3OBIA

Crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
285
structure length
285
Chain Sequence
HHQYVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFMRVVFNAAAKVIPLASLRTGFGVIAAKFTMGWHMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVSNHPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYMQILSDEMSARLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISHRDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVFTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a formyltetrahydrofolate deformylase (NP_949368) from RHODOPSEUDOMONAS PALUSTRIS CGA009 at 1.95 A resolution
rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
molecule keywords Formyltetrahydrofolate deformylase
total genus 75
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.10: Formyltetrahydrofolate deformylase.
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3obiA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3obiA02
3KWMA 4NV1A 3MAHA 3U7JA 3S1TA 1RBQA 2LQJA 1RC1A 3W7BA 1ZLYA 1LK7A 2QRRA 1Y7PA 4S1NA 1MENA 1KS2A 2J0XA 3ENQA 2NYIA 1MEOA 4GO7X 1M0SA 1UJ4A 5JJBA 2QSWA 2BW0A 2J0WA 4QPDA 3AV3A 3IBWA 3NRBA 2ZHOA 3AB4B 4EW2A 1LKZA 2RQKA 1RBZA 4GO5X 1RWUA 5IT4A 2BLNA 4ZZ0A 2P9EA 1O8BA 2JOQA 4IQFA 5J9FA 4YFYA 3Q0IA 2P9CA 1ZPVA 3OBIA 4R8VA 1ZGHA 3AB2B 4PZUA 4ZYVA 4TT8A 1PSDA 2PC6A 4X84A 1CDEA 3CEDA 4IO1A 2RQMA 4YFVA 2GARA 2FMTA 2FGCA 1RBMA 1ZLXA 1RC0A 3KCQA 4Q12A 4GMKA 2P9GA 4TTSA 2YWRA 5IT0A 1MEJA 3N0VA 4ZZ1A 4LUBA 4ZZ2A 3OFHA 1UJ5A 1YBAA 3TQQA 3TQRA 5J63A 1FMTA 3P9XA 4ZZ3A 4ZYZA 3P96A 3DHXA 3TUZC 4ZYTA 4M8LA 5IS2A 4ZYUA 4ZYXA 3ENWA 3HHEA 3TUJC 3GARA 3MTJA 3UW1A 3ENVA 4NMLA 2JHEA 1XTZA 1JKXA 2DT9A 2I9SA 3DC2A 2CFIA 1U8SA 2MDAA 5T41A 2LVWA 2DTJA 3MWBA 3AAWB 4EW1A 1UJ6A 2F8MA 1GARA 3R8XA 3L7OA 4PWUA 1CDDA 4ZYWA 2KO1A 1LK5A 1RBYA 3IXQA 3LOUA 3K5PA 2H9ZA 5CJJA 3TUIC 3OFGA 3LUYA 4EW3A 3OFEA 3DDNA 2PA3A 1S3IA 2CDQA 3OFFA 1YRWA 4DS3A 1C2TA 1NJSA 2F1FA 1YGYA 1C3EA 5FIIA 3AUFA 3DA8A 2QMXA 4TS4A 3DCJA 2QMWA 4QPCA 4ZYYA 1SC6A 2RE1A 3DHWC 1GRCA 3O1LA
chains in the Genus database with same CATH superfamily
2XX3A 2V2KA 1WS6A 4RD1A 4LSGA 1GT6A 3MOIA 1Y1TA 2D6FA 4NFHA 3CLRC 1L5RA 4D9NA 3MDFA 1Q86T 2FHJA 2I6UA 1QVGR 1IKYB 1T43A 3S2SA 3THXB 1I4OA 2DK2A 5IZCC 1FJGJ 3PO4A 1IBRA 3RS2A 1WKJA 2EJWA 2QDXA 1IIRA 3EEBA 3H87A 3M8PA 2ZAIA 1L2TA 2F6RA 2ON6A 2HVIA 1T26A 3P9KA 4DPLA 1IR1A 5D4OA 4FDUA 4USKA 1V7PC 3OQOA 1EP4B 1JNYA 3MCOA 2HHJA 2OZPA 5HMXA 3B3QA 1OXMA 3ZCQA 2NXNA 4PAWA 4X85A 5KQMA 1MDFA 1ZA1A 3HY4A 3HABA 3VU0A 5A4IS 3X2EA 2CZGA 3SU8A 3E2IA 5C34B 1SIZA 2LR0A 1ZHHA 1M34B 4K6FA 3D2AA 2HK3A 2Y4NA 4BX0A 5T4FA 4PZAA 5F1PA 1IR0A 4HN4B 3I6QA 2PWPA 1BQ3A 3EXYA 5B1DA 3L5OA 4KV9A 1N6NA 4DR4B 3PYLA 5FRDA 4Z1MD 3NKFA 2GO1A 2MLYA 4QIWD 3SBMA 2WVDA 5B1HA 1TMKA 4RMIA 1UMKA 1AIPA 3GLIE 4DMUB 3WAGA 4LFCJ 3E6AA 4OG2A 1L4YA 5AUPB 5K6TA 1UBFA 1FMFA 3HT0A 2OPQB 1J2VA 3DB2A 2DWOA 2WSSD 2E48A 4HWTA 4WEQA 5F3ZA 4MW1A 4KO4S 4HB4A 1V39A 5LB2A 5HNKA 4TYWA 5KSPA 1NPKA 3KUHA 3UQSA 4BLRA 4MFBB 3TTWA 1QBGA 4FFOA 2CLHB 3BMNA 2ATCB 3TRKA 1BE1A 1DV1A 3ETMA 4X1KA 3BH6A 2HQFA 3IRVA 2CNKA 3PEFA 4ZVTA 5EUHA 3EJ6A 2E1CA 1PQPA 2UXDB 1JMVA 1XN4A 4FDFA 3U1NA 3H2VE 4IFBA 4LAFA 2KT5A 4MWSA 2XZDA 5F12A 2WJYA 2ZC4A 1T9XA 5BYRA 1VJWA 3IVGA 1VSUA 2OYCA 2FHPA 2AN4A 1E9DA 2XR1A 3PRBA 3NQ41 2ZDPA 3B38A 1RP1A 1ZZGA 4HMQA 2ZWOA 4LYEA 4ZEOA 1PQ4A 3NYIA 3ZE6A 2Z83A 4I2QB 4X4TA 4RKFA 1QLNA 3NWGA 3GW8A 4RQAA 2XUFA 2VOOA 5FWAA 4V3BA 3PYFA 1Z2EA 5J9FA 1XJ5A 1KP3A 3AL3A 4MUNA 3TTSA 4RFVA 2QNBA 2ZOSA 4OQNA 1W76A 3A70A 1LPOA 1ZUWA 2IPXA 3TAPA 4CKWB 2VVTA 4F4UA 4MKRA 1LK0A 4MUGA 2J7PD 7YASA 4B3TB 1XVTA 3RHSA 1KY3A 3TQQA 2FW1A 4KC5A 2C2GA 2CQ2A 3FMIA 2CK3A 4YA6A 3X1WA 1XZEA 3ITKA 3M1IA 3UIEA 4GKAA 1O03A 1MJNA 4AQDA 4RDCA 4ZMBA 1BX0A 2DPXA 3GWGA 3HDYA 4DBLC 1SXPA 4N5NA 5TQ2B 1VHDA 4WXPA 1LV7A 3KEGA 5HG0A 4N12A 4U2FA 3PWTA 1B6TA 3UMJA 1SJRA 2YHBA 2N82B 1D8TA 4C6AA 5BYSA 2HCTA 3IFSA 3IRXA 1RT2B 3UICA 2HAFA 5E3QA 3C24A 1EXVA 2PZAA 3MPDA 3N6XA 3SZMA 1KOFA 4LFAB 2G5GX 4Z0HO 4X6YA 4NYOA 2FFJA 2JFDA 3PE4A 3OXLA 4LRQA 4Q4CA 3QYFA 3OT1B 7REQB 3QNUA 4FI3C 3NATA 2G1KA 1HM5A 4G5OA 3TTVA 4CUKA 4YJKA 1G19A 4KBGA 3D3WA 1A9RA 1YC5A 4UNRA 3AUKA 1ZD3A 1E5TA 3BRWD 4ZOLA 2GPSA 3M6MD 2FB9A 4Y9SA 5AYVA 2YUIA 4YREA 2F3SA 3QTTA 2ZUUA 4L78A 4G0ZA 1JU4A 2AUNA 1U1QA 3C7AA 4HI1A 3UAGA 1TQHA 3WGZA 5L3QA 2G07A 3GLHB 1V16B 2HV9A 5C1IA 4FHFA 3ZGLA 1NVMB 3UJ8A 5ALVA 5ECGC 3DLGA 2QTFA 3U16A 2XT6A 4B73A 4QUHA 3GY0A 2Y8WA 3AR3A 5BWOA 1S9FA 4GE3A 4X62B 1YB7A 2I7TA 2GM4A 5KOHB 4IAOA 3O91A 4N0PA 4Z9YA 5M04A 2RIPA 4MARA 3W3SA 1FNOA 3ZIAD 3PEHA 1ZKMA 1ZOSA 4RPGA 4MW7A 3OUTA 5CJ2A 2YVAA 2CRLA 3VJMA 2Y1RI 3DDCA 2HWUA 3G9QA 2Z2IA 4B08A 1BYUA 3DBHB 1GTHA 1D1SA 4GXTA 4G1QB 2KXNB 4LX8A 2EC2A 5CH8A 3W6PA 2HHCA 3KQYA 1NZAA 3N2KB 2QAGA 1HORA 1GQSA 2GRUA 3W8DA 2EJVA 1MX5A 3EG9A 2O2ZA 5EPOA 3LW5C 4K4YA 1NVWQ 2DWUA 5KWVA 4PFKA 4CI9A 4D8YA 5DW3A 4HH0A 5DK6A 5FBZA 3I04M 3HYTA 5GJBA 2O2CA 4KKXB 1ULAA 1GKKA 2CDCA 3T1YJ 1P0MA 4Y7DA 1FVSA 3IMFA 4ALMA 1E1KA 1JH8A 4N76A 1G21A 1AZTA 1WHTB 1QIFA 4LJ7A 5CX1B 1MNQA 3N2EA 5FTJA 