3OBIA

Crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
285
structure length
285
Chain Sequence
b'HHQYVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFMRVVFNAAAKVIPLASLRTGFGVIAAKFTMGWHMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVSNHPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYMQILSDEMSARLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISHRDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVFTD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyltetrahydrofolate deformylase
molecule tags Hydrolase
source organism Rhodopseudomonas palustris
publication title Crystal structure of a formyltetrahydrofolate deformylase (NP_949368) from RHODOPSEUDOMONAS PALUSTRIS CGA009 at 1.95 A resolution
rcsb
total genus 75
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.10: Formyltetrahydrofolate deformylase.
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3obiA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3obiA02
2I9SA 4M8LA 3IXQA 2F8MA 2YWRA 3IBWA 4DS3A 4QPCA 2LQJA 5JJBA 3DHXA 3ENVA 2GARA 2PA3A 1ZPVA 2KO1A 5J9FA 3DCJA 2CFIA 2DTJA 4ZYTA 3DC2A 4GMKA 1RBYA 4LUBA 1RC0A 4ZYVA 1MEOA 4Q12A 2QRRA 2QSWA 3TQRA 1ZLYA 4ZYXA 1UJ5A 2P9EA 2NYIA 3OFHA 1RBMA 1CDEA 1RWUA 2JHEA 2F1FA 1C2TA 4TS4A 2P9CA 1UJ6A 1MEJA 3U7JA 4R8VA 4ZYZA 3O1LA 4EW3A 2JOQA 4PWUA 2H9ZA 3N0VA 2FGCA 3R8XA 3S1TA 1RC1A 3K5PA 5T41A 4TT8A 1RBZA 1YRWA 2QMXA 2DT9A 4IQFA 4X84A 1XTZA 1LK7A 1M0SA 3KWMA 3KCQA 2RQMA 4S1NA 3L7OA 4ZZ1A 1ZLXA 1JKXA 1U8SA 1LK5A 1O8BA 4YFVA 3DHWC 3MTJA 4GO7X 1FMTA 4EW2A 3TUJC 4ZZ2A 1YGYA 5FIIA 3OFGA 1C3EA 1CDDA 3GARA 3UW1A 3AB4B 3ENQA 3LOUA 4ZZ0A 3OFEA 2MDAA 1GARA 3TQQA 1NJSA 1UJ4A 1GRCA 1RBQA 2BLNA 3HHEA 5J63A 4GO5X 1SC6A 3MWBA 3AAWB 5CJJA 2PC6A 3DA8A 4EW1A 3W7BA 1ZGHA 2QMWA 4NV1A 4ZYUA 3ENWA 3OBIA 3DDNA 5IT0A 3AUFA 3CEDA 2RQKA 4YFYA 1Y7PA 2BW0A 3P96A 1PSDA 3TUIC 3Q0IA 3TUZC 1LKZA 2RE1A 2LVWA 1MENA 4ZYYA 1KS2A 4QPDA 2CDQA 3AB2B 3AV3A 4ZZ3A 3MAHA 4TTSA 2J0WA 4IO1A 1S3IA 2J0XA 2P9GA 2ZHOA 4ZYWA 3LUYA 3P9XA 4PZUA 3NRBA 1YBAA 5IS2A 2FMTA 5IT4A 3OFFA 4NMLA
chains in the Genus database with same CATH superfamily
1QIIA 2CVPA 1IKXB 1XAJA 2UYQA 1VZ2A 2CDAA 1KMHB 2PA3A 4M1WA 2G82A 2V34A 3G23A 4R8UB 3LBIA 4ZVQA 3PEEA 2ISSD 4UE3S 3NHLA 1U1EA 2XS7A 1Z5WA 1GYQA 2R25B 3MUTP 3ET6B 2PSEA 1VBXA 2J9DA 1NIJA 3MM5A 4L27A 5A4AA 1LC0A 1DUSA 1EQMA 2YH1A 3FMFA 3SICE 1RI5A 1AHHA 4YP9A 1Z5ZA 1MW7A 3CZ4A 3LDHA 2XOXA 4M89A 4XA8A 3S2SA 4LXIA 4DOZA 3CW2C 2VKZG 2DETA 1VBFA 2X8JB 1U25A 3UN5A 1NDUA 3UJ6A 3PU6A 3LT5A 4QQRA 2H48B 3ZWNA 1U6ZA 3JWEA 2Y6UA 3EF0A 4D3YA 4JIMA 3OP1A 1ZIPA 2BHTA 4OCZA 1O89A 1DFDA 2VRCA 1UBOS 4DL3A 1LXCA 4R1QA 4YV1A 5ALGA 1DTTA 1H1LA 3TL2A 4Z0PA 5LA6B 2HFKA 2HU2A 4D56A 4CKBA 3SIPA 4U4AA 1NR1A 1HX7A 1OB2A 4HXEB 1YAJA 2BEVA 4DR3B 2YC2C 3U3XA 2VPYB 4RLHA 3PO4A 1MG7A 1LZKA 3WHKA 3UFCX 5AJUA 5C24A 5D2CA 1G291 4PG5A 3H2VE 2QQ5A 4BKMA 4LXQA 2C4KA 1PT8A 5JRDS 4JI7J 3DF7A 1T2FA 1G8YA 4DR6J 4EY7A 2NVUB 4D57A 5CB4A 2P2GA 1M5SA 1RADA 3FNRA 3OU2A 5AKLA 1ZISA 2QXUA 1EVJA 4HX2A 1UWCA 4Y18A 1TW2A 2NN3C 2QMUA 3KYDA 3R40A 3T7RA 5C4IA 3W5VA 4HSGA 3PGA1 2CDCA 1Q8BA 2OK7A 2YBDA 1H6KX 1P0FA 5EHHA 3GZ4A 4RXUA 1SIOA 3CJ5A 4HAXA 4R25A 4F26A 1JSRA 1E7MA 3OOJA 4ED6A 1TO2E 2BJHA 1P9NA 2G67A 3WO1A 4HMOA 3QQPA 1PKXA 3ZXWA 1D04A 1BSVA 3RR7A 3MMSA 4G1VA 2PLFA 2MJUA 3K5LA 1ISRA 3DTNA 3IKMB 4ECRA 3CF4G 4Y2TA 2ZBDA 4L6AA 2BZ0A 2HUPA 5DGCA 2GNKA 3E9ZA 3G6KA 2HZAA 4GXNA 2AJFE 1IPFA 3AF4A 3BSSA 5HM8A 4U2DA 3H7AA 5HDQA 2UYHA 5I3CA 3P9RA 3PNOA 2IHJA 2Y0SD 3EPIA 4LHZA 4TU8A 1QVZA 1ACJA 1SH7A 1TV6B 1ZAYA 1IBKF 2J5QA 2L0XA 3OETA 1FSSA 1T1JA 5HE9A 1P9LA 5IN4A 5JW6A 4TU9A 4G01B 1Y6FA 3D0OA 2K7KA 1SGWA 4PYJA 4XM0A 1D6MA 5CVDA 3TTXA 3F5FA 3CCLS 4YCAA 3HWX1 4B0OA 1IOVA 2AXPA 3PYGA 3AP1A 4HDAA 4S2EA 3UM9A 3R6DA 4OX8A 4NCGA 3VVBA 2JNJA 4DBLE 1V43A 2ZLBA 5BW5A 1QM9A 2DGXA 4IVPA 3MPUA 5BSHA 2J7WA 3TAMB 3H20A 4IO0A 3LO3A 4MI6A 4DHEA 2XYPA 4R2WA 2JIZA 2RG7A 4BFSA 4BKOA 3K0SA 4KE9A 4C1NA 2EC5A 5CVUA 2BFAA 2A86A 1PZHA 5C7OO 2PVCA 2ZIGA 4YT5A 1THMA 5C34B 4GKJJ 2ZZMA 2B4YA 4XUCA 3NBQA 1M0SA 1B4SA 2HOQA 3RIXA 4MKZA 4CMHA 2I5JA 1XZNA 3OESA 3IO1A 2W2NP 4TSRA 4L7VA 5FH9A 1VSBA 3G2NA 4Z1OA 1M66A 4C3UA 3UXMA 1AT1B 1J6UA 5EQJB 1YB1A 3O9MA 4F04A 4BQQA 5BV2P 4MCAA 4KHPB 1C0TA 3OIUA 2SKCA 5G0TA 2GVDB 3MFIA 1DMRA 2X5JO 1LJUA 3JXEA 1NVGA 2HWIA 4OQ4A 3WV4A 1H98A 4XYEA 4EGFA 4L8YA 2QHXA 4RK5A 4PZDA 5GZ6A 1N2CE 1FNXH 4DLGA 1QZTA 3G82B 3VAKA 3QVLA 2F9LA 4PR6A 3WQSB 4LF8F 3OR2B 3PACA 4JH0A 3EAGA 1BCRA 5E41A 1KTIA 2R7KA 3BPDA 2WSIA 2B9WA 1M7GA 2P8JA 1QHYA 4DCPB 1XU7A 5AXAA 3GU3A 5ECYA 2PCLA 1Q1EA 4XIIA 1I4LD 2G08A 4DV7J 3S6EA 2ODWA 1RAJA 3BG5A 4ZD6A 3OQBA 3O8DA 4FEGA 1SIZA 3GJRB 1R4ZA 1AHIA 2BDEA 3SIWA 4IR7A 3BBFA 3I2KA 1DELA 2EKBA 3EH1A 3Q8QB 4A27A 2P3QA 2W9BA 2DFVA 3FXAA 4DC1A 3HSDA 3I4LA 2JLWA 2XMCA 1F1JA 4BVBA 3DOIA 5EJMA 4HPWA 3R1IA 4WCEQ 2ZSFA 4YUXA 4LVNA 2HN9A 2CJYA 4P32A 4FW9A 4QASA 3WNBA 1M1YE 5KTNA 5EE9A 2ORVA 3T5CA 2V5UA 1DFHA 2PZEA 2PR7A 4WKGA 4RHYA 1W0KD 4TMXA 1O08A 5F4BA 3H11B 5INTA 2A84A 3UHOA 1SH2A 1N5SA 4PZZA 5KNDD 1AB8A 3MMAA 