3OBBA

Crystal structure of a possible 3-hydroxyisobutyrate dehydrogenase from pseudomonas aeruginosa pao1
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
296
structure length
295
Chain Sequence
b'MKQIAFIGLGHMGAPMATNLLKAGYLLNVFDLVQSAVDGLVAAGASAARSARDAVQGADVVISMLPASQHVEGLYLDDDGLLAHIAPTLVLECSTIAPTSARKIHAAARERGLAMLDAPVSGGTAGAAAGTLTFMVGGDAEALEKARPLFEAMGRNIFHAGPDGAGQVAKVCNNQLLAVLMIGTAEAMALGVANGLEAKVLAEIMRRSSGGNWALEVYNPWPGVMENAPASRDYSGGFMAQLMAKDLGLAQEAAQASASSTPMGSLALSLYRLLLKQGYAERDFSVVQKLFDPTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable 3-hydroxyisobutyrate dehydrogenase
molecule tags Oxidoreductase
source organism Pseudomonas aeruginosa
publication title Biochemical and Structural Studies of Uncharacterized Protein PA0743 from Pseudomonas aeruginosa Revealed NAD+-dependent L-Serine Dehydrogenase.
pubmed doi rcsb
total genus 99
structure length 295
sequence length 296
ec nomenclature ec 1.1.1.387: L-serine 3-dehydrogenase (NAD(+)).
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase
A PF14833 NAD_binding_11 NAD-binding of NADP-dependent 3-hydroxyisobutyrate dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3obbA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3obbA01
5L9AA 2YY7A 1Z74A 4D0RA 2GGSA 4IQGA 1E7WA 1WDMA 4W4TA 3VC7A 2NVWA 1JAXA 4LN1A 3VTFA 3ZNNA 4LCEA 2DUUA 4PRLA 3RC1A 1ZSVA 3ZWOA 4YT8A 3EVTA 2IEBA 2Q1UA 1DIAA 1QLJA 2G82A 2IXAA 3KBOA 3I4FA 3W4IA 4ALMA 1NX6A 4IDBA 2ZIZA 2GN6A 4ZQHA 3VTZA 1JN0A 3GNSA 4JK3A 3FCOA 1SOVA 5MDHA 1MXHA 3QE3A 2J3JA 4MPDA 4BNNA 4CPDA 3GMDA 3R0IA 4EI2A 4FR5A 4DIFA 4YAIA 4GSKA 4B7UA 4AJLA 3TF5A 1BWSA 3IS3A 3ZNOA 1F8FA 3UOGA 1OOEA 1EK6A 1ENPA 3DC2A 2DUWA 5JPIA 3ZWWA 2P2SA 3OH8A 3GVIA 4XRRA 4E5MA 4ESOA 4TSKA 5FYDA 4BNWA 1A7AA 5FWNA 2VYVA 4XGIA 4WLUA 4XR4A 5L7WA 1EUCA 4MIYA 4YRDA 5L4NA 1FDTA 5ILGA 3OA0A 3ZW9A 4CMGA 3C1AA 5T5QA 1ARZA 3WICA 4NNJA 4R1SA 1VC2A 3M2PA 5F1PA 4R4JA 1Y8QB 4BMSA 4IJWA 2NACA 3CINA 4L76A 5H81A 4RJTA 1JDJA 2FP4A 1F8GA 4BKUA 3KYBA 3ZWCA 1EVYA 2I3GA 2VHYA 3GGOA 5U4QA 1TI7A 4LMPA 1C1XB 3LLVA 3QQPA 4OH1A 5KKAA 4FFRA 3WNVA 3RFVA 3ENNA 3QIVA 4IDGA 1DFIA 1NR7A 2GUGA 1NQ5A 3PQEA 4XB2A 1PSDA 3NTQA 3I9LA 2Y93A 2C0CA 3WBFA 2ZATA 3KYDB 3L77A 3ITKA 4DBVO 1HDGO 4BO4A 3WGHA 3QLJA 1H94A 1KEVA 3H2ZA 3M1LA 1NNUA 2ZB8A 4GX1A 3N7UA 5JY1A 2X7HA 2HJRA 4WCFC 4BO5A 3QWAA 1H6DA 3ROMA 1VRWA 1HETA 1OI7A 4JQCA 3ASUA 3DEYX 1KY5A 1R0LA 4I5GA 4FDAA 1QG6A 3E5MA 4IDAA 1K6JA 1HF3A 2DBZA 2R6JA 4GLLA 4UVHA 4IS3A 3KLPX 1PJ3A 1JLLA 1SB9A 4XB1A 5EN4A 3A9WA 3VZQA 4YACA 3LT4A 2OBNA 2WM3A 3RROA 3DZKA 3Q2KA 5CDYA 1BDMA 2BFAA 2G17A 3DZJA 1DSSG 4U6QA 3RVDA 1TLTA 3O9ZA 3KB6A 3UN1A 1OZAA 4XQGA 3ZV6A 1M2WA 3AM3A 4I5DA 4IDDA 1EDOA 2RBEA 5DCUA 3VZRA 4B3IA 1ZW1A 3ADPA 1P31A 1P1FA 1PJSA 1L7EA 2HQ1A 3AW9A 1O95A 4R01A 4BNYA 2W2KB 5IAAA 3V2HA 1G6KA 1QXSA 1YO6A 1FXSA 3WYBA 4II3A 3MTGA 4Q3AA 3NX4A 3F9IA 3JQAB 4QX6A 1PGOA 1PZGA 4Y98A 1A9YA 3AOGA 4GX0A 4WCFA 3S2GA 4KTTE 4EGFA 2EP5A 4R51A 1Y5MA 4RQTA 1R4NA 2J3HA 2OP0A 1OMOA 3ZU4A 4FFNA 2DPGA 4XGKA 5GMOA 4RZIA 1U1IA 2Y67A 1H5QA 3BZUA 2E48A 4P38A 4DIBA 4UVGA 2WYVA 2O3QA 3F5QA 1ISGA 4P4NA 4WNCA 3FNEA 1YQXA 4BNJA 5A5EA 2O7QA 3FTPA 1Y8RB 5EL0A 2B4QA 4NFYA 3D5TA 1H2HA 3I9JA 1IB6A 4IDCA 4UVEA 1GEEA 5F1OA 4UVIA 5KWEA 4XIYA 4IJKA 1KVSA 3F46A 1XKQA 1N7HA 4JXKA 1M6WA 2DT5A 1O6ZA 3ZGYA 4XJTA 4FQ8A 4N7RA 4P4GA 2NV6A 3X2FA 1ULSA 3GVXA 3O26A 1FDWA 3FR8A 4OQYA 1LRKA 5IFLA 3ZV5A 3B1FA 2AE1A 2O4UX 4BOYA 3JQFC 1RM4A 4BQRA 3U4CA 4O63O 4MVJG 2DU8A 5C7IO 3D0OA 3ZN2A 2PH5A 4XYMA 1M66A 1YBAA 4CQMB 2NU9A 4ZQGA 2A92A 2AG5A 1YL6A 4EJMA 3QVSA 1ZSNA 4A10A 4J6FA 2NM0A 3JYPA 5TGDA 5JCJD 2NVUA 2POQX 4R9RA 1GQ2A 1NFQA 1NVGA 1GYPA 5HWSA 1GL3A 3LU1A 3QJ5A 3GFGA 2I6TA 3D4PA 4ND4A 5DBGA 1I3MA 3VPFA 3TDKA 1EVJA 3KZVA 3F4BA 4Y6PA 3TSCA 1P1JA 3PJDA 3CUKA 4FOSA 4ZICA 5CFZA 1K2WA 2Q4EA 3C85A 5DCWA 1LDYA 2B35A 2IXBA 5BSEA 1DHTA 2P4HX 2JKVA 2UVDA 5JSFA 4CMHA 4J1SA 1EBUA 5F21A 3C3XA 5CEEA 1D4FA 3BHIA 1UXJA 2EJWA 4JJIA 2YFQA 4M89A 4J7UA 4NU6A 5EQFA 4LVUA 3UFXA 1P77A 4J9VA 5FEUA 2D8AA 1EFKA 1OC2A 5ILOA 1U9JA 2P68A 2X23A 3VZSA 2GO1A 1NFRA 5ICMA 1LLDA 2ILTA 2X5KO 3GNTA 3ONEA 3PIDA 3MJ4A 4J90A 3OSUA 2ZJ0A 4YAGA 1VJ1A 1GZ3A 2ZB7A 4I8XA 4MJLA 3ZWXA 1YDEA 2WDZA 3U3XA 3GT0A 1EMDA 4OOFA 4F6LA 2Q2WA 4MP8A 1QMGA 2GNAA 1GCUA 3WSWA 2E37A 3W8EA 2HMWA 3COSA 4H3VA 1ONPA 3RUCA 4RF5A 1I33A 3I4CA 2BELA 1CQJA 3KEOA 1WDLA 3Q9NA 1CYDA 2X5OA 5TF4A 5BNIA 4WLFA 1XCBA 3OEWA 1O8CA 4CM1A 4RQUA 1C1DA 4NK4A 4R9SA 4J2OA 1GDHA 2C07A 1DRUA 3ITDA 2HMTA 2JD0A 1T1SA 1D7OA 2NADA 2PZMA 2HRBA 3AWDA 1LUAA 4XCVA 2CVOA 1PJ2A 2R00C 4B4UA 1P1HA 5CEFA 3AOEC 4E0BA 3CMCO 4RZHA 1UP7A 5B1YA 3HHPA 3G79A 3WFJA 4BO7A 3UH1A 1TVEA 2I3AA 1NFFA 2YHUA 1YOVB 1PL8A 2Q2QA 2NQ8A 1BW9B 1LQUA 4E32A 3DBRA 3WFIA 1V3TA 4URFA 2VT3A 4E5KA 3BTOA 4C7KA 2VT2A 3PEFA 1BRMA 1ZBQA 1P1RA 2YZ7A 3VKVA 3TL3A 3H3FA 4IQ0A 4J3FA 2AEMA 1Q7CA 2AQIA 1YS4A 2DBQA 2Q1SA 3O38A 1VPDA 1R12A 4OM8A 3V5NA 3JYLA 3ZZNA 1E7QA 2ZYDA 2I76A 3MJCA 4GL4A 4BNIA 4D3FA 1A72A 3LT0A 4WE3A 4KUEA 1GPJA 2IZ1A 2C59A 4ROSA 4NZ9A 5AVOA 4DLAA 4I5EA 3G1UA 4DMMA 4CM9D 3U5TA 1VJ0A 2VZ8A 2P5UA 3LF2A 