3OBIA

Crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
285
structure length
285
Chain Sequence
HHQYVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFMRVVFNAAAKVIPLASLRTGFGVIAAKFTMGWHMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVSNHPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYMQILSDEMSARLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISHRDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVFTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a formyltetrahydrofolate deformylase (NP_949368) from RHODOPSEUDOMONAS PALUSTRIS CGA009 at 1.95 A resolution
rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
molecule keywords Formyltetrahydrofolate deformylase
total genus 75
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.10: Formyltetrahydrofolate deformylase.
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3obiA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3obiA02
1SC6A 1CDEA 1CDDA 4YFYA 2FGCA 4ZYXA 2BLNA 2QMXA 4ZYVA 5IT4A 3AUFA 5J9FA 3ENVA 3NRBA 4ZYTA 1UJ5A 2KO1A 4ZYUA 2P9EA 3N0VA 1RBZA 4M8LA 2JOQA 3TQRA 2JHEA 2QRRA 3P9XA 3AB4B 4PWUA 4R8VA 3TUZC 1RC0A 3MTJA 1ZPVA 4ZZ3A 3P96A 2ZHOA 4NMLA 3GARA 3DHWC 1MEOA 2F8MA 4GO7X 1LK5A 2NYIA 4ZYYA 2DT9A 1M0SA 3R8XA 5J63A 3Q0IA 4TTSA 3KWMA 4IO1A 1GARA 4Q12A 4X84A 1LKZA 2BW0A 4PZUA 1S3IA 3DHXA 3HHEA 3OFGA 2QMWA 3S1TA 2GARA 1C2TA 2H9ZA 3OBIA 2FMTA 2RQKA 4LUBA 3TUJC 1U8SA 3IBWA 4YFVA 3AV3A 5T41A 2P9CA 3DCJA 1RC1A 1UJ4A 4NV1A 3CEDA 3DDNA 3TUIC 1YRWA 2PC6A 3OFHA 3LUYA 3TQQA 4DS3A 3K5PA 1C3EA 4ZYZA 1YGYA 3IXQA 1MENA 3L7OA 3U7JA 1XTZA 4GO5X 4ZZ2A 3ENQA 1JKXA 2I9SA 3KCQA 2PA3A 2LQJA 2RE1A 4QPDA 3DA8A 1GRCA 1RBMA 5JJBA 1PSDA 4IQFA 4EW1A 1Y7PA 2YWRA 1YBAA 3AAWB 1RWUA 3LOUA 3MWBA 1ZGHA 2CFIA 2DTJA 3W7BA 2F1FA 5IS2A 3ENWA 1LK7A 2LVWA 5CJJA 1NJSA 4TT8A 3UW1A 2CDQA 4EW3A 2P9GA 1MEJA 4ZZ1A 1RBQA 2RQMA 3OFFA 4S1NA 1O8BA 3AB2B 1ZLYA 1ZLXA 2J0WA 3DC2A 1RBYA 3MAHA 3OFEA 4TS4A 5IT0A 4QPCA 5FIIA 4ZYWA 3O1LA 4ZZ0A 2J0XA 4EW2A 4GMKA 1KS2A 1UJ6A 2MDAA 1FMTA 2QSWA