4TMTA 2PY6A 1SXJE 5IHXA 1G60A 1RQ0A 3N87A 2A9KA 1SUFA 3DCAA 1FESA 3EEYA 1RHQB 3PUIA 1PKEA 3U4CA 1G5PA 1EVZA 2C2RA 1EG7A 4KPYA 4WT7A 3AUSA 2EP7A 1G20A 1RMQA 5B2EA 2I87A 5IYZB 3EGCA 1GL7A 1H2AS 1WHSB 5CB4F 2FHJD 3G87A 4QX6A 5IH3A 4JY7A 2R6GA 3NHMA 5KOYA 2MHCA 2R60A 3PEHA 3IDQA 5CEEA 3LHIA 2IIPA 3DU5A 4RHFA 4B17A 4MYTA 3AEKB 1QIGA 3K1YA 5DULA 1H2WA 3V6LA 2IBOA 2VDPB 5K09A 5A5DA 3FOWA 2UXDJ 4OHYA 3A6FA 4JI5J 3RWMB 4YRCA 1WXFA 3WV5A 3IAEA 1R1DA 3W9IA 4PLYA 2JJ4D 5A5FA 4M1OA 1SVNA 1SO8A 1ZK2A 2H4ZA 3IO5A 4WCVA 1M6HA 4DU7A 1I6KA 3DCNA 4X91A 3IXMA 1EE2A 5CDTA 3FTQA 1YG0A 3QOFA 3GYNA 4LOKA 5EWJA 4Y2XA 4PS0A 1FFGB 2JB9A 5BY2A 1W6UA 3I82A 2VJBA 3MYYA 2FOIA 2DR9A 1RP1A 1ECBA 4Q9NA 3H98A 3HE3A 2AEMA 3HDYA 3MJSA 2IBKA 2OKGA 4QWWA 5AUNB 2IRYA 4F71A 5B1DA 3MJTA 2C8KA 3B6BA 3IIMA 3U9LA 1YHYA 5DN9A 4HP8A 3AJRA 3LD9A 3L7PA 1L4EA 4F12A 3ZD6A 4O2AB 5MGBA 3K9QO 4RW4B 4FDLA 3LO5A 3BE4A 1V6SA 1FXRA 4LREA 1NK5A 1TL7B 1DFGA 2D0PB 4OXIA 3GJXC 1PLKA 3HJAA 4HT7A 1FY2A 5EIBD 4LYDA 1EINA 2JGNA 4QREA 4KFBB 4RABA 2WNSA 5K7SA 3IN5A 4HH4A 3O2NA 1WMSA 4FGLA 1EIYB 3WK4A 1D3WA 2CLSA 1Q1KA 1T05A 2ZCJA 1XX6A 1VE3A 4GEKA 2HIYA 3MM9A 1ZKMA 2OFWA 2C1EB 3UMSA 2QN2A 3QWIA 5KJ1A 1VXOA 3L9WA 1JR2A 2QN3A 4B8WA 2Q0HA 3IQXA 2HHQA 4QUGA 5G0VA 1U3GA 4DR1F 4O23A 2WMOB 3CNQS 1O95D 4CM6A 1KARA 4YQFA 4YMGA 4RTOA 1R8XA 3DMDA 4Q1DA 5I7HA 3EZNA 4PBSA 4EY8A 2CQIA 5CYOA 5LYYA 2EP5A 2BONA 4LZAA 4NFYA 4WZZA 3W60A 4Q12A 3A0RB 4K5SA 4WERA 1JHAA 2EBWA 5H9WA 3QRPA 2OILA 4I6YA 3MRVA 3C1AA 1DURA 2ZBPA 3QPDA 1FJGJ 4OXNA 2FR1A 5CBPB 1OJLA 4V1Ak 1S7HA 4BWVA 2AVDA 3MDFA 2K5UA 4PZ9A 4BQSA 3G8CA 3ZDCA 2GZ1A 2QU8A 5D8DA 4AKHA 2XNDA 4GI3A 1BXRA 1KPIA 1WMEA 3PUYA 2MTLA 3HHDA 2YKMA 2L82A 1U5BA 4CMKA 4H18A 1ZH2A 3U4AA 3C16B 4FMCB 4JX8A 2RU9A 5AW1A 4F46A 4DCVA 1FS6A 3N8GA 3ETHA 5BOSB 1J5EF 4DPYA 3ZHXA 1JLQA 4W1PA 2CXSA 4DXHA 3ZO7A 3ZCPA 4PY2A 1QG2A 2XDAA 1SCUB 1KXJA 1PK8A 1L5HB 2VUSA 1LQTA 5AI4A 3VYUB 1DJ0A 4DQXA 2Z8YA 5CLFA 3GLFE 2V9KA 4URHA 3V48A 1U0FA 4R01A 1VBMA 1RS0A 1FX4A 1CU1A 4DFMA 4YI3A 1E0SA 4R40A 1NRIA 4ZIRA 4M87A 4P2XA 3W5BA 4GP6A 1QVVA 2I2BA 1I2BA 1RWPA 4ALNA 3USZA 2QW8A 2DVIA 4WEOA 4DV5F 3MUOA 4DMUB 4GVBA 1CS0B 1C0UA 1FX0B 2Q79A 4ZVFA 1CUSA 3AM1A 3EVGA 1OMSA 3TL6A 3SV4A 4C6HA 2PJDA 2R8BA 3LPCA 4CP5A 2JW5A 1QC5A 3MZ0A 4RKUC 2HA0A 3MMCB 4LC1A 3E2MA 1G6HA 3PDIA 1Y6JA 3NDPA 2IRUA 3DLPX 1FDBA 2M1ZA 3FWZA 5H9VA 2G5GX 3GXOA 4PYRA 5HKLA 1JQGA 2ZITA 3U60B 2EIHA 1G63A 2NZUG 5A8WB 3GLFA 3T7KA 1FUEA 2WT4A 3FRZA 2G2ZA 2FUG9 3LHFA 1T9KA 4POOA 5DTJA 1T3NA 5LMUJ 3WYNA 1SD2A 2FHSA 2YQ0A 1SV5B 3KL2A 1S0MA 1P9YA 4BVKA 4PW0A 3RFTA 3FTFA 1ZTTA 2YVUA 2W8BA 2PV0A 1NQUA 2E44A 3HKCB 4JNKA 2KJVA 1E98A 3UCFA 5B1YA 3R6LB 3QV2A 1TU0B 3DUFA 4U96A 3A28A 5AKJA 3MGGA 3QXSA 4Q18A 3DC2A 2FVXA 2ALYB 3UD3P 5GP1A 2JJYA 2ZT6A 5CEFA 2XZLA 1CJCA 1WUYA 4JWKA 4NJEB 3RRBA 4IG3A 2DR8A 3ONVA 3BKTA 1P5FA 3AIIA 2LIPA 2BFNA 5FDLB 4ZDNA 1YZFA 3U44B 3TVZA 4YH1A 3OIWA 4FKZA 1IG3A 4Q66C 4B7ZA 3FPBA 4QSHA 2CXHA 2NZCA 3HKZD 4RVOA 1EX9A 4OZ1A 5K8PA 4EKIA 1KIFA 2DR3A 1GARA 3HK2A 3B52X 5GVQA 1NPKA 1P6QA 1DXYA 1EXWA 3AUJB 3CWCA 3DW1X 1W76A 1ZVKA 5IX8A 2QL9A 1SC1B 3OWHA 2E5JA 4DZZA 2BN4A 3ID6C 3DWIA 3FPLA 3GCGA 3DDOA 3ABQB 4QA9A 3MMNA 3OPYA 5JJCA 3W2WA 1SH0A 3ROPA 4HLQB 3I61A 2ZUEA 4U2GA 2XMWA 2J9FB 1QKKA 3EX7C 1TDJA 3GAAA 2QENA 3GLIE 2B1GA 4E2FA 2VOPA 2BUAA 1UAGA 2EW8A 2XZOA 2PZKA 2FVYA 1HPZA 1XZCA 3FNGA 2VG6A 3T41A 1NDPA 2H51B 4I64A 3TWOA 4QXAA 4ICLB 3FLAA 2GDZA 4Q03A 4QYZJ 1DAMA 3C6XA 3PW4A 5HQ8A 4HFNA 3WBBA 1PZGA 2HRQA 2GH1A 3BWMA 1Z39A 4HFRA 4JP3A 3M30B 3MPVA 2D1TA 4PXBA 2RAQA 1BHO1 4N4AA 5FF9A 2Z3ZA 4HB4A 2XQCA 1JXOA 1IBMB 1SBTA 2JL9A 1KAQA 5CNJA 1KYIA 4U7JA 4MW0A 5CLQA 3J80A 2QTWB 2JAOA 4O2BF 2HJSA 5A2GA 5ETNA 4D79A 4NI2B 1K0VA 2ESRA 3U7FB 3I52A 4GRSA 5EKUA 1GT91 3H8JA 1N32B 2KX7A 5FKJA 3OLQA 2VOEA 1JSLA 1CETA 1TQ6A 1GHTA 5K0GA 1E58A 4JJGA 2FK8A 1H2ZA 2ZWMA 5KSWB 4L85A 1BXZA 2WHPA 4TS1A 3QY9A 4RDXA 1USVA 3OLXA 5JH7B 4MUBA 4FM9A 3T5TA 5CD4H 4CQMA 4JQOA 3NIWA 1KAOA 2XRZA 4N8SA 1KGDA 3TYTA 2MGZA 2O3TA 5BSEA 4G0ZA 4KGMA 3U56A 3TDKA 1XTTA 2IU3A 1KF0A 3VZBA 3AFNA 4NXNB 5BVHB 3S1TA 2AOTB 5ENDA 3UKDA 5JPDA 3GR0A 3I0NA 3NIFB 1YQEA 3GO4A 3G9XA 4KO0A 2GQ2A 4BNGA 3BH0A 4YP7A 1NXXA 2Q5EA 2M6KA 2HVEA 1KFEB 2AXNA 1P72A 3OH8A 5LJIA 1DLJA 1XMBA 1SHLA 3EVMA 4LOLA 4C2BA 1WHTB 4Q7LA 1NK9A 2BMDA 4F9TA 9RUBA 1KZ9A 1OF1A 4OLOA 2QSJA 2P2YA 3T7DA 1RLIA 3I5AA 4EZEA 4YP1A 5IC4B 2HLDA 2BFPA 2XY5A 5GV8A 3HDVA 5AKZA 2I9KA 1VI6A 2H9AA 4UF4A 2XG8A 2E21A 3NBMA 1NFFA 1S9EA 2V03A 2CZCA 3PX4A 2YJ5A 2DNKA 4ZJPA 2ANBA 1QLJA 2FCAA 2DWCA 3RTGA 3C6ZA 2CJFA 3W65A 5FV7A 1NBEA 1R3DA 1I94F 2F8HA 2RG1A 2AH5A 1FX0A 2PMZD 4KQZA 3PE6A 5B7QA 5JAMA 5GV7A 2XWYA 5AI8A 2XGSA 3RJMB 5LJ3Y 4IQGA 5ESDA 2XVZA 4IDEA 4B75A 3IUEA 2VG7A 1T3SA 2HHPA 5KNBA 3E9RA 2TS1A 3AEKA 5FOVA 3GJYA 5LCXA 5EXPA 4ZAWA 5KTMA 3VQSA 2JBWA 4WKNA 2NU6B 5ESXA 3WRYA 3Q24A 2QYOA 3A6HA 5AOVA 5D87A 5IC5A 2HYIB 2O0JA 3KLMX 4G5SA 3R1LA 4N8NA 3TM4A 2HRZA 3R2JA 1CLEA 1N8RT 2QT1A 3HN6A 3JSMB 1IAVA 1PLLA 1ZOSA 2PYZA 3UATA 2BRKA 1FEEA 3CN9A 1U1KA 2Q6IA 1FNMA 2H7VA 2I6GA 1JI3A 2HHLA 4IDCA 1EZ1A 