2PD3A 2O48X 4XD2A 3DFUA 3GPDG 4QT0A 5K9ZA 3BHJA 1U5AA 1NAIA 4Q3DA 4IY1A 3DFZA 3U49A 3E1KA 1HE5A 1JVBA 5FI3A 4LK3A 2VHXA 2R00A 2VYVD 3H8VA 2IODA 4GKVA 4AVYA 1C14A 4OKIA 4PZEA 4FCCA 4HNGA 1E6EA 4W82A 1T4DA 4XRGA 5L4SA 4XX0A 1VLLA 1N2SA 3JQBC 4FGSA 4R41A 3T4EA 2YJZA 2ZQYA 2EWMA 3I83A 4TROA 3H2SA 3EW7A 3GLQA 3OIDA 4AG3A 2O3RA 4PG7A 1HDOA 5DP1A 5A02A 1ZJZA 4TMFA 5DULA 2OMEA 4Y67A 2IE0A 2EEZA 1B3BA 5JDIA 3VOSA 4UREA 4AJ4A 1LSSA 3RU7A 4DYDA 1DRWA 1YDWA 3DOJA 4WOJA 4IDFA 1AUPA 1HDRA 4EYEA 5IJZA 4RVUA 4DQXA 1N92A 1U4OA 1GD1O 3DBHB 4L8VA 4HUJA 4IJUA 3ZWVA 3OQ6A 2HK8A 4JNKA 3PJEA 3GAFA 3EVNA 3JQGA 4AJEA 3DZHA 4HBGA 1LX6A 3SC4A 3JD0A 4UUMA 3WGQA 4BNMA 1DLJA 1N9GA 3JQFA 2B83A 3PHJA 3AFNA 2JCXA 1KVRA 3NAQA 3DBLA 4J49A 3HNPA 1PJQA 3JQBA 2EP7A 2BFMA 4J16A 2NUAA 2JHGA 1C0LA 3W6ZA 2JFGA 5LCXA 2ZCUA 3Q2IA 3MJTA 2UV8A 3D3WB 4H7PA 1E3EA 4WUVA 1HLPA 3H9QA 4CQLA 4J91A 1ISJA 2Z1NA 2OXIA 4ZU3A 2OOSA 3GGPA 4MKRA 4W7HA 4DC1A 1H6AA 4KUGA 2B5VA 3D3WA 2VHZA 4Y8VA 4JBIA 2EF1A 1NR1A 3KM0A 1G0NA 1LLQA 3H9JA 1NASA 2YFHA 1ML3A 2VZ9A 4ZGWA 3AU8A 3CE6A 5CAEA 4HX5A 2VYNA 5G0WA 4OAQA 3L4BA 2QIOA 4MVJP 1BMDA 1MA0A 3PP8A 2ZTUA 5B12A 1GZ4A 5TQVA 3CEAA 2DKNA 5B4TA 1EUZA 3HSKA 3UCEA 4B8ZA 3WG9A 4BKRA 4B7XA 3ETDA 3GN2A 2VRCA 4I1IA 1VJTA 1I24A 1E5QA 3KEQA 2X9GA 3NUGA 3SC6A 3QWIA 3S2FA 1DIRA 4YJHB 3K9QO 4O0LA 5HM8A 3UICA 2AG8A 2FN7A 1ENYA 3RC9A 3OM9A 2FR1A 7MDHA 4J4TA 3WIEA 5COQA 3AFMA 2CD9A 2O7SA 1X7GA 1HWYA 4GQAA 1PR9A 5CDSA 1A9ZA 3BMCA 4MINA 3RBZA 5I9MA 3WOHA 3K92A 4QFCA 4OO3A 4YAEA 1E1NA 5EINA 2Q50A 1Y8QA 4ONEA 1JTVA 3U4DA 1X13A 4UAGA 1HTBA 4BKPA 1TT5A 3KSZO 3OJOA 4Y6SA 1V3VA 4MVJE 3EY4A 3PQFA 3I3OA 1D1TA 1VI2A 1ZEMA 1E1LA 4QO8A 4EJ6A 3KYCB 4LSWA 3D64A 3WQQA 3EZLA 1HDCA 4CL3A 3GUCA 5TIIA 3PVZA 5DCYA 2EGHA 3KSDO 3L4BC 5BQFA 4F46A 3JQ9C 3WGTA 1LBEA 1BXGB 1U3TA 4CR6A 4BO1A 4D44A 3DL2A 3QP9A 3TWOA 5ITWA 3WX0A 2DC1A 4Z3KA 4AFNA 1KVQA 1DIBA 4YEDA 5JCJA 4K28A 1J49A 4NPCA 2FHSA 2RHRA 3AOEA 5JY6A 1NPTO 1KIFA 3DXFA 3JQGB 3HUDA 3OA2A 2A94A 4RGBA 3ANLA 4YBZA 3RAJA 4B3HA 3TZKA 3LVFO 3MEQA 4E4YA 2FOIA 1XU9A 3RUHA 1JKFA 5A3JA 5K6AC 1MX3A 2BD0A 1IL0A 2RCYA 3T7EA 1E3JA 1IHXA 1EEHA 3OHSX 4BNZA 5BNTA 2DLDA 3HJAA 3PHLA 4UUOA 4E13A 3GHHA 3GVHA 3VPGA 5JDCA 1LXCA 4XKJA 5BSGA 4YJGB 4NBUA 2FSVA 2CF6A 3ANMA 3Q9UA 2X5JO 3RD5A 1ZFNA 1A27A 3GG9A 2H9IA 2NWQA 3L9WA 4ND5A 1NPDA 1IOLA 1MV8A 5TS3A 3VPXA 2V6BA 3KHUA 4A2CA 1BDBA 1PEDA 1O94A 4KOAA 2C54A 5L51A 5DP2A 2H63A 3JQ9A 5JMPA 2FR8A 3VHRA 4NH4A 2CZCA 1U2GA 2DPHA 2YUTA 1I3NA 4NG5A 4UEOA 5A06A 4NK5A 3TFOA 1R66A 4G2NA 2PTGA 5ADHA 4A26A 2HUNA 3VDQA 3OF2A 3SLGA 1H93A 3WQRA 1YKFA 1XHLA 3IIEA 2X9VA 4PG4A 1C0IA 3LYLA 1K3TA 1DO8A 1ZIDA 5KJ1A 1JKJA 2VUTA 4R68A 5IG2A 4GBJA 3ZNQA 4M8SA 3QSGA 3E82A 4F6CA 1SB8A 1T2EA 3H9UA 1QYXA 1ISIA 4FBGA 3K8ZA 2Y66A 1JU9A 1PZEA 1DHRA 1FJHA 1Y7TA 3DZFA 3H4VA 3OETA 2ZTMA 4GMFA 4NBVA 5JDCC 1XA0A 2VOEA 3OJLA 4TVOA 2C82A 4S1VA 5CHEA 5KVVA 3TJRA 1J4AA 1XGKA 2E6UX 4EDFA 5JDIC 4QXMA 4UEKA 3SX2A 4DMLA 4PZDA 5U1PA 5COBA 2IYPA 4AJHA 1HLDA 3PHIA 1VE9A 4DLLA 4J4HA 1GV1A 1V9LA 4AJIA 1RWBA 4MOWA 1E3WA 4EUHA 1IHYA 3ZV3A 3AU9A 3AJRA 2BMAA 4IMPA 7ADHA 3K2BA 4RCVA 1F14A 3IQDB 1DOHA 3DZGA 5L7TA 2WD8A 1XDWA 1ZXBA 2C29D 2AXQA 4D7AA 1CEQA 4BO8A 2XPCA 1XQ1A 1SZJG 4H15A 1R37A 2EIHA 3L07A 4RVDA 1ZMOA 5HA5A 3ORFA 3EZYA 4M86A 3OJ0A 2GRAA 1L1FA 2CDCA 3NKLA 5JAQA 3K30A 4I9UA 1JVSA 5G0UA 2YV3A 4IXTA 1DC6A 1DLIA 4Q3EA 2WD7A 1I0ZA 2V6FA 2WYUA 1QKIA 3VAZA 1ZK3A 3UUWA 1I36A 4PLGA 2J6IA 5EQDA 1EVZA 3PDUA 3AM4A 4AJJA 5A04A 1WW8A 3GDFA 3Q0EA 4J1TA 2C5EA 4YJDA 3DAGA 3HDYA 3CIFA 1PQUA 3P2YA 5GY7A 1ZMTA 3OBBA 1TT7A 1Y5RA 3JD3A 2Z95A 4OJNA 3SEFA 4GWGA 2ZTVA 3L6OO 3CXRA 3LLSA 1NHGA 4HP8A 3TRIA 4CV1A 3L0DA 1EDZA 3BMNB 2Z1MA 3WGIA 1HDXA 1V8BA 4RPHA 5A05A 3MWDB 4IXWA 3RKUA 5DT9A 4E5YA 4GPD1 2WMDA 4A03A 4WCFB 4XDYA 3I5MA 3AI1A 1WNTA 3ZWBA 3MJSA 2CSUA 3GZNB 3DDNA 3WDSA 2X6TA 1YL5A 3QVTA 1EZ4A 3A4VA 3GK3A 3C7CB 1KBZA 3PWZA 4MDHA 4II2A 4J4BA 4ZHSA 4L4SA 1R0SA 4A27A 4LCJA 5IXYA 3DTTA 2AQ8A 3RWBA 4D3DA 1X14A 2NLOA 1E5LA 2YQ5A 4AL4A 2P9CA 5BNFA 1HDYA 1PS9A 1P9LA 3PHGA 3GVPA 4M1QA 4ZVVA 4BB6A 5BSFA 1GFSA 4D0SA 2BRUA 3GQVA 1YXMA 1MUUA 2V65A 3KETA 3A06A 2JD1A 3EDMA 1SMKA 1I2BA 3GMSA 5A3VA 5HBRA 3PDJA 4FIZA 1EQ2A 1B7GO 1BSVA 3S1LA 4LGVA 1QR6A 3L4SO 3VZPA 2B4TO 5L7YA 1ZXLA 3HQ4O 2X58A 3ZWYA 1KVUA 2BGKA 1XWFA 2V6MA 4NQZA 1SNYA 4JLWA 1B8UA 1VL6A 1ADCA 3STHA 2Q46A 1U3VA 4R5HA 3P19A 1UJMA 3RU9A 4IPTA 4PVCA 1O5IA 4EBFA 3JD2A 4FGWA 3AUTA 4YPOA 5EESA 3FTNA 1R0KA 1XU7A 1DC5A 4IMRA 4AJ1A 2P4QA 2Q1WA 3GGGA 4BNLA 2PGDA 4W6ZA 1NAHA 1ADFA 2RAFA 2QYSA 5BT9A 2DQ4A 1QSGA 4NR0A 3ZCXA 2Q4BA 5DNAA 3MWEB 5K6AA 1B14A 4ND1A 1LDNA 3F3SA 2Q45A 4B79A 5G0SA 2Y1DA 4WKGA 1RYDA 4BNKA 1RM0A 3WXBA 2CDAA 4R1TA 1IYZA 2B69A 4CMCA 4X54A 2YV2A 1GY8A 4KDEA 3PIIA 3KLMX 1KC3A 4K26A 3CZMA 3UF0A 1BHSA 3WSVA 1OC4A 1H2BA 1QYDA 2HMUA 4CR7A 1AHIA 5KJ6A 4MVJF 4HV4A 4NDNE 4DBZA 1EVIA 3HFGA 4TWRA 1XR3A 1SEPA 1MXFA 5ENDA 4GGPA 4RVFA 4HFMA 4Q9NA 3S2EA 3EGOA 3VH4A 1NQOA 3V1YA 2E49A 3I9NA 1JAYA 4M55A 3SVTA 3DBRB 1H9BA 4PRKA 4KP7A 3NYWA 3EUWA 3W6UA 2VWPA 1U28A 3Q11A 4OXYA 1YBMA 1T2AA 8ADHA 1CWUA 1VSUA 5KTKA 3INTA 