chains in the Genus database with same CATH superfamily
1SR8A 5I7UA 3I32A 1NJ1A 3H75A 4PSCA 3AOAA 4LDJA 1MB0A 3LF1A 4EITA 1G3QA 4YRKA 2DHDA 5E7QA 3EFOB 1PNOA 3DB1A 1G1AA 1WJ9A 1DBQA 1QFMA 4ID8A 5AK4A 2XVYA 2Y3IA 2WQ6A 2J9FA 1RJDA 4UW2A 3CW2A 3DBHB 4AQYF 2WJZB 1TMGE 3BO2A 4OI3A 4D0RA 7AT1B 4C0WA 4LA4A 4HQNA 1PL8A 3PQ5A 4D74A 5IV3A 3CNQS 2OPQB 3JY6A 3LUYA 2J3DA 3ITHB 4DV7J 1FXUA 4UBOA 1CUEA 3EMKA 2BCEA 2CPYA 2BDEA 2C9OA 1HBMA 1JKIA 4NFYA 4B71A 5H3HA 1P9YA 4X64J 2G5TA 4K9PA 2W6NA 5IH7A 3ZX5A 4GDFA 4BO3A 4CT9A 2CHFA 1MOZA 1ESNA 4XYLA 5A03A 1MA3A 5F9LA 3U09A 4ZVQA 3Q89A 2OPRA 3DMHA 1N75A 2W9BA 2UUAJ 4MMZB 3AK4A 2MDAA 3RW7A 1U99A 3GCGA 1NOJA 1H3NA 3TRGA 3N0RA 4FYKA 4M9QA 5A7GA 1CZKA 1KQPA 2ZRBA 4AU1A 3BKTA 1VMEA 5BQOA 3M5WA 2VN8A 3EXG1 3ZI7A 4FIZA 4J16C 4ZTBA 3L2OB 4YX9A 4MR9A 4S1WA 1SJFA 3NDJA 3KTFA 4J4TA 3B7GA 1TCCA 1Y0BA 2WWYA 4DRXA 1Y3BE 5D3GB 4II7A 3NHJA 5CLIA 1JX6A 3D6VA 1FYEA 5DLGA 4YJKA 4F45A 3FE2A 1RTIA 5C1IA 4CG0A 3BHIA 1KSFX 1QFXA 1IRXA 2ZAOA 4RK1A 5AO9A 4OOEA 2LDYA 1GCAA 4D4LA 4E2FB 1Z62A 1LA2A 4MAKA 2VWHA 1J7KA 1AQUA 3EJ6A 3C6YA 4WOJA 4BZPA 1YULA 3L7CA 4LCJA 3DUWA 3OLBA 3SS9X 3SDSA 4QUDA 4ZVSB 4B7ZA 2RG7A 1F2TA 3UWMA 1OA1A 3R76A 5A4JA 1YZYA 3M4YA 4GYYA 1YKFA 1UVLA 4DPOA 1D2HA 1XSEA 1X0PA 4OQXA 2Z6AA 1RRCA 2PMZD 4DCSA 1NHGA 4S1TA 2IZZA 3DKPA 3ORYA 1CUWA 3A37A 2I0FA 3UHOA 3LO8A 3LXMA 1CULA 3W2TA 5KG4A 4Q8EA 2B1QA 4ZV9A 1PZGA 2WG0A 2B9WA 1VPTA 4MUAA 2QYCA 2W8LA 5JXSA 4BCCA 4FX2A 2B7BB 4DDHA 3K8QA 3ZY3A 3NAHA 3BA6A 1CVIA 3LGXA 2HRUA 1UPMB 1PSDA 1T4BA 3K2QA 2PS1A 5EEHA 1RWUA 2YWGA 1GAQA 1D7AA 3H3JA 2IXBA 4ITRC 3GLGB 3M81A 1DG1G 2QKYA 3DGEC 3NU1A 4KJIA 2VDIA 4F3KA 1JTEA 1KDZA 3QPDA 1M5KC 5GZ1A 2HN9A 4UM8B 4ZCPA 2WSYB 4F04B 3MZ0A 3NCRA 4KUGA 3E05A 1NRJB 1TPZA 1X80B 1IY8A 3CKLA 3C1OA 3CNEA 3OSUA 3T1HJ 4RL4A 3FNHA 4FS1A 3BMOA 2X51A 3DFMA 5FHRA 3G8SA 4RANA 1UFOA 4URZR 1HNXJ 2RVJA 1VIOA 2R87A 1ZETA 1UFLA 1XX6A 1E1QD 1RHRB 5KVCA 1SC3A 3SZ3A 1W5EA 2LW7A 2JI9A 1LWCA 3R7AA 5JXJA 3EZGA 1DFGA 