2C2ZB 1UJ2A 2OCGA 2NXUA 4ACBA 5LQUA 4LF4F 1OC4A 1SC4A 1ZD2P 4GOLD 3TZYA 4HFRA 1LS6A 3JTEA 2EKLA 3D3BJ 4WVFA 1VQKS 4CM2A 3LP5A 4HKTA 2FSVA 4TTAA 2CQ4A 1KO5A 1I13A 5HRAA 1Z68A 3RTGA 3OFNA 2OXEA 1ELOA 3DMTA 1OT3A 1SVOA 3MINB 3Q9UA 5H8WA 1K9MT 4NZZA 2TRSB 1SPBS 1FFXA 3VVBA 1X74A 4D25A 4WZZA 2CPEA 1IBKF 2UUBB 1VPLA 4C78A 4P4SB 1T13A 4Z4EA 1IN0A 1S6YA 2QZPA 2B83A 3CJ8A 1GPNA 4W1PA 3GJ0A 5DNYB 3GGGA 5CXXA 4EYQA 1XNRF 1FS6A 4GEKA 4GX1A 4I81A 4KRFA 1NBWB 1NDQA 2CVPA 2XRYA 1KZ9A 4MAAA 2QRNA 3CURA 5EP1A 3K9CA 4PPNA 2ZD1B 2HLNA 4Y2MA 1OXKB 4NDAA 4A6DA 1WMDA 3DTVB 3OM8A 1EQ2A 1RQXA 2VC2B 3UEOA 2AS0A 3Q0AA 1JSXA 2FZEA 1SZJG 3DO5A 2X86A 5B1EA 6ADHA 1ADBA 2BKPA 3JZIA 3A7EA 4C6TA 1NN1A 4E94A 3R20A 2YFYA 4RVFA 2GAGC 2O2EA 3E03A 3RQSA 4TT3D 2Q3EA 1LY1A 4D74A 1O5JA 3UA4A 4WZQA 1FXRA 4TTSA 3D9BA 2GHWA 2PDAA 4DN9A 4AO6A 4HMOA 4JKOA 1N6HA 2AR9A 3ND5A 3IEKA 4MKGA 4D0GA 4DQSA 1B0ZA 3GLFB 5I7EA 3TEHB 4B74A 3A1YG 2FPSA 2MINB 3PXGA 4LV6A 3C14C 1ZGGA 4Q93A 2J9RA 3K16A 3T3EA 3GJTB 1EHYA 4ZGWA 3Q8LA 4JJ8A 3HKEB 1EDOA 4F38A 1FL9A 5KOYA 1ZETA 1DU4A 2J9EA 3MURP 1QP4A 5CLIA 5JDCC 3ZV7A 2D2IA 3Q9LA 3X2SA 1DCFA 2JJ1D 3QVOA 3NBPA 5BNFA 1UZHA 1M5OC 3TLYA 1T9CA 1TJ5A 1P9QC 5D8HB 3OX4A 4O23A 5JAZA 2AZXA 1VPEA 1GRVA 2FUG9 4P72A 4GI3A 3TRIA 3HVRA 3KDOA 1N5SA 3I2IA 3ICEA 3ZEIA 1EJ2A 3OQNA 3PNKA 1UOQA 1Y4SA 5FWYA 1WMBA 1Q82T 4EYHB 2NUTA 4DQDA 2QQEA 1GN8A 4E7PA 2DHXA 2KI5A 3SM9A 1CQXA 4G25A 3CCES 2IX9A 3JARA 2ACKA 4RM2A 2ZE7A 2AA3A 2HLPA 3H6HA 2YV1A 2L69A 2W8ZA 1WI6A 2JZNA 2GIQA 4FFMA 3H2KA 3DDZX 2VQSA 2Z6UA 3IQFA 1A4XA 3KS9A 1D7AA 2CPFA 5K14B 3RYHB 4XIJA 1DLIA 3SQGB 3RRGA 3SC2B 1LA2A 3DLLQ 2CJAA 2W98A 1P2DA 4DR7J 2QRKA 4Q7JB 1B0PA 4KLRA 4G0UA 4ROSA 3L6CA 2D1CA 4G37A 4LFCB 3O4HA 1GTG1 2WAXA 4GLLA 1CERA 1ZR4A 3Q5EA 3IUNA 3UPTA 5GVRA 2XMGA 3MELA 1ULHA 1LPMA 2G17A 4GX2A 5J4KA 4B3MJ 2WSMA 4C4RA 3MCUA 3DONA 2B56A 3LCRA 3ZNJ1 3HUTA 2DRIA 1TTPB 4F4KA 1FKPA 1Y89A 4Q9AA 3N59A 2WHYA 4MVYA 3W2TA 2ZITA 3KEFA 2C7OA 1EFPB 1APSA 3QELB 3IEPA 1KARA 2P1DA 2HYDA 1RT5A 4EUEA 2J3HA 4DB4A 1C7FA 2AJCA 1RBOB 1PTJC 5G0UA 4I8DA 1RT2A 3HJVA 3GPLA 3KR9A 4YR2A 4D9MA 3CE9A 5KSOA 4UBIA 1AUDA 2VA9A 3FG9A 2R9VA 4KOEC 3TL2A 2EFYA 4U2EA 3RIXA 4MKBA 4RK4A 4MWOA 1U1KA 4KHZA 5IM5A 4PR3A 4CIYA 2WD7A 2XMBA 4JLAA 2VTBA 3OJUA 4UARA 1R8XA 1R7RA 4TYBA 1CZUA 4CFSA 3S2FA 4KQWA 1UZUA 4NLVA 1X4EA 5JFOA 2PR7A 1XD2B 1XXHA 2PKWA 3ONDA 4BC7A 4OQXA 2OWDA 5DSXA 4EI7A 5TIIA 3NM6B 1R9NA 5FOVA 3SKXA 2X42A 2J46A 4X66B 1WUJS 2RH8A 4MUIA 3EMKA 1J20A 1QRDA 3ZK7A 5DIFA 1I4LD 4KR2A 3OBBA 3GA0A 4CMEC 2CB0A 2HRZA 3CEDA 4M49A 2WOJA 5J59A 3FR7A 3MYRA 4H4OB 1KYQA 3PUVA 1BXKA 1NYLA 5DM0A 5K0LA 1NDCA 3HGMA 3TD6A 2LTAA 4K1LA 2XHWA 1ST2A 2QTTA 3PXEA 3PGMA 3NCPA 5BR7A 4JI6J 3T7SA 1DTEA 2NOAA 1TEXA 1GCOA 2W4CA 2PAAA 1F5BA 1FP4A 1F2TB 2LXIA 2ZYWX 4MV0A 3AB7A 3UAZA 2XMVA 4N9WA 1N4AA 4USTA 2Y8YA 2CFRA 4Y00A 4KLNA 4YB1P 1QAMA 1Z1ZA 3A9CA 1BE0A 3VC1A 1CBKA 5E0KB 2PT6A 5J4YA 1ZLYA 2C1EB 1US8A 4FNOA 4FEEA 3T5CA 5IT9Y 5AOCA 4J0DA 4GP9A 2F9JA 1PWEA 1UFKA 1BFDA 4KXNA 4J43A 2QROA 5ABPA 1W5EA 5E4YA 1JX6A 5DNWA 4BQSA 4QT4A 2CV2A 4ZI3A 2AUTA 3A3PA 1FS4A 1RAHA 3P20A 2PUWA 4YB5A 4S2EA 1Q0UA 2FG6C 1SBQA 1G2QA 1ZCFA 2MQNA 2PS1A 3UMYA 2ONZA 5FUWA 3LALA 2RJZA 1ZQ9A 3UMMA 1KEUA 2BJ1A 1I80A 4CKCB 3KLEB 1M1ZA 4AZ0A 1COZA 3R7WA 1VLYA 5G53C 4C8YA 1Y8RA 3KK2A 1T2VA 2Q6LA 3WSTA 2C5AA 3HGQA 3FSXA 3OQPA 4ZCQA 3PGJA 4B7AA 4IG0A 1E96A 1RQ7A 1L7XA 1KKMA 1QRRA 3S0JA 1UKZA 3A4YA 2BFCB 4WX2B 2J6UA 3FTDA 3H0EA 1NN5A 3BK2A 3HJRA 2RC6A 2X0RA 2H5LA 3V8VA 3M7VA 3BGVA 4I2NA 1XQIA 4K5QA 1CJVA 1ZZEA 4X20B 1J0XO 3VZSA 1H65A 4Z7OB 4DC1A 2VCYA 3JSXA 1LS1A 2NS1B 3W3ZB 1UVKA 3EXCX 1X1CA 3O5TB 3WISA 3FDJA 1Q0LA 3WQHA 1N2GA 2Q3HA 2FSPA 5B7PA 4C3KA 2QLXA 2H63A 1WE2A 1DX9A 4CI0B 1HR0B 4YUDA 3DW3X 4CIBA 4PQGA 4YAOA 3LH2S 1ORIA 5EJ8A 3WFIA 5JVDA 3IPRA 1ZS6A 2XUZA 4OLJA 2XITA 1WV0A 4DSEA 1B7FA 4YUVA 2O7NA 3UXEA 2XTJA 2V34A 1UFWA 2OHIA 3LKBA 3NM5A 1RTZA 3MCTA 3O2SB 2A9RA 2KU7A 3CX8A 1Z18A 4D3GA 4UCFA 3Q7TA 4DBQA 1IC6A 3L09A 1KIFA 1Q15A 3CLTC 4QQFA 1FWPA 4J03A 1G21B 4IIUA 1NKBA 2JEYA 4NCXA 3WE7A 1QUVA 5KJ6A 2XDAA 1B6RA 4LNUB 4YJDA 4KDCA 4WNYA 4KGDA 2OLEA 1RHQB 2D5BA 3AVVA 4UEJA 2WJ4A 3CCMS 4MUAA 4UW2A 1IEVA 5B4VA 1CYEA 1ZUNB 2OC4A 1YZUA 1CEXA 1MROA 5IJXA 3FZBA 2WRZA 2UXDJ 1RWOA 4KUGA 1PD0A 2G4VA 3EVGA 1SQ5A 4JXZA 1OXTA 3EXAA 1ZOIA 4RY0A 5DG9A 3AM5A 3LC2O 3FH0A 2QTWB 3IMQJ 3NBZC 1SVKA 2X5JO 3CWZA 1D0EA 1N36F 2X8AA 2R84A 1GARA 1FF9A 5H68A 3EPRA 5CJJA 1O87A 4QG7A 3AEUA 2DIUA 4II3A 5ES4B 6CHYA 1R6TA 4FSHA 4S1WA 4DCOA 3IS9B 1U1LA 5EWLA 5F4ZA 1N2EA 3PHIA 4WOBA 5BYAA 1ZH4A 2IY7A 3VHQA 4E33A 1VTKA 2QR3A 5ITZA 1B6SA 1II9A 2FY1A 2EL7A 1RT9A 3B1VA 5CLHA 3K1YA 4CH7A 5KFFA 2RF2B 1E2JA 3UKJA 5JDCA 1URPA 3R2CJ 4BFYA 1V8DA 2Q4EA 5CDTA 2ARKA 3BHJA 5KMGB 1LPBB 1SHZA 1BJTA 2VUIB 2AMFA 5F23A 1JJ2R 4CIXA 4MW2A 2H3EB 3CA8A 4DIMA 5A5EA 2FPMA 3B9QA 3OAAA 1GZUA 3OIFA 1E62A 1DEAA 3Q6NA 3K6RA 4CF5A 4AL4A 4ECXA 4KOAA 1AV6A 2ZDGA 2CWDA 1O97D 4XLZA 1UJMA 4OM8A 1NNEA 2D3ZA 4MO2A 4W1QA 1TKDA 2H7CA 2VF5X 3HSGA 3T1VA 3W1VA 4LF9B 1A8QA 3S2GA 2VFUA 1XCPA 4D45A 3C45A 3ICOA 3V55A 