3OBIA

Crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
285
structure length
285
Chain Sequence
HHQYVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFMRVVFNAAAKVIPLASLRTGFGVIAAKFTMGWHMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVSNHPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYMQILSDEMSARLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISHRDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVFTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyltetrahydrofolate deformylase
publication title Crystal structure of a formyltetrahydrofolate deformylase (NP_949368) from RHODOPSEUDOMONAS PALUSTRIS CGA009 at 1.95 A resolution
rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
total genus 75
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.10: Formyltetrahydrofolate deformylase.
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3obiA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3obiA02
3AAWB 3DCJA 3MTJA 1RBZA 2RE1A 3MAHA 3R8XA 4ZZ0A 1RWUA 1S3IA 4ZZ1A 2ZHOA 2PA3A 2NYIA 2RQKA 3IBWA 1JKXA 2RQMA 3CEDA 1MENA 2PC6A 4NV1A 3TQRA 1GRCA 2J0XA 3AV3A 3MWBA 3AB2B 4IQFA 1MEJA 1ZLXA 3TUJC 2CFIA 4YFYA 4ZYXA 5CJJA 4GO7X 2QRRA 3L7OA 1LKZA 2CDQA 1YGYA 1LK5A 4ZZ3A 1SC6A 2KO1A 4M8LA 4ZYVA 1ZLYA 2LVWA 3ENWA 3AB4B 2QMWA 5FIIA 3AUFA 4QPCA 2F8MA 4ZYUA 3KCQA 1LK7A 2MDAA 4ZYWA 3LUYA 2P9CA 2P9GA 1KS2A 4QPDA 3IXQA 3UW1A 3GARA 4NMLA 4GO5X 4ZYZA 3KWMA 4TS4A 1ZPVA 4EW2A 2FMTA 2I9SA 3S1TA 4LUBA 3TUIC 1CDEA 4X84A 3U7JA 4PZUA 4YFVA 4DS3A 4IO1A 3W7BA 1YBAA 2JHEA 1M0SA 1RBMA 2DTJA 2LQJA 1XTZA 3NRBA 4S1NA 2FGCA 1RC1A 3DHXA 3OFFA 4EW1A 4ZZ2A 3HHEA 1C3EA 2P9EA 1MEOA 2QSWA 1ZGHA 4Q12A 2QMXA 3O1LA 3P9XA 2GARA 3OFGA 3OBIA 2DT9A 2BW0A 4GMKA 5IT0A 3P96A 5JJBA 5J63A 1UJ5A 3DC2A 4R8VA 1GARA 2BLNA 5IT4A 2YWRA 3ENQA 1C2TA 3LOUA 4TT8A 3OFHA 1NJSA 3DDNA 4EW3A 3DA8A 2H9ZA 1O8BA 2J0WA 3DHWC 3ENVA 3N0VA 3TUZC 1PSDA 5IS2A 4PWUA 2F1FA 1RC0A 1UJ4A 2JOQA 1RBYA 1YRWA 3K5PA 1UJ6A 1U8SA 1Y7PA 1FMTA 4TTSA 3Q0IA 1RBQA 5T41A 5J9FA 4ZYYA 1CDDA 3TQQA 4ZYTA 3OFEA
chains in the Genus database with same CATH superfamily
3EZ9A 1NMXA 4DOMA 1FO1A 5KFQA 3KRTA 1EB9A 5EIEA 4ARVA 4QICA 5B64A 2H54B 4XB2A 2PKCA 3K1ZA 4KO0A 3D68A 1RZRD 1SCUB 3KQWA 4ZLJA 2CNNB 2C59A 5LQUA 4F9FA 2DITA 2EKNA 4EGFA 4N7TA 2JAHA 4MVJP 2RGCA 1R8HA 1J1IA 4UY85 2DVMA 4YDDB 3G0GA 4N8NA 3OR1A 3N5CA 5ARDA 2VT2A 5BRJA 5LM3A 2MSCB 1E0JA 1SPBP 1E2IA 1XDZA 3BGFA 1XFAA 4O4LB 3WRXA 3PJWA 4UT4A 1Q7TA 1MOZA 1ATZA 2WAOA 2NR0A 2VJCA 1X4CA 2UAGA 2QT7A 3R5KA 4QPNA 2EKYA 4ITVA 4XAQA 3K73O 2BGMA 3MF4A 3VR6A 1XK6A 4MS4B 1JQAA 4IDKA 2XT9A 3G1TA 3B51X 2B34A 3C48A 1GAWA 1A9PA 1AS2A 3QVKA 3NETA 4NABA 2PSZA 1G20E 2C8JA 3FUUA 1ARZA 1LBIA 4KH0B 4MTPA 3F6SA 4I67A 2VYQA 2QE5A 4NOLA 3HVJA 5GONF 3C6YA 1VG1A 4RBUA 3QUBA 3DE0X 5H3CA 1M6WA 3GARA 1JHXA 1W5AA 4O4IA 3EGEA 3BQ0A 2V8OA 5IDWA 3FAZA 4M36A 1PEYA 3Q8RB 2G09A 2VJNA 4FFWA 2KZMA 1TKBA 4PIMA 5B37A 3H5YA 2JCVA 3B3QA 1CRZA 2EZ9A 3Q72A 1GXSA 3S6JA 4BGVA 1M6VA 4HT3B 3I53A 3DVAB 2V2QA 2WUVA 2NVUA 1J7KA 4YQFA 4WTOB 2HWIA 2WBMA 2CF5A 4ME6A 2RILA 2ZHAA 4BFLA 5C1IA 5BXQC 1WZNA 4JI8B 2O2IA 1QO7A 3OECA 1U0NA 4ACAA 4EX6A 4K4WA 5GV7A 1Z3IX 3I83A 3FLAA 3W05A 1FFWB 3JAMA 5ALQA 3IPYA 1HG0A 4X1YA 1Q78A 4NARA 4YDRA 3QIPB 4JAVC 1WC0A 2ZYUX 5ITZB 1I7SB 2CCGA 3TUJC 4X20B 3MTAA 1XDDA 2WHXA 2OGWA 1XCMA 4QBHA 4DFKA 2BEVB 3ER6A 3NIDB 2Y71A 1VPWA 5JMWA 5HOEA 3KPWA 2QTVA 5J5CA 3EOBI 2CLHB 1EVZA 4IUDS 1DMRA 1FUIA 3M3DA 3I9JA 4MUAA 4MUGA 4M1ZA 3OJWA 3KSDO 3L7KA 4LVNA 4ZC1A 1KWGA 4LF4F 3GMDA 3NRCA 1Q7RA 4IKPA 1ND6A 4WBXC 4YR2A 3CO0S 4ITRC 1WY5A 1E2LA 2PZKA 2ZZTA 4I9GA 3O4VA 3SIWA 1QGAA 2OD9A 4DV3F 3AOBA 5CLLA 3DNFA 5ARBA 5IARA 1J0AA 1U0BB 3RHTA 2BR0A 3M34A 3N8NA 4RJIA 3FI9A 4XFKA 1CULC 4QIFA 3DR5A 3J7YI 3EGDB 5FFNA 1I1OA 1QQAA 2IY5B 1XE3A 3T4XA 1S3FA 4D3XA 3PPXA 1S57A 3M33A 1O0BA 2V98A 5JNWA 1HBOA 3C6ZA 1F1BB 3WC4A 3L8GA 1N7JA 3A6GA 1V8OA 1NJYA 5T8KA 3ICCA 2P67A 3DMPA 5L8RC 2ZM6F 5E6RA 1GPBA 3VDNB 1IB0A 1LWXA 2I6SA 2EKLA 2Q5CA 2B4VA 1N6LA 2IW1A 3UMMA 2PZAA 4US0R 2NIPA 5EWGA 4I14A 2DLDA 3B7WA 3QKRA 3SSSA 4LYFA 4DR5F 1LB1B 1IBLJ 1M2NA 3ZI4A 1KSGA 4LHWA 4E70A 3MD1A 4YMTA 2O8DA 2IPMA 1YLXA 4DV1B 4RJ2A 1PJ4A 3PP8A 5CUQA 2R6R1 1TGVA 1EFRA 2PUBA 2VUHB 1PEAA 4KWEA 4EYSA 4O4IF 4NLPA 2P77A 3D7KA 3O2QB 2QRKA 4TXNA 2O5EA 2O5RA 3AHDA 1E0AA 3L8YA 3LOUA 3NCQA 3NYWA 3OEHD 4KRWA 5CJPA 4R2IA 4DNXA 4DPMA 4LISA 4WW0A 2B6AB 2I71A 2MZTA 4MVJE 4J9KA 4YR3A 2VP2A 3M6XA 2YNGA 3JS5A 1BG6A 1WG5A 2Q5IA 5DVZA 2YKGA 4TLBA 3STYA 4LFAF 1AO0A 2C3OA 1TYDE 3JZDA 4DCTA 3JRXA 4ESEA 2Q3EA 2JJ2D 2CG8A 1QGZA 1E79D 5FADA 3VAKA 2GHWA 1J20A 4FMDF 5LDGA 4DFMA 2D13A 4EHHA 3M82A 4M5MA 3TZKA 5BORA 1T8TA 2GBLA 2NP6A 4ALZA 3ABRB 3MBOA 3FH0A 2UUAJ 2QU8A 4C6TA 3PW2A 1A5AB 5BN3B 3UCZP 2A5LA 3DT8A 2XYGB 3KZNA 3K53A 2C7VA 3S01A 3G6XA 3QXGA 5CXTA 1NRIA 4NAHA 4JI0F 4QPJC 1LWNA 3VHQA 3IODA 2BY4A 5AUOB 1X77A 4WIAA 1PGJA 2AN4A 3B1FA 1B42A 4KUHA 2W2KA 3I5YA 5EVCA 2ADCA 4XIUA 2FWPA 2OHJA 3B5IA 2IVYA 1JLFA 2P41A 4PLWA 2G9UA 3O44A 4MWBA 1CS4A 1QH8A 1U6ZA 5AJVB 2X6TA 3F5DA 3L8HA 1SKYE 2HD4A 1WY7A 