3KKMA 4BQPA 1SXLA 3K73O 5BN4B 1IULA 3A70A 3D4LA 3MJTA 5K0FA 3V97A 1I51B 4QBIA 3R6LB 2F3UA 2Z2ZA 4YCSA 3GDGA 3DMDA 1T0HB 4G8JA 4YJFA 4IVNA 4A0SA 3CC4S 2FDXA 5PNTA 2VHTA 3T0IA 2LEPA 2QZSA 1PV4A 4UEWA 1CUVA 4X1KA 3GLIA 4I3FA 3OQHA 1JB0C 5EHQA 5IM0A 5C42A 5EQDA 2DH9A 2QM3A 3S1AB 1YZLA 2R8ZA 3ZLJA 2ACVA 3CSSA 1JNZB 4KYZA 1BFKA 4WGFA 3TAMB 4BO2A 1KEWA 3TEHB 2VNKA 3P5BA 3P9SA 1PC5A 4NYZA 2I67A 3TPCA 1LPNA 3ZZRA 5DBFA 4BFZA 3M9OB 1EINA 2YZGA 3B1JA 3NMAA 1EK6A 1Z22A 1VBYA 2XY4A 3RUHA 3HVAA 3U17A 5DYIA 3L8YA 2I6WA 1UDAA 4S3MA 4M49A 5BMVB 1K47A 1UEUA 4L7VA 4ZVRA 4IDOA 3BM7A 2BVNA 3WS7A 3TAQA 2QLJA 2Z1MA 2ZRPA 4PG4A 2AMLA 2C82A 1ENYA 3K09A 4C4SA 1F14A 4KFUA 1A50B 4P86A 4F3QA 3C4JA 1TKDA 4WJZA 1XVIA 3EWAA 3GSIA 1QE3A 3LK6A 2G40A 1CJTB 4F60A 2EV9A 2BKNA 1CRWG 1RISA 1UAAA 4OHYA 3H4TA 3G1UA 1H5UA 3ZK7A 3HUUA 6REQA 2VJMA 1D3WA 3ZIDA 2IDEA 3MOJB 2J4DA 3RC7A 1SZJG 4KE8A 4U39A 3PFFA 2NAPA 2VL7A 2HHAA 3BTVA 4J0KA 1VQ9S 5LSLA 4TXSA 1YQ9A 2E4UA 2ZJ6A 5D0GA 2XLCA 4PHFA 3IN5A 1CY1A 1XZQA 4QWAA 2OFFA 3L1KA 4C6SA 1VYUA 4RWWA 3COZA 4MH8A 4BBYA 2HNKA 3KLNA 1OB5A 2VBZA 3L41A 2ZNYA 1WPXA 3LY8A 3O84A 3PEVA 4RETA 1C7EA 5IZCA 3UWKA 5KJ1A 3M2PA 4L4UA 5J4YA 4RQAA 1A0OA 3H18A 3DBLB 2HW3A 3IDFA 2SHKA 3K70B 4CIDA 2WRZA 5BWBA 3STUA 3VC1A 4DV0J 2HO4A 4YRGA 3ITKA 1HA3A 4C3KA 1E6UA 2G09A 1GTSA 3M30A 3BMQA 4TRJA 5ILQA 4DDMA 1QO7A 3M6AA 2E4WA 3NPAA 5IOLA 2IV3A 2OFXA 3IH5A 4ZZ2A 4Q3EA 4IOMA 3WDSA 3CNLA 3LWMA 1DJQA 1GGNA 4WZAA 4JX9A 1JEYB 5D6GA 3HB4X 5AOCA 2XSFA 3GLFB 2CLSA 4AL6A 2IPMA 2IUUA 4GQBA 1TF5A 3G88A 2IIVA 4RKQA 3A1FA 3KOAA 2C5FA 5CT4A 1X8XA 4LJKA 3OFEA 4I9UA 2YOGA 5KG0A 1RAEA 1GTVA 2QD3A 4QXMA 2IYOA 3JQ6A 4KGVA 5KCZA 3Q8MA 3ZJYA 1WOYA 4PG6A 3MJVA 1NM5C 4RVNA 5ECDA 1Z0DA 2O2GA 4FJ2A 3PUZA 3CMMA 4KFBA 2I7XA 3SHOA 2IYFA 2ZSJA 3KC2A 4NMLA 1ROFA 1XTPA 2H4YA 1W0JA 3DOLB 1ISSA 4PTLA 2XXAB 4A3SA 2BRKA 4OI1A 2DKOA 2BCGY 3UNYA 4NXMJ 6GPBA 3N6RA 2VHVA 2X58A 3N3AC 2ORYA 4IX9A 4O4LF 3IT0A 2XDAA 1F0NA 3WMRA 1V9SA 1E66A 3IC5A 4RPCA 3Q72A 4UBJA 2C54A 3P9KA 