4XSGA 2KBEA 2RGUA 2QX7A 2I7VA 2PHZA 1WOPA 3VZQA 1XZBA 4DX5A 3MFQA 3WLJA 4GC7A 4RF2A 4CM0A 1CYDA 1PEDA 1XN1A 1PV1A 1UEXC 1OBCA 1R0AB 3IQZA 1P45A 4B6SA 1Z83A 3SLGA 3M05A 3UY4A 1O0SA 2AWZA 3R3HA 2ZROA 4ZMRA 4QXOA 2ZE8A 3D0KA 3TRFA 1US8B 2OEMA 1U2PA 1LV7A 4WNAA 1IUJA 1DARA 1G4HA 4US0R 1PNRA 4QSMA 2VBGA 4EG4A 5IM4A 2ZGVA 2V55B 2K1RA 1EFLA 2IPOB 4IJVA 2ZT7A 4RQBA 2FEPA 2JAWA 5B5SA 2I66A 4KO8A 3CJ0A 5CTJA 4X62B 3WWEA 1K73T 3D31A 2CT8A 4K9LA 2X3UA 5AI9A 3TVYA 2YV1A 4M0MA 4JLOA 2CNWA 3HPQA 3LE8A 5ECGC 2QPOA 2VP9A 2DHQA 1GQFA 3NBAA 3QVMA 5C7LO 3EAFA 2WUGA 3SM9A 1Q5VA 1A9TA 1Z4QA 4MGHA 1MDFA 1NU6A 4ZO8A 3FDSA 3QG5A 5FWXB 4YJGA 3I0SA 2V8PA 1GPBA 1QG4A 4NV0A 1LEOA 3TI7A 3I8SA 4ASUA 1Q8IA 3OFGA 9LDBA 5H82A 4TXSA 1JQAA 3I9NA 2MKKA 3N7UA 4LDQA 1V5IA 2PX8A 2AUTA 3NETA 4UT4A 4IIYA 4H4DA 1VLVA 3V6DA 1UM9A 1OYDA 3AQPA 1I9GA 2W98A 4DNXA 1G18A 4DL2A 3M6FA 3PD7A 4RD4A 3UTDA 4ETZA 2QAJA 5CTAA 1SKYB 1XCMA 2OO5A 1G5TA 4J9MA 1V7CA 1X8LA 3ISND 4F4KA 2M4MA 1G2EA 2J0QA 3K8YA 1M1NA 3K58A 1YRYE 3OSNA 2C83A 2HBRA 1NPYA 2DGDA 4FGJA 3KOXA 3HNOA 1XMIA 5F8NA 1FD8A 1J0AA 2J33A 3FIJA 4KU4A 2ZSUA 2DECA 3DL4A 4TU7A 1U31A 2CPIA 2CWKA 2OO5C 2HQBA 1HQ2A 3O95A 1RISA 1D4OA 5A1TA 5K3AA 4WZBB 1PUIA 3ZTQA 1XMOB 3NYRA 4WNCA 4XIYA 5CDGA 5LP6F 5EXEA 1WOMA 1FMTA 2C2BA 4PZYA 3R0JA 3G5AA 2NO1A 3N0TA 2VJMB 3GWGA 5CFPA 3KBBA 3HA7A 3CWZA 4RTNA 1CNEA 5KWIA 4N39A 2XF2A 2GO7A 1WD6A 1AA1B 3P2JA 4PC6A 3K1AA 3U5TA 3I42A 1EAYA 4C4YA 1GCIA 4YMWA 1R0XA 5KUTA 1U28A 3BXPA 3DOHA 2D0OB 2VYVA 2I6TA 2B4VA 4BATA 2ZWVA 1S1UA 5LDGA 1DDGA 3RYFA 4K3UA 3OJLA 4WJLA 3AJ9A 5DQIA 5KFWA 3CLHA 1FK9A 3SSQA 3FCSB 2H1OA 1HNXJ 2RIPA 2MKHA 1EAYC 5KFYA 3CPWR 1B6GA 3UMMA 1RWNB 1WM1A 5D3GB 2R4QA 1EUCA 3N8NA 2VTVA 4BTVA 1GOTA 2WP8J 3OL7A 2P62A 2VUUA 3C8MA 1FE0A 1B16A 1EWQA 3K71B 1SB8A 2B21A 2AFHB 1NQAO 4PQEA 3IXLA 1X1TA 1PGQA 2FRVA 1VMBA 1YFZA 2J7PA 5K8VA 4ID8A 5J2NA 4Q1FA 4IDBA 5C24B 3BEDA 5KQMA 2O2IA 3LCRA 1RHRB 2QP4A 2XZTA 1ETUA 4BB9A 4RVSA 2FVRA 3TECE 4Q6BA 2HRTA 5CCMA 3PUZA 3HNRA 3KE9A 5HZKA 4PXEA 3R6TA 1OB5A 3PW0A 4YIHA 3TFQA 1DTWA 3VSBA 4A8XA 5L1JA 2D1FA 1HMYA 3RVSA 1KYXA 1JRLA 5BPHA 2Z5LA 3GJ6A 4R2JA 4D9HA 1VIOA 5FOWA 3TOCA 1S9GB 2C4HA 4CH0S 3SOPA 3IBCA 5MN6A 1LA2A 1REVA 4Q9IA 4RD3A 1QK3A 3UJ9A 2A58A 4OZ5A 4Q16A 4YBRA 3LANA 1ISJA 1T05B 3FE2A 4EHNA 3JATA 3N2LA 2RIJA 2NAFA 2WTFA 3J7TA 4NZYA 2RB5A 1KMMA 2GA8A 1ST3A 4ROTA 1CF2O 2DNYA 4HYEA 3DYAA 5PNTA 1ZM4A 4JASB 5EQTA 1QB8A 5ALTA 4HGPA 2R4TA 1XIVA 1DHMA 3TTUA 4XR9A 4KR0B 1Q7CA 2FZLA 1MO3A 2VNAA 2BMAA 4P73A 2GTPA 1IR0A 2ZE6A 4BE9A 2AS0A 1TJ5A 4F8JA 2OTJS 5D51S 5B58C 1ZD9A 1GFIA 4D3DA 1CDZA 1Q0TA 3FCYA 5AW7A 5L40A 1XK7A 2R9LA 3TWZA 3C7AA 5H0IA 4BAGA 3A3KA 2CLEB 1XXHA 4MW4A 1S2IA 1X5TA 1E1RD 1QQ6A 4UUQA 4C0XA 3TEHB 1S77D 1Q1AA 1PBUA 3HV2A 5ALOA 1ISGA 3E4CA 5D0EA 2D7CA 4H7HA 3L02A 3RAQA 1ZD4A 1H74A 3ZG6A 1K1QA 2VP3A 4WKOA 1CEZA 2XECA 4NXNF 4E4RA 2CSUA 4OYRA 4LGYA 2JLRA 3KWLA 3OQJA 2NZYA 2D3WA 3N6NA 3EX7B 4AIIA 1QK4A 2IU4A 2NMVA 2FZ4A 3OPKA 4KAAA 1J1UA 3GVCA 3UWKA 5IF9A 3IL2A 3GUYA 1HYSB 3ZQ4A 4QNMA 3ABIA 4Z1MD 1LVHA 4ZVMA 2QRHA 1E7YA 3NRCA 1Z18A 1P77A 3HDHA 3FFXA 1B8OA 2JC1A 2FWAA 3HBLA 1Z68A 1FFXA 2EJBA 3F6BX 1MGOA 2DR5A 1VKZA 4WZAE 4X95A 3KSZO 2G5PA 3NWPA 2XWSA 3EJ6A 4MLPA 4BV2A 7GPBA 4WP8A 4MINA 4BKRA 2FWJA 2NM0A 1TK3A 3QM1A 3E7WA 1HQYE 4QO8A 2HX1A 1DEOA 4Z0TA 5KINB 3N7TA 4F4CA 2QVZX 4LK3A 4WXEA 4I9GA 4Y2AA 3FYSA 4BV3A 4G1BA 2QV0A 1SK8A 2JI9A 2EV9A 4XPZA 1RTTA 4PNHA 3LVRE 1OGJA 5I47A 4DR5J 1VE9A 4UJ3A 1NX9A 1WVMA 1ZAKA 2XDQA 3RRFA 3LL7A 2MLYA 2HLPA 2K6GA 1OYOA 5AO9A 3PC6A 1N36F 3IRXB 2CXUA 1CVLA 2ISQA 4DL9A 1P62B 1TCCA 2K4MA 2X86A 5BNTA 3FD8A 4ACBA 3CZ9A 2LCWA 2QSYA 4UW2A 4U63A 5ISMA 4DV7B 1MVOA 4LSNA 4LNUA 2PH5A 3BRWD 4JUBA 4X4PA 4RY9A 3IR5A 3TJRA 5FBHA 3W4JA 1QYDA 3AT1B 4KIJA 4DDWA 2QN6A 1KH3A 4B9NA 5C31A 4UU8A 4FGWA 2R2AA 4GO1A 3LY5A 1H42A 1LW0B 3JWGA 3SBMA 1ZN9A 4U7DA 3F1KA 4HAIA 3ZLJA 3FYHA 4YRJA 2VJPA 2G25A 1QB7A 3OC6A 4LBWA 1M8GA 4MPDA 1X7ZA 3EUNA 3JTMA 1V0JA 1UWAA 3RAPR 4B4OA 3RB6A 2LKDA 3FBFA 4UULA 1GDHA 2UUAJ 3QJLA 3TSYA 3V4ZA 4D81A 2UZ1B 3WXBA 2GXAA 4FXVA 2E5LJ 5G3YA 2J0VA 1E9RA 3AK4A 4FT2A 1VCTA 2NVUA 1CB7A 3PEJA 1XJ5A 4FYVA 4J9KA 4FCWA 1PG5B 2JCBA 2YUIA 1HFJA 4NK5A 5EP4A 1XD8A 3DR3A 4DUGD 4D9JA 1CCWA 2FD2A 3N4WA 2AF6A 1Z6TA 3QLHA 2OO3A 2PFDA 3M4XA 4YP6A 2XWPA 1E2MA 3SMZA 1GL3A 3ENQA 2Y1WA 5TPWA 2QDKA 1P0MA 3AI7A 3FNEA 3T3MB 1NZDA 5LA6A 4M7WA 2OAUA 4HXFB 1LTHR 3KSUA 1ADBA 3L4EA 3EGZA 1O03A 5DO9A 1DAGA 1KHWA 4YXWA 1Z2PX 3HJBA 3RAGA 4H7JA 4DDHA 1FTQA 1V3RA 1HLFA 4EJ0A 4BMXA 3ENZA 4WXRA 2P1RA 4N9QA 4Q3AA 1JQEA 2B98A 5CLGA 2LKCA 4FOLA 5TEVA 5JNRA 2DQYA 3OKCA 2Z1DA 1XEFA 4N5LA 3M2UA 4JBLA 3J80U 4MHOA 1MEOA 1CPYA 3DCIA 5DDPC 1E9AA 2PL9A 4KUHA 1G8FA 1SKAA 1WOOA 3C19A 2BHLA 2GNAA 1W0JD 4UTVA 2DH8A 4QAQA 1AQNA 3LWDA 4LJRA 2CCKA 2O2DA 5LQCA 2YWGA 3MINB 3KR2A 4KQWA 1C5KA 1JHZA 4AS1A 2SNIE 2BBSA 1RT1A 1MAAA 3VR6H 4ZGBA 2GJIA 3JU3A 3IV7A 4O3FA 4DJBA 1Q1ZA 3KYCA 3L7KA 1HL7A 2ZRNA 5BYRA 1RWXB 5L3SA 2B8TA 4D3HA 1P9WA 1T8WA 4E33A 2ZI7A 4XB1A 3TSWA 3G5UA 1HR0F 2VDMB 2ATCA 2OBFA 1VB5A 2IHKA 3F2VA 2H1HA 3AVTA 3VZPA 1V9CA 