2Y05A 3K7RA 1R6UA 4L57A 4A8JA 4RVUA 2IYYA 3QVSA 4RLHA 2CJAA 2JFFA 2XHEA 2HIQA 1AXQA 3VSCA 4B3TB 5SYMA 1V5FA 4YN3A 3EGVA 3ZXXA 3D2BA 3ESBA 4KB7A 4NZ0A 1CZKA 3H8SA 4CM9D 1Z5ZA 2HBRB 3V6LA 3N53A 4WF9Q 2FMKA 5F3WB 2LCWA 2JHEA 1DPFA 3W2HA 1ELOA 4LRCA 4KVZA 3IAHA 4KXFB 2J67A 1I1HA 2FJBB 3AB7A 3Q5DA 1HDRA 1E8NA 1REVB 4L8FA 2BVZA 2BBWA 2CXTA 1CUCA 4S24A 1DC7A 4ITUA 1BVYF 4F12A 5LMNB 2LXFA 4IYJA 4HDMA 1VK3A 3FZGA 2GJKA 5CM2Z 1NG1A 1RHQA 4JUCA 1UPUA 3A4NA 1TTHA 2MSLA 3L1HA 1G55A 5D1NA 4NF2A 2IMOA 4LVNP 4UBMA 1FEHA 1X7YB 4MXDA 2NZWA 2DNMA 2XS2A 1S1WB 1F2HA 3KFXA 1TFUA 1XZ8A 3IPLA 1CCWA 2B3DA 4BJ1A 2GXAA 2P79A 2W8LA 3H5LA 3C8HA 3TLGB 2RGAA 5FBQB 1J2JA 4X6YA 3VSDA 5FH9A 4FFMA 1Q0UA 3H0EA 5CTAA 4HGOA 4TYWA 3U1TA 3BPSA 2OP5A 1V26A 4C4OA 1JX6A 4M2LA 1MROA 1N5YA 5DG7A 4IYQA 5ICSA 4BBAA 3SJ7A 4CQMB 2CVOA 3OOJA 5FEUA 2Z5GA 4MH8A 1TTPB 3FVVA 2MJLA 2BE2B 3K5LA 1V47A 3WDLA 3OMLA 1NK9A 2G82A 4UNQA 1FU7A 3D0RA 4C4PA 4ZT7A 4E88A 3JYLA 5TR9A 1SU8A 3LWLA 5D15A 1CVIA 3R9XA 3PWSA 4MKVA 1J8DA 2JFDA 4OBBA 1BO6A 1KVIA 3TLAA 1FK9B 1I94B 5JCZA 1XMBA 4NOJA 2LTAA 2NUBA 3L1VA 5FTLA 3EY4A 4JGBA 4RWXA 2AW3A 4DV5B 2HQRA 2XNHA 2CLEB 3L8MA 5T5QA 4PXEA 3AOGA 3B89A 2HS4A 1V7CA 4H3HB 4ZJPA 3F90A 4RJLA 3ORSA 3R5HA 4N0EA 3KLOA 3ZBUA 2YKOA 4C06A 5H9WA 3M3PA 1OXUA 4K9RA 3NG8A 1N77A 1OHHD 4RUBA 5AXBA 3KKFA 3JQAB 4GYJA 3C5HA 4XDZA 4FWBA 3JVUA 2A5JA 2Q29A 4B3GA 2CXXA 2XZDB 4BWYA 2JGLA 4P7FA 1GG9A 2MSTA 4KPUA 1I7PA 7YASA 2ZUDA 4EMSA 1GU0A 3TB6A 3ZHYA 4EEZA 4OK5A 4EJ2A 4O4GB 2QG6A 5T64A 2R8JA 4GZ6A 3OCCA 4GMDA 4D44A 5EE3A 1GKYA 2WJWA 2FFQA 5JRDS 4J7UA 3UMFA 4M1TA 3WAJA 2OH2A 3I9NA 3PDCA 4KC0A 2LP4Y 3EB9A 2BA9A 3M4JA 5CHCB 4A48A 3DG9A 5L3QB 2B69A 3B2NA 3JXOA 2VT6A 4KHPF 4CIWA 3JCZA 1NNI1 4CLZA 5AVUA 4PZVA 5MAOA 2XITA 3HDVA 4K50A 4OJ3A 1LC0A 2IYOA 4CKBA 3V6DB 4DUGA 1VLVA 3M2TA 1J33A 4J9LA 3TXXA 2ZTSA 2WWFA 1X9IA 1NV9A 3SC4A 3QPBA 3FJOA 2DJ5A 5F2OA 3MYRA 4DSIA 1AUQA 1DFIA 2V58A 2DJIA 4NS1A 4AUMA 1PZGA 2G9QA 1A7GE 5K4GA 4PYOA 1IM8A 1J8VA 5KYVA 1RHJA 2WIFA 3RHZA 1T3OA 3GIMA 2ZKLA 1BHJA 3EZNA 1XRMA 5HK8A 2NO6A 2Y6UA 4RWWA 4NBVA 1DJQA 3T6KA 2RKBA 3LI2A 4TMTA 5FDFA 2JAQA 1PBTA 1BGWA 1XTIA 3LAWA 2KPOA 4OJKA 4PWYA 1HRKA 1K47A 2W6ZA 5KFXA 3M83A 4BV8A 4NATA 3BZUA 1BFUA 3LL4A 2AG1A 2MR5A 4G5XA 1PILA 2OQRA 3DOIA 2ZROA 1WDLA 4W1PA 3N76A 2RHJA 4IOJA 3QU2A 1GQQA 4JS0A 1I2ZA 3MMZA 5LB2A 3RKSA 3PJDA 4UPVA 3HN6A 3G5MA 1E1QD 1YBFA 4Y6GB 4J9NA 4XPIB 2J32A 3H5RA 3TZQA 1JLKA 4Q45A 4DA7A 1OVGA 4B44A 3L4JA 3N8GA 3PQ4A 4BE7B 2J9FB 2P9YA 2WYOA 3MCAA 2OPQA 4Z4GA 5HN0A 1EX8A 5EERA 4KJZA 3GA5A 2D1YA 2JFQA 2XNJA 1YS1X 4P5DA 3CWJA 3HVWA 1SUDA 4NE9C 1U8TA 1UWCA 4MWTA 3HRIA 4QTXA 1ZCFA 2NZ2A 1YFLA 4EGLA 4BWFB 1RWWB 3BPSP 3UKDA 3LM8A 3U6BA 3ZTSA 3DXSX 1PJCA 4MPTA 2H2GA 3L7OA 4X60A 1X8KA 1V96A 1JVSA 4EGCB 5KFIA 4MZDA 1Y0BA 2K7FA 1WTAA 1SHKA 3GN2A 3M0EA 1O51A 2QEXS 3CIFA 1SIOA 5IUJC 3RRMA 2X0FA 2WC1A 1FJEB 3KZMA 5YASA 2HV9A 1TUGA 1BH6A 3MWGA 4LBZA 5DBOA 2ZH3A 1BDJA 3PTAA 1YOBA 4FNAA 3T7IA 2EK6A 3RT7A 3CONA 1JRLA 1M72A 2MTLA 4KYZA 1P1HA 2RIPA 2CPJA 3DKKA 2GQCA 2GAAA 2YXEA 4KGXA 4ND8A 1SIBE 4N82A 4QG3A 3K71B 1TMOA 1O96A 3M5WA 2MHNA 4CTJA 2WR8A 2JDID 1G21A 3EZFA 3LPNA 2VTBA 4GSYA 4XCVA 4RU2A 4UE6A 3QU7A 1M0WA 4RGVA 1U2CA 2JFKA 3CC2S 3ZCRA 4ENWA 1QE1B 1VBKA 2Q66A 9ABPA 3M30A 1S2IA 2OEJA 2OCBA 3OM1A 3EGOA 3L41A 3E8XA 3IELA 4DQLA 4WKBA 1B7GO 2P8JA 4EJ6A 1N32B 1QYCA 3IOCA 4JHXA 3NQ41 2QQFA 1X5OA 2RB5A 3DYAB 3V8PA 4KO4S 4AE5A 3AIIA 1ZONA 1VIDA 3TEFA 1TMMA 2BFOA 1NQOA 5CU7A 1RM0A 2Z2JA 2HQFA 2CXNA 1Y3IA 1JJIA 2FPIB 1GILA 2CDRB 5WRFA 3CDAA 1GAEO 3TEHB 4GNRA 1JIVA 4NMHA 3SKYA 3ZKAA 2WG2A 1A9NB 3FG9A 2ODPA 3PG9A 4ARUA 2QW8A 1E6YA 1XVUA 4HN4B 2J4FA 3M8QA 1X1AA 4Z7YA 3AR9A 5FBLB 3EQ2A 2F4FA 2VP0A 1IDOA 3RW7A 2MJUA 4DYVA 3UI3A 1I3MA 3R3JA 1BXRA 5KTKA 5FCDA 1UA1A 1L4GA 3R2JA 4ZIVA 3GLKA 1RKIA 1SCQA 4PXBA 1FKPB 4KOAA 3VFDA 2QU7A 3P9NA 5CW2A 3RAGA 1IVZA 2V9ZA 2WILA 2O06A 1ZN8A 1XPRA 2VBXA 1RLIA 1LJUA 4YUZA 3G4SS 3ZGXA 1RJEA 1I5OB 2HCFA 4ZJZA 2CLMB 4UPEA 1R0AB 4N7JA 2E2WA 5JXIA 5EUBA 5DZSA 2LE0A 5LVAA 4PPDA 3FPGA 5B57C 3R74A 3PACA 4MRVA 2EHDA 1JEAA 3MW8A 5LT5A 2QGZA 2P62A 5CHYA 3NEPX 7FD1A 1U3TA 4ICIA 3CIOA 2Y3IA 1URPA 3J81j 3A1FA 3C3XA 3UMSA 3S8EA 4IIUA 1IEVA 3RTAA 5BXYA 5EIHA 5KFBA 7ADHA 4JJZA 3IRXB 1Q2XA 5KQRA 2WDPA 5BNWA 2QJOA 3HN2A 5TQ2B 3HSYA 4O2AA 1DG3A 3EBLA 3NTRA 5EWLB 3G8AA 1RWMA 2VQEJ 1S6QA 1FNMA 3QZUA 4I2QA 2VODA 1HFWA 4P2XA 4ZREA 3RTVA 2OHVA 4CKWB 1E6CA 4ZPJA 2CPIA 3TO5A 5KT3A 2E6UX 1YR2A 3G8BA 2HSDA 3OJLA 1RT9A 4JK3A 2OSQA 3EVEA 3WNDA 4KQHA 1EWQA 3RSCA 4WFAQ 4QSHA 1CDEA 4DU8A 3CJ3A 2O8VA 1FRVA 3EAGA 4BY9E 2IFXA 1KI6B 3ZHTA 2QMUB 1JLAA 3DBLB 3TLCA 3TI7A 4RK7A 3OPXA 1HDGO 3AMVA 4JJFA 1VPTA 3VGVA 3P0FA 4S0ZA 1SUQB 1W1UA 1EIYB 3MWJA 1WCXA 2VBIA 4B40A 4YAIA 2R2SA 2HHUA 1TUBB 4OG2A 2AI2A 5GJVC 3C15C 4WCFA 4R6XA 3K20A 1MAWA 2HKEA 3VM6A 1MU2B 4IEIA 4PYRA 4G1UC 4YJFA 1F4VA 4FP9A 3LU1A 1ZC4A 5KSZA 3UDEA 2REQA 4IR7A 2C5BA 3PW0A 4QASA 4RFSB 4I50F 3PE6A 3EPIA 1KK3A 2W7OA 2NCKL 1RA6A 4EVIA 4TNOA 3NWRA 3B6MA 1QH1B 2YQ4A 4JR0A 1TD1A 4DFPA 3RSSA 3PDIA 2SKCA 2GOYA 4MLZA 4JJGA 3GEMA 1S99A 