2HFKA 5IDWA 1N5DA 3I04A 1TQ8A 3T6JA 2BTQB 2RGAA 3TVZA 2PGNA 4XVCA 2RT3A 2WM2A 3D4NA 4X3PA 5THKA 3THOA 1X9SA 1Y7TA 3PXBA 2MSLA 4E15A 1DRWA 4M1TA 3PO5A 5CDSA 1OIXA 2OVBA 1W2WB 3D67A 2FCAA 2QU7A 3KVVA 1QOZA 3BZQA 3OUYA 1KDOA 5A0TA 3K3PA 5SUHA 2VDNB 4F4WA 5C3UA 5ETOA 4B02A 3P96A 2GQ2A 2AXNA 4KAIA 3U19A 4JR0A 2V65A 2FW8A 3PR3A 2IH4A 5GONA 5CDTA 4NULA 4HL9A 3RS4A 2C5LA 5IJWA 3DHEA 2FLKA 4H7DA 3RBDA 3MR2A 3SYLA 3R7WB 1LNQA 4NOLA 3WDLA 3JQKA 2YYYA 4PPFA 1PVVA 4ZIVA 2HVZA 3S2IA 5DSTA 5FOVA 2A1UB 1IOZA 1XF1A 2QRPA 4AW9A 2J46A 3I01M 1QE1B 1TI7A 1BFUA 2Y1IA 3WBKA 2KWIA 3AKYA 3E3LA 5L3VA 3NVKI 4HGZA 4L3OA 3KLMX 3NTQA 3TVTA 1XYGA 1C9KA 1PS9A 4LYDA 1B7GO 5K5EA 3ABIA 1R9NA 3BGRB 1PTKA 5DXAA 3THPA 1DS6A 1NXOA 1HYEA 4ZT2A 2Z6QA 2C94A 4LOKA 2LQ8A 3ELUA 1OWNA 1AUPA 2ZB2A 4YNBA 4KYVA 3U7QA 3I2YX 1KRXA 2QRRA 2UUAB 4C0KA 5AHXA 3ZTSA 1QGED 1PSWA 1I0ZA 3BL8A 3BN7A 5E33A 4WFZA 4HMQA 1K7YA 3DSRA 1CDZA 1ZTWA 4V39A 2JL9A 3AV3A 1RWMA 3W4JA 4DV6F 1T8RA 4JV0A 1G5FA 4JBXA 3H5SA 2AFHE 3BH6B 2V0NA 1CR4A 1W9MA 2RQ4A 1S2MA 5LQMA 3VSCA 5K4AA 4BNZA 4M1WA 2VHJA 4C6RA 1XN4A 3LVRE 4JUZA 2M4MA 3FMOB 2CLMB 3E0XA 2AKEA 1D5CA 2F8EX 3R3ZA 1D0SA 3ES9A 1Y0HA 5LLSA 1FFSA 4YAFA 3DOLA 1IBLF 3QV2A 1RBYA 5JTUA 3E3MA 4DR1B 3KR0A 1YQXA 4QUBA 3W9YA 3G5TA 3L7JA 5IXJA 3ZEAA 2BLNA 2AU0A 1JMYA 2ZU6A 4Q9JA 5GQSA 1IFXA 2C2ZA 2QQFA 3A2NA 1YBFA 2ZUEA 2ZDGA 3NMUF 4LF2A 1H72C 1W19A 4WLNA 3H5OA 1CY6A 3LH2S 5F8IA 1ADCA 5D6NA 2PL9A 3BHMA 3MPOA 3T1NA 2IC3B 4DR5B 1UBOS 4BLPA 2ZB3A 2I62A 1T9ZA 1DKOA 2ZRNA 3ONQA 2J7PA 2XHEA 3B4DA 2PUWA 1I2BA 4EJMA 2X5XA 1FP7A 1UW9A 1R43A 4MLCA 4M5DB 2YXNA 1KYXA 4WEOA 4OUKX 4Q34A 4PGMA 1S9DA 4RK5A 1YDLA 4WFKA 2HA4A 2WD7B 4HAYA 1VLZA 2Y1KA 1SKUA 2Q9CA 2D6FA 4ATNA 4RR5A 1U0FA 1QZXA 1V9CA 1EA5A 3VNRA 2YJ4A 1IJFA 5LQKA 4H17A 4UBKA 3ANYB 3UIEA 3HSKA 4Q9LA 3HKDA 3WXMA 1USVA 4G01B 3KLFB 1QG6A 4DWWA 1P0CA 2CIMA 4HFMA 3C3DA 2AWNA 1B0AA 4MVJP 2ZAYA 4NI2A 5LUAA 2HRCA 4U9RA 3R5KA 2HEIA 4WYLA 2BRLA 4KI7A 3WR5A 3UAXA 2OO5A 1V1MB 4PO8A 2FPIA 2ONKA 2WVJA 1CRQA 1YQDA 