1XNGA 3DXBA 4N7TA 3RVPA 3DOFA 4JFAA 5JS7A 1RTIA 4FDAA 1J56A 4NZNA 2O66A 1OYYA 3MK31 4LJSA 2PZJA 3PUKA 2H7XA 3VNVA 5FBQB 3PX3A 5K2MA 4Z7YA 2PZBA 3ZYCA 5PNTA 2O2SA 2KLBA 2CDRB 4XD2A 3DOLB 2IOHA 3L0CA 4LRFA 2J9YB 3JSMA 3PNQA 4E98A 2C7QA 3OI7A 5L8RC 4TTIA 1CUJA 3PEJA 4OEHA 4Q0BA 4CQMA 3RAQA 4B5LA 2Z5VA 4C7KA 4HGZA 1U0BB 3GJ6A 5JWRA 4JBLA 1UWVA 5JVGQ 4TM8A 1N2ZA 4OHVA 3MPYA 3RZAA 3B6KA 3GP5A 5LSRA 3HVWA 2ZIZA 1S2GA 1FMJA 3SYZA 5BVGB 1Z2DA 2R1TB 4ROTA 4Q02A 1U0JA 1YAJA 2HK6A 5AQEA 3WLAA 1KC8T 5BPHA 2XVAA 4ZA2A 4R1MA 2ADCA 1R89A 2I65A 3GG1A 4DLGA 1P5FA 5CNJA 1DAOA 2FR8C 3FI0A 4H31A 2HF2A 4BV2A 3H40A 1C7QA 4BBZA 3CO0S 3FMGA 4B3SF 5M34A 1K1EA 3ESDA 2Q5LA 3BL5A 3KUKA 3WLOA 2ONCA 1Z13A 3UB2A 5H70A 2F1FA 4ZXFA 4KRXA 2OFFA 3R3YA 7AT1A 4HLUC 4AIRA 1MO4A 4WXYB 4YJ2A 4ZV9A 2CNLB 3M2RB 4CUZA 2IYOA 4EJFA 4MMOA 1DP4A 3NBKA 4CLWA 4QT0A 2H2DA 3K35A 3AERA 3MB8A 4XCQA 3TNJA 2NUHA 1A9XA 4C30A 5ETVA 2IYXA 4L0CA 1TQDA 2VYVA 2HTFA 2IBTA 2HFNA 2V4RA 3D0RA 1CJUA 3E9NA 4WFAQ 2VT7A 2HA6A 3CMES 5DIZA 2B5OA 1UBKS 4HT3B 2JLUA 2JK0A 3IR6A 5FO0A 3C3XA 4P7GA 2GIFA 2PEYA 2ZUSA 4EG3A 2REOA 3HYNA 5L46A 5C80A 1NX9A 2JHEA 1B8NA 4N56A 1KVQA 2HNDA 4YP7A 2BKNA 3PNPA 5ENDA 1DJ0A 2AYEA 3JQCA 3IKLA 1HMYA 4Z9XA 4ENSA 4RORA 3RHZA 1PT5A 4ME6A 4N5IX 4Y0NA 4ZK7M 1TW2A 1TA9A 4LZLA 4BQIA 1XOIA 4BNJA 3LPLA 5IAAA 2VN8A 5KG1A 2YZGA 3EC1A 3ZY3A 3P4UA 4TS4A 2VL1A 3BZQA 1Z15A 1WOOA 4IX9A 4WNAB 4URQU 5FKJA 5DS7A 2WIDA 4FFBB 1RLIA 1CS4B 2LEPA 3D4JA 4TVAB 1C3JA 2O8NA 4LXGA 4CV2A 4N8DA 1F38A 4X93A 4B3SB 1XFAA 3LPYA 2AMVA 3BK1A 2DNKA 2IYFA 3A6EA 4QGGA 4CTJA 2ZREA 3M30A 2R65A 1SCIA 2YRFA 1R15A 3HCDA 4PPQA 2E1MC 3O8QA 4JUZA 2QTNA 2PFDA 1SBRA 3QBTA 4ED4A 4FW8A 3ZDZB 3JAKB 4EYEA 3UGKA 5BSEA 1JG6A 3IR5A 1EJ7L 3AJEA 1BCRB 4OYBA 3HCOA 5DTMA 1WJGA 5KWSA 1Q4RA 1WD5A 4OX9J 5FL7D 4J16A 1N8SA 4JGBA 2CT8A 1FX1A 4PCAA 3GAFA 4C8NA 3M33A 2R87A 1Z38A 1GCUA 5ADVA 3RTCA 2VDHA 2B2CA 3MFQA 4CWAA 5ESRA 2QVGA 3W0LB 3DZBA 5F77A 2AG1A 3M6AA 3PI6A 4BUCA 1FP4B 5B6PA 2HJWA 4MP6A 5HJEA 4IGEA 3FYTA 1YVFA 4EITA 3NCHA 3Q8MA 4I66A 4K4WA 3T3PB 1TAHA 3ZWVA 5I9NA 3GCDA 2IAJB 1ORRA 2DWPA 2R25B 2Z56B 4KTTE 1U9CA 2YMLA 4FNIA 1MW9X 2JNJA 1L3TA 2FZKB 3LP1A 2YIDA 3CFYA 1C0LA 4CLYA 2D5IA 1WKLA 5DZ7A 2YZNA 1M0SA 3TR0A 3JQKA 2OO5A 4B9EA 1HQCA 5EIEA 4YRBA 4NLTA 3RG8A 4E0BA 5L39A 4L3OA 1JIUA 3BO4A 2CEAA 4O3OA 4Q9LA 4DSOA 1HMPA 4ZVRA 4BYGA 1SXLA 1AQ6A 5ENZA 1YQXA 3NGKA 4BO3A 4O4IB 4RV9A 1T05B 5DT9A 3LIIA 3I4HX 5HIKA 1DWUA 5JXIA 3C3JA 4L0DA 5CB6A 2G2YA 2A1TS 4X8MA 2V69A 4TLLB 3IOYA 5IN5A 2P35A 5IJAA 3II6X 4DV5J 5KS2A 4C0LA 5KYWA 1RJ9B 3MGAA 2FVQA 2HZBA 3G17A 3AONB 3W5IA 1U63A 4U7CA 2QC3A 1KHWA 1OX4A 4RABA 1AGNA 1K6IA 4OJ1A 1F5AA 3MR5A 1RAEB 4YI3A 1B15A 2D4AA 3MN1A 1Y3BE 1Q1ZA 2X0DA 1TIPA 3H5LA 4WK2B 2NUBA 2B0JA 1VP9A 1VL5A 3OE7A 3R5XA 3A6DA 2Y66A 3BXZA 3QJGA 4RADA 1F4VA 4PS1A 1BHNA 2N75A 3AXSA 4EY4A 1XD2A 2OV3A 1RHMB 2AUMA 3N2GA 3IQZA 3NBYC 4LVOP 4E07A 1NR5A 3ZC3A 1XJCA 1T91A 1K9SA 2ZAOA 1U0GA 3FOZA 3I0RB 3M8QA 3PHEA 1MC4A 1IKWB 1JK9B 2BFFB 3M8KA 4PVDA 2X51A 1LC3A 4Z0NA 4I3HA 3FLMA 3TE7A 4EF5A 4EQ6B 2PANA 3QAUA 5K8TA 2I22A 5IG2A 4MICA 3WK6A 1QPBA 4JI4B 3CTRA 1AF7A 3K8VA 2FK7A 4KXYA 1VBZA 1W93A 2D62A 1E3LA 3IC5A 5FFFA 5AKJA 3LUKA 2KT2A 4AFNA 5BWBA 5FFMA 5EHGA 3N76A 3DVAB 5GP1A 1J8MF 1OH7A 2PS3A 3TXXA 1VJ1A 3TQEA 4DA6A 2FPGB 5AQ1A 3C3KA 4NXNF 2HSDA 1YRYE 3PW4A 2W2PP 2Z8YA 4B6QA 4P10A 1VSQA 1NLFA 3I9JA 5BSRA 1RHQA 4MULA 3M81A 2QRGA 3P4UB 3HXMA 5K51A 1MD9A 4IIYA 3T1YB 1JLCA 4ISCA 3S55A 4X84A 1RI7A 3H5IA 2ZROA 3AOCA 4CLFA 1MO2A 1SURA 3WWDA 3S1SA 1FK8A 3W34A 1XT6A 5AXNA 1UC8A 1MBZA 1J25A 1CJKC 1QH8B 1PBAA 3EQZA 5C8XA 3L9WA 2YNMD 3MM5A 2Q8QA 3GGPA 4KO8A 4PNZA 1IONA 2XNRA 1O54A 1RT6A 1U8EA 1HE4A 1SULA 3C16B 2ZB7A 5E3AA 5JC1A 3SXUA 4TL8A 1GG2A 2ZE5A 4W9RA 1KZYC 4H77A 2C5SA 5IT5A 5AXKA 3AGPA 3QF7A 1S7IA 1B0UA 3ANNA 4EUHA 4MDEA 1VQPS 1IBLF 5COBA 3WX4A 1RFLA 5BSMA 4PIPA 3CPWR 1HQUA 2C5EA 4FCTA 4Z99A 1AZLA 5CHCB 3I1JA 3ZWQA 5AHWA 3FD8A 4U7GA 5KYVA 4NXMB 1AKYA 1BMFD 1HSOA 4R8VA 5ALSA 2J0UA 2XECA 4EHFA 1H22A 4MVJI 4DOZA 1SEVA 3OCUA 1X86B 5CFNA 2IHBA 2JGNA 3KLMX 4I0WB 5GONA 5IEBA 1W9HA 4RUCA 2P8SA 2B37A 1NK4A 2FY8A 1QH9A 3BWEA 1OPIA 1ONSA 1X8KA 1WF6A 2FVYA 4MR7B 2GCEA 3LWMA 1H0HA 2B1QA 2BJWA 2FDXA 1C30B 3IAS1 1Z28A 3EYZA 2AD9A 2EX1A 2J8SA 4RQUA 5B0EA 3GRPA 5FDLB 5IHPA 1WD7A 4A73A 4BCCA 4L07A 1OYVA 3AHCA 4YRAA 3DR5A 3OFGA 2AFRA 1TJYA 2P2SA 4DN0A 3PHGA 4UQLA 4ACAA 1VBMA 3T52A 4NCBA 1QM9A 1O96B 3K09A 3VDQA 3HKBB 3X1JA 1E5XA 1SVWA 3JRXA 4RHFA 1YQUA 4K5RA 2G36A 2C2EA 3QPUA 5D01A 3B78A 4PG8A 3QPIA 1PGJA 1YVRA 4PHFA 2EHDA 3NNDA 2ZDHA 4ZI7A 3RRFA 2X9NA 3CLTD 2E7XA 2DH8A 4GNRA 5IF3A 1U8XX 1YZFA 3ZZ1A 4BKQA 3GJTA 3IPYA 1LOUA 2V1UA 4NLPA 1WVGA 1UM9A 2HFUA 5TR9A 1SC3B 1ZG3A 3VZCA 1U3DA 4NXNB 1Y3JA 4ZD6A 1JJCB 2MZRA 2FPIB 5G0SA 3ZHCA 2C7PA 4KN9S 6Q21A 4K87A 5DDRC 4UW9A 2XYPB 4IDOA 5CA1A 3EZNA 2P3QA 1PJRA 2YX7A 1EE2A 4CKBA 2QOEA 2IRWA 4M99A 3RR2A 1EUZA 3KKEA 3AUYA 1VE3A 4MB0A 4RFLA 3R5CA 1CJCA 1OXUA 2AOWA 3Q6IA 5D0HA 4HDNB 5EQFA 3RVJA 4MAFA 4LE1A 4ZOLB 1P6QA 2VK1A 3R9KA 5LQDA 1R88A 1YDEA 4I6WA 1QNFA 3UCEA 3JARB 4DR1B 