4WP3A 3F5QA 1P9YA 4Q5VA 4G4SO 3P26A 4XFJA 3DV2A 1P44A 2I2XB 4BLPA 2H0QA 3HYSA 2XRMA 5FNZA 4OLPA 1YR8A 5CLJA 2AZ4A 1NVGA 4K46A 1UKBA 4EUKA 1RDFA 5BP7A 1KVUA 1C4WA 4II2A 1EH5A 4ETZA 3HBNA 4JBYA 5EHIA 3VR0A 1M2JA 3GPAA 1UODA 4M0EA 2IV7A 2JOQA 1CZUA 1SOAA 4UARA 5BV8A 1HYBA 5JWRA 1JMKC 3LXRA 5CYGA 1DXYA 1TF5A 1O0SA 2YZKA 2MQQA 1FNSA 5B1HA 3C7TA 2Z6UA 2OZEA 1TMYA 4A2WA 3RAFC 2I22A 1EAYA 2Q9UA 1WB6A 4ETNA 2L2QA 4XYGA 5CXUA 4OX9Y 3QUCA 3HEMA 4KG7A 4KE9A 4CFSA 2QSUA 2WHOA 5E9WA 4ZO9A 5EPOA 1IDN1 2A3NA 4DR2J 4EMDA 1S1CA 1TTQB 1R0KA 5DNWA 3RC7A 1W36D 3PDHA 3ICPA 4O2AF 3DBHA 2WONB 1Z75A 2BL4A 1X7WB 2UYYA 1WHXA 1AYEA 1N25A 3SEFA 2H65A 2HHQA 1UIRA 3OKAA 4IDBA 4LJRA 1KSPA 2W6QA 4R7TA 4KAIA 3DGFC 1ODCA 3TNYA 4N6NA 2HU5A 4F4UA 1EK0A 2ZIGA 4DEYA 1RKBA 4CWAA 5KFFA 5C81A 1U49A 3ELDA 2H18A 4QYTA 4D3YA 2JB9A 3KUKA 2QB5A 5KQGA 4EHBA 2V4UA 3GCXA 2BEWA 4LJLA 3GFPA 1KO7A 1Q4RA 4DY4A 3FCUB 4MV6A 3TJ9A 2C4VA 1AK9A 1VSTA 5THXA 1RJDA 2R68A 5EFZA 3T1HJ 2WIBA 4GP9A 1S3GA 1FNBA 1MT0A 1W87A 3PXUA 4ZVGA 5DM6Q 4Y2XA 5HA5A 4MLCA 4DCMA 4KIUA 5HDBB 2QMQA 3T94A 4RF4A 3FMVA 1UMJA 4D41A 2QTFA 3C98A 1TQ4A 3EHEA 5JCJA 1RZVA 4IGAA 3DOLB 3M8ZA 2EQAA 5KFZA 4CH0S 2UXDJ 4ZO6A 3LLUA 5KYWA 1UDWA 4YRSA 2D2XA 1M8GA 4MVJH 4U2BA 2MKYA 1VIOA 3KO8A 3PKIA 3W1WA 4L5JA 3NNAA 1LU9A 1Y6GA 1TQ8A 2A78A 3PKMA 4ED7A 4AN1A 3GSIA 2VN8A 2R79A 1T1JA 1L5SA 1XVVA 4LA4A 5J2QA 1XK8A 1KMQA 3T1YF 2PFSA 1PFUA 2PIIA 2VH1A 4YBRA 3UWTA 1EGHA 4QULA 2YH2A 1IXYA 2Y92A 1MZVA 1XHEA 1E3WA 4FD3A 1QYWA 1QTRA 5DI3B 1IQRA 4OU5A 2CPDA 2YJ4A 1RHKA 1FRZA 5JJKA 4WWSA 1UM9B 4R2MA 2FP4B 3EYAA 4TS9A 2LIVA 4IHQA 1KJZA 4C7QA 1TPYA 1S3SA 4DR1B 3I62A 1HI9A 3KAPA 1WE2A 2F8MA 2HX1A 5K3SA 1JNXX 3BGSA 3PCTA 2CQ3A 2ZT8A 4LFBF 4USWA 1OWPA 2VG6B 2OHGA 3BWXA 3VYRB 2WHPA 1KVRA 1Q95A 3AJAA 3ROZA 3X2SA 3EFHA 121PA 4P36A 3MBKA 2KXHA 1KDPA 4QQBA 4LF7F 3LH2S 3K72B 4EJMA 4KDEA 1IIBA 1WZ2A 1QVAA 4Q9AA 2QP9X 5FA5A 4JBIA 1JX4A 4PLHA 2NPIA 1XKXA 3FKQA 3KK1B 1G4AE 1G7SA 5CBPB 1KAOA 2DSTA 1YFJA 2ZBFA 4ISCA 1FJGF 3W7AA 4RMGA 2FPMA 5ETNA 3IT3A 5HS4A 5DHQA 3JQEA 4D2IA 1GP2A 2C2HA 1J5EB 5AI6A 4ZS6A 3H8YA 2DGTA 1UBOS 4BCAA 3WA6A 4Z4QA 4BO7A 1RT4B 5MHTA 1D2AA 2QS9A 4YV7A 1G21E 3A6KA 4QOGA 4KQZA 3ED5A 4WNAB 3UB3A 2MINB 1LQTA 3AF6A 2Q3FA 3WLOA 1VGVA 2XUIA 3AG6A 5JMOA 1WDWB 3F47A 5U4QA 1BJRE 5ETRA 3SBDA 2HADA 4ZPAA 2L18A 3B4DA 1M0EA 3R3UA 3KXDA 4F7WA 4HL9A 3KDPA 5HILA 3FUXA 3JAMY 3H20A 5KDLA 2QI9C 3FDJA 3OQIA 3K70C 1XL1A 2HOQA 1HBUA 4KO1S 4CMHA 4E3ZA 3SJUA 2AJ8A 2QTMA 3T1TA 1P7WA 2MSNA 2HVIA 5H9VA 4X62B 2B4PA 4IH7A 5JAQA 1WSRA 3F6RA 3R5XA 5G40A 2XNDD 4ILMA 3R7NB 5KQMA 1GRVA 1Y8RA 1FLAA 3Q3IA 1PYGA 3B5JA 5JG7A 1AXEA 2P6SA 1U9JA 2ZB8A 5G41A 5HTOA 1DRZA 2FK7A 4Q39A 1JF8A 1QPBA 5I7EA 2B37A 1NR5A 1NU8A 3Q1KA 4QATA 4XX0A 4KLNA 4TM7A 3BE5A 4KYIB 3EVZA 5GAGU 1UAAA 2IDMA 4MWZA 1GZ3A 3EA0A 3R44A 3CRZA 4FDUA 1XMVA 3Q15C 1M1YA 2AK3A 4FBGA 5FIIA 1F9EB 1UM8A 3EVGA 1UWBB 3DU5A 1E9AA 4PAQA 2YHBA 2QN7A 1IBSA 1HR0J 4DKJA 3RB3A 2YMLA 1EVEA 4W7HA 3F74A 2X0JA 3GCXP 2MZSA 1A2QA 1UEKA 1E9DA 1XEWY 1M5OC 1DC6A 2FK8A 4RQAA 5CMLA 1U28A 1WC6A 5DNAA 3DHXA 4TMZA 4JMLA 2OPRB 4MJKA 4Q12A 2ZSKA 4NH4A 4LE0A 4GYYA 3PFGA 1PLKA 2AC4A 1LWEA 5ILQA 2CHEA 4PY2A 3QE2A 4NNOA 1VE6A 1WR8A 3V80A 4RW7A 3U7QB 4BFSA 3Q3CA 1PTKA 3QYYA 4N65A 1CJTA 4TTAA 3AR6A 5C1PA 1I6WA 4AKSA 2NV0A 4RWEA 1G41A 3IBFA 3G79A 3E2IA 4D26A 4JXZA 4KO2S 3OL7A 3ACCA 4OQZA 2MQOA 1SHUX 3X1JA 2F3QA 5I3ZA 4GUDA 4QWBA 5CVEA 2VHWA 3B5EA 1Y6FA 1PIEA 1E6LA 2ZDGA 2YVQA 4EDFA 4F0HA 1KFCB 3HH8A 3UATA 3EN0A 3GPIA 4Y2YA 5EYPA 2VG5A 4W1QA 1T95A 3A1TA 4UVHA 2V96A 1VBMA 4F8EA 3VR6H 4QDXA 4PZ9A 2RH5A 5LM7E 1SXHA 1XTRA 4GW3A 3EM1A 1AKEA 2IOFK 1SXJA 5I4BA 1RYEA 5U4XA 1MKYA 3DOMB 1PGZA 1FTNA 1M6EX 5CAEB 5DEOA 3RU3A 2AL7A 1YBMA 1JDBB 4FKMA 2NQ8A 3W60A 2QUAA 5KKAA 2WP8J 4Z2YA 5LJ5Y 4EHJA 4P4NA 1GPUA 4PLZA 4DNPA 4BB6A 3OV7A 2FPPA 5DK4A 4KXXA 4EOGA 1FRNA 2OG2A 2QJTA 4BKMA 4PG7A 2XAAA 2IPOA 2BZ0A 5KFNA 2DIUA 4MPDA 2Q2OA 3K09A 1KE2A 1VYAA 1NM5C 2W2LA 4A6DA 3IEXA 3JZMA 1NI3A 4CZ2A 3QGGA 4LSNA 4Y2JA 3R7BA 2IHVA 5A8KA 2HGZA 3AINA 4CKEA 4Q3KA 3P6YC 4QKQA 3GT7A 2HHLA 1EFDN 2OBMA 2WT4A 1U7DA 3ZNJ1 4BGDA 1JLLA 5IFMA 1U99A 1VSVA 1ULRA 2E82A 3RRBA 2KMLA 3A1SA 1ACLA 1KR4A 5ALFA 4QM7A 4FGLA 1FUEA 2FLWA 2VHCA 2GETA 3L0OA 1JXMA 4ARCA 1UEJA 3IFSA 1VHFA 2AT1B 4I5EA 5FPTA 4Z4FA 4YOEA 5E4FA 4MARA 3BXPA 3SX4A 5KTNA 2F6RA 4CM4B 1D5WA 2PQMA 2BRUA 4UAGA 2E7ZA 3FOWA 1ESZA 4G6ZA 3FTFA 4J0EA 4P3YA 5K0NA 4NS4A 3UNGC 2PKEA 1BQ3A 4M1MA 1PR1A 1TI7A 4RNFA 1J2UA 2AHRA 5DM4A 1U2GA 1X94A 4W9MC 5M3BA 4FF3A 4F4IA 3RABA 8ATCA 3AB4B 2GN6A 1DPGA 3ZWWA 4CIVA 2M3DA 2QDXA 4OIMA 4IGKA 1ZGJA 2QVGA 5F8LA 1KBOA 1V16B 2J9CA 2E3JA 5IM4A 4Q19A 3PRYA 5C9ZA 1YNOA 1C8LA 3AR2A 3RFFA 4IQXA 3IG1B 1UBNA 1K5DA 3WRYA 5DSXA 2HQCA 4DCPA 3G85A 4IJ5A 5ANRB 2P1RA 4ZC8A 1WABA 4XR9A 4EYEA 1Q0TA 5A8WA 5GADl 4MAMA 1PZHA 4XEUA 4IKEA 3L4BC 1B8NA 4K9SA 3PF8A 3AVYA 1S0NA 2HMWA 2CMDA 2JGKA 3MB5A 1QHYA 4CFZA 3GJ7A 1VQKS 1ABBA 2H9AA 5FORA 1DAIA 2D74B 2UZ0A 2FPGB 3THXB 3KG2A 1GZ5A 1XR6A 1FIUA 1B4SA 2GVZC 1SB6A 1HGXA 1BUXA 3PX3A 4HMOA 2NYVA 2E5LJ 4B82A 5A4AA 3W1YC 2DR8A 4RF5A 