4M87A 2UDPA 4U6SA 2D5CA 3DZBA 2ZB3A 1DJNA 1T25A 4J7XA 2PKRA 4PZCA 4FFOA 1UAYA 3S2IA 2QW8A 2BH9A 4MP6A 4KZPA 3ICPA 4GI2A 4N18A 2RH4A 4YT4A 1YGYA 2Y05A 1PQPA 3C1TA 3H5NA 3ROQA 4D45A 4WLVA 5G4KB 3JV7A 3ZWPA 1ZK0A 3ETEA 4BUCA 2Q49A 5L95A 5G2OA 4E3ZA 3BIOA 3CTVA 2BHLA 1C1XA 3C7AA 1N5DA 1B8PA 5EIOA 4UUNA 1X0XA 1W73A 4Z3DA 1O9BA 1GYQA 1LRJA 4YAKA 4TRNA 3CH6A 3UAGA 4GGOA 4RDIA 4YXFA 1KETA 1CERA 3B20A 3AUAA 1XIVA 3RKRA 3DTYA 4YRBA 2P9EA 2HKIA 2HO5A 3C24A 3M1AA 3ROPA 4CM4B 4NI5A 2X22A 2GERA 3PYMA 2ZYGA 2C7GA 3IJPA 5C7OO 4BMVA 3T4XA 3U0BA 2JJYA 3S8MA 2WJPA 1ENZA 3GZ4A 3AUSA 2RHCA 1SO8A 2HAEA 2HK9A 2J3IA 1QV6A 2UUPA 3E9NA 3KXDA 1QRRA 3QW2A 2DM6A 2AEFA 1E3LA 5C5IA 1BXZA 1CQIA 4AICA 2I5PO 2BFPA 1RYEA 2Y1OA 4AJ2A 4AJOA 5L53A 2VYND 3E03A 1X1EA 4D41A 1QLHA 2O3SA 5CEJA 4YWJA 1MG5A 2EW8A 3GNQA 1M76A 1KVTA 5G4LA 1ADGA 3NDJA 3JQDA 1YVEI 1SOWA 3B1KA 1HZJA 4GLOA 1LLUA 3G17A 2PZJA 1WZEA 2OHXA 4BMNA 2GN9A 1A7KA 4DUPA 4EW6A 5H82A 2QZZA 1UUFA 3WQSB 1NVTA 4E2WA 1LSOA 1RJWA 1HT0A 3TFQA 1DC4A 3W4KA 1QORA 4FJ0A 4P4LA 4BO6A 5CPBA 1E0DA 4U0JA 4BB5A 3QRWA 4LRTB 1LTHR 4E12A 2EJVA 3DBLB 1S7CA 3OICA 3F6YA 4E31A 4CUJA 3RQSA 3FNGA 4GMGA 1HYEA 4GX5A 2PA3A 4NJMB 4YJFA 1HYGA 3CMMA 1MB4A 1YBVA 4Y9DA 3RI3A 5JMWA 3IOYA 5IN5A 4BGEA 3TNLA 3UGKA 2E82A 3H5RA 5K0ZA 1MLDA 2EKQA 3HWRA 1PIWA 4E5PA 1X0VA 4BNFA 2JFHA 4CV3A 4R54A 1Y9AA 1UH5A 3OEYA 2EKLA 1P74A 2DTDA 3BTUA 4O6VA 3I1JA 3M6IA 1PWZA 5JCXA 3KTDA 3VPHA 4B4WA 3RIHA 4DLBA 1Z7BA 1HRDA 4MP3A 4J7CA 2X0RA 1TA4A 1ULUA 1E1KA 1SEVA 1UDBA 5CDUA 4R5MA 3PGXA 1X15A 2ZJ1A 3DMTA 1PJLA 3NTOA 4P22A 2O50A 4XYGA 3OECA 5CP8A 3EAGA 1DEHA 4DREA 4H16A 3WGGA 1WAMA 3PXXA 4E2XA 1MC4A 3JCZA 4ALKA 5BR7A 3P5SA 1GUFA 5LC1A 2RH8A 2GLXA 3CPSA 2QZ9A 3DBHA 4FC7A 4KQWA 4RPJA 4BO3A 3NGLA 2DVMA 3PYLA 4LRSB 4DA9A 3GC6A 3H3JA 2CUKA 4CLRB 3IKTA 2NNLD 2EW2A 5H83A 2AW5A 1EBFA 4HXYA 4BS9A 3O03A 1SBYA 4NIMA 2VCYA 1D8AA 4YB8A 3GY0A 3T7CA 3PZRA 3AY6A 4D42A 4OHUA 2GDZA 4CMIA 4MVJM 3UXYA 4U0KA 5T67A 3LT2A 2X9NA 4YT5A 3H5AA 3OQ1A 3RUEA 3UCXA 3PWSA 4GAEA 4A0SA 3GRPA 3K73O 4IGFA 3LSYA 1YB5A 3ZWMA 1UXHA 1E7RA 3NT2A 4YQZA 3W1VA 1N8KA 1VL0A 1IPFA 1WVGA 2X0NA 2Y1EA 4TZKA 4M54A 3S55A 2VHVA 3ZDFA 2F1KA 4J1QA 1VKNA 1GTMA 1QP8A 5LDGA 5EMHA 3DMTC 3KYCA 1YE3A 4OSPA 2FZWA 3E9QA 4GSLA 4FPXA 3Q1LA 1A4UA 5DN9A 3K31A 4E21A 3EMKA 3N58A 3RUIA 1P1IA 4MO2A 3DQPA 3GEDA 1VSVA 3ON5A 2OO5A 2Q1TA 2PD4A 3AUUA 5JC1A 4Q3CA 1HE2A 3ADOA 2UAGA 3R1IA 5JAZA 4BKQA 5IZCC 2HSDA 4NMHA 1GQQA 3GDGA 4Q39A 1P3DA 2H1SA 3E5RA 1YONA 1FDSA 3DOOA 2X0IA 4S3MA 4HNHA 1NM5A 3CSDA 4J43A 3LZ6A 1WP4A 4LISA 4NBTA 5KNLA 4XDZA 1J5PA 1GPDG 2FSSA 2P9GA 2AE2A 4E5NA 4NFSA 1SCUA 3E18A 3A14A 5EERA 5EJ2A 3ZHZA 1G1AA 4K6CA 5ER9A 2HMVA 1PL6A 2IZZA 4WEQA 3KYDA 4PGFA 4IBOA 2GYYA 3E8XA 1H0KA 3BYZA 3ZHBA 2ZB4A 1ZCJA 4NBWA 3SXPA 1F06A 3GEMA 3PFWO 2XXBA 3D4NA 4NHEA 4B8WA 1V35A 1PX0A 5JNLA 1IUKA 1H6CA 3WLFA 2JFFA 1W0CA 3D4OA 3PQDA 3ZWAA 1AXGA 1XLTA 3H6KA 4PVDA 4IIUA 4YT2A 5C3MA 5AQ1A 2ZCVA 2IYOA 3FN4A 1LC0A 4YR9A 4DPLA 3WTBA 4PLTA 4ND3A 3RSHA 4XEHA 4DIOA 3K2EA 1SPXA 1WXDA 3VH1A 4XR9A 2GN8A 1UAGA 1BGVA 3GA0A 4ZQBA 3KRTA 1T1RA 4JROA 5CDTA 1V6AA 2FZEA 4NJMA 5IZCA 4JIGA 4FB5A 1JWAB 1ORRA 4CM3A 2A35A 3D5QA 2YYYA 3R3SA 4MVJI 2VN8A 3HE3A 1ZKMA 2TMGA 2VWHA 4O59O 1DIGA 1UZNA 4PLYA 4CM7A 1T2DA 1HYHA 1GEGA 4HKTA 1KC1A 1MGOA 3NV9A 3NRCA 2V7PA 2HU2A 1LDBA 1Y9EA 1LDEA 5JYDA 1IE3A 3LT1A 4CMJA 2HCTA 1ZZEA 3HB4X 1CF2O 5F5LA 5TT0A 4A73A 3QVXA 1YWGO 3PHHA 3I6QA 2AHRA 4L74A 1HXHA 1LSJA 4FSHA 4L9RA 4PN3A 4A5OA 2HRZA 2I66A 2Y0DA 4XJSA 3PPIA 5IXSA 1Q0HA 2QX7A 2UUOA 4YVFA 2XAAA 4J9UE 4E2ZA 4OKNA 2Y1FA 3D7LA 4UEJA 3BMNA 4LSMA 1GUYA 4XYBA 2X1HA 1PWXA 3OFSA 5TRTA 2J3KA 1QYWA 3PTZA 3RBVA 2AEJA 4CMBA 3CKYA 3FWNA 2J5QA 3GDOA 3AI3A 1W4ZA 1MG0A 2NTNA 3ROKA 3U62A 1E3WB 4D46A 1OBFO 2PWZA 1IZ9A 4DGSA 3JSAA 1YRLA 3OMLA 4WNIA 4CMKA 1K6XA 3A28A 3ZWNA 1W6UA 1UXGA 5G4KA 5ER6A 4C7JA 3INRA 5B4UA 2I65A 3KVOA 3A1NA 5DZSA 1VL8A 5A9TA 3LDHA 1JQBA 3BMQA 2NVBA 3AM5A 1D1SA 4TKMA 4MIEA 3V1TC 3G49A 4JCOA 3SBOA 4UVDA 1O0SA 2NVUB 1I5RA 3FF4A 4JBGA 4WGGA 1DRVA 1BW9A 3AK4A 3P7MA 3HZZA 3CTMA 5G0TA 3TOXA 4MVJA 3WGOA 1VKOA 1E3SA 2JAHA 2DFVA 3HN2A 1T2CA 2BI7A 4EUEA 4RPGA 2W2LD 3BTSA 1I8TA 3RFXA 2BGLA 3WGZA 4G65A 1YQGA 5IDXA 1QV7A 4PG6A 6LDHA 1VM6A 4GVXA 3TPCA 4FN4A 3FWZA 2P5YA 3C1OA 2YDYA 4NU5A 5KJCA 4CM8B 4CLHA 5HRUA 3O8QB 3I9OA 1PR3A 5AXAA 4D79A 3BHMA 5LDHA 4A7PA 4LVCA 3NJ4A 3UCFA 1HE3A 2C5AA 3WMXA 4CM9A 4N54A 1B15A 4XQ9A 4BVAA 1Q7BA 2D4AA 3MOGA 1I3KA 1LI4A 3W8DA 3JYQA 4AJNA 1ZO8A 4PLHA 1NYTA 4ZRNA 3JYNA 3LC7O 4R1NA 3GUYA 3PK0A 1AE1A 1NWCA 4YJGA 4R3NA 2HDHA 2ZK7A 2G1UA 2W8ZA 1EUDA 1K5HA 3EYWA 1LA2A 2D59A 3FPCA 4GX2A 4CQMA 4FJ1A 3ZV4A 4FJ2A 2NTJA 1BXKA 1U2DA 4B4OA 5JC8A 1JWBB 3Q6IA 4P8RA 4KUHA 4RL6A 4W9NA 1WMBA 2VTEA 4ZRMA 4QEDA 5GZ6A 4BV9A 2FY8A 2YQ4A 1R16A 3RUFA 5MGBA 4CLOB 3PZBA 4QTZA 1DJQA 4TKLA 5A5FA 1HSZA 4M49A 4IDEA 3BAZA 3JQEA 2Y68A 1PJTA 1LNQA 2D3TA 4KMSA 3QV1A 4J0FA 3VPSA 1GV0A 3GG2A 4CUZA 2A9FA 1AGNA 1AXEA 3MJVA 1P44A 2GZ1A 4I5FA 1U8FO 5J23A 3OIGA 1Z73A 3HN7A 1TB4A 1E6WA 2OP1A 4RPLA 1MP0A 5L40A 3K96A 3V1UA 3CZRA 3DMYA 1DB3A 2Y1CA 4OYRA 2BF7A 5KVQA 3NT5A 4HADA 4OMUA 