1MMFB 3IIKA 2APOA 3M6FA 5KTQA 2XWXA 4OP1A 2YBDA 4E31A 2Q4DA 1QB8A 2CQCA 4BQOA 1QH0A 2RI6A 4WUTA 1IHYA 4IXMA 1RFGE 1XZGA 1X5TA 1QYVA 1MAWA 2J32A 2QL9A 2BZ0A 1MEEA 1IN1A 3JQBA 3TZCA 3K8QA 1I4TD 1HSZA 5LJ5Y 5EG5A 4XWOA 4UNSA 3KOZA 3MAAA 3T9CA 2P9TA 2GGPB 1JHRA 4QIGA 1XRLA 3EGZA 2KQUA 1K0TA 1N56A 1XO1A 3QTBA 2RUSA 1QSYA 5UKDA 1GILA 1F3FA 5HQ8A 3KOUA 4MRVA 2BMEA 1XF9A 2V4ZA 4ND5A 4KIWA 2FUNB 2BMAA 5HP1A 2VS1A 3FUWA 3OLZA 2CWKA 2GPWA 3I30X 3PXXA 2X2OA 2VQEJ 2WE7A 1S3GA 4W8HA 5HZKA 2JGKA 5B7QA 3WZMA 2YKPA 4MS4A 1HTTA 1EZZB 2IOYA 2O7VA 1ADCA 3EXHA 2IDMA 2ZJ8A 3RRHA 2VHWA 2VSFA 4FYYB 1RJ9A 3I82A 4EIWA 2DEIA 4YRFA 1JX4A 3NETA 4IHJB 1XQWA 3DBVO 2I9KA 5KJ1A 1CQNA 3KPWA 4I67A 3Q2SC 2VP5A 2V55B 4YLGA 1BMTA 2AWNA 1QYIA 1Q0QA 4AY6A 5LZ4A 2I5JB 1E2PA 5C3MA 1ULBA 3ORQA 4FFLA 2OUGA 3R3HA 3HG7A 3TDNA 3W5ZA 2V9WA 1V8FA 4Z3KA 4CF3A 5JAIA 1IBLB 2F3PA 3UN5A 5AW4A 1FVHA 1K3UB 5HMMA 1G1MA 2PIAA 2NO1A 4X1IA 3MJDA 4B9AA 3LOQA 5IF9A 1EINA 3LNTA 2OA0A 3P0IA 2YWKA 5C24A 3ZX4A 4DLKA 3OL7A 4A82A 4PXAA 1LWEA 1RW4A 1XX6A 2A8YA 1JAYA 1HDCA 1T2UA 3I6MA 4RKRA 2O52A 4QYIB 1X60A 3KYDA 1GTJ1 1V4NA 5IARA 2ZJPQ 4NDNE 1C7RA 4AZ3B 2W6JD 1ECBA 2G67A 1GZ5A 1CYDA 3CNLA 1B00A 3WLQA 1MABB 3TO8A 3OG9A 1F1BB 1S79A 4ZVRB 4I5GA 1R8QA 1IBLJ 3QEMB 2FN8A 4X8LA 1VDMA 4MPPA 4XDCA 3TQTA 4TM7A 4RKYA 3NR2A 1TQ6A 4BX9A 1K5DA 4BN5A 1DRVA 2IA6A 4G5YA 4ZGGA 5GZ1A 2MY8A 3EAFA 3SX2A 1NU8A 3WLSA 2HMAA 1N33J 1ZCBA 1A0OB 3UCZP 4N18A 5K4GA 2UUBJ 2GESA 3G68A 2XBPA 3QWIA 1E8DA 1S1WB 1FU4A 1WI8A 2B34A 1W6RA 4C6TB 1EVYA 1P1LA 1N2BA 1TU3A 1US8B 1Y8QA 3NORA 4MQUA 3THXA 1DBVO 2G25A 3CN7A 4EY7A 2GZAA 1S9HA 2N1BA 1B42A 1E4EB 1YDHA 3ETGA 1SIWB 2B99A 2CIMA 4WJKB 3K1AB 4KYIB 2NZ8A 4JY7A 4KWEA 3UNGC 2PL3A 3S1LA 3VO8A 4ALKA 1HLWA 4BU1A 2ASJA 4IIDA 3TQHA 4UOGA 4KH0B 3I8OA 4WXEA 2R1VA 3M05A 2PZKA 5BSTA 4B76A 1OQAA 4YCMA 1UL3A 4IFVB 1XKXA 2RGDA 5FUXA 3QYPA 4A8XA 4QPNA 1XEXA 2CSXA 2IU6A 3KOXA 1GKLA 4EJSC 1QQTA 1K7EB 4C43A 4D0LB 1WHSB 4FBLA 4GOOD 1ZH5A 4N03A 4E2XA 1OGJA 2QAGB 5KPJA 4ZN1A 3F96A 3WICA 5H02A 2HMWA 4NU6A 4NKRA 3QNMA 4NYJQ 1PHPA 3PPYA 3TAQA 1U11A 4KQMA 2F40A 1PNQA 2J3LA 2AVNA 1JHQA 2GVZB 3NHYA 4E0DA 3UG6A 5HGJA 2P1RA 4Q9NA 3BQ2A 3BWYA 1IOWA 5CX4A 2WD7B 1U65A 3TOQA 1W2BR 4BKRA 6REQA 3FB1A 4HBZA 3HSZA 2PGXA 1CUCA 2OM2A 1KEWA 1JAXA 5KVQA 4E15A 1PNTA 1HF3A 3IIJA 2GCOB 1O89A 3O0TA 1Q74A 2WSLA 4NHOA 1ZIDA 3M6LA 4V1CB 2WVFA 1T8UA 4NOKA 4CLZA 5HUJA 4NJMA 2H8GA 4OF4A 1A2KC 2DUJA 3G59A 2XCOA 1GQRA 3VKUA 4GO5X 1WOYA 3CCJS 3TB6A 5A8KA 2XMZA 3CW2C 3AUXA 5TMDA 2ZI6A 1P45A 1SO8A 1SGWA 4HDOB 1OQ3A 5IW8A 3OW2R 1N5YA 1NU4A 1UZAA 5TT0A 3L6EA 5ADWA 5JCOC 2B51A 4B80A 1UP1A 1O6XA 3LP8A 2QZ9A 2G08A 1UPAA 3STHA 3V3KA 4NESA 2CPJA 1HNIB 1QAJA 3GO4A 3VOBA 4JI6F 1SB6A 4QPXA 2Y1OA 2RHOA 1ZP6A 2GCGA 1LWCA 2VYFA 2HW8A 2W7TA 1OHHA 2MKHA 2V0NA 2PQ2A 3HJBA 4RXUA 4JELA 1KOLA 1UWAA 4DQXA 4J7XA 4U2KA 2XD9A 5CCLA 2RHGB 4D0SA 1USVA 1GTZA 4Q3OA 2HQGA 3OSUA 3TP2A 5K0SA 4LFAJ 1EWQA 3CVUA 3FWYA 1NJGA 1RT5B 2D5AA 3X1MA 1U3CA 3AKZA 5HLFB 1E6YB 4XSVA 4EABA 4Y2PA 2OV2A 3FF1A 1V4BA 2P4EA 2BDUA 2JASA 2IF0A 2E7VA 4WZAA 3GRRA 1V8OA 2ZWPA 3WYCA 4WFBQ 3OCVA 3ZN2A 1J5EJ 4FSXA 4KFRA 5AFSA 1PT6A 3NHKA 3V6DA 3PZRA 4F96A 4HD8A 2JK1A 1COWD 3H6GA 2EWWA 3E8OA 3OLQA 4JI8F 3ZU5A 3QLHB 1QU3A 2HQCA 1HW9A 1EDEA 3P5BA 3JQJA 3MTBA 1Y8AA 2GF0A 2E1PA 2AG8A 3PFEA 2HXSA 3N2ZB 5E2BA 3VAHA 4ZQBA 2OKCA 3HWRA 1O94A 4B9MA 1N4LA 4O2AB 1DMRA 3I62A 2XYHB 2R6AA 1V35A 4MVJP 3ZHYA 2AB0A 1KZ4A 2R8ZA 3F1LA 2GJFA 4L16A 2HF9A 2W9BA 2CNOB 2G5TA 3O03A 2H3HA 1T4BA 4FDMA 5A5DA 2HHPA 2D41A 1FSZA 1K92A 3WGJA 1OXXK 5GVQA 4OQLA 3A9SA 3NHJA 4Z0PA 1STOA 3LQKA 4NLSA 4EHBA 5J2NA 3AQIA 2L9WA 1UMDB 3C41J 1VM6A 3CGWA 2X7XA 5THWA 5AK5A 1UXGA 4J3NA 5KT2A 4K9OA 2I2BA 3B7PA 3V6KA 3VC2A 3FEZA 1UM9B 1RDFA 3KCQA 5CYMB 1QFXA 1GSIA 3FVTA 4B46A 1IPEA 2ZIEA 4QOEA 1IKXB 2ZUAA 3W9IA 2C4TA 1D9ZA 4LYJA 3UWMA 3MTDA 2I4TA 1SCAA 1MZPA 2HMIB 2WDPA 4D3ZA 1UAWA 1FEHA 2MJUA 1OJ7A 1PNVA 4YJGA 1JWBB 3JD3A 3C1TA 3HB9A 3HA7A 4POAA 2ERCA 4IEEA 4A8PA 4PO8A 1YZVA 2BFOA 1TCBA 4XEHA 1UMJA 2I5JA 4BLPA 1IQRA 3TRJA 2VSXA 3SQDA 4PPZA 4ZEWA 3SBEA 3RLIA 4ENUA 5A3QA 6REQB 1T3NA 1GMVA 3AV3A 1Y9ZA 2VDRB 4DHWA 3GGDA 4L5JA 1NVEA 1F6DA 1T9WA 5LQJA 2V7EA 5EKTA 4INZA 4YEDA 1IN4A 3PNIA 5K8LA 1CRWG 3EW9A 2VASA 5JZMA 3ZNNA 5K3CA 4BDTA 1IOVA 4DU8A 5H9WA 4MRSA 1NJWA 3B85A 3KKKA 3NUQA 5JCZA 1RBAA 4Y6LA 3LA6A 3ZE9A 3FWKA 3KALA 3SX0A 1Z63A 1RA7A 3FBGA 3G7NA 2ZR7A 1Y5MA 1P3Y1 4Y3CA 1CUSA 2C92A 4AZTA 5F8IA 3C48A 1Q16A 4D7AA 1P7WA 5K0ZA 2O1SA 3IHLA 1URRA 2A3RA 1EWTA 3CH6A 4QRIA 4PLZA 5D86A 2DQZA 4RJ2A 3RYHA 3I42A 1P1CA 1KYIA 2GA9A 1SY7A 3WJ1A 2HEIA 1QORA 5EJFA 4DJ5X 1XZIA 3TB4A 3GSDA 2F4VJ 2Y8EA 3QK7A 2AMCB 3ETCA 3FPBA 1KK0A 2VHQA 4ED1A 3E22B 3A28A 3T3IA 3FMWA 1P19A 2CJWB 1CVRA 1ABBA 1A5TA 3WA7A 1KMNA 2ZJYA 3ITDA 3DE5X 1ORDA 1VPVA 4PXDA 3DVRX 2VJCA 4ZEMA 2WE8A 1Z2ZA 2C9ZA 3OBIA 3ZTOA 3MEQA 2SCUA 4FF1A 4C98A 4JROA 2WQ6A 2E9RX 1W48A 1V96A 4QKQA 5FWXA 2N46A 1FA9A 2FLKA 1A96A 2H7VA 4DIEA 4WUVA 3ZWCA 1RT4A 2FOXA 1RI3A 2I4NA 2P30A 1R0ZA 2YW9A 4I19A 1KORA 4LF5B 1UCFA 3NDRA 3H5AA 1JU3A 3G8QA 5JJLA 1N7JA 2O3UA 3BGSA 