3JR3A 5CM2Z 2XZDA 3H9QA 4RUBA 4GEGA 2EGHA 1FFWA 1FU4A 4AKIA 2MTLA 4F7DA 4BNGA 4JC8A 4QU0A 2AX1A 3C2PA 1GA1A 1JR3E 4JGIA 2BSXA 3OL8A 1JIVA 1QWOA 4WDQA 2EKDA 4HQLA 1VI5A 1F5AA 3VAYA 2H1LA 5AKXA 2V4QA 3EZOA 2EIXA 2XVZA 4KQXA 3EY9A 2BSAA 3P45A 1H6BA 2CUZA 5DM4A 3RS2A 2RU3A 3T8YA 3H11A 5AJXA 5IJ9B 1F51E 5A6WA 4RLEA 3TL3A 4NU0A 4PZPA 2HV8A 4QIVA 1CDEA 3PPYA 4FZVA 4MQUA 3HWX1 3W2GA 4ZYVA 2FWMX 4WIQA 1TFRA 3RE1A 3DU6A 3E7DA 3IDZA 1UADA 3IAXA 4J7CA 3DE6X 1L5HB 1FC0A 2I2DA 2YHBA 3NV9A 1HDCA 2ICAA 3IPRA 4OGFA 4OJ1A 1RYHA 3H5XA 4KSCA 4L78A 1CWUA 1SCBA 3S40A 1SGWA 2OCBA 3E2PA 3C5WP 2M9KA 3ZZYA 1O6GA 1UOEA 3M5CA 3AKZA 1UBJS 4QVGA 2IX3A 4D4JA 3CF4G 3V8EA 1MU0A 4YI5A 3Q8XB 4H7JA 1USIA 3KE8A 1DY3A 2SXLA 1FS5A 3FTPA 1MN7A 2E1CA 4FMCB 2DNQA 1E9DA 4B85A 3DVAB 3UQZA 2Z2XA 2BBTA 3F2IA 5F9NA 1DX6A 2Q5LA 4OHRA 4EB0A 1Y1LA 4GKKJ 4AWAA 1JQAA 1ZRSA 1XTQA 3G2KA 2VU5A 4K81B 3ENKA 1DBRA 2FPGA 3BQNB 2I6TA 5C0OE 3CJ5A 1DQ8A 4FU0A 1DJOA 3B60A 4P0QB 1WZ2A 4C0BA 3VTZA 4EVRA 2WMDA 2HGZA 3ZJTA 1VQ7S 1EWRA 1V43A 1DQNA 5EP4A 3B8EA 2YNGB 2PH5A 1OYEA 3A4YA 4OA5A 4KQ2A 3RW9A 3KP1A 4BV9A 3LHIA 2P11A 4J37A 4K2AA 3KHLA 5ADWA 5MFZA 4MRMB 1P81A 5JXGA 1FTQA 3PQFA 2C8VA 1HTTA 2TMGA 5WRFA 2OR3A 3NHSA 3N8NA 2Z0GA 3AUYA 3I76A 2QLTA 3RKUA 5J1EB 4UQGA 1XEFA 2MQNA 3BGIA 4K4SA 1I01A 1H2XA 1B8NA 1V3SA 2JLSA 4DS4A 5ETNA 1X1DA 3ET6A 1Y8RB 5IC6B 1BWQA 2XTMA 2DUMA 2MSKA 4AUEA 2NV0A 3I2FA 3QTTA 4JI4F 3JX9A 2CVFA 3K6RA 4A8TA 1XKQA 1GMVA 4YP5A 4QREA 4MJ3A 5MGNA 1CR1A 3OOJA 3AI2A 4EWTA 1K6JA 4JYBA 3IBGA 3C39A 5L3RA 2H1OA 1U9JA 1DFIA 4OEHA 2O3DA 1IUNA 2AOXA 3QX3A 1MOPA 2VRCD 4C7XA 1CY7A 2VPZB 2VDHA 1OXXK 2Q1TA 3NBKA 5HK9A 4FYHA 2Q5JA 2Z8YA 1OX4B 3K09C 4BE7B 1MW7A 3VVCA 4PLGA 5TMEA 2VRWA 1X2EA 5G3YA 3ZHUA 3VHXA 1DZIA 4E98A 2E5LB 3NWGA 3W5YA 4I5DA 4OKNA 1VLHA 2C2YA 3FOFC 4OD0A 2R6ZA 3ZW9A 1XEXB 2B2XA 2Z2KA 4OB6A 2OGUA 4L9WA 5EMHA 5KT5A 4UOZA 2VYVD 5B0DA 2F6RA 1TUBA 2C99A 3JU3A 3L7LA 3WBZA 4FHCA 3V6LA 4B2LA 2ZTUA 1M0EA 3FNQA 4RNHA 4TUYA 2RH4A 1FX4A 5I4MA 3FWZA 1JDBC 3HJBA 