5T6BA 2PZKA 3F1KA 2PK3A 4XYEA 4FFMA 5A03A 4WPGA 4BGIA 3O4RA 2LDBA 4RORA 5G0VA 1XYGA 2W4QA 1C0KA 1Q2XA 4WLEA 5TJ9A 2OORA 1DC3A 2W2LA 4ZD6A 3TQHA 1C0PA 2A4KA 4IZIA 4RF3A 2FRDA 3PJGA 1PZHA 2GSDA 2OZPA 2WD7B 3TZCA 1DDOA 3PLNA 3E48A 4TQGA 4GWKA 3HADA 3PLRA 3RASA 2YV1A 3ICCA 1FF9A 1LDMA 2QHXA 3WJAA 2BGMA 4OSOA 3ST7A 3U09A 2VWQA 4IM7A 5T8KC 2WE8A 1PGQA 3IDSA 1YH3A 5IN4A 1KERA 2JCYA 2NSDA 5DDIP 4ZQEA 1HE4A 2GF2A 2FPIA 5ES3A 2CY0A 5JO0A 3VH3A 1M6HA 4N5NA 4Z0PA 2VQ3A 4IUYA 2GZ2A 2QRKA 2C2YA 2CNBA 3TZQA 3OJFA 3MJEA 2OBYA 3JQ8B 2IDZA 4OXNA 4LMRA 2F00A 1E77A 1R6DA 1PGPA 4UUPA 2PD6A 3IL2A 2WEKA 4ZQFA 2O4CA 2X86A 4XQCA 2B5WA 3GOHA 5JS6A 3QWFA 4XWYA 4WOKA 4IQ8A 5F1KA 2EGGA 2VUSA 2Y0CA 1S6YA 1AN9A 1SAYA 4JP2A 4WCDA 3SLKA 1BTOA 4NBRA 3HG7A 4PIVA 2FPGA 3FD8A 1PGJA 4RPKA 5TX7A 3RUDA 2HMSA 4DC0A 3JQAA 4QO7A 4YA6A 2VNSA 1U3WA 3SJUA 1NTOA 2J8ZA 3D1LA 1Q7GA 1U8XX 3PWKA 3NDIA 4J2HA 3GR6A 4ZN6A 1ENOA 1T4BA 1P1KA 5HS4A 4R1UA 3RFTA 2W2KA 3GZNA 3BXXA 3FR7A 4ALLA 4DVJA 1UXIA 3DB2A 4RVHA 4W7IA 4BKOA 1U7TA 1KEPA 4JN6B 2OUIA 2PGJA 1FK8A 2XOXA 2JL1A 4CM4A 1ZSYA 2B0JA 3WYEA 4MIOA 3BMQB 3JQCA 3MZ0A 1BVRA 3WWYA 1B0AA 3SJ7A 1NHWA 1KS9A 1ZNQO 2O23A 3DO5A 3UW3A 1M67A 4YJFB 5ITVA 1P0CA 1V3UA 4B3JA 4ZA2A 3FRJA 4EEZA 4JGBA 3W8FA 3WTCA 2C7VA 2VZ0A 1OAAA 3ABIA 1TEHA 3RUAA 4YTEA 4OXKA 1GYRA 2DFDA 3I9MA 2Z5LA 4FW8A 5DF1A 1J0XO 3FNHA 1HDZA 3GVCA 3MTJA 3RCBA 1E7YA 4CUKA 1ID1A 1UP6A 2PNFA 4K9DA 4TRJA 4ZJUA 1Q0QA 1N9GB 5TT1A 4IZHA 4RLSA 2EV9A 3NEPX 4XGNA 1ONNA 4CL8A 2TMDA 4YAJA 3M2TA 3VDRA 4PLCA 2GASA 3ZHYA 1WMAA 4XZ3A 1RPNA 3I52A 3U9LA 1M75A 1R4MB 3VH2A 1X1TA 2PKQP 4B4VA 4DPKA 4QUKA 1EK5A 1UXKA 1ZUD1 2Q99A 4NFHA 2CMDA 1A71A 3INGA 5A4DA 1A4IA 4Q3BA 4RVSA 1ISFA 3TN7A 3GFBA 1IY8A 3BTVA 4RDHA 1ZH8A 1NQTA 3JTMA 4CV0A 1ZVMA 2XF8A 4OIMA 4ALIA 2WSBA 3IP3A 4CM5A 1PJCA 3HDQA 4LW8A 5KKCA 4CR8A 4WJZA 2PGLA 4INAA 1CDOA 4R3WA 2Q3EA 3RBXA 4HFRA 2AA3A 2YW9A 6ADHA 1UDCA 4QQRA 4YRAA 4CQLB 5AOVA 4PLWA 1TT5B 3TL2A 1XEAA 3X2EA 4XYLA 2QRLA 4XIJA 1E6UA 4PFJA 3GN1A 3ZH2A 5CDGA 4DPMA 2FWMX 4W9NC 2R2GA 1IULA 1YOVA 2ZKLA 4YDRA 1YQDA 1QYVA 1P0FA 1Z82A 3HB5X 2CVQA 2NU8A 1XELA 4YQYA 4DXHA 4E2YA 3FBTA 2GR9A 2HJSA 2J5RA 3HFSA 4UULA 2OGUA 2JHFA 1G0OA 4JJFA 1BXGA 5I7SA 3V2GA 1GR0A 3NDRA 5TNXA 4CODB 4OOEA 4PLPA 4CMAA 1GCOA 3GPIA 3FNFA 5JW6A 4ILKA 2G5CA 3ZI0A 1P45A 4FC6A 5KJFA 2O2SA 3U4IA 2E4AA 4QFDA 4W99A 2D0IA 5T64A 4BQPA 2D2IA 1P33A 1T2FA 4L4XA 4ND2A 3MCVA 4JP3A 3LQFA 1JA9A 3TOZA 5AYVA 2Y0EA 4JX8A 2Q2VA 3BMOA 4CMEC 5CG1A 1UR5A 4AJPA 3BMCB 1YB4A 1ZK4A 5A1TA 2GCGA 3QY9A 2GZ3A 1PJBA 4DL9A 2VRCD 4RF4A 2O2YA 1GQYA 4HWKA 1LLCA 1KEUA 4DTIA 5A9SA 2ZQZA 5L45A 4EEXA 1V0JA 1CRWG 3F5SA 4HY3A 4YCAA 5KJEA 4EUFA 1E3IA 4R69A 4CLOA 2I9PA 1IZ0A 2D1YA 4KQXA 1W8DA 4CM6A 5T57A 3Q3CA 3QWHA 2WE7A 1U4SA 3KSUA 3LF1A 1NQAO 2NU7A 3UHAA 1CJCA 2BKAA 2JCVA 4J0EA 4Z9FA 2PLAA 4BO0A 5I7FA 4FD3A 5GZ3A 3GHYA 2J5KA 4WEOA 1WWKA 5L4LA 3ZU3A 1E92A 5T8KA 1U5CA 1O89A 1RM3A 5I7EA 3DHNA 4PG5A 4TVBA 4ALNA 2GD1O 1T26A 2VWGA 3JQ7B 5B4VA 3K6JA 2JAPA 4BL5A 1NP3A 1R4MA 4RV9A 3P2OA 2OL4A 2WYWA 5BSHA 1Z75A 3QVWA 3EC7A 3PFFA 1I01A 1GZ6A 2HLPA 1RKXA 3H65A 3AY7A 4EITA 3IJRA 3IUPA 1LRLA 4DQVA 3OP4A 4CMEA 5I9NA 2AMFA 1K6IA 1SC6A 3L6EA 3PGJA 1DBVO 1LEHA 1DIHA 4BNXA 5IDWA 4K6FA 5JXWA 4L75A 2B36A 2JD2A 1WPQA 3PI7A 4N5MA 2CDBA 1DXYA 4B7CA 3R6DA 1LU9A 3I6IA 3ULKA 4WLOA 4GH5A 1PQWA 1RM5A 2C2XA 1N1EA 2YHIB 4ITUA 4G5HA 3OJEA 2LDXA 2DBVO 4PG8A 1F17A 1KEWA 4HFNA 3B6ZA 1TXGA 4PCVA 4CLEA 3VVCA 5KOIA 3OQBA 5C37A 3ZW8A 3PJFA 2VHWA 1PGNA 3WS7A 4I08A 1N1GA 4RVGA 4O5OA 2FMUA 3DOCA 3LC1O 3V2UA 5I7VA 3FI9A 3GH3A 4J1NA 1I10A 5FI5A 2QRJA 2RIRA 3C8MA 5IZ4A 2PR2A 4FOOA 5IF3A 3QWBA 3WR5A 2X8LA 4IINA 3ZU5A 5TC4A 5ICSA 4QSMA 3IAHA 2QG4A 3AY3A 1KOLA 3RC2A 1GU7A 1CETA 1H6BA 1PL7A 4L73A 3D3EA 3ANNA 5ENVA 4MVJD 1LJ8A 1MC5A 1ZJYA 1LC3A 4TRRA 1BVUA 2CVZA 3PYXA 1X7HA 1Y8RA 3I23A 3ONDA 1HL3A 4Q3NA 4MKZA 3TZ6A 1FDUA 4KTVE 4BGUA 3IKVA 4Z0TA 5I8ZA 1T24A 4OQZA 5AXDA 3G1TA 4E33A 5GZ1A 4KDFA 3ASVA 5JYEA 1B16A 3G3EA 4PLVA 1MFPA 3WJ7A 1B8VA 1JKIA 1PS8A 3GF4A 5C7LO 2IRWA 5DOZA 5AXCA 5JO9A 4I9NA 1YJQA 3NTRA 4Y6RA 3GRKA 3F1LA 1LSUA 4XQEA 4WECA 5FF9A 3DBVO 1MFZA 2G0TA 2EG9A 2I67A 4O1MA 5TSDA 4ALJA 1E1MA 1PJ4A 3MOIA 3WYCA 1HZZA 1UP4A 3WLEA 4BNTA 3OIFA 4I9HA 1R15A 3WMWA 4TRMA 2CF5A 3R3JA 2VRBA 2ZYAA 2XXJA 5HS6A 1I32A 2CFCA 4DYVA 2B4RO 1NPYA 3LK7A 1Q0LA 3WWZA 4AJKA 1NBOA 3ENKA 1C1DB 4IS2A 1ZEJA 4OGWA 4TZTA 1GADO 1HEUA 5CPFA 3JQ6A 5THQA 1IPEA 4N5LA 4BNUA 4C4OA 3EHEA 3G0OA 4MKXA 3ZNPA 4L4RA 1XQ6A 3JYOA 3E9MA 2YDXA 3QHAA 3BA1A 3WBBA 3EK2A 5KIAA 3FSRA 1EQUA 3JQ8A 3WGYA 2VOJA 1ZK2A 2EHDA 3KOUA 1ADBA 4FFPA 4IIVA 5COAA 4CLXA 2O3JA 3VKUA 3H7AA 3FHLA 4D3SA 4WK6A 2I99A 2V6GA 5KVSA 4OL9A 2FPPA 2W98A 5TJHA 3GEGA 3DR3A 2VTDA 2DTEA 3ETGA 5I9LA 2X4GA 1QYCA 1DAOA 3DAPA 1Z45A 4R16A 2EXXA 1XSEA 1F0YA 4D43A 2Y1GA 3TZHA 3U4HA 3WB9A 5I8WA 2GPTA 4DQUA 2EERA 3DWFA 2ET6A 3F4LA 4EZBA 1R4NB 4BNVA 4QECA 1N7GA 1B2LA 2VNAA 1YJ8A 5KCZA 1DFGA 3IP1A 1KY4A 2PZLA 9LDTA 1PZFA 1HKUA 2BLLA 3F47A 4IJVA 4Z9YA 3W4JA 3DZIA 3H9GA 4U8GA 1K89A 5A9RA 1EFLA 4RO0A 5THKA 2NQTA 4BIIA 1UDAA 1FMCA 2PY6A 3KUXA 4K1LA 4CQMD 1XG5A 2AQHA 1B26A 