5CUQA 3DC7A 1EUYA 4K8RA 3ZTYA 1O57A 4P5DA 2X3DA 2BDEA 3CC2S 1YIJS 3IMCA 2OGZA 3WLHA 4MUYA 4CMCA 4R31A 2J4CA 3FJOA 2NAPA 3DM2A 5AM4A 4AICA 3R3ZA 3HD1A 4EPRA 1N34F 4AU1A 3PEEA 3EGDA 2PU7A 3S3TA 3C3BA 1RWOB 1N6KA 1ZOOA 5IM0B 3H5OA 1DQNA 5DM2A 4F2RA 2BQUA 3OCWA 4B5KA 3WSWA 5DNEA 4F3NA 1S8NA 3WMWA 3JD2A 4AT1A 3IR5B 4MVJF 1E9RA 1E18A 1FB5A 2H18A 5L1KA 3LHIA 1Q53A 3GFTA 1R0CB 4K9KA 4KO1S 3FSYA 4JBWA 2AXNA 1TCVA 1NBEA 1JHDA 2QZJA 3BBPA 4R9UC 5KZMB 2JIQA 4A10A 4YFVA 1FRQA 4N5DA 1GGKA 1PFKA 2FSIA 1YQHA 1M0TA 4K9SA 121PA 3H5RA 1T3TA 1QVRA 2OO3A 4MVJE 1R6YA 5GMEA 1KZGB 5DV9A 4KO2S 1QCCA 1RB0A 2I8EA 2YNIA 3C6TA 4ZOEA 2J3DA 2GZHA 2A58A 4IKAA 2PI4A 2JKVA 3BCSA 2CVZA 4LBWA 4TYMA 4EMSA 4CLRB 4JBHA 1TLTA 3DPIA 5HBGA 4J2TA 4Q3BA 3B1WA 1B8OA 3DE4X 2ZUEA 5CB4F 4S0ZA 1U04A 3LYLA 4ER5A 4ZIRB 3NWPA 2FQQB 2DR7A 4IIGA 3FXAA 3ZE1B 4GDMA 3ZKWB 1V9LA 2OHHA 3P9RA 4J4BA 2RKIA 5LLSA 1U3TA 3N8DA 1XEXB 3NX4A 4KSCA 4OL0A 1K7XB 2BUCA 4Y0VA 2HWXA 4NCGA 1A9XB 2K2WA 4MJXA 2QG9A 3MTEA 3AH6A 3DOHA 1PCAA 3GDFA 1RSZA 2Z8XA 3B36A 3AHFA 3P0HA 4ENVA 2LLZA 2BONA 1LWNA 4L4UA 1GPKA 1REGX 2FYTA 2ZNYA 2FJAB 1N32F 1J2UA 4AJNA 1JIQA 5ETKA 5IFLA 5H3CA 2Z9CA 1XCGB 1SG9A 3UW1A 4ZDJA 3KNGA 3GLUA 2D4HA 4I6GA 1Z6QA 4IRXA 3H05A 2NTYC 5AKHA 2HQ1A 4A0SA 3SG0A 5AKEA 2Z58A 1A88A 3IO3A 1Y1QA 2VRCA 1KQFB 4AY4A 3KJVA 4EUSA 4WE1A 4F2WA 1OREA 3HBNA 3IAFA 3MZ0A 4ND3A 3L1JA 2TECE 4DT1B 1GEEA 4LJ9A 3PKJA 2X0IA 5I3ZA 4WK6A 3ACDA 2ZRPA 4B3TJ 2QT7A 3NJ4A 4KZKA 4YRCA 3AW9A 2RHJA 3I1YA 4U9IS 3VH4A 3QRRA 4QBTA 3IAM6 2AFVA 1I2CA 5DTEA 1T0HB 2HDWA 5BSFA 1NI5A 3GRUA 4Y1RB 3BS9A 1KR5A 5D0GA 2GDJA 2C2OA 3A3KA 3RYIA 1SJ9A 2B5JB 1U09A 5L3ZA 2XDQA 3QLVA 3O2QB 3HY3A 4CCYB 1L3BA 1L5WA 2MQ8A 4HZUA 4KR0B 2VNHA 2QTMA 1SL0A 2AQKA 3FFWA 3MD0A 4PGHA 2OO5C 4MQFB 2UU9J 3RTDA 3AEYA 4DZTA 3I4FA 2X0NA 3Q12A 4JB3A 2M6RA 5DXFA 1Z7YA 4NX2A 2Y0BA 3JYLA 3KZVA 4HNGA 2KMLA 2F8LA 3OTEA 4WI1A 4USJC 4Y2IA 4A9AA 1Z0ZA 3NV7A 4KIJA 1DJNA 1Z0AA 1DTQB 1GMUA 4G07A 4AVYA 3HP7A 2V8VA 4Y2CA 1UWCA 3B2EA 3GLFA 1YE3A 4ZA1A 3I5YA 4DLLA 1YSCA 4JYPA 2K06A 1FTRA 1YV9A 3W7AA 1U6JA 2IHVA 2C8VA 5FBWB 4Q4HB 1G9SA 1YS2X 1SA0B 5F1YA 1U28C 5C7IO 1VK3A 1WXHA 3G8BA 4O4JF 5CDFE 4DPUA 1G2IA 5AXDA 4RH1A 2KSQA 4Z4GA 3CX4A 3NRBA 2KH9A 3WL6A 1I3MA 4JCCA 1C80A 4AN0A 3V6DB 5DBEX 4R5PA 3MNFA 4KREA 2V8GA 4Z53A 1MJ5A 2JH3A 4CL2A 3S6JA 3H9CA 1XYVA 3IJRA 2LBPA 4B3OA 5IYZA 3GELA 1BLUA 4BXOB 5CJPA 1K47A 3E7PA 3KHRA 4MP8A 2HI0A 2CJYB 2F9DA 2J4DA 1LNQA 1JHXA 1FT8A 2ZTUA 2FZ4A 3CT6A 2LQ9A 5DOZA 3KYCA 2BD0A 5G0VA 1SXJB 4INAA 4MA4A 1DO2A 1SQSA 2QRMA 1MAHA 2VPZA 2CXQA 3W2VB 1POXA 1U2QA 4EGJA 1CX9B 2NSJA 2MGZA 4PHCA 2GIRA 2JKYA 3C6XA 1HNZB 3PWSA 1U1FA 1HBMA 4X7RA 4PLFA 4UBKA 2AFHA 4NYZA 2FW6A 3FMFA 3VHXA 4K0KF 3CVYA 4MFBA 3BGRB 2H48A 3F6RA 5LKRA 1OLXA 1LBHA 4RTKA 3D0GE 1P75A 4WY5A 5ALFA 1XLVA 1QH1B 3HU3A 4J9OA 1NTOA 2PD6A 4XJVA 4UZSA 3SNHA 4TRRA 2R6R1 4QQNA 3O94A 1I7PA 2PLNA 2RKIB 3EZ9A 5D8DA 2G4LA 4KE8A 4J1NA 4DREA 3PX2A 5HQ3B 1WPRA 3P96A 1YR7A 2AN3A 2EHJA 3G0GA 3KRTA 1SU4A 1DKRA 3OTDA 1SCBA 4HNVA 1N4DA 3F41A 4LBYA 4DR2F 4ESVA 1KMCA 2CNWD 1YS4A 3PJEA 1SKUB 3HRKA 1BE4A 1FD8A 3Q85A 3A3OA 1SOVA 1KDNA 3QX3A 4KE6A 3E01B 1PF7E 5L4NA 3ELYA 5DK4A 2O54A 2WG2A 3GROA 3MSXA 4KFTA 1NVTA 2BISA 2BW0A 4KQFA 1E0SA 1I2ZA 4HVCA 1X5SA 5LMNF 2VZLA 3C3WA 3RNLA 1GVHA 2W2OP 2OMKA 5DW0A 4I6YA 2AG0A 1WBBA 1LFPA 1LVUA 4OUDB 2XDWA 4JI2F 5FFNA 3O75A 1B74A 3T9FA 3AWIA 1YU6A 1JA9A 1IBMJ 4BB5A 2WHRA 1NPTO 1XEZA 4YRRA 1F0YA 4C8MA 1N9KA 3H9UA 3HZHA 2LYVA 4HV4A 3TUJC 3HA3A 4C0BA 2ODQA 3RYFA 2VWHA 1UQTA 2GM5A 1H8HA 2F1IA 4EHLA 3NDBB 3JAMA 2PRIA 3D3JA 3Q0TA 1AT1A 3IPXA 4CF4A 5IDVA 1NJYA 1U2DA 3GFBA 2PL9A 2WWFA 4DIDA 4G6VB 3TQIA 4MWTA 1GZ3A 3PX4A 3VU8A 3PHLA 3CW9A 2DB1A 3P5SA 5EVJA 4MQ4A 2Y68A 1X87A 2ZRAA 3LC0A 1NZFA 1QZ3A 2PO7A 4ETIA 2YJ3A 4XSHA 5JSQA 1BRTA 4JB8A 4I36A 3ZHUA 1YUNA 3CXRA 3HZRA 2JIZA 1BHO1 5GADU 5FUQA 4DR2J 4TZKA 1DRJA 3A6LA 2P5YA 1CDEA 4PLYA 4LQ4A 4KXFB 2ZKTA 2JCBA 2PGNA 5SY9A 4IRKA 3LJKA 3FUVA 1DFDA 1CQIA 2BC9A 2G1AA 3ZNUA 4W6QA 4D9CA 3MWDA 1G0OA 4JR0A 1FMTA 2PQ0A 5BW4A 2K3IA 4BNXA 4J0QA 3QLUC 2NQPA 5TE9A 3PJGA 3HVAA 3OJEA 1UW9A 2UYGA 1WORA 4F9GA 2DEUA 3TA2A 2UZ4A 4KVZA 1Z33A 1UOOA 1D3WA 1D5WA 4QBHA 4O59O 4MRMB 3R0XA 1U3WA 4J9QA 1EHIA 1LC0A 1PIWA 1L5QA 2UXBB 1KQPA 3R6TA 1CJTB 2WWYA 2DGXA 4OA5A 3R7WB 2FQYA 3ZJVA 4G1QA 1JQKA 4COKA 5IM0A 3QKIA 2ZB2A 4B7UA 4K0KJ 2O14A 2C5BA 3WYBA 3HYRA 4GMGA 4C0QC 4Z86A 4A8MP 5ETPA 3TXYA 1BHQ1 3CUEF 4PR6A 4PCUA 5T4BA 1GRNA 1G9TA 3PUWA 5LCXA 2ZRKA 2WMOB 4S0MA 1I1GA 3QPVA 3TIVA 2XOKD 4OJTA 1KQFA 1AE1A 4J37A 3F49S 3MMBA 3OCCA 3K09C 5FLXA 4L02A 3I6BA 4OATA 3NXZA 3Q40A 1KJQA 4CLEA 1YL6A 4TVOA 3ADBA 2OGUA 4Q2MA 3VTAA 1XNRB 4P73A 1WY5A 3IP0A 5B4UA 4ADSG 1XMQJ 2VQ3A 3OXFA 1HRDA 2CPYA 1TFRA 4LC1A 1N1EA 3IQHX 2EFVA 5GADI 3RODA 4O1IA 1U1RA 2ZRHA 1DG9A 4GAEA 3HMJG 3RUDA 5I42A 1G38A 5HMWA 3BXXA 1WXWA 1I2BA 1OASA 1QV9A 5FR1A 4WT7A 2BMFA 4FBUA 2O01C 4YASA 3NG8A 4PC1A 4H60A 2JVRA 3W7VA 2F5GA 3QOWA 4EBCA 2HWKA 2RGNA 4QHYA 2JG3A 3JQDA 3GFGA 4C87A 1QWSA 4U7WA 1TFUA 3TVYA 2IEAA 2EKZA 2JJ1A 2C2DA 3EIWA 3A1VA 4C4SA 4MWZA 4B3HA 4HFNA 