4KLZA 1AKMA 4JHLA 3AZPA 3HB1A 1N6QA 1VMIA 3KLFB 3C7CB 1RISA 5J2MB 3OTBA 2AZ3A 2FPWA 5JANA 1Y9OA 5BJRA 1ZD5A 2HWXA 4WESA 4OFXA 4Q7QA 5EJ7A 4X7RA 2VQFF 4UUAA 4YXWA 1T8SA 3STUA 5CFPA 4IDEA 3ADPA 1WF1A 3HJHA 1BWRA 4OH1A 2VHGA 1XLTA 1V5EA 2IDEA 3HE3A 4K87A 2YBDA 5JALA 4NA1A 4N18A 1PDOA 5GIOE 2INGX 3WVNA 3IVXA 2G4BA 2YZMA 5IBRA 1VFJA 3LXMA 1JDZA 4R05A 4HUTA 2X0DA 5LFAA 2IOYA 2IBKA 3IR6B 4IWXA 3A13A 3GQCA 2F64A 4RC9A 4TU9A 2ZH7A 3RVMA 4C8LA 3C3MA 4GVPA 2REOA 5HVFA 1HWKA 2W43A 3RFUA 4WKGA 3D6FA 3QZ7A 3AUUA 2VNKA 1T3SA 1S5PA 2CDBA 2XWQA 4DOZA 3H59A 3FFWA 2ZSUA 2OCIA 1B70B 1PNRA 1UVLA 2JRCA 2PCLA 1AQYA 5CG2A 2X7HA 1Y00A 3O7WA 4BVGA 2NV2B 4X92A 3GFYA 4M1KA 1CRQA 3SEAA 4JYAJ 4LRYA 1UVNA 1NHUA 2D59A 4JV0A 1VBFA 4V1Ak 3A9UA 5U9CA 3GP9A 1UEVA 3RBDA 3EY9A 3LQRA 5AJ3J 5IM4F 5BY2A 4AN0A 1QVGR 5LP6C 3P2IA 4QPZA 5BUCA 2O52A 4ZV4A 1QUVA 2YV1A 5CDFA 3G9TA 1U3UA 1G8JA 1Z8FA 1LDBA 2GHRA 2I1LA 4DSFA 4M54A 2V4MA 3VISA 1GIAA 1NDUA 2ZJ8A 4DRYA 1MPTA 2WJ3A 2H7YA 1SH0A 1KI4A 3PC2A 4OL8A 2SXLA 1L4HA 4RHFA 1JLQA 3WXMA 3IERA 1OXKB 1P62B 2QG9B 1FVFA 4CMCA 3D5MA 1H6DA 3ENKA 4DLUA 3M1VA 3ASYA 5BV7A 4M9XA 1OU0A 3PRKE 2HRRA 4QIGA 3QO9A 4Y2TA 1TCCA 1EVIA 3CVUA 5KCZA 5INTA 1N2JA 2V6JA 3HUFA 2ZFUA 1XX6A 4IWNA 5KFUA 5ETSA 4B81A 2BMVA 2WSLA 2DPIA 2V65A 3IDSA 5A4MS 1ZK3A 2XLBA 4BWVA 4FNOA 3BM5A 2FPRA 3ICEA 1NE2A 5HBMB 2Y1JA 1L3BA 2V7QA 3GROA 2QRNA 3R5BA 5HLFA 3S5UA 3G87A 2IYWA 4V2IA 1IKVB 4PW0A 4X9XA 3AUSA 3SFZA 2V0NA 2MGZA 2O3DA 4QGFA 5DTRA 1W4AA 1WMFA 3ZDFA 2G08A 1O5OA 2O6LA 4C2MA 1KKLA 5FAXA 1AB8A 4QGAA 4RD0A 2OPSB 2AI1A 3NANA 2QROA 2Z0MA 1DT5A 4A8SA 1ZLXA 1DNPA 4BLQA 4G1BA 2HW3A 5FOWA 2OC4A 1N2XA 1SC9A 1TRHA 1J42A 4FS3A 5HGXA 3T5BA 3NHSA 3GYNA 1S1XA 1JKMA 3SXUB 3EX7B 2PUVA 3JD0A 1ZOPA 2HZBA 4JP8A 1ISJA 2P6OA 3TJZA 3WGNA 4DABA 3H6HA 5KFCA 2ERRA 1E3JA 4LNUB 1F0KA 3WQRA 3HCDA 2BEKA 4WSOA 3GUUA 4MW1A 3KJQB 1NA5A 1M1XB 3ZH9B 2Q9CA 3VNSA 6FDRA 4UUQA 5EESA 1T10A 3BQ9A 2JBWA 2QD2A 3BUSA 5TSDA 3UH0A 3W2TA 4GR5A 4B3RF 4L8WB 1MAHA 3O1HB 4MW0A 3BDAA 3E35A 5GADI 4K0RA 2BN4A 2PE8A 1KRPA 1TK2A 5FOSA 2N3OA 5TQJA 4IIGA 3PICA 1RRKA 4Z9FA 3K4PA 1KQNA 3QLUC 2XDYA 1BCSA 4KQJA 3PNBA 3T5MA 3HSJA 1SKAA 4OX8A 4Z4HA 4DSTA 1I51B 3RS9A 2WG0A 2XMQA 1ONBA 2CEAA 1MAUA 4LY6A 2ZAYA 1EE9A 4IQ8A 1CY8A 2FKAA 1M2OB 1SWVA 4EVQA 2G2YA 3IUYA 3L7UA 2XMTA 1K7FB 2CQPA 2Z2IA 4ZDNA 4FFVA 1R9GA 3UD3P 4EG7A 5GOTA 3E7FA 4HRAA 4ZI7F 3K1JA 2VHYA 3K5IA 3LZCA 1G66A 1RPNA 1W48A 4I6EA 2IVZA 5CIWA 2XZTB 4X44A 1HV8A 4Y2RA 1WL8A 3PKYA 3URKA 4ENQA 1YB4A 4QJIA 4X1IB 1XNRJ 4OX9F 1FLDA 5BQPA 3MPOA 3U1MA 4AIRA 1SXJE 2ZIXA 4UMVA 4UOEA 3QENA 4Z9XA 5FI5A 4Z7OB 2CJWA 2X5OA 2A33A 1WUHS 1I01A 1UPMB 1JLBB 3I1JA 1CEXA 5H8WA 1T2UA 1XTSA 1X87A 5DX0A 4UQTA 4KIAA 2AN5A 1IVSA 5TV2A 1CJVA 1V11A 2ZWIA 2JLYA 4BP3A 1U5CA 4OYRA 3UC9A 1K1QA 1D9AA 1UOQA 1V3QE 5B0EA 1CF2O 4W7SA 3KEQA 4K26A 1F7UA 4JBHA 1VZ2A 1GPMA 4BVKA 5C5EA 2RG1A 1E2UA 3HJNA 1BQNB 2F3JA 4XIGS 4NASA 2QTTA 4OB6A 4CCHA 5ETKA 4ZQFA 2J33A 2B1GA 2RQ4A 1HLGA 3IWXA 4AD6A 5J43A 1P2DA 1VMBA 4C2AA 1OH6A 4DUGD 4WJKB 3D28A 3UE2A 3GV7B 2P2NA 1JI3A 3EXIB 3DS8A 3FXAA 1H7WA 4GKKF 3CUUA 5KJEA 5D4OA 1GARA 2EJVA 3H11A 5TC4A 5L53A 4AQYF 2I1WA 1KDRA 2XQIA 3TBKA 5IEJA 1TO2E 2R66A 3HMKA 2FR8A 2BGJA 1GLNA 5B1SA 4XOIA 4Y1RB 4R1NA 4M7PA 1CSJA 1MR3F 3QFCA 5LUAA 2HRTA 2EW8A 3CZPA 3KQYA 3OQMA 2DUJA 1SCIA 3BWVA 3N7TA 4AL5A 3OSZA 5TS3A 3RS3A 3MM7B 1G16A 2OAEA 1CJUA 3LO5A 1IONA 1PJ5A 4TZ0A 1FNNA 4BRZA 3I9V9 3CVXA 2CD7A 3ML1A 4LDZA 2RAPA 3FZEA 1NHGA 1OLSA 4DJAA 1LK7A 3E22B 4RSMA 1BW9A 2LXUA 3D0HE 5JHGB 2RUSA 3M6VA 4V2UA 4MQFB 2A9FA 4J3JA 4UFNA 3Q23A 1ZIOA 4B9EA 1ZJZA 2IH5A 4RYLA 3EODA 1YFZA 1RJWA 2B7CA 3EXHC 2B6HA 2R8OA 2QQGA 2MYFA 2QN9A 2C1EA 2RMKA 1U31A 2OYSA 3ZW7A 3DQQA 1JBEA 2L69A 3L92A 3KSAC 2I34A 2HQOA 1C3OA 2HMYB 1YDEA 1JWBB 5AOAA 2XUHA 2BCGY 1OW3B 2IIBA 1S1UB 2ZD1A 2BCJQ 2LKCA 1S10A 7MDHA 1DQ8A 1GZ6A 1SBHA 4YR9A 1ZR2A 2R7LA 1U1GA 4BDPA 5D1HA 5JD5A 3ONVA 1GQSA 2W70A 2AEMA 4NNJA 4DTIA 3PPWA 1OYEA 2AFIB 2I3AA 3ONEA 2BSXA 3HZOA 3N6LA 3U31A 1WHTA 2FWJA 1V41E 2JHFA 3EPGA 2HGNA 1ZVVA 4X71A 4D8UA 2VCEA 3JD4A 4ID8A 2JVOA 1OWLA 3R0XA 4GS5A 4YB1P 3AI1A 5JO9A 4OXQA 1KEWA 5BVHB 4R1PA 1V1MB 4J4BA 1G5IA 1SVOA 1GL9B 3QFWA 3IVGA 1D8ZA 2ROEA 2PX8A 4Q66C 4QM6A 1C0UB 3COJA 3MS2A 5C31A 1VG0B 2UU9F 2P6MA 3MM9B 2V4JA 2ZRLA 4JYZA 2QLJB 3TPCA 2O8CB 1NU6A 3HYRA 4GKJF 2YWXA 3ZY4A 5H9EJ 1ESEA 4WFJA 4YAKA 2IW3A 4RTMA 4AVYA 1V35A 3R7FA 1NFQA 2VC0A 1SJRA 5DNYB 2PX4A 3PQEA 4IX1A 3W0LB 4FR0A 4OXXA 1P9WA 3C6QA 2I54A 5L3SB 1I4EB 2B82A 4OJGA 4R40A 3M4NA 3RIEA 2WUGA 3Q5EA 4JLOA 3E82A 3FFXA 3TRDA 5DTMA 1N2GA 1KETA 1QB8A 3IVAA 4PEOA 3EICA 3CVOA 3HLUA 4PYAA 4KYTA 4EW2A 3FGZA 3ESQA 3OOYA 4R68A 1ZUNA 4BZZA 4QQKA 1WU8A 3DRRA 4URWR 2CHFA 3CUKA 2HK7A 3KE9A 2F63A 3FYUA 2C1ZA 1PW5A 3GNLA 3IP1A 4HDQB 5JHHB 4LYGA 4EP1A 3Q8PB 4S2UA 5C35A 2HK6A 3TQCA 5DT9A 1CS0A 3NEJA 2JA1A 3SZUA 4PQFA 3KAJA 1P39A 3EVWA 4Q4HA 5AHXA 1CZHA 2R8PA 1I24A 3UV7A 3W5BA 3W34A 4KXWA 2I7VA 1JA9A 2Z5FA 1A1SA 1QIKA 1TRKA 1PQPA 2C5LA 4WNIA 5JZBA 4TUYA 4HWGA 4PYDA 4AMVA 3KQSA 1KSFX 1K9SA 2NTNA 3IN5A 4DJBA 3A1VA 3HPRA 4KRXA 4HEQA 2IIVA 