1LQTA 2B37A 5JAMA 2DAPA 1D3AA 1B3RA 1F12A 1GUZA 2P91A 2WWRA 1I2ZA 1I30A 1Z6ZA 3QVOA 2PKQO 1BG6A 1ISHA 3RC7A 1LDGA 3B1JA 4Z9XA 5EPOA 2IEDA 5A9SB 1DFHA 1E7SA 2OFPA 1YB1A 1I3LA 2GN4A 3UVEA 1KYQA 3E6AA 1NVMB 4CLDA 1OFGA 2H5LA 5HTOA 1YL7A 1ZK1A 5FFFA 3JD4A 5AXBA 2Y99A 4KWIA 3NJ8A 1PS0A 3JQ7A 4RLHA 4E6PA 5IDQA 1WDKA 2C20A 2PV7A 3I9KA 1EE2A 2W90A 3NT4A 1A5ZA 1DAPA 1FDVA 4YYZA 1JW9B 1X7DA 3WNQA 3O8QA 1PU2A 4CM8A 4G81A 2HK7A 2NTVA 3H9EO 5B37A 5JE8A 4E30A 4BNHA 4CV2A 2YHIA 3NGXA 5F5NA 5DBIA 1I2CA 4F3YA 1L7DA 2O3TA 4CJXA 4DWVA 4Z0HO 3LC2O 1HSOA 1AHHA 4BO9A 3RJ9A 3DAFA 3IC5A 4FFLA 3QA9A 3K5PA 1PTJA 4PLZA 4U5QA 3JQAD 1DPGA 3IUSA 3VVBA 3N74A 5KVCA 5U9CA 4WASA 1UZMA 4BV8A 4CMIB 3BMOB 9LDBA 2DTXA 4IGEA 1ONOA 4MVJH 1J6UA 4BNGA 2SCUA 4XA8A 2D5AA 1Y6JA 3FBGA 2G76A 1WZIA 5JBIA 3DONA 4RF2A 3ZU2A 1U3UA 1ISMA 2NU6A 3FPLA 1Y81A 5CG2A 8LDHA 2X0JA 4JBHA 2DBRA 3L9XA 2QQ5A 3HDJA 2BFOA 3ZHXA 2EKPA 3AI2A 5F3RA 2PFGA 5L3ZA 4U7WA 4PLFA 2H6EA 4BGVA 1NXQA 3DHYA 3DHEA 3V8BA 3PRJA 4L0QA 3GAZA 3C7DB 3B70A 5JLAA 1NWHA 1GAEO 5IDYA 1EE9A 2IZ0A 4DRYA 5TLSA 2ZTLA 1Z7EA 3KV3O 5DBFA 1CIVA 3WIDA 1E7MA 2UYYA 4WLNA 4EJ0A 1UZLA 3HDHA 1C3VA 2FR0A 4YJHA 4Z6KA 4FS3A 2AQKA 4GVLA 3UKOA 2VUUA 5DOVA 1H9AA 2WTBA 4BO2A 1K0UA 4HFJA 4NJOA 1U7HA 4GKBA 1Q1NA 3KO8A 4ID9A 3L6DA 4CLRA 1WLYA 4F45A 3RJ5A 1Y1PA 4BHTA 2QYTA 5JFOA 5JAIA 2O3UA 3IMFA 4KWHA 2PH3A 3ONFA 4JJGA 3JD1A 2BI8A
chains in the Genus database with same CATH superfamily
2OB1A 5L9AA 4MGYR 2ZIXA 2O7NA 4DQLA 4ARIA 1ECFA 3ZKAA 5KYGA 1E7WA 1WDMA 1JEYA 2CEAA 3VC7A 4P31A 5DNEA 2VJLA 2BCJQ 1D6MA 1QZUA 4UNNA 2RHJA 5HUQA 3ET5A 4GFDA 3PXBA 3D6VA 4OEHA 4UDYX 2DOKA 2ZIFA 3WGKA 2G5GX 4QU0A 5IUKC 2Q1UA 3LCJA 1DIAA 2IXAA 2G82A 4QIHA 3LL7A 1AKYA 2C42A 3I4FA 3M4JA 3S3TA 2QN7A 1L5WA 2O7VA 1NX6A 3DZCA 2GN6A 1EINA 3UWSA 1GTRA 3OZRA 1W36D 1W44A 2FMFA 5LP6B 3Q87B 1XZDA 3D9QX 3QYFA 4QFMA 3TLAA 2IJGX 5KC8A 4DV7B 1QGAA 4LJKA 5AM2A 4IQFA 5BNZA 2GAJA 3HY3A 4NJEB 5JD3A 2ADMA 3QE3A 3EJ6A 4BNNA 1RZRA 3GMDA 3UK7A 2M1ZA 1P17A 2AMLA 1G20B 2X2OA 2IA5A 3WK6A 4DIFA 3IEVA 3OJWA 3BL6A 4GSKA 3EPKA 3LOUA 1M0EA 1BWSA 4N8EA 3PNVA 3VVMA 2GHQA 4EPRA 4AYXA 3L1IA 3O3CA 4G0XA 1ENPA 1TTTA 5KVAA 2NO9A 3GV0A 5ALLA 3RRFA 3WWPA 2P2SA 2P69A 1VIYA 4XRRA 1YA4A 3PXAA 3I9V1 4OGLA 4EO4A 5FWNA 2C2BA 4XGIA 3NVKI 1Q22A 1TQ4A 3F5MA 1GA1A 1EUCA 3SC3A 2QMOA 5L4NA 1W36B 4QBFA 1FDTA 1FSGA 5ILGA 3AL0C 1BS1A 1E9SA 4RZQA 1IXZA 3C1AA 3LCVB 4TV8A 2G08A 4ES6A 4NNJA 1OCEA 2H8KA 3GLVA 2JGKA 4R1SA 1LTQA 3FFXA 3EMDA 4MPTA 1IUPA 3CPJB 3MA0A 4RZSA 4BMSA 4DG8A 4N76A 2ZYHA 4IJWA 2WJIA 3CINA 4JS0A 4L76A 4URUR 1GZUA 3AMVA 3MTEA 4BV3A 1GGFA 3TMAA 4MSUA 1QIKA 1FVOA 1U6IA 5F7JA 4JV5B 2D54A 4Z49A 5KPDA 3UYLA 4HEHA 1E2QA 5BW4A 2RKOA 2BYTA 1NNLA 1P91A 5AT1A 1C1XB 5H4HA 1OH5A 1G6OA 4L95C 1DBIA 2NP7A 1UC4B 2C61A 4F4CA 1NR7A 1D7AA 2GUGA 5ALTA 4I2VA 1D1QA 3L46A 4BRUA 3NTQA 4B6JA 2Q7OE 1NJFA 2YVUA 1U2QA 2C0CA 2O2IA 2Y93A 2ZATA 1KP2A 4OHKA 3ITKA 1ZG3A 4EGSA 4BO4A 3WGHA 2A0FA 4GYJA 5AK3A 1FUYB 1IEXA 1VE5A 1X7YB 1CU1A 3HUFA 3N7UA 4LXIA 5J2UB 4CF4A 5BN1A 5JSQA 2WF9A 4WCFC 2X42A 3EISA 4AB1A 4GPBA 2UZIR 4RD3A 4PC2A 1H9CA 3IR5A 5CX1B 6GPBA 3ASUA 4PZPA 2J7PD 1M34B 2C2GA 1EESA 3CJRA 1CJTC 1GAQA 1K6JA 1OA1A 3CZAA 4O4HB 3WBJA 4G25A 4UVHA 5FI1B 1H2WA 4N12A 4LGMA 1PJ3A 1N8SA 3BICA 3RH0A 4LJ9A 5KYTA 3PB3A 5FP0A 4D4JA 2EW1A 2GJ9A 3E2PA 1L9KA 4RU1A 4YACA 2PLFA 1LB1B 3DZKA 3N3AC 4UARA 5LNK1 5CDYA 3B3FA 1BDMA 1UJ6A 2BFAA 3DZJA 4TGLA 2IEIA 2PZ8A 3DFMA 4TKZA 3RVDA 1RLMA 4PYMA 1EK0A 4KI7A 3TRFA 3F49S 3BFJA 1JIUA 1HYQA 5JZBA 1M2WA 4RHXA 2G5PA 1D0IA 4IDDA 4RD0A 3VYUB 3TUZC 3KTAA 5DCUA 4B3IA 3EQ2A 4KR9A 3EUEA 2OVBA 4R2IA 2JGDB 2JPDA 4GPZA 5EYPB 4FE7A 4OLBA 1P1FA 2P2ZA 4R2XA 1V5WA 5EP2A 5FA5A 3STVA 3AW9A 3PA8A 1O95A 5EE3A 3HJRA 4TT3D 3G0CA 4UU7A 5IAAA 3UWDA 3HC7A 1ZNXA 4DHWA 1VCOA 3KVYA 4MYSA 4C22A 4J07A 3WO0A 4JJAA 1SU4A 1FCJA 3FY4A 5GV7A 1N0HA 4D9MA 3T5BA 2VI5A 1N6KA 1DKNA 3KXKA 4QX6A 4Y98A 5DBHX 1I1QB 2V3CC 3AOGA 4GX0A 1LF5A 5ARDA 2ZIXB 1GPKA 1VQ1A 4XPIA 5ULLA 1KGSA 4KTTE 2PUJA 3CEHA 4YJ3A 1PK7A 4JH0A 2EP5A 4ZAFA 4XVRA 1Y5MA 3U6KA 5GJVC 2J3HA 2G3YA 3ZLVA 1OHHA 3ZU4A 1OMOA 2MR6A 4EF5A 1U98A 4XGKA 4B3CA 4EHHA 3SICE 5H59A 2A9PA 2Y67A 3PSAA 1HR0B 1EPUA 3BZUA 2MSWA 2QAGC 4HB2A 3ENVA 2O3QA 2QXYA 4P4NA 4PSCA 4WNCA 5EE9A 1YQXA 4BNJA 4C4TA 5A5EA 4WESB 4JC5A 1DKUA 1T29A 5EL0A 1TM4E 3AFGA 3IKLA 2SHKA 4KVGA 2QN1A 4G2TA 1D4AA 1UBKS 3U7JA 4IDCA 1Z7WA 3D6JA 5F1OA 2PSFA 2JI9A 1R6VA 1XDSA 3EODA 4HNVA 2P6NA 2RGDA 3CJQA 1EX6A 3EZGA 1GPAA 1CE8B 1KU0A 1SQ0A 2OCLA 5ELLA 4P7JA 3DCYA 1NONA 1YCDA 5DK4A 5SV2A 4B46A 2DT5A 3L6RA 3NVAA 4NCJA 5FL7D 4PFSA 5B58T 4H7JA 4JQOA 3O3NB 1N0VC 2C98A 4XCQA 5C8VA 5AVUA 1VG9B 2FSHA 3CB2A 3EB9A 3HFRA 3P0JA 3FZEA 3IYLW 4V0QA 1CW2B 4MQFA 3Q98A 2WG2A 1Z0FA 5J5AA 1KMCA 3AB8A 4OU4A 3UGJA 4KN9S 4RK1A 1RM4A 1RBMA 3GJZA 1FNDA 3L7OA 3O8NA 5ALSA 3RYHA 5JLJA 3K0FA 4N49A 4YJKA 5FOXA 4PF1A 5CYOA 3U3OA 3WE7A 4ZOQI 5BMVF 5CCEA 2AN1A 2DU8A 3I42A 3PTAA 1R50A 3RVLA 3VPDA 3LYUA 1KDYA 5FTNA 3ZN2A 4E5VA 4XYMA 3C97A 3U4QA 1M1YB 4ZQGA 3T3MB 1RHJA 3AVUA 5BYBA 4TS1A 4BC1A 3Q3VA 2H8GA 4JYZA 1FVFA 1ATIA 1ZSNA 4GPTA 2OBMA 3EXAA 4K2AA 1J8MF 