3LF1A 1XE3A 1BEEA 4AX8A 4P7VA 1NVXQ 4MH0R 1DHMA 3VAZA 2A0FB 4LF9F 2I91A 4RIFA 3SDSA 4BC1A 2I66A 3C7KA 1TCUA 4YXWA 4DA8A 4NRUA 4MTCA 1BYIA 3V1TC 4AP9A 2CUNA 2VHJA 3AB8A 1QAXA 3RT7A 3PC8C 2H17A 3INRA 1JFLA 1G5HA 2Z43A 1P7YA 2QRHA 1R8JA 5DX1A 5CTAA 5KWJA 3IQIX 3JQRA 3WFZA 3R27A 4LISA 2DF8A 3A8TA 5A7FA 1AXQA 4I5IA 4BGVA 1U2RA 3TIGA 2W6ID 1R5JA 2EP5A 4TKLA 5DBGA 2ZSJA 3VOTA 5FXMA 1AMNA 1KNQA 5I3QA 1KH3A 4YQWA 2Z58B 1QU2A 2W8KA 1SUBA 1DIAA 4XYGA 1DCKA 3ED1A 1C2PA 3PDHA 4NWIA 3AM4A 3L1VA 1HFKA 5AVKA 3S1AB 4FFPA 3D9QX 3EMBA 4YRNA 2O3SA 4ZHRB 2FXVA 2HZ7A 3ETOA 5IWAF 1HKUA 1I0IA 4DMGA 4TU7A 4YRPA 2L19A 4YEAA 3T15A 2XE6A 2BJDA 3HB1A 5KFEA 4M7PA 1PQWA 2PBRA 4A27A 1PZEA 3A3PB 5INTA 1PC5A 2QR5A 3WO1A 3EDRB 1ZU4A 4NDZA 3M6XA 3WBKA 3QFTA 3KSAC 2UVDA 4L8YA 2FV8A 4B43A 5TJ9A 4OKSA 1RWPB 3KX2A 1N34B 1EP1B 4LBHA 3N2GB 5FBKA 5HQTA 1U5AA 1U98A 2WYVA 5LUBA 4HADA 2LIVA 3WL8A 4ZVOB 1ZJ6A 3PNVA 4LSNA 4ED5A 3GNSA 3L1HA 4Z4QA 1BWRA 3G6XA 4XWAA 2UZ0A 3C39A 1RLDA 3UDCA 3G1WA 1Y6FA 2FK8A 3HXPA 1TUEA 3OZAA 5HKAA 4A0HA 3NBQA 1G63A 1HBMB 1UK7A 1AGPA 3LLMA 1DRKA 1RTJB 1ENYA 4ZCSA 2BGTA 3EWIA 3KYDB 1D6JA 2IEDA 1HHQA 3QF4B 4HZUB 1RD4A 4E09A 3LBNA 3NPAA 3LANA 4RDIA 2IM1A 4J49A 3U7QB 1SVDA 3HHLB 4RV4A 3HJUA 2DH5A 2QPLA 2E4UA 3C1UA 4ZT7A 2RH5A 3MYYA 2IYVA 3CINA 5EMNA 2XGQA 1T10A 1YR8A 4XLLA 3Q8UA 3HJFA 5IDWA 4KGXB 2DUUA 1KYVA 1U0HA 3M3HA 4YJ2F 4GPEA 2Y0BB 2Z8YM 2B8NA 2A67A 3HVHA 3U80A 1Q1KA 2FDNA 1JLCB 3V4OA 3KUUA 5I7RA 4FFVA 3QELA 5K4HA 2PT5A 4Q7MB 1RAGB 3WQSB 4L57A 5IBQA 4OZ3A 5A4KA 3OOJA 2VKTA 2ZJBA 2WAOA 1AZSA 3LHSA 1QAIA 3H0PA 4PWUA 3OQMA 4IHJA 5K5EA 3V4IA 1T6ZA 3MM8B 4CKZA 3ZWMA 1YF3A 3SZ3A 2C31A 4CWBA 3OZWA 4YRJA 3MI7X 2KXFA 4R40A 2C5HA 1J5PA 3TRFA 4JLNA 5EWMA 4QE3A 1VHTA 3Q9NA 2BM0A 2ZBVA 1HW8A 2EBUA 3HADA 2DYKA 1E3SA 1CY0A 2Q62A 4I1OA 2LRHA 3R5HA 1J5OA 2ZRCA 1E3MA 4OAPA 3CCQS 3JD0A 3ZI4A 5HE8A 3JASB 4V1CA 5KFLA 1CUIA 2OD6A 3K0AB 1EARA 2F8TA 2R5NA 3V81A 1C9NA 3D3KA 2ZP1A 4CO3A 4O33A 2CNLA 1NDHA 1ISMA 1JHPA 3OE7D 3V7FA 4H1UA 1UK6A 2X22A 3IIMA 4JLMA 2QZ8A 1KKHA 3I5XA 3U4QB 4WD3A 1XR5A 4ZOLF 1A2QA 4C0WA 1NH8A 4CCYA 3WRWA 1K27A 2GCIA 5ESWA 3PDIA 1U7ZA 3EG5A 4Q9DA 1EB8A 5C2CA 2I2FA 3Q11A 1AT1B 1G20A 4YAUA 3QYYA 4MWDA 2VR1A 1KYTA 4NMXA 1NU6A 1PT9A 4C4AA 3GI1A 4DCOB 4EFNA 2WM2A 2O3QA 3FCXA 3EHDA 4BIIA 1GITA 1WZIA 5E2AA 1TK0A 2HWYA 2XY7A 3O4IA 1Z7WA 1NK9A 4YC7A 3R0VA 4LDZA 2JBAB 4IDKB 1NEEA 5BQ5A 4JWKA 3KT3A 3U1TA 1ATIA 1RK8A 4F6RA 1FVFA 4J2HA 3QLJA 3F5FA 2O2GA 5F9MA 2KDOA 3FEXB 1NF2A 1V0JA 4CT9A 1GGFA 1MG5A 3KZMA 4IPTA 5DI9A 4IFYA 1E1RD 3RJMA 4TYYA 3GYBA 2OI2A 3KZKA 1GAEO 3HO8A 2KM8C 3OEWA 2I7DA 4O5OA 4MVXA 4KB7A 3D6HA 4DMRA 3KZ1E 3R3SA 3JAKA 4JBGA 4EATA 1S96A 5DGIA 4CYUB 3QMVA 4NLYA 4ALNA 4DDMA 1LPSA 4LRAA 5F78A 4MUFA 4U3JB 4NI2A 4Q4LA 2YNHB 3G8AA 1EVKA 1RQGA 4JODA 1OI3A 1RI5A 2X3UA 1CJUC 2DHQA 3N3AC 3GDWA 4OFXA 3ZDYB 5BW6B 3OEEA 3VR2A 3EZ6A 4OZ1A 2QMUB 1NVBA 1WCYA 5IVKA 3IP9A 1HR0F 5IDQA 3WV4A 3NL0A 2I62A 4WWHA 3LFUA 5IUJC 3DHYA 2Q5FA 5IPFA 1F2VA 3GTYX 1C0TB 1FRIA 2WAMA 3WSVA 4ITRC 4QTYA 3SSNA 1T94A 1HBOB 3EFHA 4PSAA 3T3NA 3Q98A 5LD2B 4AL5A 1GAQA 3CVXA 1ULSA 4E2YA 3N39C 1OVMA 1MG7A 4A36A 2BVNA 4US0R 1EXWA 4ZV7A 2PEZA 2UXCF 4QASA 5HCIA 3MPUB 3AHIA 3CC4S 1HQDA 4FUQA 2VAMA 3L8MA 5LMNB 3Q41A 3A25A 3CVOA 3VAGA 1JSLA 1J1ZA 1NF9A 3FMBA 3SHQA 2PUCA 2V7WA 1YI0A 3W5HA 3N2LA 3HUDA 1Q5YA 5H0IA 2VJQA 1JEAA 3L7KA 1NBAA 1RAGA 4ZO9A 1K89A 2AW3A 1RM0A 5E41A 5KTNA 5J2PB 5K99A 4YJ2B 5EJIA 2PWZA 4EBEA 2X4GA 3HMKA 3IP1A 2B8WA 1UCNA 2O67A 5AI6A 3IAS6 4CKEB 1RACA 2UUAF 2CQIA 3DOLA 2YKOA 1RT3B 5JSHA 4C7VA 3SDEA 1ULRA 3H9QA 3IURA 1N6QB 3MPWA 1S9GB 1RYNA 5C7OO 2N3LA 2IPOA 4WK0B 2IRUA 1OSDA 1ZD9A 3PNLA 1EAMA 1LF0A 5CT4A 1WEZA 1X9MA 1WSDA 2XSZA 1IM5A 3ZV5A 1QE1A 1CS0A 2KL8A 3F6PA 1JH9A 2VUUA 4Q5IA 3QMQA 2ZJ4A 4YDDB 2E18A 2G1DA 4EJ0A 3DVLA 2SKDA 5D1NA 3CRVA 5GJVC 5LQSA 5CYQB 3RSCA 3CUWA 3BRQA 4KIFA 2QXYA 1AF4A 4RD4A 3AEXA 4FKZA 2V6IA 2A59A 3VHLB 3S68A 3C3AA 1THTA 2EW1A 3ZZMA 4IFIA 3N4WA 1FY2A 3R7NB 3OTGA 5WRFA 4BGIA 4UMFA 1AXRA 4XFDA 3GT7A 1XN1A 4XKJA 3LF2A 3DXSX 4RUBA 1PJCA 3TFOA 1ZNQO 3QG1A 4DXHA 5A1JA 4U8VA 4AM8A 3RBAA 3JWJA 1IN5A 1X39A 3V3TA 4MV6A 1WDTA 4WWSA 3GIWA 3ZUPA 1HG0A 4E5SA 2I6FA 4IHKA 5EXTA 4LJLA 3UT0A 3VYSB 2PKQP 3KZNA 5LBUA 1CEZA 3L7IA 2BR5A 2YPYA 2ZCUA 2BHNA 2O3DA 3ZXWA 3TOVA 3OZVA 4EDHA 2RFLA 1RMQA 4PO1A 2Z30B 3AB3A 1TGYA 2FFQA 2FWBA 1CIJA 4AJHA 2GMLA 5LU9A 2W9BB 1ZJZA 3ECSA 3G4SS 2K3KA 4RANA 5MF6A 1SFRA 1X42A 2XCQA 4F71A 5BN4A 5CB0A 1GA4A 10MHA 3EOZA 4ZO7A 4LR8A 3DAPA 2HIGA 3H4TA 1U8SA 2VPWB 2W0SA 1BQEA 1O77A 2X7HA 3KHLA 1HDIA 3G88A 4R8MA 5G4DA 2ZJFA 4UMEA 3Q5GA 3RQIA 1AUSL 2FN9A 3K96A 3Q8YA 4JYZA 2RRBA 4J6FA 3HCBA 4ZZIA 3EEIA 3OZGA 5IX8A 3KWMA 1C2YA 5DTIA 5LUAA 4JSRA 1S6PB 4U3JA 4GO1A 4A23A 4LF4J 2W4QA 3IBCA 4CTAA 2FX5A 3MD1A 5IP5A 1Y0HA 2W2NA 4RTSA 3DNFA 3EDQA 4C88A 3FY4A 3DEKA 3MS4A 4AG3A 3S29A 2H0QA 4AJ1A 4WPGA 3GIJA 1TK5A 2V03A 1DDOA 1U7TA 3K2IA 4OK6A 4ZOAA 2GMJA 3T1OA 5K0BA 1IRIA 4DPTA 2FZLA 2X19A 2PCLA 5EWMB 5LD2C 2DISA 2C20A 3ANYB 3LI2A 4JNKA 3R6LB 3EGVA 4WE1B 3ZQ6A 3W2GA 5JO0A 3N6LA 1KFSA 1WSVA 3QQCD 4MW9A 1F1JA 