1JG4A 2BGIA 2FW0A 4G89A 2CYBA 1SOVA 5CDFE 5AW0A 2F3PA 1G4HA 2WA1A 1YF3A 3RUCA 3VSAA 4F86A 3IKTA 1GL7A 2QUZA 4K6OA 1T9XA 3G5UA 3D1HA 1YXMA 2QN1A 4NIMA 2VT7A 3LP5A 2X77A 1P2FA 1ORIA 2YWWA 1IATA 4ZEVA 3II6X 3GDHA 4YPFA 2OXRA 3OTGA 4PQYA 5FPKA 4ZVOA 5BSKA 2X58A 4MKIA 3IIIA 4JV5B 1NHVA 1YZKA 4RE5A 3N2EA 1MABA 3UXEA 3GCWA 4GRAA 3QVVA 1E9RA 5IT0A 1NJWA 1NVBA 3R7LA 5CP8A 1VQ9S 4Q03A 1POXA 3B3FA 3OFHA 3QMWA 1N33F 4R8UB 3V4LA 4X8LA 6REQA 4AG6A 3N6RA 2AOTA 1FXSA 5KTPA 1D2GA 1JKFA 4KE8A 2YXNA 1ZZEA 2CWDA 2GFQA 4OL0A 3ELYA 1N2BA 4LZNA 1YBHA 3DZDA 1TT5A 1VXRA 3W9JA 4RJJA 2PMEA 3RUFA 2EOAA 1C1DA 2UZ1B 1UBGA 3Q2IA 5EGNA 3QT5A 4TWAA 1DWUA 4E2FB 2QW1A 1SCKA 2YFHA 3CKYA 2F9LA 2G7ZA 1SVUA 3AHPA 4JWKA 3VTFA 2D2VA 1E6VA 2BTOA 2PWBA 1JMVA 1KVJA 3IT0A 3U16A 1BQEA 1IY8A 9LDTA 2XO6A 4DHWA 4KH1B 2K7KA 1VZ3A 2QSZA 2H11A 2X8JA 3EUNA 4XTTA 4ZP1A 4HZUB 1EWVA 2HMTA 5IBQA 2CHGA 1KYQA 5C24B 3J7A1 1NK4A 2JJ1A 1OX4A 3H3FA 3CWZA 2IT1A 1ZIPA 3OIUA 4U7DA 1U45A 5HE8A 4FHDA 1JQDA 4BUZA 3RHSA 1ZJYA 3O8OB 5LDDC 2Q62A 4UEQA 4KPYA 2WBRA 3ADAC 1EINA 4R0EA 2WT9A 4EJ0A 1U0GA 4W63A 1F38A 2FW8A 1YJCA 2K7JA 4PCLA 2FJVA 4RELA 3NIWA 4B17A 4A0SA 3IUSA 2GVDA 1AQJA 1ETHA 1M5UA 2KM1A 4GGOA 2HZVA 1GLGA 3ANSA 1QJHA 4TUYF 1M75A 5SY6A 5DHTA 4YP7A 5LU9A 3U7FB 1OQ6A 2L19A 3HRHA 2ZCJA 4Q7KA 5KFDA 3SAJA 5K0FA 1O4VA 3B53X 1SBYA 1K8AT 2BP7B 2XJ4A 4Q7MB 3ZN2A 4AO7A 1A71A 3FX2A 2GPWA 2QBYB 3BHMA 3QSYA 3QVWA 3TG8A 3ZZNA 2KBEA 4JEIA 5JYCA 4P4SB 1PF7E 1X1TA 4X4PA 4CTAB 2FG5A 1TFRA 4BNJA 2PZGA 4DV4J 2R2AA 2AYZA 3AD7C 3WXBA 2GN0A 3NAHA 1UPTA 4RPIA 2WAYA 1E20A 1XTKA 2FY1A 3TO8A 2PKRA 1Z26A 4XB1A 2RHCA 1BVUA 3SEQA 3MJTA 3FKBA 1FDNA 4DFJA 3T3EA 3FTCA 4O3FA 3PFNA 4EJSA 2VP5A 3ICLA 3N0TA 4LDNA 1TL1A 1CY2A 4I9FA 4LWZA 4LF6B 1H94A 2VI5A 3HL0A 3CJ4A 3ZQJA 3BH7A 1NT2A 3RK0A 4ZRNA 5TRTA 1ENZA 4ZIRB 4BLOA 4HN2A 1E2PA 3HT3A 5BYJA 4N5SA 4O3NA 4CLPA 3TW8A 1E4VA 1W5SA 3LC7O 5A0FA 3M6FA 1XU9A 3MQ4A 2ZSFA 4QT4A 5HUQA 3CT4A 3LPDA 5DSTA 1T9KA 3AP1A 3T9EA 2K3KA 5H9EK 2ZDHA 4NR0A 4NXNB 1RLUA 2H2IA 4NOKA 1NATA 2BXJA 3OPKA 2Z2MA 3DZHA 3H2GA 1J70A 5H1YA 2GNAA 4R51A 2B4OA 3KUHA 5CR9A 1W29A 3W06A 4B4DA 3HHLC 1ZEMA 1FDAA 3Q8VA 5ALOA 2YFYA 4WKOA 5KYYB 1BX0A 1UPPA 4A0QA 1R3UA 4IOAQ 4Z54A 4EY5A 5HMLA 1EP4B 4MQEB 4J0DA 1CJKB 4K4ZA 3ZD6A 1P9NA 4D98A 1IFXA 2UZIR 3WSVA 3NDJA 2DNNA 1NGSA 2W6JA 3BYRA 4IQGA 1IN8A 4P2MA 4DBVO 1SRQA 2BZSA 2XIQA 1O0PA 3GCWP 4TV8B 2LVWA 3KKLA 1WF0A 2Q8QA 5FTMA 4C21A 5AVVA 1PC5A 1MOPA 1K06A 4QTYA 1HNZB 4HNTA 3S70A 1H8EA 4ZAGA 4H0NA 4CF5A 2Y0EA 4BQPA 4A8MP 1S0OA 2FZGB 4HX2A 3MCSA 2QLBB 3LP2A 3U7IA 1QE3A 1QOQB 5LBIA 2PGNA 5K0LA 3PD0A 2FRXA 2MHCA 2O05A 4JNKA 5JBNA 5F7OA 1QQBA 4F04A 3I3SR 3NM4A 3PA6A 4DLKA 2CQ2A 4CVNA 1ILEA 3TOQA 2QJWA 2AFRA 3A6ZA 821PA 2PFDA 2PLAA 3ANXA 1GMUA 3FM9A 2C3MA 5IJAA 1JJ2R 4D3HA 1VQOS 1YAJA 5C3UA 3ZHBA 1Y1KE 2P8IA 1Z9BA 3L6OO 4H7DA 4DIDA 4GVXA 4NK5A 3VAGA 3V7WA 2P4EA 4WASA 2VHJA 3E3AA 3LK6A 4QW8A 3OE4A 3RARA 2VNJA 4ZEOA 2L08A 3D5EA 2C9OA 3AEKA 5TPWB 3NNSA 4IIXA 3UJNA 1XBTA 1PS0A 4BMSA 4DGSA 4ZQCB 3UTCA 2R6FA 1ABEA 3RYIB 3HBLA 2IH4A 2Q79A 5DNDA 3DM2B 3KKZA 1Q3TA 1WPGA 3RS5A 3ZXIA 1VC6A 4MB6A 5FA6A 1JQ3A 3STXA 3HCAA 2VZEA 2Z4SA 4L51A 2DFLA 3F5SA 1ECLA 1ZEJA 3UYLA 1PR3A 4XWAA 5IWAB 4L8YA 1JDVA 1YCDA 5AR1A 5LZ4A 1IJFB 3SBXA 1EX9A 3HA2A 4OP3A 2FY8A 2XDQA 2DNOA 1R0BG 3US5A 4AG5A 4WI1A 5DLYA 1MX3A 4R8SA 5TJ9A 1YTUA 1E1YA 1SUAA 2QL7A 1FRHA 2P78A 2QA4S 2TMKA 3TR5A 1NXTA 4LHVA 4QWDA 5E3PA 2UZAA 3IR7A 4OSEA 2RHMA 1SHTX 5AXNA 3D6HB 1BMQA 3FWKA 3JSRA 4JI3F 2NZUG 1TU3A 2E89A 1II0A 1G8YA 4PAOA 2W8BA 2QLTA 5THQA 1A5BB 2KJQA 3BQMB 1NB7A 1VPLA 1RLCL 4LYDA 3B60A 1QCDA 4ZICA 3KBOA 4QGSA 3CDUA 4EELA 4KLCA 2AJ2A 4IG9A 2IRXA 4NLGA 2C78A 3H0KA 4UOGA 2Y1OA 2WJ4A 3D0QA 5B2ZA 1HWJA 2Q49A 1I4TD 1N0IA 2QE7A 4RY9A 2FCRA 1ZGGA 3VJKA 2H5JA 5HEKA 2GKGA 3LLVA 3IVRA 4J9UE 3EMBA 2OCXA 3NRBA 5LA6B 3ILIA 5DZ7A 4AZ0B 4M5DA 1JQ5A 3MEEA 3JSMB 4CV2A 1FVOA 3QGPA 5C53B 3TB4A 3EDRA 4EHDA 4ZQIA 3T6JA 4PSVA 4MPJA 3EH2A 4LR9A 2XHZA 2B9WA 1KD1T 5IVPA 4A16A 2EFGA 1EX7A 3PYXA 1FXDA 3T15A 1FU8A 4EZ9A 1MVNA 1U2RA 2G70A 2A0KA 5GAGI 2X4GA 1JB9A 1A7UA 2ZIZA 3TMYA 2BR4A 3UXHA 3CN9A 2DFTA 1U7ZA 2RHTA 5I9BA 2H92A 3SSNA 2EDAA 4IFYB 3QVGB 2GN4A 3VUFA 3B2EA 1YZFA 2V3CC 1ZPDA 3C6UB 2RB4A 3W6ZA 2VDRB 2VPZA 4U67Q 3LY8A 3EXAA 2AJ1A 3ZD8A 4ZALA 4NPOA 4KR0B 4HLUA 1SA0A 2XKBA 4UZFA 1RGVA 3V46A 2YNIA 2EP5A 2OFWA 1KS9A 5BWCA 1TVEA 3F41A 2Z9DA 1JJVA 3TJMA 1M34A 3EZYA 4F5ZA 1J1UA 3HVRA 3DYVA 1NKEA 3OG9A 1FMCA 1Y8QA 1RTKA 3L7BA 2X6QA 2V7BA 2FFJA 5A8RA 5TVKA 1YQHA 1KFJB 3WLQA 4RX6A 4J9RA 1JAXA 2JLCA 2BQRA 3AETA 1Y3BE 3AR5A 1MWYA 1NOKA 3C16C 1Z0AA 2OECA 4L7QA 2HIHA 5JWOA 1JE0A 2OORA 1MWZA 2VDLB 1YMVA 2IHR1 1QAMA 3DLLQ 1QUPA 3S7ZA 4YJ2A 4JXJA 1U7TA 2CBGA 4C05A 1IZ8A 2P6PA 1LQ9A 5AM0A 1YQGA 4B3IA 4LF1A 4FFDA 1WJGA 3A4YA 1F20A 5F33A 5LNK1 4ZVQA 1VMKA 1K44A 1D1UA 1QZ3A 1NSPA 5EP2A 1WF3A 3MJVA 1EJBA 3VBEA 1WC4A 4HX9A 4AN4A 1YL5A 4J1NA 4DS5A 2FSIA 2J7PA 1MQ9A 3L7JA 4P92A 2QR2A 4YDXA 1YJ5A 1MUUA 1TJ5A 4J0FA 4W9NC 3W5VA 3E5HA 2CC2A 1TR0A 5K8UA 2PGCA 4JI2F 1ZITA 5LKRA 2Y1RI 5NULA 3R3WA 4P84A 2PSHA 4MKGA 4YY3J 3Q8MA 