1VG8A 1QUEA 4GVLA 1JN0A 1DI0A 2AA3A 1F3OA 2HRTA 2AJ8A 4N18A 2OCDA 3THVA 2FR8A 1R5NA 4AJEA 3T1QA 2WSSD 3ENWA 3S2FA 2Y6VA 3GLTA 1YOVA 3SNHA 1ZIOA 3BQ2A 2FPPA 1KI4A 2O3SA 2DFNA 1MWYA 3I62A 1S9HA 1DPFA 5KDLA 1R8QA 4CTJA 3WB0A 2M32A 5A05A 4MA5A 2G82A 5GOZA 1YJUA 4HPWA 1T0PA 3ROTA 2IHNA 3K0HA 1H23A 4G1CA 2DGQA 3U9LA 4B74A 4DT1A 3NRBA 1N5YA 4HUTA 2C58A 3L1HA 2EC0A 2O6LA 4KPFC 2XEXA 5CT8A 5BRAA 1BCRB 2UUCF 1R8BA 3MIZA 3LWZA 4MLZA 2R97A 2QI9C 5PGMA 1XDDA 3DE7X 4Q4DA 1JLRA 3ZGOA 5DVZA 3GGCA 4NE9A 3L40A 1Y9ZA 5FXMA 4GNKA 2AYEA 4BMYA 4BQSA 1BHJA 3GPLA 1DTQB 3DXFA 1NKCA 1DX4A 1II8A 5KTPA 1ENPA 1Z33A 1B7FA 5CAAA 3G8QA 1QGUA 4PU0A 1ZGBA 2RSQA 1YWGO 2FZGA 2XM3A 1U2ZA 2H4WB 2O20A 4D56A 3H42A 2OPSA 1MVLA 1V47A 4R3UC 4QGBA 3KSAC 3RTEA 2EW2A 4J9NA 1H4TA 1XJ5A 3HXQA 3NORA 4OOFA 3HU1A 1RWXB 1X7YB 3PDHA 1TKCA 5FI3A 3BD6A 1KH1A 1BDJA 4GVBA 3OPVA 3VTIA 3FB1A 4QOGA 1IC6A 4F4AA 2G7ZA 1BWVA 3UUFA 3JYTA 3ZWDA 1HE1C 3RC2A 2GC8A 1REVA 5HFJA 4DCTA 1UMCA 4DCVA 3MCOA 3IWLA 4PZEA 3DMTA 1QHNA 2GA8A 3HGMA 4G9GA 4A26A 4IUDS 2MINB 5D0EA 1CG6A 1U2PA 1LTHR 2YV2A 2ZTMA 5EJFA 2OD6A 1TEHA 1DADA 1MNEA 2EP5A 1E2PA 2Z4TA 3PDUA 3H17A 2FEKA 5DCYA 3I83A 4DR2B 4O1HA 4F38A 5AI4A 5TVGA 3FPFA 2V7VA 2V8VA 3WTCA 1T95A 2XMCA 2VDWA 5ALYA 5IXYA 1AKNA 4ENQA 2FX3A 5IAKA 3QATA 3L02A 3K58A 4EH1A 4GF5A 4CLHA 2GO7A 5FR2A 3I6PA 4IJ5A 3ED5A 2OHHA 5KFLA 2K1RB 1O87A 4S04A 1UFRA 4Q7KA 1ZLXA 4DV2F 3LOPA 4JP8A 3PGA1 2DC1A 1NVVR 1DFDA 2QT9A 1F48A 4OYYA 3PTZA 5J9FA 4R68A 2NO6A 4UASA 4MAAA 3L0CA 5CFOA 3NYQA 1NK7A 2OV3A 1V25A 4MROA 2XUQA 4ZK7M 5ITWA 1JSCA 4DPUA 3A0RB 5K0NA 1A1VA 3W2WB 4FYYA 3MBOA 4JEUA 3TTWA 1FE8A 4X8LA 1U1QA 1M0SA 1ISGA 2XV1A 2C9BA 4PR3A 4KUEA 1U8FO 2AJBA 3CGIA 3CIFA 3AHJA 3RG2A 4N8NA 3LIIA 3HA2A 4WV3A 4BNWA 4DV1J 3SOZA 4GDMA 1U3DA 4JR1A 4HB0A 3VZDA 4XD2A 4TLAA 4ZVTA 1F6BA 3HLUA 4DCUA 2WI8A 3LTOA 2D06A 1GNPA 2BX6A 3FZYA 3DNCA 4B5LA 4BWVA 5COBA 3VH2A 4N5LA 5LJLA 1OU0A 1JFFA 4BWJA 3P4YA 2DY0A 5KYXB 5GVSA 3P9ZA 2VPPA 3PEFA 3GNTA 1EHWA 2XRFA 4RTMA 2CZGA 1X9MA 5KX5A 