1TUBA 1QBKC 4X62J 4WFIA 4Z7OB 4L1KA 2QE7D 4MVJA 5DCWA 1YQQA 4ARSA 3AY7A 4DJFC 5KT7A 1G1XA 3H84A 4XFKA 4ZT2A 3W61A 5EKDA 2HWWA 5BSTA 3EDCA 1FDUA 1K5DA 2JH3A 1R5NA 2OTLS 3K0KA 2Z8ZA 5FEMA 5DMXA 2IC3A 2R8GA 3T1NA 4BO2A 1UCNA 1SH3A 3DLKA 1SOAA 4CEIB 2BW2A 2VJCA 5B57C 2AW5A 5M2RA 4DSEA 3SC3A 5ECWA 1NHUA 1UZDA 1AUOA 3EOZA 4PC7A 3GRFA 1AQIA 4MRAA 3UJCA 2Q5IA 3QI2A 1OZGA 1PS0A 2JLZA 4PF1A 1SPBP 1GNQA 1ZWLA 3ZTOA 2FPUA 3AIMA 3DB1A 5DIFA 2HHAA 5KFGA 3K0BA 2B2NA 4N6GA 4MS4A 5DWQA 3M32A 1ORVA 1L1QA 3L9XA 3RJZA 3BBBA 1D2NA 2EXXA 1HWKA 2IZ1A 3PS9A 2XNQA 1EKRA 3GEPA 4DC0A 1IRIA 3CMAS 4UHEA 3C74A 2Z95A 1K6MA 2FW6A 4QOIA 4PHCA 1NNDA 5M3BA 3D6UA 1SQ0A 2WFLB 1R6XA 3MCMA 1VGQA 3JAWA 3Q10A 3Q0EA 2DTDA 1EM6A 3NP7A 1TYCA 2P9ZA 1D6JA 3HO1A 2NQ8A 4UZCA 3RUBL 1VJ0A 2ZHAA 1G6OA 5JS8A 1G7CA 4MUHA 5IVKA 2EW9A 4PGHA 1ACMA 1NZFA 4LUCA 2PRZA 2POKA 3IVMA 2EF1A 3M9NB 1L4KA 4V19X 3TG2A 4C6AA 2V9ZA 1JUDA 1NVAA 3PFEA 2W58A 2W9BB 3B3JA 1Z28A 3PKZA 5CXSA 3L7NA 4Q93A 2B36A 3KKMA 3MEGA 3IDFA 3TAXA 2WF7A 1XNQB 2WBMA 1UMBB 2I8EA 1XD9A 2KN4A 4QWBA 4IDNA 1H6CA 5F76A 1CHNA 4L28A 3NAMA 2NTEA 3P2OA 1QO0A 4PQYA 3CCBA 5ALQA 2ZRPA 3MIIA 1NW5A 2FWRA 4JR0A 4WIQA 2WIFA 5DH9A 3D6VA 1UVKA 3LM8A 3UWDA 4CKEB 4WK1A 3WGMA 1RLUA 2P41A 4ZA2A 5FOSA 1A77A 1PJTA 4RJ2A 2EFNA 2IRXA 4B5LA 2ZJYA 3POTA 1Y7PA 4YAKA 3LQRA 1QFMA 3RRXA 2ORWA 2CZ9A 4EKGA 2F8SA 2VFTA 4RF5A 4YMVA 4IOJA 3MM8A 1FFDA 1HLGA 4IQ0A 5T7BA 2JGKA 2ZTVA 2VYQA 2JEFA 4ZEWA 3D7NA 4EOGA 3R9XB 2SXLA 2D62A 3FGZA 4Z4IA 3B78A 2ZHBA 3KEQA 1JEOA 3ABSB 3P8ZA 5B6IA 1H85A 3U7QA 2BJEA 4OYBA 2I1WA 4XWAA 3V2UA 1M6WA 2OSVA 1UPUA 3NTVA 4CLUA 2BEFA 1OI7A 2G9VA 4TWBA 4U02A 3ROEA 1T3GA 4W99A 3X1JA 3FHCB 1SKUA 5FNVA 1OPRA 3RK1A 1RTHA 1HBUB 1RE1B 3LTOA 2O66A 1P91A 1MT3A 3F3KA 4O3RA 3QVWA 4I5FA 3GBPA 4I6GA 4B3IA 2W5UA 5K8UA 1DPGA 3GCDA 1YTLA 4BN4A 1IG0A 2OM2A 5CYQA 2K7JA 3GE9A 4WKCA 4LF5J 1E79D 3VNRA 2ZYTX 3M30A 3U1NA 4JV5J 5CCBA 1W4CA 1YA4A 2O5DA 5I01A 1WSRA 3QWUA 3IQFA 4E08A 4ZPTR 3E0XA 4DLPA 2HSEA 4E5KA 3CEPB 1U0BB 2NUBA 1K8RA 2NADA 4ALMA 5B4UA 2OUIA 1JJCB 2VSYA 3EISA 1LI7A 1NF8A 4HUJA 2HXGA 2K2PA 5HL7Q 4C4PA 4XCVA 4P10A 1FDDA 2FZCB 1RC0A 4LSMA 1WB9A 2FUG6 3CB2A 3VYTB 1V3VA 4ZS6A 4XGNA 3RC7A 4JFRA 4Z3OA 1UH5A 3JR3A 3G2OA 1PQ4A 4JDUA 4Z0HO 1AB5A 4MV5A 3W77A 3AG5A 1TV6A 4ZPCA 2KZMA 4D46A 1GLVA 4W9MC 1J2JA 2J3JA 3N05A 5KG6A 2YHAA 3HI4A 5CB6A 1FRIA 4KK3A 2AL7A 1R3NA 4IHAA 3RRHA 3UE2A 1JE1A 1KLNA 3J81k 2WMNB 3DFUA 3DA8A 2E9TA 4A26A 4LXYA 4XEHA 5DM0A 3R5GA 3ZKWB 4OHUA 3R76A 4Z7JA 1BD4A 1N3YA 3PJ9A 4X64F 2ACVA 3WLFA 4S35A 3KYCB 5FD1A 2FPPB 2KM1A 4EJSA 2IWRA 4P84A 4LFCJ 5C25B 4UKDA 3SP1A 1V16A 5ED4A 3WKCA 2H65A 2RH9B 1VG1A 3R2CJ 4DLBA 5AFSA 2O19A 1ECLA 1P5ZB 3GMGA 2JIMA 2WV7A 4NMWA 3DBRB 3K8WA 3PENA 3HJNA 1WCWA 2CCGA 2EF0A 2FSIA 2BFMA 3JAKB 3KHGA 1ZCZA 4IYJA 4C8KA 2H4FA 3QPIA 2WJHA 5CH5A 3KVNA 1TT5B 2ZE5A 1U9IA 1C9MA 5I9TA 4D8VA 4CO5A 4DL4A 1VYUA 3FGPA 3QBJA 3LKVA 1NXIA 1N36B 1WHTA 3LHSA 4WADA 5C42B 3I83A 2CJ9A 5BUQA 2D74A 5BN4B 4OK5A 2JZOA 1SBQA 5DNAA 1O87A 3H6HA 3RKSA 1X7YA 4UTZA 3PC3A 4DR4F 3VOAA 4CPDA 3E9YA 2GTIA 4LK2A 1HYEA 4PPGA 1RABB 3G59A 1UKZA 2HV9A 4EO7A 3EZOA 2WSSD 2XA2A 2CXXA 4Y9DA 5EYPB 4OJYA 2W9AA 4PHHA 1S1VA 3RV4A 2Z3WA 5AJZA 3NMUF 2KE5A 3SAJA 3QPBA 2BGLA 3MWKA 3T52A 3FRHA 2X9GA 1VIDA 4NECA 2M2IA 1K92A 4LZWA 4ZQFA 2O0HA 1BYUA 1Z2ZA 3PQ8A 1MJGM 3IRVA 3KDSE 3ZC4A 5TQ0B 1X5SA 3THWA 1ZJYA 4NENA 2ZAMA 2RC5A 2J7UA 1KJJA 1U1QA 3BTVA 1QWSA 4UUMA 1FP1D 4FF4A 1NZJA 4HI1A 3G2XA 1ZOTA 1NULA 2C2ZB 2AR0A 1RKIA 4BMSA 3LA0A 2BHSA 4JL5A 4G9GA 4JBXA 3OE7A 4RU9A 4M4SA 4EB8A 3GP9A 2QJTA 4U7UK 1C3XA 3UWTA 3HU3A 5CX1B 4XQ0A 3KZMA 2VHWA 2VT3A 2D9PA 5BXIA 2QF7A 5DXAA 1QOQB 2DTEA 2EG9A 2DGOA 3CINA 2ZM6B 2YUTA 1T8TA 5HM6A 4X64J 3VPXA 2FY8A 5A3QA 4UD6A 2X0EA 3L40A 3IP0A 1OTHA 3MF5A 3EH2A 2OUKA 1U6BA 2PWZA 3ZDQA 3ORFA 1UW4A 3PLRA 5CMLA 1X4EA 3TOSA 2HT1A 2O07A 4F3CA 3DI6B 2FV8A 1ZAXA 3B5EA 3CXRA 3ETMA 1M2JA 3SMQA 1Y3KA 2GRAA 3LSTA 1NQTA 2RDDA 3X43A 1LQ9A 1EUCB 3ABZA 3SKYA 5T8KC 1K08A 1GTMA 3MCUA 3OX1A 4FB4A 2P90A 2SCUB 3CVUA 4OV6B 1JG3A 5JNVA 3VU9A 2DIUA 3G6VA 3S81A 2WTUA 3TA2A 3PUXA 3EVCA 1F0YA 4AJOA 1AX9A 2W9CB 3DM5A 1UVIA 5DMHA 2QIOA 4TMYA 4FOTA 3WB1A 2G3YA 1DJLA 1ZP6A 3U7QB 1I5RA 3MTAA 4GZLA 5AVJA 1OZHA 3LGHA 4CKYA 4OLBA 2RHHA 4X00A 5K8NA 5AK5A 4LF8B 1JHXA 4LZLA 4MUGA 4PANA 3WB2A 3QLEA 5E0KB 4AQ7A 4P1ZA 4HLUA 4K6FA 2XZDB 3F5QA 4MIOA 2MHNA 1KJ8A 2JF0A 2WOMA 2V6AA 1T2AA 3GPDG 2IYGA 1ORHA 1Y4ZB 1WEXA 3C16C 3RRNA 1ENOA 1H66A 3CYFA 3WYCA 2H1LA 3HB0A 3OLYA 2CG8A 2OD4A 3OTOJ 1UBJS 3G9ZA 2A9RA 3R3WA 4G26A 1DQZA 3WMGA 1H6BA 3ZTPA 4IDDA 2XB2A 1U7TA 1YU9A 1ZITA 2Q9UA 2AQ4A 1Y4DE 1JN0A 4M5GA 1ZOPA 2B4UA 1RP7A 2PBFA 3LYLA 2W6ZA 3IUPA 5IQQA 4UNQA 4N5HX 3ZWXA 4IOKA 2E7XA 4ZHRA 4J1TA 5KAMA 4MCJA 2OCLA 4JL6A 2QVLA 4TRNA 5K9ZA 1GGNA 2GPTA 1JU3A 3W6NA 2HIGA 1JX6A 2P6OA 5LSRA 4GLLA 5JYCA 4K9DA 5A8WA 1B99A 2B8EA 1K44A 4GRAA 5C81A 2MWMA 4X4VA 4A0GA 1YZGA 1KTQA 1WXWA 1XWIA 4IR1A 4B6FA 2AR9A 1RFGE 3WA6A 3EA0A 1JKHB 5IARA 4XUDA 3CDUA 2P9GA 1H9AA 1E0JA 1PGNA 1SZJG 1L1EA 1I7DA 4PTLA 1DBDA 2I2CA 2VP2A 3B60A 4UUWA 2XUJA 4XPEA 3W04A 4DR4B 4LBYA 