2FPSA 4JMLA 1I1HA 1U1EA 2G06A 5TGDA 2ZYWX 3VMFA 4EDHA 4FNAA 5JCJD 5JNWA 4N4AA 5JRZA 1NVGA 1OGYA 5KPJA 1GYPA 5SYAA 2QX9A 3EUAA 1MVNA 3HM9A 1A69A 1X77A 5AJYA 4BEWA 1GG2A 5DV9A 2I6TA 4ND4A 1XRNA 2J30A 2IHTA 2O2HA 3ND8A 4NCBA 4KL8S 1JG7A 4FHGA 4LKRA 3EGIA 5TPZA 3RF6A 1EVJA 2CXQA 4FYWA 3B6KA 4ICIA 2OGWA 1FX1A 3PJDA 4R3UC 4RTKA 3QOWA 4KR7A 4K0RA 2RK4A 4WUTA 4ZCTA 1NE7A 2OV2A 4Q9JA 4A3SA 2VAXA 1VMEA 4W8OA 2NUAB 3G23A 1DHTA 1PI3A 5EIBC 1DX4A 4CL3A 2LE0A 3Q7PA 1PAUA 1KFCB 2IS6A 3C3XA 5CEEA 4LXUA 4AZ0A 2PS1A 4JJIA 2UYGA 1WQ4A 2M98A 4M89A 4J7UA 1P77A 3WLAA 3BM5A 3WIVA 1OC2A 2VNKA 2ONZA 2P68A 4JUCA 4DV2B 1OU4A 2PLWA 2GO1A 2J5XA 4OHXA 4LI3X 4PX9A 1CJUC 3JSXA 1NFRA 4DCCA 2X5KO 4KSYA 2VAMA 2ZYSA 3V7FA 3ONEA 5DLEA 5KTMA 4X20B 3MJ4A 2QBYB 1FU8A 3ZS8A 4YJ2F 5FIUA 3TLEA 4BVFA 4OXIA 4YCDA 3FYHA 2XR1A 3U3XA 5CK5A 4WOCA 4V1CI 2I4LA 1SC4A 4QXQA 3F8TA 3B1VA 1EMDA 2DPMA 1L4HA 2DLNA 5AUPB 2NYUA 4LY0A 2A14A 2NUTB 1KY2A 4QOIA 2DUNA 4GRAA 2VPPA 1TUBB 3DBOB 4MP8A 1GCUA 4H1UA 4XCXA 1B41A 4OU5A 2HMWA 3SMVA 4QKQA 4KFRA 3B3JA 3V55A 1KO5A 4H3VA 4TLDA 2R6GA 2Q5EA 4QUAA 4QQFA 4RF5A 1UIRA 4QRHA 3JARA 3I4CA 4DLUA 3LQRA 5IU6A 4ENWA 1TVCA 5BV7A 4AC9A 3MB8A 2X5OA 3OTQA 4MWZA 3P9XA 4WLFA 1IDOA 1G6Q1 3EIOA 2BM1A 4P0QB 1XZCA 5G1OA 2B8NA 1C1DA 3BJMA 4MVXA 4TUYB 4BX2A 1GDHA 5L3VA 4Y18A 1T1GA 2VXOA 2AXPA 3O1JC 4JLDA 4EPWA 4WXYB 4BFXA 1D7OA 2NADA 2K7FA 2GI4A 5EIWA 5AW9A 1SELA 1XD2B 2WJWA 5AUQA 3ZHVA 4GOLD 3OIVA 5CEFA 2BR4A 1OWNA 3W05A 4E0BA 4RZHA 3G79A 1GZDA 3WFJA 3Q8KA 1PJAA 4BO7A 3UH1A 3DV2A 1EFTA 1NFFA 3FNBA 2YHUA 2EJTA 1QP7A 1F2DA 3U13A 2Q2QA 3PPWA 1T6YA 3DBRA 1RXVA 3MF4A 3ZHCA 1H66A 4E5KA 2RC5A 1USIA 1L2TA 2VT2A 3PEFA 3BTOA 3NYRA 1XEFA 4IIHA 1N5MA 3T35A 2BFDA 2QTZA 3H3FA 1ZWLA 2WAXA 3TL3A 2ZSFA 4GLFA 1XDUA 2F9LA 2WPNA 3G9ZA 2F2TA 3WK7A 4DSOA 1SHJA 5IM5A 3SZUA 2OHVA 1VPDA 1I3CA 1W35A 3QW4B 2XUQA 1YVPA 1E7QA 5HZGA 1E0JA 3COZA 3MJCA 3N7TA 2JVJA 1A72A 1G18A 1ZUIA 3NOVA 4WE3A 3PI6A 1P7WA 1Y48E 1IVNA 3QVVA 3H9CA 1H4TA 2XMSA 3FI0A 3PC3A 4YROA 3S29A 4DM4A 1JA0A 2D5IA 2O0HA 4BZXA 4CM9D 1L7QA 5CVCA 4ZVKA 2VPWA 1VJ0A 3SNKA 4A8JB 1SCIA 3ZEAA 2VBIA 5C35A 1IHUA 3QF7A 2C57A 4KVAA 1QB7A 2MSLA 2O48X 3A1UA 1YZ3A 3A9RA 4OM7A 5F1YA 5DO9A 1NG1A 3VNBA 4BMCA 1N2IA 1LW7A 2IXGA 3CURA 1LPMA 3DFUA 3HB0A 4LJYA 2O07A 4TKVA 3LYAA 3X1DA 1SK9A 1YMUA 4U2KA 1KK2A 4LF4B 4IY1A 4PYJA 1EHYA 1WCYA 5FI3A 4ZKDA 4BN5A 2X13A 2ZAGA 3OY2A 1XF1A 3OFVA 1YZHA 3FUVA 1MR3F 2I3DA 3PVCA 2P1ZA 4KQEA 1XVIA 1R3UA 4ZI7F 5K2OA 1V96A 3M6XA 5CIQA 1NC1A 2QVYX 2VCEA 4G4IA 5EHNA 1PR1A 3LPLA 1P2BA 4JT4A 3G6KA 3RRBA 4HNGA 1E6EA 1T4DA 1VBKA 1VHWA 2VLIA 5L4SA 4XX0A 2G07A 3EG5A 3K8YA 4FGSA 2BCEA 1F9EA 2HHJA 3L04A 2MYTA 5DHRA 1W8IA 4C2AA 1Z22A 4TROA 2A1TR 4HQLA 5JAUA 5LPNA 3AG5A 9MHTA 3SJZA 3E9DA 1C7IA 4PG7A 4WL0A 4QDZA 2DF8A 6PFKA 5FBVB 3L7MA 4OB7A 1S3IA 5IC5A 5TQ2B 5DULA 1ML4A 1LV8A 3GEHA 4DMHA 3DE6X 3L0OA 1BJRE 3K4QA 3WWCA 1L4LA 4JL6A 4N7MA 2OPBA 3DXZA 2OYCA 5JDIA 1U0JA 2BLNA 3I1FA 2ZTSA 2V7QA 3A9VA 4OY3A 3RU7A 1HTWA 1YDWA 3I8OA 2AH5A 4PZLA 1NLFA 1DAEA 4URYR 1Q3KA 4Q1EA 1AUPA 1HDRA 5ALNA 4B48A 4Z4FA 4AQDA 2WF6A 2VNIA 3HKCB 2H0RA 1U0GA 4ZYYA 2PX5A 1DARA 1T4CB 1DEOA 4DARA 1FL9A 5IWCA 3B78A 2DFKB 4NCHA 1BE1A 1VHTA 2PR7A 4HUJA 4Q03A 4B5KA 3N2ZB 1PLKA 1N1DA 3OQ6A 1KYVA 4JI3B 4UCWA 3ETJA 1DBSA 4AJEA 3H1GA 1LX6A 5LUBA 4UUMA 3SC4A 2GN2A 4XD7D 3WGQA 3QEMB 3R6GA 1DLJA 4Z2AA 1Y4UA 3AI7A 3JQFA 1OILA 3D6AA 4A5SA 2DMRA 3AFNA 4UEWA 3O9MA 1QIGA 3NAQA 1U1CA 1CUDA 1ST3A 1D2AA 1HE8B 2FYTA 3AV0B 2QTMA 3BK1A 1PJQA 2HSEA 1L8AA 3HNPA 3KFVA 2GPNA 1QDUA 2W6JD 3QUAA 4JI1B 2BFMA 4DRXA 2NUAA 4MUBA 3BWEA 4E4RA 3OTOB 4DCTA 2BWJA 1NRWA 3SYMA 4I46A 1A4RA 2W4IA 4CTKA 1L7NA 4KNVA 2BVNA 4B6EA 4CKXA 3DFKA 2UV8A 4H7PA 3NS7A 1GWNA 4OI2A 3ZWKA 4G63A 3BGWA 3EAQA 4GM1A 2VDUE 3BX1A 4R8RA 3RFCA 1EM8B 2OMKA 4G67A 3OQNA 4X6YA 2IC5A 2OOSA 2EQBA 4TL9A 3T94A 5TS2A 3D3WA 1OAOC 4UE3S 2WYIA 4G5GA 1RRVA 1NASA 1C4WA 4K88A 3ELUA 2BGNA 3LC0A 5K05A 3BHNA 2VZ9A 1KZ1A 1RJGA 4TTVA 3CE6A 5D6OA 4TWJA 4NOMA 2GWRA 2VYNA 5G0WA 1MORA 1U1DA 4Z4QA 2JK0A 3OURA 1AVTA 1MA0A 1KR5A 1GZ4A 2IL1A 3CEAA 2DKNA 3C43A 1I7SB 3PDHA 1EUZA 1E96A 4B8ZA 2N42A 3IELA 2HRQA 4H0CA 3R74A 2EATA 3BJEA 1PJRA 4F2PA 1TYZA 1VJTA 3KEQA 2X9GA 1W47A 2BEKA 1Z17A 3NUGA 4RESA 3SC6A 3ZE0B 1GVHA 3QWIA 2RGRA 1C30A 3PUIA 5HM8A 4LNUB 4KLAA 4Q9DA 4HLDA 2WF5A 1BQ4A 3I1YA 3REOA 4MQUA 2FR1A 4KO2S 1AA9A 1FBNA 2QG9A 4EFMA 4U02A 5AI0A 3K1JA 4P0PB 1YB7A 1YJCA 2O7SA 5JFGA 2A0UA 4PX3A 2ZSDA 2XVAA 1HWYA 3JWIA 3L6CA 4G4JA 3WXMA 4KGZA 4B0OA 3C4VA 4U1RA 1KI6A 3DLCA 1E2UA 2JFQA 3F78A 3WOHA 4FWBA 3O0DA 2V7QD 4HAWA 4OO3A 3DPSA 5CBKA 2IUSA 1E1NA 1NJ8A 4F3KA 5HW0A 5CDFE 5BPFA 1PZXA 4Y2PA 1JTVA 5AIBA 3JRNA 4Z5XA 1GDTA 1IBMB 4BKPA 4PICA 2VP6A 4QYMA 1TT5A 3GARA 3KSZO 3K70C 1MBZA 3Q72A 3A1WA 4H0FA 3PQFA 3O74A 5CW2A 3KU1A 5F64A 1XDDA 1E2FA 1R10A 1RJDA 2IHUA 3JWJA 3L3BA 3GAAA 4G6ZA 3OF5A 2Q6OA 4JT2A 4Y2YA 3GLTA 4HHEA 1E1LA 5BORA 4EJ6A 4HGPA 1V1MB 1O08A 4Z8XA 3HVUA 5IRCD 1XPOA 3D64A 3MIIA 3N0RA 4JHLA 4JR2A 3CNHA 3EZLA 1HDCA 3HFJA 4OG2A 4RPCA 3GUCA 3W2GA 5TIIA 5BYJA 1EM8A 1QO7A 4W8GA 1JEDA 4OUDA 3PVZA 1OLSB 4NEGA 2YVQA 3REQB 1E6MA 3G5UA 4WZBE 