1Y89A 3FOAA 1V1RB 2VTVA 1CX9B 4FYWB 2FGCA 4S1PA 2JJ1D 4PX5A 3G82A 3BORA 1BZYA 3LLSA 3LLUA 3F2VA 2DPGA 3SY8A 5EJEA 1Y5IA 2L2QA 3U27A 4DXHA 3BYZA 3RRZA 2KHCA 2JFKA 1XWWA 4RW6A 4F67A 3GJTB 4DSTA 2MYUA 1UT6A 4D80A 4HL6A 1SHTX 1NU4A 1AS3A 3ZK9A 1U1DA 3AUXA 4O4JA 4G8DA 4QRDA 5LCXA 4IDAA 4LUBA 4LF4B 5E3QA 2AMFA 5F23A 2GHWA 4UMFA 3S1AA 4WXWA 1ZR2A 2NVUA 2X5JO 4MVXA 1MJGA 1XR7A 1TK0A 1VG0B 3GPAA 4I2QA 5KNDD 1NLKL 3GQBB 2XUHA 3E2MA 4PGHA 4NLOA 3RD5A 5DCWA 4B6FA 4C7MA 4IIVA 3ANTA 5ESRA 5BJRA 1PWXA 5DH9A 3BQMB 2R8PA 2IOFK 1LNSA 3CVJA 2BE2B 4I2PA 2WSBA 2Q1LA 3WLAA 4HNQA 3D54D 8LDHA 1D4AA 1FX2A 1BTOA 5D7NA 1GSHA 4JP3A 4ZPBA 4K1XA 4HN2A 5LYJF 2PGLA 2A86A 4ROTA 3VKVA 3D8TA 3I9MA 3ROMA 1XBTA 2CLEB 2A33A 3AUFA 3P52A 4NZ7A 1NY6A 3UV7A 1X1BA 2Z04A 4ZOLB 4JBLA 1CHNA 4R8VA 3I53A 1T3TA 4RAQA 2PU7A 1ZAWA 2IPOA 3P7MA 2XF8A 4DV5F 4HN9A 3DOJA 1VL0A 2HADA 3C74A 5CBPA 5KVQA 1FXDA 1X92A 2MYTA 3U1TA 4BC9A 3H9JA 3WRWA 4B3HA 1E9CA 4R1PA 2OLWA 2O2EA 4GOOD 3H9EO 3BIJA 3DO8A 5EIEA 3SC2B 2ISCA 4O1IA 5DO9A 2IKSA 2C5SA 2V7TA 4Y8VA 4QYMA 1S5PA 2VXOA 2OESA 5TT0A 4PWDB 3ISZA 4JI3J 1XZKA 2JGRA 3UD4P 1JLEB 4D9JA 2BT4A 4JQZA 5KSZA 1CJVC 1ADYA 2F9DA 2FE4A 2BANB 3GNLA 2I1RA 2VK1A 2JK0A 3TQOA 4P71A 1K0FA 4QGAA 3WSWA 4MK9A 1U2GA 5HKBA 5KFNA 3QKWA 3BH0A 2F8TA 2XI2A 1KETA 5I4CA 3JQDA 3E3AA 2IYRA 2ZJYA 2QMXA 4IFYB 1ZHOA 4I56A 1BHNA 1P1LA 1U3WA 2Y6UA 4BFCA 1ZCJA 3NC0C 3ZU2A 2AZTA 3ICPA 2F1HA 3TJZA 4YUDA 4OZ5A 1DPGA 5T7LB 3KKQA 3TVDA 4F2DA 3LNTA 4FYDA 1I94F 2HPAA 2RJ3A 4A8SA 2V5HG 3V3KA 1Y1PA 4DLXA 1MBZA 5C37A 3ASZA 3O8RA 4HAOA 1UEXC 2C2OA 1SXIA 4DSZA 4U1RA 2QTTA 1ZMOA 1WLYA 4F12A 2FG6C 2DUWA 4FGKA 3T5KA 1N5KA 4Q45A 2H9YA 2ZSHA 4UHBA 3JYHA 1U1NA 1E2LA 1QIKA 4N9WA 5FRDA 2X6QA 3QHQA 3G2HA 1RAJA 3OIFA 1S9EB 1H65A 4I50B 3BWBA 2Z8XA 2I5PO 1E62A 4KXYA 1W5TA 4XJSA 1UINA 5AJYA 1LW6E 1H4SA 1J21A 1I0IA 1QTQA 5LP6F 3R2JA 5I7OA 1W4AA 4DT1B 2HHTA 1XZGA 3MFYA 4B8ZA 1UMBA 5K6AA 3QSYA 1WB6A 1ZEJA 3KQPA 4DR1J 2C4WA 1G98A 3R1HA 5IVDA 3TZZA 1JQ3A 2J3HA 1LCIA 2IHVA 4PAAA 3OEHA 5FBKA 