3IBFB 1GA4A 1IBMJ 4K26A 2QRUA 1J8VA 4AWAA 3OM9A 4DV1J 1HZZC 4OGLA 1XK6A 3CDAA 1NVTA 4NF2A 4AJ4A 3SFGA 1Y6QA 3NS7A 3UK7A 2FUKA 1LSUA 1PK9A 2CUKA 2XHEA 2EGHA 3D2BA 2GFHA 3AFMA 3R8XA 1E9VA 1BG6A 4BNLA 2A2CA 3N5BA 4BV9A 3LLCA 2AW0A 4CLYA 3O9VA 3K20A 3N6LA 3B2NA 2BR4A 4C04A 2XKKA 2IEGA 4V1CI 3DYAB 5KTTA 3B1KA 2VH7A 1P3Y1 1PHPA 2REQA 4GZMA 3BWDD 1T7PA 1C4CA 3DQPA 5BMVB 4BDPA 3CJ3A 2VSXA 4OL9A 1H7XA 5A6VA 1A7AA 3BB5A 2M9MA 1I2MA 1NHGA 4NMXA 3PNSA 2XZTB 4DYVA 1LI5A 2XB8A 1YRUA 5JMPA 3TZYA 3TANA 4OKSA 1CKEA 1Z3IX 2BCEA 1D1QA 3DM2A 1M34A 1ZUNB 1NURA 3R5CA 2FMIA 4EPYA 2F4FA 3DOKB 2CF6A 2X4GA 3PNBA 2VJVA 1XMPA 4G0WA 3Q7IA 3SJAA 1A76A 3DZJA 1BX1A 3GR6A 2JFGA 1W9MA 4HWTA 4KZPA 3WO0A 4EB0A 4OHXA 4S0ZA 1I3KA 1PDVA 1IOZA 1G98A 1Y3CE 2HFZA 4CDRA 3NKYA 3OXFA 1P4HA 3GLJA 4OHMA 1RRPA 5T4FA 5C8XA 1U0HC 1ZM9A 3WFJA 1VHQA 3LAWA 3T7EA 5AVKA 3I0MA 4MVJE 2BSAA 4OAQA 3H8WA 5MLCV 1G8KA 4PSUA 2VJQA 2HNDA 1T34A 4GYKA 1U6FA 5A4IS 1MU2A 4FJ2A 3T3OA 2AK2A 1XZGA 3M6AA 1OFUA 2XA9A 2CMDA 5CX4A 1VRVA 4IRDA 4YMUA 4WE1A 3PVZA 2CJWA 1RM5A 2OGZA 3WC4A 3MIZA 4KAFA 4JLWA 1H8ED 5EKSA 1ULBA 3ODPA 3ELDA 4FS2A 1CERA 3WY9A 3FNNA 3MRTA 1O6GA 1VDMA 2XVXA 5IM5A 1NUPA 1UKUA 3AFGA 5L3QA 2HYIC 3PFKA 4R2XA 3VAZA 5KYWB 4DWJA 2EOAA 4M98A 3ILSA 3RHFA 1FJ2A 1R8QA 4KRGA 1QNFA 3P9YA 5IDVA 2KLBA 5BYBA 3LO8A 1UPBA 2XYHA 4MVXA 2Y1CA 4WRRA 4AXXA 4AX8A 4TKMA 4J2HA 3RHSA 2YV4A 2VONA 2P68A 2WUDA 1KO4A 4CH7A 4X3PA 2OCPA 4J0FA 2M98A 5KEIA 3LJKA 3HCXA 4PBRA 4ZHQB 4ZJZA 1PJ5A 3EWGA 1L3BA 3HS3A 3NBKA 4RIHA 1R4MB 1BLUA 4FF2A 4CHGA 3FZGA 2IZ0A 4DHWA 2YIDA 3DLEA 1RI4A 2R7TA 4S1WA 2BKAA 1XRLA 4Q39A 2RJNA 4AROA 4QC2A 3EGVA 4WZBA 4KOEC 2CADA 4GDMA 1FT8A 4KXWA 3FFIA 4HWKA 3EWAA 4LQCA 3FVYA 2W42A 4IIGA 5JU6A 3QX7A 4J1NA 2H9IA 2FW7A 1WV0A 5JARA 2V7TA 2TMGA 2O8FB 1E6CA 4TRJA 4DANA 4CIDA 2NYAA 3Q9SA 1J9EA 3DAHA 3UMFA 1EWTA 2QTMA 3FTPA 4H9GA 5A0YB 1NJ1A 5HBMA 2WD7A 3HSYA 1XR5A 4ZYXA 2DB3A 3AESB 3O2IA 5EPOA 4ID5B 4ZP9A 4QEKA 4B3RB 3JAMA 5EVCA 2WJGA 4RKEA 1NXVA 3LY8A 2AE2A 1G21A 1WP9A 4H77A 4LJMA 2QV7A 3DFIA 2W4DA 1Y3FE 3K53A 1P1JA 3BILA 5AKXA 3N5KA 3PIPQ 4Y3UA 4HC4A 1KAEA 5F7XA 2XLKA 2JFDA 1MGPA 3WZLA 3R5AA 1TTQB 3T5KA 1T0TV 1D8ZA 4X4OA 2HZBA 4X1YB 2XCTB 1RW4A 4MPRA 1EGMB 5BQ5A 2RI0A 1ZH5A 1L5OA 3G0DA 1ZSYA 1T9UA 1VYVA 2OC9A 4LECA 3AF2A 5JTTA 2W2PP 3ITHB 2Q7OE 1RHRA 1W2BR 1Y63A 2HQFA 4OJMX 5IAOA 2J9GA 4K4YA 4WPAA 3KDPA 3ND8A 5H83A 1GAQA 1SXJC 1IZ8A 1U5AA 1V45E 3U4HA 3T5HA 2AGOA 2FW9A 1D6NA 4R2KA 1IAQA 4GRDA 3H2GA 3K9NA 4I55A 1BN7A 5HUHA 2DHXA 2GPWA 4CFSA 2QNRA 2D54A 1RHUB 2Z5VA 1J90A 2WPDA 3QHPA 3FDFA 1JVNA 4L3OA 3ADCA 5K05A 3KUGA 4KX3A 4A82A 2PKWA 4IJWA 3KSAC 2VNIA 2P3SA 1X87A 3MJDA 1WC0A 4W7IA 4DDUA 2RGAA 3DP9A 4B3OA 3UAGA 1DIHA 4C0HA 4ARCA 3FTCA 3O8BA 2YN0A 4UPEA 2VP6A 3WXMA 3K9LA 1RJ9A 5DFAA 5AHKA 2VWPA 4I08A 5KNBH 1BCSB 1DZIA 4IZIA 2HJ9A 1PWXA 3VNSA 4HJRA 1ABBA 3IQWA 2QYGA 4JMLA 3SXPA 3HBJA 5AJWA 3H1GA 1UKBA 1TU3A 3TVTA 4K9PA 3QVUA 1LDGA 1IYZA 4YQYA 4W82A 5G41A 3GILA 2VF7A 1BEEA 5FPQA 1JLEA 3AOCA 1KBOA 4I9HA 5TT0A 5G0RA 2DFPA 3GZNA 3FROA 2XR1A 2UXBF 4RKQA 4BP8A 4FDAA 1YT5A 3FMPB 3HGMA 1YI8A 1G5RA 1LVUA 1DKQA 5IJ9B 1BYIA 5CIQA 4KFCA 3U1LA 1CP3A 4EUVA 4I0WA 2YWXA 2G4BA 3BCUA 4H4MA 5EEGA 4M7PA 3AHIA 2YJ3A 1PL8A 3QMPA 4P0QB 3CWJA 2QW1A 2BGUA 4D6PA 1DX6A 1P8JA 3O4GA 1E3SA 3GB0A 3J7ZT 3NUQA 1EVQA 4PZ0A 5JYBA 3KOWA 1CC1S 1D2AA 1J23A 1IQZA 1EG2A 4MH8A 4BNKA 5AI6A 5AOCA 3NGDA 1M5HA 4E5MA 1RMYA 5LSOA 4QXPA 3BIOA 5FBRB 1F4VA 3W6UA 1ULZA 5AT1A 4FFNA 1B7YB 4IDHA 2BTOA 3SM3A 4MZXA 4WLUA 1CZNA 3M8PA 1WTCA 3V32A 2GD2A 1H22A 3RSLA 4OHRA 4TLQA 4EY4A 5LZ7A 2O7VA 1IR2A 3IR7B 1QH8A 3KFXA 4PYQA 2M3DA 4QUKA 4ENQA 2VBWA 3WDMA 4R51A 4UOHA 4RK1A 5ICFA 2OBBA 4JC4A 3UAZA 4YMEA 3WYDA 2PL5A 4O4GB 2X0RA 3A9UA 2I67A 2HWYA 1PJZA 1YJVA 3BRSA 3WB9A 2GHRA 1IBMF 4R54A 3IDZA 2HJGA 1M76A 1RU3A 4KGVB 3H5XA 4DYDA 4FZ3A 1J5OA 2QX8A 5KAKA 4ZK7M 3D28A 4ZCMA 1DJQA 1JHUA 1KNXA 3MFHA 1X9MA 2OHFA 4UDNA 1IZZA 3JASB 3BL6A 3GFBA 1ZOLA 4Y0AA 4MEAA 4ZZ1A 2JVJA 4KN6A 1F8XA 2BJVA 3QMVA 4R0MA 2ZYWX 2HFOA 1G38A 4QT0A 3HBMA 3NTOA 2DKOB 5IN5A 4QIGA 4PBTA 5KKCA 3AETB 4X92A 3H59A 1B14A 1E62A 1U3VA 3NOGA 4US1R 4MIAA 2ROPA 4ED7A 4Z8YA 1CNFA 4WZMA 1N33F 2W8ZA 4UDOA 4F8YA 2P9BA 4YJFB 4A4DA 1AZSA 2QAGA 1DLOA 4YHHJ 1COWD 1W2HA 4JI4F 1ZJWA 4IR9A 2TYSB 4Y2YA 2V5VA 1FFSA 1VJQA 2YMMA 2PIIA 2YC4C 4UUBA 2H51A 2XKJE 2ABYA 2NYIA 3HB4X 2N42A 5SUHA 2XMGA 2OHIA 3J81j 3MLAA 3F9RA 3NDIA 4CM8B 5ALDA 4JI3J 5FBKA 3EGDA 2PSDA 4MKRA 4QZVB 3OE5A 4ABYA 4NDZA 2DR7A 1QSLA 3SHTA 1K89A 3ZHOA 4MYSA 4HT3B 1K47A 4F4AA 3EF1A 1T6BY 1KP3A 4EEZA 4WX2B 4E2YA 1SC3B 3AL3A 1ZFNA 2MR6A 3VDNB 1WWHA 3KOUA 2H29A 4PHFA 3DT8A 2I3AA 2AU0A 2ICAA 3Q1KA 2Y1XA 4B3SF 1FXWF 3T1QA 1GEGA 3JD0A 2X1AA 1TK5A 4TVBA 5CFRA 4A23A 1KR4A 4ZYYA 2W7AA 2I29A 2PXXA 2MMYA 1N6PA 4LMPA 3FG9A 4IUCS 3QENA 4RWEA 3TBFA 3P6YC 2ZRMA 2XDYA 1G16A 1B64A 3QT7A 221PA 3A4TA 1KQFB 3A1UA 4N0QA 5JCZA 3K8VA 4LTDA 4NA2A 1QH0A 4O4IB 3TD9A 2N3OA 1A8HA 1HBJA 1PWYE 2XE7A 4GQAA 4KJXA 2HQGA 3QW4B 2PPLA 4RW4A 4O8CA 4GKKJ 3R0ZA 3WIDA 1K06A 3OPXA 4CL0A 5T7LB 2IUYA 3CGGA 1ZSNA 3OV7A 4TY8A 1N7JA 4RZ3A 1OC4A 2CPHA 3PHLA 