5ITSA 3LJKA 4WKOA 2G9VA 2WIAA 4I55A 1U3TA 2HPZA 4Y2UA 3WQQA 3G0BA 3HVKA 3DL2A 2WJHA 3NM5A 2DERA 1K2VN 5FFMA 4YJ2B 1EDDA 3DTVD 3OIWA 2FEMA 2BGJA 4OHPA 4UCFA 2HSJA 3T3IA 3FHCB 5K0LA 3X43A 3WNDA 1O6FA 1YZLA 1GPMA 4YEDA 1P4JA 5B64A 1J49A 3AOEA 3NHPA 3RSZA 3W6NA 1ZISA 5DWDA 5IARA 4H7FA 1NPTO 2FUNB 1M33A 3HDGA 3L8EA 4PYQA 4UBNA 3OCWA 3OX2A 1DI0A 2OFFA 3DXFA 5MN6A 3NOXA 2V6IA 3G2OA 3HUDA 2EYQA 2ZVDA 3LPNA 4RQAA 2IXTA 1WP9A 2FOIA 2JJ8A 2QYOA 2EL9A 2QSUA 4LYYA 5AFSA 2YXNA 4DLWA 4QOGA 3M6WA 4DDVA 3UGQA 2QUBA 4GI1A 3M82A 2XYVA 3CA8A 5HOQA 1W5AA 3MHPA 4F92B 1LXCA 1M5RA 2JVKA 2GKSA 1GG9A 2FSVA 4F8EA 3ANMA 3RD5A 1ZFNA 4PIMA 2Z04A 4LXYA 4ER7A 4YX9A 3M3HA 2GRUA 1QB8A 1T6BY 1NPDA 1IOLA 3R5KA 4C4ZA 4DCUA 1KJQA 4H4EA 4ZHQA 4DJTA 3U3MA 2FN8A 2VG8A 5BRAA 1S4QA 3M4YA 2DB3A 2H63A 2OBLA 3FCXA 5LIRA 2WMYA 2WPDA 2CNWA 2WWHA 4IDPA 5FLYA 5K8UA 3VHRA 3FOAA 3CH7A 1BDJA 4NG5A 2YUTA 4CKWB 2OD9A 1QK4A 1R66A 4F71A 1E9BA 1NJ5A 2VSNA 1BGXT 1Z5VA 1FTNA 1Z0JA 1ZRSA 2HUNA 4F3RA 5HCUA 1H93A 4MDFA 1DWQA 1KOGA 1XHFA 2H1LA 3A70A 2CYCA 2FFQA 2X9VA 3L7DA 5CVDA 4YRZA 5HG0A 5L3QB 4S35A 3GEPA 3DM5A 1I7PA 4G5OA 3S1SA 3FPHA 1QU3A 3U60B 2VUTA 3L18A 3MWLA 3CJTA 5IG2A 1IY2A 1W34A 4ITVA 2I2BA 2LGJA 2O5RA 5K3SA 3QSGA 1VXOA 3D31A 4OQFA 5FOSA 3HYNA 3V2IA 4WZBB 3E7PA 4FCTA 3USCS 1JF8A 2F9FA 3K8ZA 1JU9A 1PZEA 1G5PA 1P4GA 2ABWA 1Q3TA 2R7KA 3DZFA 3H4VA 3LUGA 3OETA 4J2TA 3WLOA 2FE4A 3ZDCA 3Q7QA 3BDVA 1XA0A 5HE9A 2O8NA 3OJLA 4S1NA 1S8OA 1T35A 3M81A 4S1VA 5CHEA 1EFRA 1RLOA 3D0RA 1VLHA 2OD2A 3UTDA 2E6UX 2YFKA 4KYTA 3WLMA 4E3WA 4PZDA 1P4AA 1K98A 4W5NA 2FQQA 5DI9A 3U19A 4FM9A 2RE8A 1M6YA 4DLLA 2PMCA 1K7YA 1GV1A 3NXKA 4ESHA 2I2FA 4AJIA 3DJFA 5KC9A 2KHZA 3VBEA 1UQRA 3A6FA 4M7WA 4Y1RA 3WJ1A 5JWRA 1KZYC 2P2NA 1SCJA 3AU9A 4ADSG 1YTUA 2P4EA 1JG2A 4ZPXA 5GJWC 1R0XA 5A4AA 4NTZA 1OJ7A 2NAPA 5B3KA 7ADHA 4DQ0A 4Z1OA 3K4HA 2YXDA 5L7TA 3HA5A 1PFVA 1SXHA 1XDWA 2C29D 2FW0A 2BE7A 4KQGA 2V59A 1ZGZA 2XPCA 4BO8A 4E5SA 4F7WA 5KNBH 3KNZA 2M6SA 1XTUA 3L07A 3GEEA 4RVDA 5C81A 4YY3B 5JNSA 3QSYA 3OPQA 1E0AA 3UPTA 4GWLA 3NKLA 3HKBB 4HUQB 1JU4A 4M9CA 1B0UA 3L43A 4BMPB 3K30A 3WHPA 5KNBD 2ZXUA 1QQAA 4Q02A 5G0UA 1MB3A 4FD2A 1RRMA 1CJBA 4IXTA 4AZ3A 1F7VA 2TMKA 5K0JA 2NW6A 4Q3EA 4RC9A 4UXJA 1E60A 4ZYVA 1GQFA 4V0NA 4FS8A 2QJOA 4YV2A 3UUWA 3FB4A 3HABA 1FQKA 5EQDA 2FMXA 3EGEA 5KTYA 3RAEC 2HGSA 4WXMA 1F20A 2H07A 2FPPB 1WW8A 2C5BA 2CJWB 4YO7A 4F04A 1AK2A 5E4JA 2ISSD 3LCUA 3DAGA 3IIKA 1XDZA 3EOBI 2NZ2A 5CIWA 4Y0VA 2M32A 2R8EA 1T13A 3AR4A 4YAOA 5DTQA 3VR5H 2LP4Y 2ZBGA 1QCCA 3BE6A 2WZCA 1G8PA 1TYAE 1EYZA 1KQ3A 3I53A 3M4XA 5GY7A 1KEEB 1UBUS 1M7BA 1MQSA 4OJNA 2FWJA 3CWQA 1XU4A 3L05A 5KBYA 1NHGA 1TMGE 2Z5VA 2B3TA 3DE5X 1NURA 3MYRA 1LK0A 1CIPA 2QMZA 3BMNB 4OLFA 4UDNA 5CTAA 1PYGA 1TEVA 1J2JA 1TK3A 5DM2A 3VZDA 3PPVA 4KQHA 3I04M 5SZKB 3DYIA 4PS0A 3K9HA 4OFZA 4WOBA 3DW3X 4X60A 1AV7A 1Y7LA 1D09A 4BLPA 2AMJA 2C9BA 4BFSA 1UKYA 4TMTA 1W94A 4C0XA 2VYFA 1ND5A 3U39A 3G8CA 4FCWA 1P7PA 2CSUA 3GZNB 3AQIA 2CWDA 3DDNA 3GNLA 1CY4A 1E1CB 1ZNYA 3QVTA 4QUIA 3B60A 2FWNA 5IBQA 4PCLA 3GK3A 1NI5A 1JKMA 3NKVA 4ND7A 1M7HA 1H0SA 3R6LA 2I6GA 3ROTA 5E9JA 1KDRA 1KQNA 1X7WB 3A1CA 3EGVA 4B47A 4B2YA 1J06A 1X87A 1X14A 2NLOA 3QFTA 4MICA 5ALKA 2O2JA 1HDYA 1PYOA 2WV9A 3GVPA 3SHTA 4BB6A 1JB9A 1PUJA 1WG8A 2BRUA 1IAVA 3Q0IA 4KAFA 1MUUA 1F6BA 1QH8B 1U8UA 3VO8A 4CQNA 5BMVA 1WR8A 4IAOA 1SMKA 1NZFA 2GXSA 2FQXA 5K8VA 1FFBA 5A3VA 5JYCA 2WFZA 4FIZA 1B7GO 2Z98A 4WBSA 3L4SO 3VZPA 3ZY3A 3M89A 4R7GA 4ZO9A 2EC5A 3HQ4O 3CS3A 5CLIA 1RIFA 3G7NA 3Q9SA 4NE7A 4I4LA 1OT5A 2B21A 4HAOA 1NYRA 5C5DA 2O59A 2JFWA 2H59A 4JLWA 1T34A 2M1XA 4PBSA 1ADCA 3L7YA 1Q6YA 1U3VA 2QSJA 3P19A 3TQTA 4IPTA 5KX5F 1O5IA 4EBFA 4GNRA 5AVWA 3JD2A 1BS2A 4FGWA 3PQ2A 1M2GA 3S5UA 3AG6A 4YPOA 2HNAA 5JD5A 1RKUA 1XU7A 1IXRC 1Z6GA 3K0FB 4YIHA 3CUEF 4L3WA 3L06A 3LBYA 1WD7A 2FKNA 1UJ4A 1PFYA 2P3LA 1C7QA 4PCUA 3T9BA 3GGGA 2CK3A 4W6ZA 4BNLA 4AI6A 4D3YA 4IOLA 1NAHA 4XWWA 3ZK8A 1ADFA 1YIOA 4HC4A 3GFRA 4KDCA 4KE7A 2CHUA 4XIGS 4GE0A 3ES9A 1QSGA 3MWEA 4LBVA 1CR2A 1RFLA 1V6CA 3ZHRA 1IQ0A 4FMCB 2WFLB 5DNAA 3MWEB 5AICA 1AD2A 1HDIA 1B14A 1JQ5A 2A1TS 4M1SA 2YWDA 3D7RA 4ND1A 1Z4QA 4B79A 5G0SA 4F84A 2O2DA 3OCUA 1H3NA 4AG5A 3RK0A 1TW2A 5JPDA 1LF0A 2RH9B 5D86A 1MHTA 2ZIEA 4AY6A 3SY8A 4TXNA 1ZIXA 2QE6A 2YASA 4I6EA 4PIPA 2F43A 2QD2A 5GM1A 1UK8A 3KLMX 1H3EA 3NBYC 3A0RB 3CZMA 3UF0A 1AQLA 3MLAA 1LV7A 1ACLA 3Q5EA 1QYDA 3PDWA 1SBHA 5ARBA 2HMUA 1AHIA 4ZWNA 3SSOA 3N8IA 2COKA 2VSXA 4NDNE 1DZ3A 1XR3A 1SEPA 3KEFA 2MR5A 3KXIA 1ODFA 3S40A 9ATCA 3EPLA 3UA4A 2JGAA 4AK9A 4RHTA 2X5XA 2ATVA 1WV1A 2FR8C 5D3QA 1OXXK 3TECE 3U31A 4TYWA 3I9NA 4M55A 2VPQA 1T9KA 1BYUA 3RS5A 2C2WA 4P7BA 2GBPA 3UFXB 3SVTA 5IJWA 3GXOA 4F1KA 1Z4NA 1NVUQ 2AMYA 2GPSA 3DCJA 1Z38A 3JXEA 1SQGA 1U28A 4IHKA 1L5FA 3MQFA 2XODA 5EMLA 3QKRA 3C74A 8ADHA 3UHOA 2WTNA 2XA9A 1LBIA 2B1JA 5CFPA 4M87A 4DEVA 4ENTA 1FS5A 1RBZA 2NZJA 1GR1A 3QJGA 4PINA 5LA6B 5HNKA 2I87A 4DUYB 1ZGAA 2QTLA 2R4TA 4FFOA 4Y2GA 4K46A 2FSGA 3S2IA 3J81A 3KB8A 3MXTA 2I6SA 4X8HA 5IHPA 3ICPA 4GI2A 1KMHB 2RH4A 3R0VA 2NPIA 2P8SA 4RAQA 1LI7A 2JAOA 2CLMB 4IKOA 3NAMA 4WLVA 3EZ2A 4ZCPA 2B8TA 3KLOA 4MPPA 2X8BA 2FZ4A 4QDKA 4CWAA 