1Y4ZA 1J2YA 2ORVA 2PG3A 5DKFA 5CB0A 3R40A 3KV3O 2G5CA 5J63A 1WHSB 3H4VA 3V2UA 3VI4B 2FJEB 4R1UA 4RD4A 1QWSA 3OICA 1C50A 3RIMA 1VQ7S 1T1EA 2EARA 1GNQA 5BOSB 1DKLA 3Q7TA 5FQOA 1JDTA 4WLFA 2IY8A 2OV8A 2OFPA 3PR1A 1S1MA 1ZCAA 4G1PA 3IXMA 3LTNC 1G6OA 4Y1FA 5U1PA 4OHFA 5HL7Q 3QOYA 4XVQA 5T6MA 4X2BA 1LJ8A 4TWRA 4XJVA 2CNKA 3ZGOA 1Q16B 4GXRA 4MIBA 4YNBA 4A7PA 2P4UA 3ZJUA 4Z9AA 3U26A 3RTCA 3RTGA 4U8VA 1NV8A 4AZVA 4DUYJ 1OH7A 5ETMA 1YS2X 4QLBA 1PR9A 2DBVO 1ZOOA 4MUJA 1KK2A 1AGXA 1TEXA 4PLCA 4NMXA 4I4TB 2QUBA 3SJCA 3JQJA 2GFFA 2MWMA 1UZMA 1G4CA 2W2OA 2XOKA 1T4GA 2WKWA 1WM1A 3L40A 4CMGA 4ROTA 1Q0SA 1DUIA 2XWSA 3CLSD 3QG5A 2ODTX 3B20A 3UF0A 1AB5A 3DTVD 3OF2A 2W2LD 2FZCB 1KJIA 4WV3A 1D2CA 1HBJA 2HMAA 3FPAA 4NG4A 1N5DA 3E58A 2F4VF 3ND5A 4DDVA 4DLAA 5CYOA 4F67A 3A6DA 3GMIA 3T5HA 3LGNA 4ILEA 4FCCA 4HI2A 4E2ZA 5FBHA 5COQA 1L8LA 3RJMB 2C8LA 1Y1QA 4Z6KA 4KV8A 3PEEA 3PD1A 2H85A 5B0DA 2IOHA 1EETB 4G9GA 3RVSA 3GLTA 3DOKB 2I38A 2HHHF 3ILHA 5IK2D 1ZDMA 1FE8A 4BBPA 3MWEA 4O0LA 3SM9A 1NPTO 2RIRA 3D8NA 1IHYA 3B1VA 4YJ2F 5JNVA 5B4VA 3B1XA 1CQJA 3BN3A 1R0CA 1UUFA 4ZI2A 2UYCA 3OM8A 1D8AA 4U00A 2O2EA 3KWMA 3S2EA 1EFVB 1RWQA 5JVDB 3H90A 5TLSA 2IUFA 2QNRA 5F5XA 1IEWA 3OLBA 1P4HA 4GLLA 4MUXA 2EVWX 2DYKA 1W5EA 3NS7B 2WINI 2HPUA 4V03A 3W2WB 4Q9JA 3BO4A 2AUTA 3G49A 5EZ6B 3NB0A 5J2TA 3JQMA 3EVMA 1QHHA 3ZZTA 3DF9A 3EAQA 3S55A 2M9MA 2I8AA 1AKNA 3C5CA 1B1CA 3LLSA 1RTIA 4P7JA 1A5ZA 1DB3A 2R5FA 2F1JA 1IMOA 4F0KA 4DR4B 4D4HA 1K89A 4ZGWA 2HQ3A 4U2FA 2HLTA 1VBNA 4KAFA 3JQ9C 3FTPA 3HG7A 1CNMA 1T0TV 4KQ9A 1D6MA 2XNQA 4F1KA 4DX5A 1YGYA 4JQYA 3CLTD 2H54A 4I99A 2B3TB 1VM6A 1ZN2A 4AI6A 3PGJA 2HT1A 3GFRA 5AI8A 4NCGB 1SCUA 1W5BA 2CK3D 2CNNA 3QG1A 1LTQA 5GINE 3U7JA 4ZCSA 2ZJRQ 3W5CA 1N78A 4HATA 2YQZA 1JJCB 3PC3A 4TYYA 1YHYA 2AOXA 5I7WA 4AMGA 2N75A 3TMAA 2QN2A 3G2OA 1NC3A 5IAJA 2XECA 4LGYA 3CLVA 3RUAA 4QTTB 5DXAA 2XHCA 1AN0A 1M5TA 1P72A 4QLAA 1WQ4A 4O4LA 4XZ3A 3ZV5A 3SLKA 4MVJD 4F5DA 4GMGA 4AIIA 1G6BA 2BUBA 4YT2A 5JAPA 5BR8B 4YDSA 1C7EA 4V19J 4XTCS 4L22A 3CBGA 4EWLA 2FSPA 4FZRA 1TTTA 5CHEA 3WSTA 1NBMA 4MS4A 5HCNA 4UASA 5BSTA 3KUCA 4C7BA 2HF7A 4ENOA 5H5JA 3PX2A 2NUAB 4FI3C 2BCEA 5D6NA 1EVLA 2YBVA 4ZVHA 4M94A 4LJAA 1FFEA 2Q4EA 3COVA 1DAMA 2CXHA 2MLYA 4EJFA 1KBQA 4KH0A 1A3CA 5KFEA 4LV5B 5CD4A 5IJZA 1WUJS 1WJ9A 3C3LA 1ST3A 1HZZA 1IK4A 9MHTA 3BD8A 2V68A 3C85A 3FPLA 3ZGVA 4PRFA 5KVQA 4B35A 3W65A 4P2FA 1KO1A 1JLRA 2U2FA 1R9MA 1Z0IA 2RCNA 1GEEA 4DEVA 3HHNB 2Z4TA 4YC7A 2CL7X 5HX7A 1NMYA 3DVAA 5L6MB 2V74B 4WTOA 1I4OA 2QYTA 2CDAA 3X43A 2WVEA 2XZLA 1FJ2A 3S3TA 2FEMA 1J21A 3O38A 1FA0A 5F21A 2W2OP 4QOSA 5J2TF 5I51A 5AK0A 1FFWA 1NSQA 4YT4A 4FS8A 4I1RA 1F0PA 1VJ1A 4DLWA 3QIPA 4X94A 5F7ZA 5ITZA 1J2TA 4XLTA 2FHSA 2ZRBA 1KY4A 4X20A 4ZOLB 5D3MB 4LF9J 3HJFA 3WKDA 4Z9BA 3N0RA 2BEVA 3ZGNA 4KNVA 4RL6A 3ZDXB 4DV2B 3UY4A 3OFKA 3S29A 2DHSA 1XL0A 3QVOA 4L95C 4J2TA 3NP5A 4GRSA 2PQ0A 3H2UB 4F2PA 1MXHA 3GBSA 1KDZA 2C04A 3AUJB 4ZZ2A 3QBJA 4X65J 4MQ6A 3ZJYA 3FB4A 4U2DA 3SHTA 5KJ1A 3EULA 3B6EA 3TDMA 3DB1A 4JKYA 1A8HA 3HSZA 3BF8A 1P2TA 2VUIB 3HWRA 2J85A 1UPXA 2H4HA 3BGRB 1DX4A 2ZOFA 4YCCA 4FC6A 1WNTA 4DL7A 2PGJA 4KR9A 2LA6A 3P3DA 2XRZA 3OZGA 5K0SA 1RXOB 3PR2B 3K0KA 3DKDA 1XCJA 5JDIA 4OYXA 1UOOA 1OO0B 3EGDA 1DKMA 2WIKA 4RH3A 3DBRB 1KWMA 4O4LF 1D2EA 2V7QD 1UFQA 3PIIA 3KR0A 3ZWDA 4BFWA 1FHTA 1F1BA 2Y27A 4FINA 4DLYA 1GYPA 1CUJA 5HXAA 1B6GA 3DF7A 3WWZA 1EWKA 2WLSA 4Q1CA 1EAMA 1UXOA 1OPZA 2EYQA 2I3ZA 4AZ3B 1RU2A 4PHGA 1AUDA 2V6MA 2HHJA 3D7MA 3K8QA 3D3WB 4FVTA 4CR8A 1P8GA 2CNDA 4D9HA 4LF8B 1ZMRA 4HQOA 3WJ2A 4KMRA 4LWOA 4W5OA 5COAA 4DWWA 3ETOA 3Q8WA 4GOND 4USMA 3TTUA 2EIXA 2PNFA 1ZUWA 3DH0A 5CCDA 4CLRB 2QMOA 5ICMA 4QYMA 1M34E 3ESCA 2OOKA 3ZPXA 5JSZB 2RDJA 2OO5C 3WL8A 1ZOIA 2C77A 3NT5A 1E94E 3M5CA 1RAOA 4N7MA 2Q21A 3MMJA 3OF5A 2VUGA 5ABPA 1RAEB 1ZK1A 3ZHZA 4F2SA 2FNAA 2J8SA 4LIWA 2GPJA 3L8EA 1GXTA 2D3WA 3G8SA 4Y6OA 5DO2A 3S6EA 1BS2A 1IZ0A 4M22A 1PWZA 1DSSG 3B7PA 5AOCA 4MJXA 4A82A 4MPRA 3DVRX 4PZDA 2B6AA 3W9SA 3U3RA 1E4YA 1LBSA 2E7VA 1UZUA 1FOEB 3P2EA 1V7PC 1XQVA 4NA2A 2ZUAA 5KTTA 5ETPA 3SIRA 5E3CA 4PNZA 4D45A 2DSNA 3BRQA 3TBHA 4P81A 2TMGA 2OPBA 4GEGA 1EQMA 3OVSA 4IDGA 2R96A 3TQOA 3NS6A 3W1VA 4NXMJ 3CRNA 3A9TA 4PNEA 3PXXA 1N6HA 3UMYA 4LBWA 3EASA 4PPYA 1G9XA 2CL6X 1NDCA 2GJ9A 2MY8A 2FDNA 4FYIA 1JXAA 3JV7A 1YJ9S 2YV3A 2YV4A 5KX5B 5BN3A 3D0OA 3P97A 2XYGA 1ECGA 3EQ7A 5F0WA 2EGGA 4ZOCA 3LV8A 1RZUA 5KFYA 1OYDA 2YIVX 1FP6A 1KAMA 1RJGA 2Q1WA 2ACVA 3CMCO 3TD9A 3VR6D 2G8NA 5DDPC 3KUDA 3DE7X 3BGIA 1H7XA 4PU0A 3VDQA 4R7ZA 3HFSA 3SJAA 2Q1YA 1Q21A 1SG0A 2LXIA 1CE8B 2HS0A 4TWBA 4L9RA 4DR6J 3WIVA 4G1VA 3MI7X 1C2PA 4GZ5A 4Y6PA 4GLOA 5BMVB 2HFJA 4G8BA 3TEJA 4H4MB 1K0VA 4BC1A 3S2GA 3UQZA 3SV4A 2XWBF 4KW7A 1QG4A 4RCVA 3UT5B 2GFIA 4WUTA 4ANFA 1SC3B 5FTJA 5I8WA 4FE7A 2D7CA 1LXJA 3FJ1A 2HSWA 3KHHA 2YRXA 4C0XA 2E6KA 2HBRA 3W2IA 1HPZB 1FMLA 5JAOA 4G0XA 3B1ZA 5AI5A 5D0RA 4LC0A 4FT2A 2C2MB 4UMFA 3KEFA 4YGXB 4IDFA 1H22A 1XAIA 4X64B 1E5XA 4WCVA 3MGKA 5JMPA 3GBVA 1REVA 3CC4S 4XWYA 3DCIA 3ZGYA 3DLPX 4DNFA 4FYVB 4PSUA 4XEHA 2G2OA 3RR2A 2A88A 4MW5A 3AW8A 3CF6R 1ADJA 2HEGA 3CNHA 2BBTA 3S7TA 2D41A 5ESWA 4DV1F 