1X42A 3NAQA 2X1FA 4N77A 7MHTA 2FJBB 3P9ZA 1N0VC 5JI2E 3SC2B 2NUHA 2Z30A 1Z4MA 2ID8A 5HFAA 1Z2CA 3PO5A 2IDMA 1YDMA 4TV9F 4M60A 1EXMA 3OO0A 1CVJA 1NYRA 3T3DA 4M5JA 2OYSA 4Y3CA 2L42A 4YCMA 1PAEX 2Y1FA 4YV2A 4UREA 2K3IA 4LWPA 3H13A 1G7CB 1QE5A 2RB7A 3LWMA 3IV6A 2EX1A 2F9DA 5BW6B 4ZHQF 10MHA 5BQ3A 4DQPA 1N2SA 2VHYA 3L0IB 5THKA 5DBFA 3GTYX 2ZSDA 4IMPA 5FB3A 5HS6A 2FQ1A 2DXFA 4JJKA 3T06B 2IYAA 2W93A 3VNAA 2IKSA 2YIMA 3PWTA 3ISJA 1ZJZA 2FX3A 1QOZA 2MKSA 3B8HA 1F60A 3L7OA 2PKQP 2FVPA 3FDZB 4IDAA 2ZRBA 1EQUA 1WTFA 4X1IB 3ICVA 2OLKA 3NJ8A 1JA0A 2V4ZA 1JKIA 2R7WA 1IZ7A 2M8DB 1NYLA 5C5JA 1FSGA 1IULA 1EZZB 2CEAA 3RIMA 3FTEA 1RXIA 1T24A 2O2SA 5IKEA 5JFGA 3NATA 4G63A 2MSCB 4UAJA 2XODA 4Q21A 2OMKA 1BD3A 3ER8A 3TZHA 3PRVA 3FPHA 1E9SA 3H3FA 1I5OB 1Z4UA 2GFFA 2VZ0A 3OKPA 2I4RA 1NU8A 1B8PA 1ULUA 3ULKA 4G4SO 4E6EA 3TIFA 1G4UR 3CW9A 3PWZA 3HVRA 4LYYA 3K0CC 1KI3A 1IXSB 2JLQA 3HJCA 2ZFHA 2OK8A 5F2KA 4B9SA 3W79A 1IHOA 4ZZIA 1KJYA 1A8QA 3G2PA 5E4TA 4KB5A 4DI6A 2HM7A 4BGEA 4K2XA 1JLKA 3ASVA 5K8OA 2NPFA 3R7WA 4B9LA 3H4DA 1YS4A 2H7CA 5E7OB 3GD5A 4II3A 3S5UA 2J46A 4NG4A 3L6UA 1X7WB 4XUGB 1QAOA 1F48A 1C2PA 2RGWA 3JQ9A 4LE1A 2ALJA 4JOBA 2C5HA 2WSFC 1HF3A 3OICA 3H4BA 1JEAA 4AT1B 1RTHB 3GIDA 1XTBA 3GROA 2Z08A 3SE7A 4YHHF 3HUDA 2ZR7A 5DBIA 1JHQA 3F73A 3NHSA 4AJPA 4D97A 4RUCA 2XNDD 4WESB 2VA2A 3ROZA 1KP2A 4K8RA 1E0DA 2AZMA 2MSLA 2NZJA 3D59A 3UMBA 5C2JB 2WSBA 4KXXA 1B15A 1ESDA 1XNRB 4XKJA 4C4ZA 1HNWF 2P6NA 1U8FO 4TZKA 1RHKB 3IRXA 1M34E 3DLAA 4IQMA 4Q3EA 3I87A 3EA4A 2VYCA 4OV1A 3L04A 1Q3KA 4Y2GA 1KHHA 4MS3A 2Q1YA 2WHYA 4K3VA 1GR1A 3HADA 5D5PA 2J76E 2G71A 1JNZB 3KG0A 5LM7E 1OASA 3FNQA 1XZ8A 2O7SA 4DOMA 3D5QA 4UATA 1TYBE 1OBHA 3Q2IA 5K3DA 1RYEA 1VOTA 2N7YA 1KVQA 2LA6A 2OVBA 3BT7A 3I8OA 1C7FA 3SS9X 4CUZA 1JGTA 4TYAA 1OIWA 2YJ4A 3COPA 2BZ2A 1PTKA 1T13A 3I76A 2WB2A 1L6IA 4MFBB 4I2PB 2YWEA 3EK2A 1YJ8A 3UFBA 5B2FA 2MU1A 2QTNA 3GBSA 2O05A 1R3UA 4EYEA 3PTWA 2FW0A 1GMWD 2ON6A 1F8YA 4J9SA 1L0BA 3IA2A 2BGJA 1W35A 5DGIA 4KRYA 3GVHA 3VWSA 2V4QA 1WBJB 5HK9A 4OM7A 1C9KA 2P30A 3NIBA 1LX7A 4OIFA 3WG9A 5F8GA 5BSWA 3V1TC 5DI3B 3OJFA 1KORA 3FZBA 3QXCA 3AO0B 2X3FA 1NE2A 2Z58B 1RDFA 3R7FA 1DXQA 3WGLA 3AEYA 1N0IA 2CUTA 3SR3A 2YQ3A 5IZCA 5ALXA 3TZBA 4NYMR 2HHTA 3QFCA 3FCOA 2VU5A 3RC3A 4UFOA 4D4GA 2QRPA 1DIOB 1ZRNA 3MT9A 3T15A 4ZT7A 3S1AA 2HNYA 4ECQA 4PR0A 1PFQA 3GRZA 5A7GA 3IVRA 2ILTA 3P9PA 5BR1A 1KY3A 4I4BA 5HNKA 2NQPA 4BRSA 2GGSA 1Y3BE 4TV8B 1G3UA 1NBWB 4LQ4A 2HNKA 1V7QA 4CYUB 5L3ZA 1VQMS 4ZREA 4LGVA 3HX9A 2OCKA 3ZTYA 1ML3A 1QH9A 2WYWA 3RIGA 4XPCA 3O8OA 3VZSA 1JAZA 5DYTA 3UQYS 4CG1A 3Q3IA 1A5SB 3OLCX 1GEHA 4DR7J 3NB0A 1JNXX 1TVEA 1QTRA 4L0QA 1CJKB 2PSFA 3QGGA 5DHUA 3PVCA 5A3JA 5HANA 3D7SA 2CJKA 1NJ2A 3KHUA 4X1OA 4LJ6A 3EPHA 1XTSA 1MOPA 4RMGA 3AUKA 5K3OA 2FB0A 2HAIA 5U47A 4BC0A 3BMQA 2VTEA 3RYLA 3W1WA 4N5NA 3QVXA 3JSBA 2EJTA 1D4AA 3O83A 3B8EA 3OZCA 5HE8A 2AZ4A 3EW7A 5EKTA 1WHXA 1Y4SA 1C9EA 2QZ4A 1PFUA 1SB9A 2R8IA 3KKQA 4KAXA 3BORA 3G9TA 3D54A 2AQKA 5C1IA 3W4IA 1T1RA 1BFUA 4G23A 5LUAA 4D3XA 2DPYA 5AR1A 1Q20A 1S72S 2FZCA 4EEKA 4OYWA 3P9SA 2CD9A 4RQAA 1WSDA 5KNDH 4M7RA 2RQKA 4RA6B 2HK2A 3MMPA 3PYLA 1QZZA 2ZS9A 4JI7B 1Z6GA 1NNUA 1WB5A 3P5SA 2A9VA 4MLDA 2QB5A 4HDQB 1YZNA 1ZR4A 3SSRA 1NUUA 3TLKA 3IBWA 2NTYC 3HVTB 3C3CA 3PW2A 1HDXA 4QGHA 4ZVPB 1G3OA 4IOMA 5H1SV 3QUSA 4DL5A 2CNWD 1ZC4A 1RZRD 3MR3A 4F67A 4PAMA 4ARZB 3VR1A 4K9QA 3TKLA 3NHAA 3A10A 3RYCB 3Q7RA 4HSEA 3ADAC 1WXQA 3A1YG 1OWLA 1OPZA 1VPWA 4U0JA 3ZV5A 1N4LA 3L07A 4ND6A 1AFIA 1AKNA 3PCRB 4A8JA 5FPTA 3ZC3A 3ZV4A 2MSSA 3JSYA 1XA4A 2C58A 1ODKA 5LYJB 4DV7F 1QYRA 3B6EA 2IYFA 4V0MA 4M38A 4QR1A 3AX6A 4TUYA 1C4KA 3CR3C 1MROA 2OCGA 2ZH9A 2O8EB 3DWGA 1NRWA 3VR4D 4NENB 3BDAA 1MW8X 1UQTA 4K87A 4J6EA 2BZ1A 1AS3A 2FMFA 2FQXA 2QX9A 3WBZA 4Y9TA 4C87A 2PTHA 3W8DA 3D7SB 2ZU0C 5D5HA 4BBYA 3IXQA 1GUAA 3SHOA 1PVOA 2LXNA 1NBEB 4IIJF 2FIUA 2RRAA 5E9AA 4ZALA 3MOGA 3L1VA 2NX2A 3CBQA 5DK6A 2J0QD 1EJ2A 5ICSA 3TW8A 2FDNA 2F63A 1Q1NA 2HA7A 3OTOB 3SI7A 2MYTA 2J1LA 4HK4A 4R8LA 3ZNJ1 1PEAA 2P9HA 4NX9A 4ME6A 4D74A 3LHKA 4U8GA 5DCLA 5K8MA 2DPXA 4Y2SA 1Z2DA 2E0IA 2APJA 4EARA 4ZVUA 4UQGA 1A0OA 4KLCA 4NPHA 1ZX1A 5HI7A 4RD1A 1C1HA 1M8FA 4LN1A 4F97A 5T6BA 3QEKA 4Q6WA 4NLWA 5J2PB 3KT8A 1C7ZA 1JA9A 1UBRS 1L5GB 4DPOA 2IVMA 1LJ8A 5KYWA 3I5UA 4ECAA 3H65A 2D2XA 4BVLA 2WZDA 3DLHA 3G88A 3NPAA 3H5NA 1F0PA 3HJUA 3ZNNA 5G2OA 4L4ZA 4RTJA 1BQXA 1U98A 5D01A 2Z6QA 1QYXA 4WLVA 4J5OA 2FEAA 1BQNB 1NGSA 4R9UC 3NBYC 3LWBA 1U9CA 1T4BA 1QAMA 3O1LA 4CTAB 4EIWA 2F8EX 4GBGA 3ZEAA 4CCWA 4WI1A 3O6VA 3EYZA 3AM5A 5DO2A 4YAEA 4RZIA 3NT4A 1T8PA 3SEOA 3HCDA 2XVMA 4PXAA 2VODA 1RFLA 2W25A 4MVJP 1PHRA 3KZKA 2CVOA 5AM2A 3HJGA 1JFVA 4PE5B 4I36A 1QGZA 1QF7A 4P9SA 4NI2A 1QO7A 1IJEB 3DUFB 1S1XB 4MGKR 4OIMA 3OIYA 1AQYA 3FC9A 1G17A 2QL7A 5TPZA 4FKBA 1FA9A 4JJIA 4KACA 4GNKA 2H5IB 5IULC 5AICA 1U3WA 3ZEIA 1G55A 2EZ4A 4XIFA 3GJRA 5CFOA 1KEZA 4KYUA 2M0GB 4NYPA 5DGHA 2C2GA 4KTVE 1PGPA 3T1YF 3A8JA 4WJBA 1XVAA 4EO9A 3QYAA 4KBGA 4M63A 4Y9RA 4BEVA 1X5PA 3KAJA 4NFHA 2R1ZA 1XC7A 4B74A 2EKZA 1IN6A 2J9EA 4LVCA 3S28A 1X9HA 3OEED 3D2LA 3BDVA 2WF9A 5HPYB 1XXLA 2CFRA 2FKAA 1OPIA 6PFKA 