2WM9B 4MS4B 4JI7F 3DBLB 2M2BA 1N3IA 3M8RA 2HH9A 3PDUA 3ZR4B 4WF9Q 3MLEA 5BQXA 2EJBA 2WIFA 3BO2A 2NUPA 4RZ3A 2ID9A 2HSZA 2Y1FA 3EODA 2XUOA 1UODA 2GETA 3QFSA 4DRZA 3W2FA 3E2EA 2UDPA 4I50A 1TW3A 5TPWB 4M5HA 2NXCA 3CCSS 4NLQA 2E7ZA 4PXSA 2GBPA 3FLBA 4G1MB 2VJOA 1L8LA 1XQ1A 2N7YA 1TM2A 4BL5A 3N7AA 4EHDA 3ZHZA 1T3SA 2VUSA 5CIYA 1G20B 3VZHA 3KOOA 4XFKA 1REQA 2JHFA 1XMIA 4CKEA 1B4SA 2O0LA 1UT5A 2DH9A 2WB1D 4MUMA 1M6YA 3L49A 3U6KA 4WCDA 3AKDA 3M1VB 1KK2A 2C78A 1V8PA 3AERB 4OV1A 1Q11A 2UP1A 4D3DA 4XUGB 3GJQB 4PZ0A 3G6WA 3KLPX 1G16A 1DEOA 3MAAC 1WHYA 5E9AA 1PG0A 2CNOA 3DZHA 3GSIA 5T8KA 2Q4RA 1LW0B 2WW8A 1X7GA 3NNNA 4F6RB 2ZSAA 4YMLA 1GQEA 5ILQA 1RHUA 4OP2A 1VFJA 2XLCA 4H4CA 3KLHA 3AOEC 4QNRA 1O9HA 2IC5A 3OFND 2MR6A 1CQWA 3QKRA 2P2YA 5C53B 3E61A 4A03A 2ZTHA 2VDLB 2G40A 5HDBB 2JJ2D 1HHSA 1YIDA 2O3TA 3VSBA 2PG3A 5D4PA 2AGVA 2YCBA 1FQJA 4MYHA 3CCFA 4GOKA 3SHVA 4P38A 1DT5A 3WNBA 2BM8A 1M34A 2YYYA 1PL8A 3SCLE 3JQAD 4M0EA 2FPRA 2ZIVB 4XI9A 4C20A 1BKYA 2YXEA 4WZAE 4ECTA 1YOVB 4UEWA 4ILLA 1Q7YT 2P2LA 4BJHB 1JEQB 5LWHA 3FPCA 4CG1A 5K09A 3V8RA 5DSTA 1BHSA 3FPEA 1XJQA 3DE6X 3HSKA 1I1QB 4RFSB 1NB7A 3W2VA 3QX7A 5IM4A 1PR2A 5EY5B 2OHJA 5AW8A 1E6LA 4ZYXA 3RKUA 1GJRA 3TW8B 3E3NA 4EGQA 1FDAA 1WCIB 1JQEA 1XU4A 1KMHA 2AX3A 2P9BA 2O5DA 4PPDA 4QWWA 1KZ1A 4EW1A 4IDCA 1JEYB 1G5RA 5CDYA 3GBSA 1R0CA 4WP9A 5IAOA 4P34A 1Y4ZB 1NMZA 4J9KA 4JOQA 4PXBA 3LSYA 4PQRA 1AUXA 3EZFA 3I3OA 3BPSA 3P52A 2IEBA 1U3UA 4YROA 4PR0A 2LU1A 4FMDF 3ZO7A 3H04A 1L3KA 3CF6R 4BJ1A 4M0LA 4BDSA 4G81A 5EXDA 2MOKA 3HJNA 4TSKA 5K0JA 3P45B 2Q2WA 4Q4AA 1Q79A 1NJ2A 3DMYA 3HLYA 3OUUA 2VBGA 2EJTA 5IAEA 1OY9A 3RSHA 2I4LA 2E82A 3AB2B 3EGXA 1PKXA 4B3SJ 1N34J 3WGOA 1Q16B 1M8PA 5SZHB 4N48A 5AJ3F 2XTAA 4HQ6A 2XQGA 3HNOA 4FYYA 1QONA 4R9SA 2AEFA 1CP2A 2BHRA 4LTDA 2FC9A 2RHBA 4GYYA 4RE6A 3OE5A 5KSYA 1HI9A 3EDCA 5DNDA 4KMRA 1MV8A 2C57A 5JMPA 4L9AA 2QRLA 4KAFA 3Q8VA 2BCGY 1OFVA 3OCZA 3P9QA 4OYYA 1UAAA 3DC2A 3CVWA 1WSWA 4HQKA 1V3TA 4A0FA 3CN9A 1IZ8A 1IHXA 3EGWA 3CSKA 1JDJA 1K66A 1K86A 3DLHA 2I34A 2OPPB 4EEYA 3GRAA 3OU6A 4R54A 5EKUA 4TLBA 4F0HA 2FD2A 5DEOA 4R2KA 1H2TZ 4CIOA 4ZJZA 2HYIC 3PC7A 1BQMB 1SC6A 1OBCA 3HHKA 3IQDB 2W42A 1H2BA 2JBHA 2X5NA 2V96A 3MFIA 4FQ7A 3GFRA 2OGTA 1XQ6A 1PHRA 4QIVA 3NU1A 4LFCF 2HA7A 5P21A 3MTAA 3QU9A 1G21E 3QE4A 2QRPA 1VYTA 2B0GA 3KL4A 4NY1A 4PQUA 3SD7A 2CZCA 2XRFA 3FZNA 4FS8A 4HF7A 4I5DA 1R2QA 4LTMA 5I9BA 4BVFA 3QNWB 4HYTA 1JI3A 3G9TA 5J1EB 1XRNA 3C2QA 1BIFA 2GWHA 5EESA 1BNCA 2GASA 4DUGA 1VB3A 3KQNA 1NTRA 3RBDA 1GWNA 1F2GA 3ROFA 3JR7A 4G89A 1HLPA 4WCFA 3R7BA 3GCZA 2JLYA 5MN5A 4UZCA 1DT3A 1W1WA 4B3IA 5E0OA 1F3LA 5J1SB 3ZJ4A 5KINB 5FI0B 1JQBA 1OTXA 1YZKA 3QVVA 2VT3A 1XV5A 2EKPA 3L3CA 2B8QA 4G5SA 1V5FA 3F5SA 5IT9A 4DR5F 4XGKA 4EK9A 1P0FA 4QHTA 2YJ6A 1K2VN 5EGYA 3NWOA 4GBGA 3PEVA 4AG6A 2YWBA 4GWKA 1HMVA 3HXQA 4E4YA 1HIYA 1E4EA 1EDDA 1J0EA 2OBMA 2QFIA 2HXYA 4YAGA 1XAGA 4IHAA 1JLAA 2A5GA 2EBHX 4JH0A 1DTTB 1JRLA 4HDRA 1R0AB 2G1UA 4FQ8A 5E1OA 1CZLA 1ZNXA 4HQNA 3ZCPA 3E3XA 1QXSA 3B9RA 4UY85 3IGFA 2QGFB 3PYGA 4L74A 4HNAB 1LBIA 2BBOA 1EZ4A 4Q1VA 1CJSA 1CJMA 1K8ZB 1D2CA 1DJLA 5AUQA 1Y9EA 3BORA 3IJPA 2JPDA 2QU8A 3OA2A 1ML4A 1ZK2A 5A3JA 1KETA 2ZULA 4IR7A 4ZKAA 3K5OA 1CUEA 4EQZA 2R4UA 1ZH2A 2AF3C 1E7SA 1DC5A 1MC5A 1YBUA 4TV8A 1ANKA 1UMDA 3RYFB 2GFFA 5BNZA 3RRYA 5KTKA 5G1PA 3ONNA 4C0XA 3G8DA 1OFTA 2EF1A 3FYSA 2BANA 3KQQA 3TMAA 1MRSA 3T3HA 5IKPA 1TXGA 3NHRA 4EL0A 3CT4A 3S27A 3CD7A 4EKDA 3M4ZA 3BH7A 4WK3A 4RJIA 1UBJS 3NYQA 1K44A 3PYEA 1VHJA 3IUBA 3SJAA 2J33A 4RM3A 4FEAA 4LJ8A 4BWMA 3OLWA 2RC5A 2XB6A 5A2GA 2JIRA 2GGPA 3BE6A 3PC8A 1DPGA 1VQMS 1V11B 5FD8A 2CVIA 2PLWA 3W5SA 4FK8A 4MQ6A 2ZS9A 5EZ5A 4ZC8A 4PLGA 1JTVA 1IFXA 1GL3A 3W90A 1KVKA 5KYKA 5DLYA 5KG4A 1HC7A 1X7DA 4L8GA 4LHYA 4JOSA 1A7KA 2YRWA 3K0JA 2BXJA 1W96A 2QORA 3QE3A 3ESXA 1KR2A 5EERA 2Y1IA 1W9MA 3E2PA 4KWIA 3LKDA 1ODKA 3RB3A 5D84A 4A0GA 3DLEA 2CD9A 3POTA 3COVA 3DEIA 2XNKA 2B7BA 2FLOA 3BM5A 4NNJA 2O8CA 5IFMA 4LF5J 4KYZA 4O4LA 3EDYA 2WZ1A 3EXEA 4LOIA 2V5UA 4IWXA 1R8AA 1MGPA 2Z2KA 2J08A 3SQXA 4AKTA 3KPVA 2M6LA 1KXZA 1U8AA 2ZYIA 2B8JA 4I4TB 1LTKA 2DR9A 3JZAA 4RNDB 4P35A 3LW7A 3UOWA 1IQTA 5F76A 3W8FA 4DJTA 3LTEA 2HW3A 3DPSA 4EL5A 3BYPA 2DJ5A 3DBRA 1RXYA 1W34A 2HM7A 4GXNA 1HKAA 1WBJB 4KC0A 2ESRA 3EPKA 2GBIA 1XZJA 1NIPA 5F3WB 2XQCA 4GXRA 5EE0A 5LWQA 3DVSX 5EDWA 1OBHA 1S0OA 4C08A 2XB2D 3D6TB 1WG5A 4YMGA 4QU7A 3JSYA 3IT3A 3U4MA 2FI1A 4PC3A 4UUQA 2C3YA 3D7MA 4M76B 3FDSA 3HVIA 2ZATA 1ECPA 1DXHA 1PD1A 1T9GR 1JNRB 2RGUA 4MCJA 3QQ5A 1RLTA 2F48A 2QIOA 1B26A 1FP6A 4MK4A 5KFDA 1M2KA 3G89A 3NAQA 1QUFA 1XMOJ 5HTKA 3JZMA 3EOAI 2CXXA 1M0WA 3IAEA 3VNQA 5BNIA 5JG7A 3GPCA 5IC6A 1UKCA 1QTRA 1JLFB 3IA2A 2FFHA 1C1DA 1C3OA 4EB3A 2YY6A 3NT5A 4ZZ1A 1RWVA 4U39A 5DYGA 2HZVA 3GLQA 3JYHA 1ODLA 2RGNC 3NASA 4BRSA 4XQGA 4PQEA 2FGOA 1TLLA 2PCJA 1KLNA 3GYXB 3HP4A 1TD9A 1O7JA 4OHPA 5EIOA 4AMZA 2EOAA 3IG1B 4NU5A 1Y1LA 2FJDB 4F25A 1QOQB 1OI4A 4RNNA 4CEJB 1TO2E 2NREA 2FEXA 4B3RB 2D1SA 3WYAA 3R2JA 2ZBDA 2P7IA 2GJ9A 4RWWA 1PBTA 4WE3A 1UINA 4QR2A 4LC9A 4MB2A 5LP6C 3V1MA 1VCTA 1NPDA 2XMKA 4G56A 3ZLUA 3TQCA 5DHTA 1K7FB 1CC8A 1KSJA 3I04A 