1VGQA 4OMDA 4F9GA 4ZPCA 4KGZB 3GI1A 2B43A 5KFAA 1X7YA 3FMBA 2JFBA 3K2IA 1S1WA 2LRHA 1RT3B 3FC9A 2F8TA 4Q6WA 1U0TA 2CD9A 4IXNA 5ADZA 4TMKA 2Z3WA 3UJ3X 2RKIB 1Y82A 1B74A 2VA9A 1J8YF 2QQEA 1GOTA 3DXZA 4C7XA 1C1HA 3TLGA 4CT0A 3ADCA 1R15A 2PSEA 5BV1A 1R43A 3TARA 3P9CA 4JI4J 1UPAA 3N39C 4QNMA 2OEKA 5FLXY 4I1UA 3ID6C 2WA2A 1A9OA 2AZTA 1IG3A 2O8NA 1N5IA 1YJRA 4CQMA 1HOXA 4LRQA 4MQUA 5C25B 4YAWA 4FW9A 3FMGA 3T3DA 2LEPA 4FQ7A 3HYCA 2BE2A 2MQLA 4KU4A 4QXMA 2YJTD 1SPBS 3M3HA 1KO4A 4AZTA 4OJNA 4UHEA 2RIJA 1PSZA 2OBYA 2FDXA 2P0YA 4LTDA 4NZ9A 2P9JA 1LLQA 4K8OA 1Y5MA 2RJZA 3UQYS 1VYUA 2IHBA 1FK9A 1S4MA 1R3NA 2OB1A 1YQQA 4R5HA 4YAJA 1MW8X 4UM5A 2CV1A 2EBGA 4LDQA 3RSOA 3ZVNA 2Q43A 2FCAA 3LCRA 3AHJA 3WGGA 1Z0DA 2QD1A 2OVFA 1VGRA 4JLPA 1YDHA 1FRMA 2VONA 1GJRA 2J30A 3IIMA 1OY1A 4MQLA 3CLHA 4URQU 3ZWXA 2JH3A 4J9QA 3GP5A 3JQAA 1MJHA 3R0QA 3LOQA 221PA 3KQUA 4FGKA 3NGKA 3WGOA 1M7HA 5A4IS 2EBUA 1EFRD 2PPLA 4B3TF 2XZDA 1K1EA 1CF4A 1UDBA 3MJCA 5D84A 3E3MA 4GZ3A 3GGGA 3TOVA 4RORA 2Z8YM 5DK6A 4O4GA 1OWNA 2LNDA 1XJQA 3PDWA 1DINA 4BWJA 1WZIA 3I0SB 2PBRA 4K81B 2WHEA 3OHMA 4PEVA 4GXNA 1P3DA 3TR0A 4YT5A 4MQ4A 1HWLA 4XDGA 1O8CA 3K1AB 1V4VA 5ALLA 3E3LA 2RS8A 2FUNB 3AHGA 3GLRA 5L3QA 1NBME 4TXMA 4DQSA 5LMNF 1G8KA 3B9RA 3X1ZA 1BDHA 5EKTA 2ZH8A 3G8TA 4RPJA 1N8RT 3HVUA 3DW3X 2VDHA 4K88A 5HQ8A 2NZ4A 4W6QA 1I0LA 1OZGA 4I6YA 3V6DA 3KVNA 5DBHX 3B8HA 3AFMA 1TCBA 4DIOA 4M4SA 3DGPB 4AMZA 4UULA 4C0LA 4UUXA 1Y3JA 3LSYA 2E49A 1G42A 1M74A 3DAPA 1IYZA 4RVNA 4CNZA 1VP9A 3ICVA 2J3LA 1CJMA 2OHHA 1OIWA 2D4AA 3CULA 4HNQA 5IHXA 3UO8B 4B1FA 3CCCA 5SY4A 4JZYA 5ADWA 4RK5A 1IN5A 2ZE7A 1K7YA 1VLYA 1VIYA 4XPCA 2J3IA 3DR3A 1SVNA 4X4SA 1KONA 3AUYA 2UVVA 3IQDB 4KK3A 4XJSA 1NZDA 5CH5A 3IBWA 4EPYA 1TEHA 3DRXA 2UYHA 3ISVA 5F2KA 3AKCA 5DLQC 1R6BX 4M37A 1HURA 2DR9A 3HHPA 2CLDX 4F2GA 4HAWA 4II3A 4LYYA 1Z74A 3EGNA 3THYB 2Q0XA 2XUGA 2V03A 5LIPA 2M8DB 3DOJA 3FDFA 3L7IA 3LGXA 3N2KB 2HAIA 4OSPA 3OLXA 1YD7A 1I94F 2G2ZA 1PV1A 2BSQA 2YC4C 4G2NA 3HB9A 2FTKE 4OB7A 4ZVPB 1WW3A 4DV5F 2Q8NA 3AKZA 1QP4A 1YG0A 3PC8C 4XPIA 3CWQA 5A03A 2E7XA 2YQ3A 4F5YA 1LQUA 2LV8A 4GL2A 2BGGA 2C3YA 1ISGA 2HHVA 1CEYA 2BT4A 1JBKA 2J9FA 3MHYA 1WXQA 2A18A 1Z0SA 2UDPA 2C9DA 2XQVA 2BGNA 2YXPX 3HCRA 4CNQA 1P61B 2XKAA 5I5EA 1MWQA 4S1VA 4LGMA 3QU9A 1F14A 4K6MA 1S6OA 2VBYA 2HO5A 5LQMA 1T4DA 3LX4A 1PS8A 4E4RA 1EP1B 2FOXA 2J0SA 2BEFA 2E1AA 1RM3A 3HNOA 1RWWA 3KJZA 2QMHA 2CFIA 4CLSA 2BHRA 2RGBA 3PZPA 2I9PA 1JW9B 3OM9A 2HWYA 3M4XA 4J3FA 2HNDB 2BKPA 2BGLA 1DJLA 4ALMA 5C34B 1M5KC 4BNIA 4RNOA 1TUVA 3I37X 4IFTA 5AJHA 3BJIC 4LNHA 1Z68A 1YDGA 1T8EA 8ABPA 2I33A 2A1TR 3UN1A 1SQSA 2DG2A 3JQBC 1CNFA 3P1JA 1YHNA 3BV8A 5EHHA 1CDOA 1XZLA 4ALKA 3HCCA 3IPAA 4KXYA 3CRW1 1FT8A 2I6QA 3QX9A 1QTIA 3RAQA 1IIRA 4INPA 2FWAA 4DXHA 1X4BA 1LWOA 3J81A 1CSEE 1HHQA 3NTVA 4OHVA 5CX4A 2L0XA 4YT8A 4F85A 3S8SA 1PVOA 2JJ1D 5DHUA 2C2XA 2ZWMA 4DHEA 5TB5A 2B4RO 4QUDA 1GVNB 2W93A 1H69A 4AL7A 1QE1A 1IPFA 3CF4G 4BGEA 4CIXA 2Y4OA 1GNSA 1RA7A 3T4UA 4ZI3A 3AOCA 4ZCIA 1Y33E 1QC5B 1AVTA 3FDZB 5JCXA 2FXVA 1S2GA 3ADOA 4AY5A 4YRMA 3FMFA 1H98A 3C7AA 4PHHA 1PG2A 2MTBA 4FFBB 3DYAA 3CCFA 2QENA 3IA2A 4B80A 2GEBA 2ATVA 5K3FB 2GSWA 5GIPE 3TFWA 4RQUA 1JAHA 3CR3C 3JQKA 4EU0A 3V8NA 2DT9A 2JC3A 3GIWA 2FPIA 1XZNA 1GADO 4F7VA 2CDRA 1F51E 3OTCA 3UCUP 2NSHA 2ZKUA 3OHPA 5U47A 1DP4A 4OX6A 2Y8WA 1EQAA 3IAFA 1M1HA 4U0JA 1ZJ5A 1XKQA 4ZYYA 2E4AA 4Y2UA 2PV7A 1RXEA 2RI0A 4E21A 4YO7A 1PK7A 3TNJA 2X0RA 3B6JA 4G0UA 2G0AA 4UREA 3CY6A 1XWFA 1S4EA 4MDEA 1OX5A 1Z56C 1FKPA 1QLJA 2C8VA 2H1RA 1DOHA 1EDOA 5E3JA 2DGWA 4JLBA 1UTAA 2ET6A 1XAJA 1KJYA 2YVUA 3U02A 3SS8A 1KYZA 2PZBA 1T0HB 1WDDA 1I5OA 1VBZA 3W6UA 1IVNA 2ORYA 5B58C 2DD8S 4HN9A 1EK6A 4QIEA 3INTA 1R0AA 4JA0A 2O20A 4B4UA 1UC9A 3QX7A 3TI9A 3MMXA 1O77A 2B2NA 1QONA 2GDJA 1YO6A 2YWRA 5COBA 1ANKA 1S8OA 1CQZA 1QX4A 4ZXFA 3UEOA 3ZWAA 1RYYA 3OA2A 5CVCA 1EEHA 3L0BA 4PNPA 3MT7A 1P9QC 4N9QA 4LQDA 3RZAA 2H5LA 1U0HC 2JFYA 3ZX5A 3EC2A 4DY6A 2F1KA 1XLVA 2D0IA 3G2JA 3IRXA 4KOEC 2DBZA 1NK5A 1VI6A 5L4LA 5TQ2A 4RQBA 3EPKA 1YRBA 3GJ8A 5EWLA 1T5BA 1G3OA 1VE1A 5HNKA 4OKIA 3R3XA 4CKWA 4C78A 2FDCA 1SJ3P 3OFNA 2G0IA 2PUEA 4OXNA 1X60A 5G4LA 2PZEA 3IWNC 3K9GA 4GI5A 1RS0A 1OLXB 5LQAA 2IP2A 4ABYA 4QUAA 1SWWA 3JW8A 1O9HA 2YFQA 2A0XA 1QU2A 2AJBA 3RRKA 1TM3E 1KI6A 1NAHA 2QMUA 3DBLA 3O90A 2QX6A 2CW5A 1P0MA 1U5BB 4D4JA 2YNHB 1N32F 3GR0A 1H8ED 3WFIA 1YJWS 3AM5A 1M0TA 2VL7A 1FDUA 2YZ2A 1ADBA 4R9VA 1SUQA 4TX1A 1AS0A 2ZUWA 1TUBA 5K1ZA 3T5AA 4DSEA 2P2SA 3IIEA 2XZOA 3VAJA 3BH0A 4ZANA 3U4DA 4DGQA 4DQ0A 5CGQB 4PAMA 1DHMA 4FNIA 1ZI6A 3I2IA 1MU2A 2DERA 3TQRA 4JELA 3O74A 4TXHA 3I6ZA 2JLZA 4H3SA 1LQ2A 2ACMA 5TPZA 3E8MA 2RAFA 4FYWB 1UH5A 1OREA 1Z5WA 2DX7A 1WUYA 3I5UA 4RFSA 4OLAA 4QE3A 2ODNA 1Z83A 1T8RA 2I7XA 1PR0A 4LUBA 1QH1A 2WWYA 2R9VA 1W8IA 1O4WA 4ZCPA 1WLYA 3NFRA 3SDSA 2BKLA 3KG0A 4LT6A 3MGAA 1P19A 3QM1A 4PZCA 1NNUA 1UOPA 4MROA 3KMQA 5KOHB 3GG2A 1NB2A 3L8FA 4IMPA 1XG5A 2WVDA 1BXZA 1QRTA 1SUWA 2C2WA 3GBPA 2H48B 3OBIA 2VAXA 1OAAA 2J48A 1ZVMA 3I0RB 4Q5IA 3T7TA 4BUJA 2R6CA 1B6RA 4MGYR 3EXCX 4UQGA 1M2GA 2BMDA 5JI3E 3EWAA 1MTOA 2GBFA 3HQ4O 3SFVA 3R6GB 2FMXA 4QOJA 2ZYTX 