5SZIA 5HAOA 4MCHA 1TO6A 4RKFA 2BPOA 2QVXX 3DBHA 4DLTA 2H1IA 2BJ3A 2BE9B 1FLVA 3ZIDA 4ZU1X 3LGMA 1XD2B 3SQWA 1NASA 1TM5E 2ACEA 4FHFA 4CLZA 3Q7SA 1X38A 3PNMA 5F8LA 4QG7A 1HT0A 4JQYA 4R1MA 4JP8A 5C7YA 4NJOA 3TIIA 3PR2B 4ZQBA 1UANA 1GXUA 3F7MA 2QC3A 2WC1A 3EVNA 3RW9A 2JFHA 2PAFA 3G1UA 5TQ2A 4CHTA 3M8ZA 1T1EA 3Q5DA 2QQ0A 5KJCA 5M7EA 4LDNA 1HNZB 2QUBA 1HD0A 1GH8A 2DWQA 4DBLC 1E1RA 1CIJA 5LZ8A 1Z45A 4C30A 3GIJA 4MWBA 1PUJA 4GKAA 3AUYA 1HEIA 2MSWA 3QVSA 2VAPA 2W6CX 1FNDA 4YRNA 2P9EA 5C80A 4NICA 4MRSA 3EPLA 4KSCA 2NT3A 4DN0A 4AF7A 5E1OA 4ETNA 3DNMA 1RYHA 1OKKD 3AHJA 3RK4A 2CW5A 3WDOA 4PCVA 1ULTA 4FLFA 1QJCA 3KELA 1CBUA 2JJ8A 5D1NA 2Q4TA 1R0SA 4YAGA 1YONA 4ZDWA 3CW2A 5JZOA 1XD2A 4C8YA 4UOCA 3F4KA 5GOTA 4LRCA 3OJXA 3L4BC 3CUUA 4FXDA 4I3GA 2UZIR 3F8WA 3CE8A 3UJNA 2OV3A 3EQ2A 2JZ5A 3D6HA 1GV0A 3LBNA 1V8DA 1RYBA 5E2AA 1ISPA 1RRGA 4TYNA 1RJJA 2C96A 2FJVA 5B1HA 4BMYA 2WFLA 2HCTA 4EJSB 5YASA 3AD9C 2YCBA 5E3IA 3PDNA 2OXEA 5DCYA 2YTCA 4A6XA 2CVFA 3TEGA 1AKYA 2I4LA 2NQTA 2WAOA 3ESYA 5FIUA 3VTIA 3ZY3A 2YX4A 3O21A 1D9XA 2CQDA 3ILJA 1E5TA 3OQ6A 1RNLA 2C54A 1U02A 2FZ5A 4DDKA 5CITA 3TS1A 4OYZA 2GXUA 1M8KA 3HJRA 1T6XA 4MJKA 2OGUA 2DO0A 4IDPA 2A3JA 4IQXA 5AYVA 2X6QA 3NYQA 3PFHA 1GQ2A 5AMXA 2HK8A 1QGUA 2VJLA 2ZRQA 5MF6A 2B82A 1YJNS 5A5GA 3O3LA 3B51X 4ENVA 1HNNA 1SIWA 4D3GA 4WA8A 4RVDA 1WSAA 3Q2KA 3TZKA 4W5HA 1RBAA 2X9VA 4RNOA 1PC4A 1H5UA 5TIIA 3KLIA 1Y0HA 3ZLVA 2ZVIA 1C8BA 3SDEA 1TFRA 4XIUA 4IKEA 4DNQA 3PEUA 1S8AA 3PWKA 4B76A 5CP8A 2H7XA 2FFAA 4IEFB 2WB4A 4IVRA 2NUTA 3O5TB 5F1KA 1TM3E 2ZD1B 3WP0A 5AQEA 4CNZA 4IUBS 1Y3AA 1MFZA 2WG2A 2OPSA 5L7TA 4YVFA 2R4UA 3R0QA 4ENOA 3OTBA 1JJ7A 1Y5LB 3KTDA 4UM9B 4NZPA 1XEWY 2YNHA 4DLZA 4RPFA 2MQNA 3QVTA 1QVRA 4PNEA 1YBVA 3V8RA 4QPNA 4TYWA 4PQAA 1PN3A 3SLRA 1YCGA 1PQUA 3BE6A 4ND7A 3SIXA 1E2FA 2R87A 4QU6A 3ZE1B 1CF4A 3TZ6A 3UW1A 2HMTA 4MRVA 1QQAA 4HDSB 5AT1B 3RUHA 2OQRA 4Q1AA 5FOUA 4REOA 3WIOA 3PWSA 4WACA 5EMKA 5G0UA 3BH7B 5JY6A 3NALA 3LZ6A 4W4TA 4FZ5A 2BUBA 3P32A 3S68A 1CULA 1OREA 1H69A 4WBNF 1NXPA 3PUJA 5BP7A 3CVWA 1YS6A 2XCSB 4EGQA 5FWDA 3NVMB 1LQUA 4CLXA 3U2QA 4IRUB 4UUOA 5EJGA 2L48A 2AZDA 2O5CA 4X65F 2W2KA 3O4JA 3VDQA 3KJNB 5LQRA 4MI9A 3UWOA 3GJSA 4KWHA 4HQFA 4WCFC 3T9AA 3IAS6 3JQCA 2VUGA 3CJ4A 3OZXA 4LJAA 4YJGB 2DEUA 5EXDA 4JUDX 3RS7A 4LQDA 2O1XA 2V4MA 2Z2JA 3V4SA 4DABA 4EVRA 5DRKA 2GZAA 3HCEA 4CNYA 3NEKA 4OJGA 2VKRA 4HAYA 3QATA 1PF7E 4DMGA 1KFKB 1YQHA 4IIJB 2O3JA 5J3JA 1UPTA 2VLBA 2E4XA 5JSFA 3KEMA 3UUGA 1R8PA 4KGDA 1I80A 3AR9A 4Q45A 1X7GA 3T5MA 2Y0BA 1KK3A 2YNIB 2ZG6A 2ZAGA 3LTEA 1ZGAA 3B3AA 3IVXA 3UO8B 5FLXU 3EM1A 1LEHA 4YRKA 4Y9UA 1K8AT 3D5EA 4C06A 2IYTA 4OO3A 3TLXA 1M75A 2I80A 1YUBA 5L3RA 1A4RA 4JB0A 1VL2A 2FA9A 1S49A 2QN9A 3IDOA 2ZYRA 1AMNA 3BGOP 3CJTA 3T5GA 4YAUA 1Q53A 2AC4A 2JLCA 5KT3A 2EX0A 3HM2A 1W48A 3LUFA 4IWNA 4X9XA 1YFJA 2OXCA 1TKDA 3ZXUB 2ERCA 1L5SA 3RJ9A 1KKUA 3VR3A 1Z56C 3KKNA 4UY8T 2C8LA 1NI5A 3AR6A 3PFWO 1VR6A 4RJVA 1QOPB 2FSGA 3HZZA 3JAKA 1EFRD 1MIOB 3A2MA 4M22A 1P1LA 4OQEA 1NE7A 2V8VA 5LZ5A 4MRNA 1Z08A 1D0SA 1R5JA 3EBPA 2VAWA 3V46A 4DIFA 3CTRA 1NJ8A 4DBQA 2IHNA 3RYFB 3BH6A 3JTEA 4DY6A 1S1UB 3U9TA 4S0MA 3QEBZ 5CIWA 3T94A 4QM7A 1U4BA 3ZZRA 1IB6A 3C16A 1Z7WA 4WKPA 5EHGA 3TJMA 4CUKA 4NOMA 3RVQA 3D2WA 4NNOA 1QIEA 4IH9A 4K1XA 2AB0A 4TTIA 4FN5A 3OJSA 4DLXA 1ID8A 3PTAA 2RFLA 4RD6A 5HQJA 3O0DA 2IXTA 3CLSC 2YWCA 1NMXA 3ZE0B 3CJ8A 2IZ6A 4LJKA 5ILQA 4RLSA 1VJTA 4M6WB 5CYMA 4JELA 4TSFD 1LFAA 1Z4NA 4OA5A 4FCVA 2C9MA 3VM6A 2XMQA 3LLMA 2TMYA 1EVKA 4NONA 2DMRA 2EHDA 2HO4A 4YT2A 1QGYA 3S29A 2PA0A 1U1GA 1ZGZA 3OPVA 4I81A 1VRUB 4D8YA 3PGJA 2NU8A 2CHEA 2F4NA 1J24A 1T1IA 1BMFD 4JJFA 3PQFA 3PNKA 1Y8AA 3NS6A 3MEKA 1RWMA 5H3HA 3JVVA 4MKBA 4X4NA 3INGA 1X4CA 4DEVA 4YB1P 3NHFA 1W4BA 4R1LA 5EI5A 2ZBEA 3WQBA 1T4CB 1TX4B 1N5MA 1CJMA 3GDWA 4WN9A 5AM0A 3DMTC 1Y4UA 3NVAA 3HWRA 4DM4A 2MKJA 2OLEA 1Q1GA 4S1PA 5L6LB 1RT6B 3F96A 4J16A 4W8GA 3VDRA 3D1HA 3ZZMA 4ENSA 4C3ZA 3FRIA 3OR2A 2R7XA 3RSZA 5EIBC 4QPXA 3IUYA 2NO6A 5DLGA 2JA1A 3T12A 3I6IA 4OXKA 3ZJTA 3THRA 3GLGA 4YAJA 1X4GA 2PA8D 4O6VA 2YY6A 3BK7A 2BZSA 2WJVA 2CLLB 2C2NA 1ROFA 2J45A 1MABA 1SUAA 5HQLA 4QOJA 3NFYA 2J31A 3LLUA 4MPTA 1YJ9S 3UQZA 5KT5A 5KYGA 4BU0A 3MELA 3HUEA 1P8GA 5B2ZA 4A4JA 4DR2F 2UZ1A 3O47A 5BN5A 4M46A 3ZU3A 3AEUB 3BGDA 2CN1A 2YRFA 3PNLA 1NG1A 3NOVA 1YR1A 1J27A 1UJBA 3PHJA 2WW8A 2GZDA 3F2IA 2E5WA 3MD9A 1QYWA 1CSEE 3IODA 2GWHA 3DT6A 4KUEA 1NY5A 5C18A 2FLVA 4QUHA 2HH9A 4UVIA 3AXMA 1T2VA 2WT8A 2XGQA 4R3UC 1IY1A 2XOKA 4B83A 2LDXA 4ENPA 3KU4A 4NBUA 3KWFA 3VNVA 1BUXA 1QYCA 5JJ5A 1N88A 2LGJA 4A15A 3C3AA 1GGFA 4QTXA 1E2KA 3NGTA 1T0IA 2ZI5A 4FS1A 1S01A 4NNPA 4Q34A 4CIWA 2ZIWB 4RETA 4INPA 3F5DA 1I13A 4DIMA 2HI0A 3R9IA 5IFLA 3KV1A 5CAEA 3R7BB 3CSUA 1NX6A 4V1CB 3R3JA 3UXYA 4QBHA 4X45A 1U47A 2O7NA 5TF4A 2OPQA 3LX6A 3U7IA 5ICGA 1CRLA 1R0ZA 4P52A 2PGCA 5IHPA 1RWWB 4AO8A 1T4DA 2C7QA 3SSNA 1E69A 1KDRA 2KYZA 4RD2A 4EFKA 3ZI4A 2WD7B 5A8RB 4HYKA 2F40A 1CJTB 1V5VA 2XIJA 1ZZEA 2B94A 3VAMA 4RV5A 2IJFA 4ZODA 2X2EA 5EXXA 2N47A 1XP8A 4YJ2B 1WCIA 2DGWA 4X4QA 1B2RA 5BSGA 3OQNA 1M0TA 4JV1A 4AUKA 2X13A 3IEPA 5J2TB 1HEYA 1JZQA 2CFCA 1V37A 5H81A 