5FUBA 3KWFA 3PFNA 2HNBA 4BUCA 2Q49A 2Z3VA 3AERA 4FYPA 1JIXA 2IYQA 5G2OA 2BHLA 2Z56A 3C7AA 1B8PA 4D9HA 3ADCA 2Z2IA 2VRNA 4P6VF 2SECE 2AYZA 4JP8A 3EZ9A 3HCOA 2RB5A 5D1NA 4DR1B 3KLBA 2WAOA 1UBNA 4II7A 3VHQA 3CH6A 1S7GA 1J9ZA 2GFIA 3ZVKA 1Q7RA 1YCHA 1OLSA 2WICA 3KX2A 4RDIA 4YXFA 2H5JA 4OHYA 3N0XA 3ORYA 4DCJA 4F56A 4MRPA 4UNPA 4RV5A 1U5BA 2HCBA 4FFBA 2H9YA 3HACA 2HO5A 3M1AA 3ISTA 1TECE 1VMKA 3ROPA 4C6RA 2J0VA 2VDQB 3KSRA 3R4VA 3PYMA 4NI5A 4B44A 1Y1QA 3IJPA 4QXRA 3TB4A 1GNVA 2WOJA 3CYFA 4DY6A 3U0BA 2JJYA 3KKQA 1GCIA 4NBLA 3L82B 4GBMA 4D3XA 1WNFA 3B3GA 4FHFA 1ENZA 3GX1A 2ICAA 1RHMA 1ZC3A 3GZ4A 5E6SB 4RTLA 2EP8A 5AW8A 2HAEA 2UZ3A 4YHHB 5HKKA 1QV6A 1FFXA 2GT1A 3ZZTA 3E9NA 4D9JA 1TFUA 1ZJ5A 3OPXA 1IN8A 2XUZA 2EZ4A 3I1IA 2HIGA 1JJIA 2DM6A 3QW2A 4IO1A 4B81A 1EXMA 3LX8A 1MQAA 4IXMA 1CZNA 1CQIA 3I64A 2FUKA 2AI3A 2BC9A 4AICA 4BASA 1EJBA 2BFPA 3IX7A 5FAKA 1Z6XA 1Z0ZA 2IBTA 2VYND 4MW6A 1G5RA 1L5HB 5DMXA 4AMZA 4D41A 4CF7A 1Y80A 2KB0A 4MQLA 1MG5A 1G3IA 3THXB 4O2BF 3GNQA 1UFOA 1CK4A 3HUEA 3LHFA 3SIXA 4R1OA 3FYUC 4MV6A 3B1KA 2Z08A 4GLOA 3HKCA 5GGXA 1BMFA 4JYPA 4O25A 4X1YA 3TM4A 3MWFA 3T7IA 1CUGA 3T54A 3RRJA 5F9HA 1GCAA 3W5VA 1ZMBA 3UW1A 2ZUWA 1JI3A 2QZZA 1V5IA 2HA5A 2PWBA 2VJNA 4IFBA 3WQSB 3ZHUA 1LSOA 1SU7A 4HWRA 5CU7A 3W5AA 1DC4A 1AKEA 4PSKA 2IYWA 3ADKA 1QORA 1RADA 3L8CA 4LZNA 1RYFA 2VDNB 4FJ0A 5CPBA 4E03A 5A3QA 5JZVA 3LVRE 1L5OA 3VNSA 3F6RA 3OICA 1S7CA 1ZAYA 4JEUA 4S2EA 3RQSA 4NJMB 4CUJA 4PGHA 3Q2OA 2PA3A 4ZV7A 1PV4A 4P80A 5JMWA 4EYSA 3R9WA 3SIWA 5LZ5A 4MYTA 4Q48A 3QLUC 4WZAE 2IPAB 1S2GA 5ALYA 5A71A 1CJSA 3E8MA 3IAS1 1YNSA 4BUJA 4FDMA 4LRYA 1XZMA 4CV3A 4R54A 2FX5A 2XOKD 2ZBFA 4JLPA 1Z56C 1OJLA 4RABA 1FW6A 1UPUA 3QH4A 4C04A 1I6WA 2HPHA 3NHBA 1XCJA 4P9NA 3I1JA 4LZOA 5AM0A 3M6IA 1PWZA 2YNMD 4DLBA 2ATCA 2H9AA 2R62A 1HRDA 5SY4A 5KI6A 4MP3A 2X0RA 3KT8A 3LXMA 3A31A 4YMTA 2PT5A 3K8QA 4BFYA 1UDBA 2KE5A 1H1LB 5CDUA 1U0OC 3EXHA 1N9ZA 4D6YA 3NTOA 1TJNA 5T4BA 2HCJB 4P22A 3HJHA 4XYGA 5CP8A 4RTNA 3WGLA 1AC5A 3OLZA 4H16A 1OPRA 3PXXA 3TDMA 2B5OA 4XDGA 3TRJA 3IPAA 4ALKA 2QENA 3ZZ1A 2QTAA 2IIQA 3E3LA 1TTHA 3CPSA 1Y4AE 3SOPA 4KQWA 3REFA 2FN4A 1G2IA 1QV9A 1TYCA 4P4TA 5L3RA 4BO3A 3PYLA 9ABPA 4RW0A 2HQSA 4Y0NA 4W6QA 2QLJA 2AFHB 2H7VA 3GC6A 3NNSA 4WIAA 5TE9A 4GVPA 2NPOA 4TS3A 3WKBA 4MV3A 2EW2A 2E87A 2IYSA 1OT3A 2NXEA 5H83A 1TM3E 1XRQA 4X45A 3HJUA 2ID9A 1VLJA 1D8AA 1JAHA 4HDOB 4MW5A 4NG4A 4YB8A 5FTWA 4BPRA 4OHUA 2QEQA 4M0EA 4MVJM 3T38A 4U0KA 1AGYA 5T67A 1BWPA 2NYRA 4HATA 3LT2A 1VMIA 1O2DA 1JWLA 1U0LA 1N5RA 3H5AA 4KNWA 3UCXA 2WSSD 1KRHA 5J2TA 2QSZA 1JZQA 1CR1A 3K73O 4OQLA 3HXMA 4Q05A 3LSYA 1WUKS 3OZXA 1AMNA 2NO1A 5JS7A 1DEAA 2ZZMA 2WZBA 1YA8A 3JY6A 1WVGA 2OAP1 4TZKA 4K05A 2AC4A 2X8WA 4QPPA 4MRAA 3B51X 1ZA2A 4JDPA 3QBDA 3SSMA 5FBRB 3WAGA 2BMVA 1H5UA 1QP8A 1UANA 4QYXA 5LDGA 5IH7A 5DYGA 3PLAE 4W7SA 3RGWS 4OQQA 3HXQA 2C4KA 3CX4A 1B6GA 2XZLA 1NBWB 1P2UA 1QWOA 2BJHA 3QMPA 3QIAA 4FGKA 1QF9A 3Q1LA 5EUQB 4ZYUA 3N58A 1M0SA 3EMKA 4HMQA 4OK3A 4MO2A 1N33B 1PVDA 2XE4A 3SJBA 1G9XA 2WHPA 1VL1A 4HWOA 1NVKA 4M9RA 1IWBB 2OO5A 4LZJA 4AN0A 2C8KA 4EI8A 4Q3CA 1HE2A 1ZD8A 2H5EA 3B9QA 3EEBA 1NDUA 3K1AB 2ALJA 2DH6A 2HSDA 1NXXA 3P2MA 3UXEA 3ZE8A 3OY7A 3GDGA 4Q39A 5DTEA 1P3DA 3E5RA 4A8JA 5ICGA 1IHOA 1N2GA 1EWRA 4CW7A 1FDIA 4DADA 4V2IA 4DFDA 2X0IA 4E1BA 4S3MA 1NM5A 4G09A 2F3RA 5EWJB 4HNUA 1GQSA 4QDTA 1WP4A 4UJ5A 3WHKA 3KHSA 4OH7A 5JCPA 2FSSA 1GPDG 3BILA 3OPNA 3UANA 2AE2A 3A1FA 1JSLA 3K70D 5F23A 3E18A 5D01A 4P4SA 3A14A 3QF4B 5EJ2A 3RYCA 4K6CA 4WACA 3EEQA 5ER9A 5LMNB 4UZSA 3W5DA 2WKSA 3KYDA 4GF5A 2GYYA 2VJQA 2VJCA 1H0KA 4D82A 2XB8A 3GDWA 2DWPA 2JFYA 4CCSA 1BC5A 5UKDA 2VHCA 4GP6A 3L02A 2HJVA 5JNLA 2GBLA 1FRQA 1LX7A 1QGED 1R8JA 3G68A 3LBIA 5PNTA 3TUJC 3WLFA 1W0CA 3PQDA 1TMKA 1WMEA 1AXGA 4ARZA 2IHVA 2BJWA 2LWIA 2YQZA 3ZZUA 1LJLA 1CLUA 5A4MS 1GILA 3MW8A 2G36A 4Y9UA 4NPHA 1IJKA 5B58C 3OTGA 4M2LA 4G9EA 4ZAXA 4YRIA 2XE6A 2ZAIA 3B2QA 4V0ME 1AY0A 1P61B 4I9GA 4YI5A 1PLJA 3IT0A 5LJIA 1Z2PX 1TLFA 1UAGA 2GH1A 1XK7A 1VIVA 3GA0A 3OQVA 4ZQBA 1CP2A 3DKVA 3H1TA 1P9NA 2C9MA 4JROA 4HZIA 3TSYA 5CDTA 5IZCA 1DAFA 4FWTA 2A84A 3R75A 3DE1X 1DQRA 1ORRA 2C2ZA 4CM3A 1YV9A 3R3SA 4MVJI 4KKVA 4UBLA 4D99A 3HE3A 2TMGA 1N6RA 1YIDA 2CL6X 1P2TA 2FGKA 2QS9A 4LZLA 4PLYA 1HNXB 1HYHA 1NNSA 1E9DA 1M5TA 4RMGA 1YGPA 1KC1A 2J0UA 2P2DA 2C4MA 2JARA 3HJNA 4IGIA 4FMDF 5TDHA 1P5FA 3Q7RA 4OQEA 4QBIA 1LDBA 5JJ5A 1Y9EA 1LDEA 2ZULA 5JYDA 3PPYA 2JATA 2QL6A 3MGKA 3LT1A 2GO7A 2G83A 2IY8A 4IIYA 2QMQA 1YB2A 3WIBA 1VJ5A 1X38A 4YRRA 5B6PA 1RCUA 1CF2O 5F5LA 5TT0A 5IF9A 4LY3A 1VGVA 1YWGO 4X20A 2BGUA 4L4UA 5B3LA 1M10A 1IVSA 2V1UA 2XA1A 1P6QA 2AHRA 2ZANA 4L74A 1LSJA 4PN3A 3U7RA 2QX6A 2Y0DA 1F4LA 5HQJA 4DG9A 1Q0HA 2UUOA 1XZKA 2GJKA 4W5WA 1KDOA 1T91A 4OMDA 4YVFA 5EKSA 2WIGA 3VU1A 1KZ9A 1E1RA 1IMJA 2J9FA 2ODNA 3R3ZA 4LSMA 5E4YA 4C5CA 2ILVA 2XA2A 1FFAA 3N6VA 1PWXA 2PUBA 1Q50A 4NAUA 2QN2A 3OOJA 2J3KA 4I99A 5TRTA 2AEJA 5GOZA 1II8A 2RAVA 2H54A 4E30A 1C7JA 3GDOA 1WCV1 1ORDA 4Y2TA 1W4ZA 2W42A 1A8QA 4LQLA 5ALGA 1E3WB 4YRFA 1SPBS 4X44A 4JEHA 3M4NA 4Q93A 3OO1A 1I7QB 1NNI1 2GBGA 3K1YA 3OKPA 3OMLA 5ECYA 4JAVC 2RFLA 3U3JA 1ZVKA 1PEYA 2AFHE 3ZBQA 3F3MA 3WQHA