3HP7A 2QVBA 4WAUA 1K7SN 4X97A 1BS1A 4MDYA 1OZHA 4NP6A 2QZ9A 4TWJA 3QHAA 1QE0A 1JHVA 3FLBA 1L6RA 2O5VA 3GJ4A 3UFXB 2G6BA 3UUEA 4BZWA 1JT9A 5E9AA 3TRKA 2JA2A 2H7XA 1EE2A 2ZU6A 5KJFA 5LQRA 4KQKA 2CJQA 5CJJA 2GJ8A 1HD1A 2R84A 1OAOA 1XZDA 1P0CA 1W0KA 2O50A 2C7QA 4Q93A 1SG6A 4NLSA 1XCOA 3STVA 4U7UD 4O33A 1U1KA 5LMUJ 2Z83A 4OBWA 2AWOA 2LUOA 1QS0B 4TY8B 1CQIB 3RVQA 1GNLA 4FGZA 3HP6A 2WONA 3UJAA 1LEHA 3GVXA 1L5VA 1X7WA 3ETMA 3A27A 4WN3A 2NUHA 1YBUA 4RZRA 1H2YA 2LYVA 4B2LA 2ZUVA 2XB4A 1NXOA 3DM9B 4MKFA 2NUTB 4F92B 4FNMA 3TH5A 1NDPA 2AJQA 1R50A 3A31A 1OY9A 3HPQA 1B73A 4PXCA 3DE5X 1RAAB 1NW3A 5KWIA 2FWMX 3EZXA 3IMQJ 4RPCA 2ROPA 4WU3A 1M10A 1XTPA 2MMCA 3FI0A 4G4JA 4X93A 3TZXA 2HRDA 5BQXA 3DRSB 1DARA 3IVMA 3TQQA 1C9KA 4G97A 1F3FA 3NOVA 1GRCA 4EABA 3AM1A 3PBKA 1RBAA 2WBLC 1K27A 1DVRA 4F1JA 2O4UX 4RY8A 1VP3A 2OFFA 4P34A 4YP1A 1GV1A 4KKXB 3GJQB 3AXTA 4G0QA 2I55A 1MMLA 5DGBA 2FQYA 1G17A 4TYAA 3UNYA 2JEOA 1R0ZA 3IXQA 1FP2A 5CGZA 4BLWA 4BZPA 1N4DA 4ERXA 1UQUA 1MD9A 1YB2A 4YMGA 1KR5A 2GZHA 3P9SA 3DOLA 3RHFA 3TA2A 1RC1A 4QU9A 3TZZA 4Q01A 1YJUA 4FT4A 1JU9A 2DWPA 2HKIA 5DGAA 3KTDA 4EBBA 3OE7A 3UMVA 2HJVA 1J22A 2NAPA 5I7HA 4WDQA 1YI1A 4H60A 3AY3A 3NHWA 4GR9A 2LDYA 4L27A 4JLMA 2VDVE 4DCNA 1JPVA 2NSDA 2RRAA 4BWMA 5FLXA 2DEJA 4YRZA 4IOCQ 2BEJA 2YZGA 5DNVA 3R5JB 3B6BA 1RWNB 1BEUB 5DOZA 2GSDA 4KVGA 4X63A 2FB0A 4PZPA 1AX9A 2Y9HA 3HVTB 2QVZX 2FEAA 5DI3A 1O6FA 1JNZB 3TTWA 4RTOA 3PEJA 2DH8A 1WTCA 3D3QA 2EK1A 1VCTA 4U7FA 1UM9A 2FP4A 1B0AA 3UR0A 4U9IS 3FOBA 4ED9A 2HQGA 1QZTA 1TYEB 3ZW9A 4NTZA 4JQSA 5ALWA 2A6PA 3F8SA 2VG6A 1WHYA 1WB9A 3HKZD 4UEJA 4DILA 4JVNA 3PPVA 3GA7A 4C8KA 3RRHA 1UT8A 4N41A 3UJBA 5KVAA 4M9CA 3PPYA 2IVMA 1CNEA 1W9HA 5KU1A 3WYAA 3KK1A 5CBPA 3R5DA 4Q2LA 5EIFA 5KYUB 2VG7B 2CFOA 1VQ4S 1NLMA 1N5MA 2B92A 5AE2A 1Z6QA 3DMHA 2W4DA 1LVHA 2ZRAA 4ZO7A 1RT4A 1KYWA 3E3OA 3ZK9A 1V6AA 4M89A 3UN5A 4BNKA 5E7MA 4WNAA 2PD1A 2ATEA 1PQUA 5JD4A 1E2DA 2MINA 2OFHX 1N4LA 2ONZA 2EC0A 1J56A 2P3LA 4TPKA 2R42A 4D6YA 2C4UA 1YU6A 5EIAA 4M95A 2Q3HA 3U27A 1FPMA 2GF0A 1UJNA 1GITA 3GN1A 2PUHA 1GXLA 2FFHA 4G5QA 3W2EA 4BFYA 3AHHA 3LTEA 2RFLA 2LQ9A 1Q1NA 3SU8A 1N57A 5I9LA 2J9DA 3V4MA 3PA8A 1RIFA 5ITSA 1IL0A 1XF9A 5IVIA 1ZQ9A 3OFSA 1YIJS 2H1YA 1PR6A 1CVRA 1N48A 3GEPA 5BR7A 4UBJA 1VDZA 4I6JA 4LRDA 3REQB 3QLHB 3RBXA 2PRIA 2BLNA 4LK3A 4WNCA 2XOKD 3VGJA 1L5UA 4WZ6A 4EG1A 2FV8A 3R7NA 3L79A 2HJGA 3TAPA 3C6TB 3I2FA 3WLMA 2AR9A 4W5NA 1P75A 4ZT4A 1D3AA 5REQB 1RSZA 2X42A 5EMMA 1DKRA 1W0CA 2MIIA 4PPQA 4KGDA 2OUIA 3C1TA 3D02A 2L9NA 5K20B 3UHOA 1PL0A 2M0GB 1R4ZA 3ND7A 3KUGA 3MK31 4MLDA 2B2XA 3PNLA 1F9EA 1P1JA 2W6CX 2WSCC 1X31C 3LT4A 4C5AA 1UWBA 3BTUA 4CO4A 3KQTA 4OLBA 3HGTA 1VOTA 3NBFA 4ECEA 1XELA 4B3MB 3OQ2A 1VKRA 4NJMB 2R6AA 3C6BA 3PHCA 3ZS8A 2RHOA 3ESYA 1XMOJ 1Z6TA 1G98A 1WA5A 4NCHA 1P6XA 4ZVNA 3DZGA 1I1NA 2R8RA 1D1PA 3E5RA 4IICA 2OPRA 2OJ3A 1SG9A 1GTHA 1S77D 3ZK7A 1Y63A 1KEUA 5AESA 1KAQA 3IXLA 5FD8A 5EXTA 3U7QA 4BO6A 2R1ZA 4XX1A 4JCOA 3WMEA 3ILYA 4UUMA 4CMEC 4UNIA 3OEWA 3NT4A 5IZCA 2LBPA 1H4QA 1T34A 1S3IA 4IJUA 2O7NA 2QAGB 3HO6A 3VR1A 4HTFB 4A6PA 2WTNA 3NIGB 3H4IA 4HACB 3DO5A 2D6FA 2ZRGA 2Z2YB 1JWWA 2XMJA 4GI2A 3FCWA 4OHYA 4WKPA 4LXUA 3U4MA 2W58A 2Z58B 1HDYA 4ZHQB 3HFJA 1J5EF 2MMGA 4RBTA 2DO0A 1TD9A 3HZZA 2I6GA 4QIHA 1IM6A 4H6PA 1GFSA 2N7YA 1RYZA 5B7WA 2ZJ6A 3V6JA 5CXSA 3AI2A 5JCJD 4CT8A 4ECTA 3BSFA 1GPH1 1R66A 1V5IB 1OB5A 4DL9A 4PG6A 1I7QB 3CNLA 2G1JA 2I4TA 3NGRA 5CYFA 2AA3A 2IY7A 1JLEB 3SDZA 4A91A 2UZ4A 1AMUA 1UMBB 3R9WA 4MEAA 2OB2A 4TMVA 4M8IA 3V9PA 3T95A 2HPHA 3MT8A 4EZBA 3GY0A 3PQDA 2K3IA 1ZD1A 5KOXA 1IOVA 4OKNA 1WMBA 1ZU5A 3HEBA 2FW6A 2VHQA 1S5ZA 3TQFA 3NTXA 1A8PA 4WVFA 3U3XA 4DB4A 1IQ0A 5JFOA 2EFQA 3DOMA 3FWZA 2ADBA 5CAEA 4M38A 4QC2A 3YASA 1NLFA 1WKCA 1V43A 1AJEA 2MKKA 3S99A 1USKA 3RLFA 4CXMA 5SUHA 1MENA 1EARA 1HNXF 5CD4H 3Q8LA 1LSOA 4PLGA 3BJZA 3A6JA 4AP6A 3HXPA 4TXSA 2W0MA 2ZPUA 2DRIA 2B5VA 4ZYUA 2J6BA 4J9PA 2ABYA 4HPJB 1NN5A 2G1HA 4R6WA 7AT1B 4E11A 4IG4A 4KWHA 3NUQA 4D02A 4V19X 4LC9A 1Z7EA 2FHJA 4B47A 4FW8A 2JLRA 2HCBA 2ZBVA 5JEEA 3ZZUA 1Q8KA 1T9ZA 1UOEA 2ACYA 5HVNA 2QRMA 4CLTA 4AMBA 1FL9A 4CEHB 1UVJA 1WG1A 2JPDA 4X45A 4C4ZA 3CCVS 2O8FB 2GUWA 2XUZA 1HHSA 4NYZA 1U65A 1PYOB 3EQ9A 1SQFA 2Z09A 5IFLA 4MV5A 2XJ9A 2AT1A 5CM9C 3W8DA 4ZYTA 1JFSA 2RD5C 3GLSA 1QMGA 3TAQA 3A8JA 4CM4A 5B0CA 2JGIA 2QX0A 1I3OB 4FGUA 2YKAA 2X1FA 2WHYA 4G81A 5CABA 2DM6A 1WVGA 5HM8A 2I4IA 3HVAA 4INOA 4JEMA 2XKKA 2ZHBA 3NVDA 1GG5A 1NP3A 5L7WA 4LW8A 4X66J 1WOMA 3DXBA 4WZAB 1SU4A 3VZCA 4HFJA 1PFYA 1MN9A 3CEJA 3IBYA 3RT9A 3WADA 3HZHA 4B09A 2NO5A 1V16A 1DI0A 5TMPA 2LLZA 2RVJA 4JYPA 3P2OA 2DPLA 1AURA 2L3MA 4DHVA 3IG1A 4Y9DA 4I7EA 1XP8A 1RWPB 3PX4A 5DO9A 4DQVA 4M0LA 4IZ6A 4YP9A 3SV3A 2PCJA 4FMBB 1T9YA 1O57A 4PPFA 1AV6A 1JXVA 5D77A 2O2SA 3JQQA 4LF2A 4ODIA 3L9ZA 2B8WA 1VHTA 2KT5A 3NGMA 3BXOA 4RIIA 3OTDA 1CZNA 2D74A 3AP3A 1GHTA 2FPGA 3THXA 1U1DA 3U7RA 3A37A 2XVXA 3JD2A 2XTMA 4XAKA 4ZT5A 4B3SB 1JQKA 3TGPA 1HSZA 4NU5A 4XQ9A 4HQNA 4B9VA 5DLDA 5JFTA 5IDQA 3U5TA 3KLFA 1FRFS 5K8IA 4N56A 1H9CA 1URRA 2OO7A 1YA8A 5J2MA 3L1KA 1O08A 1OFUX 3G5TA 1QRAA 4UEWA 4IDCA 4ZFNA 4YCLA 3ER8A 2GPNA