5KO2A 3A3PB 3C8DA 4M9CA 2WILA 1XCPA 4BCCA 1XU9A 2GK7A 3BTOA 2C84A 4DXLA 4MRPA 3VKFA 4B3XA 3TZQA 1L5RA 2ZUWA 3IEKA 1RQ2A 2GM4A 3AHFA 1L7RA 4KMMA 4JBYA 2AC7A 1D1TA 3VVMA 4ZLNA 4C43A 4YRDA 3MXHP 3X2FA 4PHTA 4MV1A 5GVSA 2QYCA 2BCGY 4CF6A 3MURP 1UM8A 1RLJA 1JG7A 5CT6A 3VBCA 3K70B 2N82B 2W8KA 3OY7A 3ZHSA 4I6AA 5C8DA 4U67Q 4LDJA 2HFJA 1MB0A 2CVIA 4GEGA 1RIIA 1A71A 1POXA 2AD9A 2R66A 2HQOA 5ITVA 2GSDA 4AZTA 4RIIA 4G1CA 3V4LA 2XCOA 2Z4TA 3GSDA 3FRJA 1D5WA 2E5HA 3FJYA 4PUOA 2FZKB 5CURA 2WOMB 1U28C 2CK3A 3FMIA 4TT8A 1VJ1A 3N7AA 6Q21A 4RY8A 2GMWA 1GZDA 4M6WA 4OPMA 5LZ9A 3MMAB 3M8WA 4HMPA 2FEOA 5DG9A 2ZSIA 2ECQA 4Y2HA 3UPUA 1WORA 4ZIRB 1N2ZA 2UZ4A 2FN7A 3UH1A 2O4UX 3MAQA 3KV3O 1IHYA 4B44A 4W5TA 1SXJA 4MWEA 5FLYA 2YXPX 4RZQA 3TQSA 4PYDA 5WRFA 2IHUA 3T1VA 1LRKA 1SC3A 5EIEA 1BJKA 5DBEX 1RU1A 2X1VA 2J4FA 1EUZA 5FNVF 4RNDB 4YYZA 1W5FA 3OQ1A 4HYQA 4M55A 1UEVA 1R88A 4NE9C 4TLRA 3OHSX 1A5TA 3BBCA 3MGAA 5LA6F 3MM7A 2ZUCA 3DKPA 3GV5B 2P0YA 5AVOA 3QQCD 2LP4A 4N6NA 5HVFA 3ZIUA 3VVTA 3H16A 3ANTA 1PW7A 4FBGA 5LMNF 1UPCA 2CBXA 1DBQA 2HK3A 3TD2A 3ZI0A 2CXEA 2Y1JA 4IOBA 1MN9A 2QZSA 3V3KA 5SY4A 4ZMBA 1RT4B 4N76A 1T2EA 4AW9A 1J7KA 5AW5A 1MX3A 5H16A 2HHHB 3IULA 2OORA 3AXTA 3HO8A 4CKXA 3DJFA 3MG9A 3OA0A 4LCEA 1DTQB 2CHFA 1WO8A 2I6QA 1ETHA 3EPGA 1JYFA 1YJXA 3B1JA 3GMSA 4LFAB 5G1PA 2BBTA 4KLRA 1N6OA 4E07A 2YZGA 3LALA 1VHIA 1I4EB 2QMHA 4DZ6A 2DGUA 1HFWA 2V8GA 4X1IA 3N8DA 4IRMA 4UQPA 3WKAA 2OAQ1 5JVDB 4DIUA 4FYIA 1P5JA 2IVYA 1IWOA 2CY0A 1L4MA 4GWKA 2NNLD 4EA6A 2VFUA 4AL5A 3WX0A 2QD4A 3CRMA 3BPSA 5FJJA 4Z3KA 3E7PA 4A0SA 1AUQA 4MUIA 3R3YA 3FQLA 1L7PA 3AFOA 4WFAQ 4ZOLB 5H1YA 4G9EA 2CZGA 1LDMA 2VQEJ 2WA2A 4D9CA 1TMKA 1FBTA 1PI3A 3TNFA 4K2JA 1XWFA 4DV6B 3I55S 1B93A 3D9QX 2QT9A 1F4PA 1YNOA 4BE4A 2BJDA 4CN9A 1HR0B 1JQLB 1RAFB 1NW8A 1TM2A 1J33A 1K7YA 1J8YF 3IWNC 3SZGA 3JAWB 4YA6A 4WP3A 1FP4A 2F3UA 3ZS9A 2ABWA 3PC7A 1LH0A 2O1PA 2QUAA 3E82A 2R4FA 3URKA 1UPFA 1WZNA 4DFJA 1SCKA 2CD7A 3WTBA 4L5YA 3DPUA 1FHTA 1J22A 3QT5A 2P8IA 4F2WA 1HC7A 5GQSA 3LA8A 5C4MA 5KYYB 1EXVA 2DRBA 2PZGA 3DXBA 3C14A 1D4FA 2VQDA 3E8OA 2EW2A 3ML1A 5F23A 1SUCA 3D8BA 4WCFA 2JFXA 3SS8A 5KX5A 2VXYA 1DKPA 1QZUA 3BUSA 4NLVA 1CFJA 3C48A 4LI0A 1G20B 2H52A 5DTMA 3RQIA 3PPWA 4YNBA 4DV3F 1Z7YA 1J2RA 5AKYA 1GUYA 3I8XA 3EPJA 1PBNA 2YNMC 2HWUA 3ZY2A 4ETWA 5K0TA 5DQHA 2Q6KA 4DF8A 2IMWP 4ZMMA 2XMRA 1F4LA 4TS3A 3MS2A 3PLAE 2AFVA 3RS2A 3UB2A 4GXQA 4PPDA 2GO1A 4U8HA 1DC6A 1D2GA 3S2ZA 2X8BA 2CMHA 1U7LA 1PDWA 2FNAA 3GC6A 4P9NA 4ATNA 4L50A 2D1QA 1CIPA 5KFIA 5J2UB 3HH8A 1F9EA 1EUQA 1E4OA 5BUSA 4AJ2A 1QFYA 2CZQA 4GE0A 3D81A 1KOLA 3OTGA 5HIJA 4ZDJA 1AK1A 2W22A 5IT4A 1R6YA 1CJBA 1R8JA 3T95A 3MTDA 3WNDA 4B6PA 2Q49A 4ZRNA 2G76A 4CG2A 1OSDA 1RWVB 2XI4A 4FF3A 4YUZA 3F6EX 3CH6A 2W4QA 4WKBA 4L6CA 3N79A 2FLKA 2J0EA 2UUCJ 4JB2A 1USWA 1U6KA 4I50B 4KSEB 4DG5A 3L4KA 1XJ0A 2P6TA 4KN8A 2JKVA 3MTIA 1VCIA 2BTEA 1RZUA 5EGYA 2HHHF 1DEAA 3RSQA 1ORTA 4I55B 3JPYA 2NP7A 1BMQA 1NJXA 5D00A 1TUVA 1VIXA 2EFCB 3VVUA 2B3TA 4PEOA 4LE0A 1FNSA 4LHXA 3LLVA 1M2VA 7ABPA 3ZU2A 4A8PA 3C3BA 4X44A 3FB1A 4BRWA 1G4CA 5JMTA 5BSMA 1H3FA 3BSYA 3GFHA 4IVNA 1GP2A 5B7PA 4CLEA 4W98A 2FFQA 3CLTD 1K5PA 3O8LA 4W1RA 2DNOA 5D4PA 5F8JA 4L5IA 2KHZA 5KFQA 1MUUA 2WTMA 2JIZD 1GSIA 4GAEA 3U37A 3W4KA 4KLZA 5JPCA 4W1SA 3IWXA 2ETXA 5A4KA 3FVTA 1K5HA 5IXJA 1JAHA 2AC2A 4GQIA 3R8CA 4CKZA 2MCFA 3FYTA 5CNKA 3MM6B 3ZTRA 1N5KA 3FZNA 3I9JA 2QNIA 4X63A 3HNPA 1X7HA 1BQNA 3WYGA 1FS4A 4ZVTB 1THGA 3PHBE 1DNPA 2OE2A 3GRVA 4F04B 3ROMA 1RWOA 2YL2A 3E5RA 3MNFA 4F4WA 4ENUA 3COSA 1MG0A 4D25A 3PQEA 3BO3A 1NA5A 3OHPA 2MZQA 1ZIXA 4Q3LA 3FNHA 1SKQA 2CKMA 2YDYA 3HYRA 4XXHA 1J20A 3BERA 1G2QA 4O4JA 3WLOA 4DUZF 2Y6VA 1XF9A 1NCLA 1FSFA 1UMDA 4DIBA 5C7PA 5KPDA 2QU7A 2D1RA 4JMPA 1MRZA 1O96B 1VJGA 3R9KA 2Y27A 5JNTA 4C4OA 4P71A 3MPUB 1NK0A 4IH6A 1BU8A 3K5HA 1H7WA 1F5AA 3FGVA 3R7SA 2K7ZA 2O67A 2AR7A 4NKRA 1C30B 1IN8A 2DY9A 4YB8A 1DV2A 1VHLA 2IOHA 5KSZA 2K7FA 4ZOCA 5LSLA 3EG9B 1NVEA 3KHKA 3AKCA 3RJ5A 3OT1A 2OP0A 1L4BA 3OR1A 3WL8A 4GOXA 2B25A 3RKRA 3HXKA 1QLWA 3IMKA 3KLGB 4TMVA 4YT8A 4XGIA 2YXDA 1R0CB 4B9UA 4F7VA 2HTEA 2LVBA 1N32J 3VMMA 3OY2A 4BJ6A 2YZ2A 1SJQA 4ZCPA 1U7XA 1SG0A 5H80A 3OD2A 4XTRA 4HDMA 3U4MA 1HQEA 4JXJA 1U49A 4P72A 5JAQA 3V8MA 4RZUA 4FB5A 1O5OA 1KHVA 3IGNA 2CRLA 1IWGA 2GZOA 2RHQB 3JYTB 4GU5A 3AHDA 1H0RA 2MXYA 1RHMA 4W92B 3AR7A 4V0NA 3MVEA 2YNMA 1NKVA 1IN0A 2GCPA 1BH2A 4NYZA 4H17A 2FWNA 4PZAA 2QLTA 4FNAA 4I5IA 1YQWA 1XNRJ 1VCNA 4AKEA 1HFKA 5JECA 1R7RA 3GN1A 3PUWA 3QUCA 1UJNA 4BC9A 1Z7EA 1B1CA 3KNGA 3LXUX 4G9BA 4PZLA 1UBUS 4DEXA 2ONKA 2FPGB 4BBAA 2NSJA 4V0ME 5E3HA 3PX7A 5KT2A 4OFXA 3PKMA 4RPIA 3QSGA 2A5YB 4KQXA 2PX0A 3BHJA 2BKOA 4HH1A 2G0JA 3USCS 3HRHA 2DBBA 2DCMA 1EVLA 2X2PA 1GT6A 3RG2A 3RF6A 3NASA 1DJOA 1KIAA 5BN3A 2WAXA 3EOAI 5JUWA 1C7QA 5CM8B 4QW8A 3RU3A 4URQU 4JWTA 4D3ZA 1Z5PA 1CG2A 1DO2A 2D59A 2D8AA 2E1MC 2Q6LA 2BKUA 1QC5B 5FI0B 1CUYA 1P7PA 6ADHA 1XN4A 3ZDAA 1FXLA 1K8QA 1BRTA 5IBRA 2P91A 5K4HA 3HZHA 2YKPA 1R43A 4QWMA 2BMJA 5H3LA 5E1BA 5A9SB 1ZMOA 4EO8A 4KLNA 3KOZA 1CY4A 2DCUA 3TOVA 1ULAA 4AURA 2ZNZA 1JVSA 2O3DA 2QWXA 3WGQA 3NT2A 1SUQB 1J5EB 3IV9A 4FPIA 1DVRA