1VJQA 3COJA 4B6JA 4HNUA 4FQ5A 4DVGA 1WTBA 4YTEA 2Q50A 4G1EB 4CMIB 3P27A 3A1CA 1OBFO 5JCJD 3B1XA 1XRMA 2PX4A 1VRUB 3H25A 4QR0A 1OZFA 1Y34E 1SQEA 2IS2A 4QR1A 3X0DA 3RC1A 2ZJOA 1BQMA 4JUAA 1L4LA 1VYHA 4X4SA 1KFDA 3QP9A 3LPEA 2QTZA 2GHQA 4KXUA 3D6UA 4NBKA 2WONA 4AQ7A 4IQ8A 4M5MA 3WMXA 4XXHA 1QVFR 3WLPA 3MWKA 1NIJA 3PFOA 1ZN9A 4MINA 1U5BA 4O6VA 1EJ6A 4NLXA 1W5FA 2PS9A 2OFHX 4FNGA 2ODPA 5HJ7A 3VO1A 5BSGA 4HFJA 3UTDA 3QPAA 4RH3A 3FOCA 1RWWA 2QMQA 2EBFX 1GR1A 3DLKB 3LUBA 4J75A 3G7UA 3EE3A 1NMSA 2V63A 4MWBA 4F9EA 2QW8A 3M83A 2EFQA 4GIBA 3UAVA 3D2BA 4BO9A 3TL6A 3HCXA 1S48A 4RE5A 1M1XB 3QFHA 4YN3B 4B6FA 2C2YA 1A5SB 2VH1A 2CZQA 1YZLA 1GU1A 3Q1KA 1YI8A 2H48B 4BJ5A 2H31A 4GX0A 4P5EA 1RHRA 4A2WA 3NGSA 1JG3A 1EFVB 5BOVA 1G20E 3ITHA 2XZOA 3B1ZA 1SD5A 1VMIA 2F1KA 5H9FJ 1MKYA 1NP6A 3GQVA 1W49A 1GX5A 1YZNA 1IHPA 1SHJA 3DL2A 3A2MA 5GWXA 1KRHA 3L6RA 2QLFB 3LAMA 2B8TA 1PNRA 3G8TA 1RE0A 4AJEA 3TQSA 5IKEA 4K8OA 2FZWA 4O44A 3T1YF 1KFKB 1TKZA 3CDEA 3HLKA 4RF3A 3A05A 1ZW1A 1HR0J 1QIMA 3GH1A 1ODFA 1OX4B 2E5LF 1JS1X 5LYYA 2BFNA 3QF4A 4DLAA 3GBVA 4BWGA 3LP6A 4RWEA 3WNCA 2XZWA 1ZVQA 2FHSA 3E82A 2YQ5A 4CQNA 3U81A 4L8WB 5AKIA 3CUSA 3SJBA 1TF7A 1VCMA 1NMQA 5KX5B 2R8RA 4E22A 1BJRE 3EDRA 2I2XB 1UVIA 3PO5A 2XHZA 5BV8A 5K0FA 5AJYA 4HJRA 1UMCA 2BI8A 3OT4A 4YCDA 3H8SA 3RB4A 5TS2A 1C9DB 4QJ3A 1FUIA 2ZYRA 4JSYA 1M2EA 2BHSA 4LRDA 1XYGA 4J5OA 2IS1A 3N28A 4CF6A 2VT6A 1TL7B 1SU6A 2MT9A 3E2MA 4WCFB 4KBYA 1Z22A 1ZAKA 1DX6A 4FF3A 3QVMA 5EYPA 4EG8A 4B6PA 3DOKA 3EHEA 4E5DA 5EP3A 1E8MA 2DPJA 4Q4JA 3RANA 3TAMB 3FCHA 1KY4A 4P36A 3LC7O 2ZM6B 2AEMA 4M1ZA 4RIIA 4OYLA 3D3EA 2PE8A 1GZSA 5CH3A 4DRYA 4ALLA 1PBNA 4HVZA 4QQ8A 4MLZA 2AV5A 5E38A 3STYA 1UP6A 2CNNA 4FDVA 4DSLA 2CJXB 2Q1TA 4GRSA 3QUAA 5EFOA 3OJLA 4DM3A 4RTRA 1W4BA 1D6MA 1R0RE 4BCDA 3QEAZ 3R75A 3SZLA 1NAIA 2J85A 5ERXA 5HVFA 1P7ZA 4LOHA 3UMFA 4IRUB 1EM6A 1AGXA 3WRVA 4B48A 3O84A 3KD2A 4HGQA 2OO4A 5IBCA 1V41E 1ICIA 1YVEI 1A2BA 4HAZA 4G2NA 4D46A 1L3VA 4Q37A 3MVEA 4YAEA 1VQ6S 4DBLE 2IYNA 1C2TA 3KHHA 3BQNB 1MMLA 3PXCX 5DISB 2OE2A 2COEA 1G3RA 2JL1A 4MRRA 1KWMA 2ENWA 1JQJC 3A0RB 4AUKA 4RPFA 2O48X 2BW7A 4LGCA 2BOVA 4KO3S 5LXTB 2B4PA 1CNEA 3CBQA 4ZIVA 2WB2A 4I8IA 1XDGA 3CJQA 4Z49A 2XJ9A 1KGSA 4FYJA 2H2HA 2E9TA 4WPAA 2FTRA 2QEXS 1BJKA 4JV1A 1EX6A 4XVCA 3WGIA 3TZBA 3KR2A 1B23P 5EGSA 3MMPA 5JJCA 1Q21A 3QUBA 4ZGBA 3CNQP 5LZ9A 1MXFA 2IHKA 3MOGA 4BASA 1NK5A 1F9AA 2J3JA 3E7FA 3L40A 4M5NA 4TNOA 4EOGA 5DH9A 3PC2A 1G2PA 3L6DA 4JI3F 5D3QA 3DRSA 1XTKA 3AHEA 2RBGA 1AO0A 1DDGA 3IKJA 2CYYA 4LNUA 2KG0A 3IT1A 1DKOA 2UUCB 1BS9A 4BMCA 4OJHA 2B61A 5KT4A 1XZ8A 1NZDA 2C9YA 4C2TA 1LWFA 4A48A 2I03A 4LSLB 3QHQA 4JT2A 1O4VA 2DBQA 1M6VA 1WV1A 4UUXA 1KAHA 4M88A 4YMWA 3G5LA 5DZSA 4DVJA 4EAQA 3O8QB 4EBDA 2HVZA 5A1TA 4RA9A 5EKXA 4FNAA 4AJJA 1XRJA 3EZUA 3P9NA 5EMJA 1OTYA 4H1TA 4E5KA 3MR3A 3UUGA 4QPPA 1VP3A 3JCZA 4ZT5A 4MIYA 5M3BA 3GCXA 2HC9A 1EBBA 1JT2A 3QHAA 1U1IA 3ADOA 2XKBA 2AOTB 4OVKA 4YHBA 3MWFA 2HCBA 5EI5A 5AP9A 1SVSA 1FLNA 2ZW9A 3PR3A 4F5EA 1IM4A 1WWKA 4NE9A 3HBJA 2BV3A 1VCOA 3VPGA 4QPZA 3E84A 1MGOA 1RT7A 1QDEA 1KI6B 1GADO 4P7KA 1NK6A 1X1TA 2R42A 4TUYB 1QCYA 2J9GA 1VLJA 1OS5A 2ROEA 4NR0A 2V0CA 4NK4A 3CW8X 5FNZA 2BEJA 4JJGA 2QN6A 2EGGA 3JPWA 4KAIA 4M86A 1BE6A 5KFKA 1NJSA 5AOAA 2JLFA 3EMVA 2F00A 5HPYB 3AF1A 2C58A 2KPOA 4NULA 1GNVA 4MYTA 1BDJA 1RJDA 2LQJA 3H97A 2GVDC 2GM9A 1EP3B 3CDBA 3K3PA 4GC6A 1IQUA 4HXFB 5FUVA 3WWOA 2FTKE 3GNTA 4JZKA 2DTXA 3VR5A 3IO1A 2HX1A 3CNEA 1L7AA 4KPFC 4L8FA 3S44A 1OOEA 2NPFA 3C8DA 5JAQA 5AW5A 3U26A 4MK9A 4BQPA 1WNTA 5EE9A 2NU8B 4UPVA 3I9KA 2WJHA 1TMGE 2ZEJA 3BMXA 4PY2A 4YJHA 4Y3UA 2E5LJ 1JB1A 1RTTA 5EOVA 4ETXA 2IELA 1T15A 3U7RA 2MZQA 4C1NA 5AD1A 4QGAA 4E08A 5IKMA 3I52A 2ZJ1A 2RD2A 1SH0A 4OGFA 4Y2XA 5DETA 1E7QA 3K5IA 3J80A 4O0MA 4EJSB 1XAIA 5JAHA 1JHVA 2MKIA 3ONFA 1BFKA 3SSMA 2TMGA 4NMMA 3I9V9 1B41A 3LQ4A 1O0BA 4ATNA 3OX1A 1P4HA 3NIFB 3T61A 4G9BA 4M9CA 4QOIA 3U7JA 4MGYR 3OZFA 5FA5A 2QMHA 2DNNA 2CKMA 1H0RA 2EYUA 2CLDX 3MUNA 4HWRA 4ZOQI 1YJAA 1Z47A 3GONA 4MKVA 1L4HA 1T3LA 2WP8J 2GAFA 4AF8A 2F1OA 2FW8A 4TN2A 3DDOA 1A6LA 3FNBA 4Q8EA 3T7EA 4N0MA 4RZIA 1Y5LB 2A86A 3KP1A 1RAIA 1R6AA 4H08A 1TK9A 1E2HA 2R6DA 4FDLA 3V6HA 4X4VA 1Z8FA 2WM8A 2VDOB 3IAHA 1I6KA 3FK4A 5A6WA 4AF7A 4N5LA 3V7UA 4C6RA 4LIPD 3TEJA 1EFPA 3I34X 3BJRA 1HL6A 4FJ1A 1G66A 1P29A 2XG8A 2BEUA 2R6ZA 3ROKA 4ASUA 4QBIA 3WRXA 4EFAC 1JYEA 2HBQA 2B94A 2JCVA 4UFOA 1FI4A 4EA8A 5B7GA 3QUQA 2WHQA 3H1BA 3P2YA 2I9PA 3KFXA 2BWJA 3DCAA 3FYHA 1R31A 1KSPA 3QIPB 2H0RA 4YY3F 3NALA 3DXXA 1M3SA 3K5HA 1JKJB 1TPZA 3GUCA 2B2NA 2R7VA 2WU0A 5DGDA 1O5OA 1WXXA 1P61B 4GM1A 2WTUA 2V6GA 2E4XA 2YCLA 3GX1A 3K5NA 2X0FA 1U7LA 2O8BA 3DV0B 4EU0A 4MVWA 1QRUA 4GOMD 4KAAA 1T4DA 4C4YA 1MAAA 2OD2A 4R83A 1E5LA 1QSSA 1GXSB 4ILMA 1S5ZA 1L9XA 5F1OA 2WZCA 2C5LA 5J4LA 1P9NA 4O4HA 3SCZA 2X2FA 5DCWA 2PXCA 4YPOA 4JV5F 3MMXA 4EBFA 1QO7A 1N7GA 1E9CA 4LXIA 3ZX5A 2PSHA 1TYCA 1JLQA 2DT9A 4M46A 3VJKA 2VJKA 3BWMA 2BACA 5KFHA 3I9OA 1JXAA 5GM1A 4RU1A 2WM3A 1TJNA 2AOXA 1JWWA 5KFRA 1TCAA 1SUIA 1NKCA 4U9HS 3DO8A 1XZQA 2Q99A 2XQIA 1ORWA 3PU6A 2KJVA 1L4NA 4Q19A 5CRIA 5C31A 4DDKA 1VMAA 1MW8X 4G8JA