8PA 3IBFA 3W34A 2EVWX 3LGAA 5A03A 4YHHB 1M2WA 2WTNA 2F8TA 1UQTA 3LWNA 2VZ9A 1YVUA 4FW8A 5ERXA 3RU2A 4DA0A 2O1WA 3OC0A 1RI3A 3WLLA 4LPKA 3WGUA 1D7AA 1KORA 4B31A 4H7IA 1EVYA 4MQLA 3RIHA 4OXYA 3SZGA 2O8DA 3M9XA 1I1NA 2QI9C 2A3RA 2R47A 4UBIA 1LDGA 3VNSA 4ZO6A 1I0LA 4HRYA 2EBFX 3LXXA 4XD7D 1O94A 2OMEA 4Q05A 3G5UA 4CG2A 1CB0A 1V6AA 1SXHA 5KOIA 2VNKA 2DFDA 2IYRA 2OORA 1ZI9A 1IEVA 1KDYA 2VJMB 3SQOA 1BZYA 2WTUA 1QP7A 2VAXA 1ZCBA 2ZIXA 3LX4A 5FLXA 1YR3A 1PR9A 3IIJA 3CZRA 1K6IA 4OIMA 4AJLA 3QVLA 1VLVA 4TS3A 2L18A 2G9VA 1GTVA 1Q1ZA 2WAMA 2QZSA 4RFSB 4RGVA 2AFRA 2EFCB 2W0SA 4F0JA 3G85A 3WGNA 3PC8C 1U63A 1EPUA 2GF2A 1QS0A 1U81A 4XDHA 3B20A 4G2TA 1JR2A 1ZOSA 3LO8A 3QG1A 4TXMA 2IVFA 3CIOA 3MWLA 3SYRA 3BAFA 1NWHA 4OHZA 2YHBA 1XA0A 1ORIA 5JD3A 5DIZA 2NU8A 2C9DA 4IDQA 2A14A 5AM2A 4LHSA 2Q8NA 2Q3DA 4Y2YA 1S8NA 3LLCA 2B6NA 3TPFA 1L4GA 2NOAA 3IUPA 3VR2D 1EGAA 3IEMA 2WJJA 4NU0A 5CDTA 3QI2A 3DTVD 1AK2A 2FSVA