2VG5A 4DR6F 2CXPA 1YIJS 2XAAA 4BQIA 4U7JA 2PMBA 1RJJA 1NVDA 4GKJJ 4BAGA 2G80A 3A32A 1WU8A 2CNKB 2ZSEA 5ILGA 3LP6A 2FZGB 2PXHA 2XH8A 3D2BA 5TJ9A 3LOUA 2DFPA 1QR2A 4RLFA 1HQUA 2CDRB 2NU9A 1KYZA 3EQZA 3G5MA 2GYUA 2WJVA 3HGQA 3FEYB 4G4SO 2DRBA 2J87A 1P5ZB 2B69A 4NXMB 1N56A 4QIEA 2W2LA 1T5LA 1GAXA 2BDTA 2BGRA 1W0JD 4RX1A 1E4YA 1BUXA 5CP8A 4N6GA 4Q1DA 5A4MS 2Q6IA 1DCKA 2EJTA 4TWRA 5AOVA 2XMUA 1HETA 3KAJA 3T4XA 1NJ5A 3JQAB 1P18A 3S1SA 1BMFA 1G7TA 1R0XA 3BT7A 1MB3A 1E9RA 5TXGA 1DT5A 1N2HA 4AYBD 1N32J 3I2IA 1N9GB 5FTJA 2WV7A 1IMJA 4EAQA 3KHHA 3LOQA 2BKPA 4DR6B 3QAEA 4Q16A 1U6KA 4A48A 4H6XA 4JEHA 3DKVA 2VF7A 5GAEI 4EW3A 3UCFA 1QGYA 4GPTA 1Y6QA 4IJKA 2XVXA 2FN4A 3BXZA 2HLDA 2QNIA 1F8GA 3WBBA 3HJCA 3FSYA 2CAJA 3RYHB 3VI4B 2HJHA 3MOSA 4RBVA 4DLUA 4X1IB 3TQCA 5KOWA 3WYCA 3Q98A 5JCPA 3AFNA 1E7WA 2CLDX 1CJMA 4I50F 3BMXA 4HRVA 5JVDB 3ILSA 4UHHA 3MEDA 1J2UA 2C8JA 3ZY6A 1GTZA 3BRCA 3MW8A 4XWWA 1CLUA 3ZXWA 1OD6A 1T9WA 2EEZA 2JIDA 3I6BA 3RG6A 3RAXA 1KORA 4I67A 2VIHA 2I80A 4OLFA 1BHSA 3OIGA 4BC0A 3I6ZA 2OPPA 1YIOA 2WVEA 1ZNZA 3TCKA 4QUJA 2Z2LA 421PA 1YR6A 2I9PA 2G4BA 1H1LB 4DMHA 1RWKB 3LTEA 1QCDA 6ABPA 1LC3A 1FXWF 4FPRA 1Y4ZA 1AY0A 5J1NA 1ZI8A 3IRVA 3ZWKA 4MWBA 2CXXA 3JD0A 2C78A 3MEEB 4C8OA 4P38A 2XTJA 4UE6A 2V7WA 3HDTA 1X1AA 2DPJA 5F35A 1YUBA 2YKOA 4P58A 4ETMA 3RT7A 2FDNA 4EMTA 1H05A 4GBED 5D4NA 2X23A 4GKKB 1V9OA 3RS3A 3VYUB 1EX1A 3MAAA 1YO6A 1GXSA 2JFNA 4BWFB 3TQRA 1AC5A 4QLAA 2DYKA 3CD0A 1EESA 3ZDRA 1P2TA 5K2OA 2RCYA 1NAIA 4C7KA 2O2HA 2Y66A 1FNNA 2RIJA 4JQOA 3B5EA 3FZEA 3O1JC 3KJNB 2BELA 2J9RA 3FETA 2DR7A 5LMNJ 5ETSA 5I5GA 4P33A 1T3SA 1YK9A 1BE1A 3WNCA 1A7JA 1PFGA 5CDHA 5J2TA 4O4GA 2NSHA 5GY7A 1EQUA 2IS1A 1CF4A 5KU1A 1E3QA 4ZAYA 2HNDB 2QTCA 3CR8A 3TDNA 2OD9A 3CC2S 3T5PA 2H11A 1JKJA 2XVMA 3A3PB 3R09A 2B37A 3SJUA 3O4HA 2POQX 3E9ZA 3Q6IA 4TT3A 5CH5A 3L7KA 2RSLA 4RK6A 5T7LA 1WD7A 5ALZA 4RK4A 3CE6A 2REQB 4O3SA 4WZZA 4NBRA 1FDNA 3WV4A 2HFZA 4R1SA 3W1WA 1C1BA 3OZAA 2DXIA 1W9HA 1FTYA 4C4AA 2DSNA 2IU0A 3VU1A 1TEXA 5CFNA 4HI1A 5K8LA 4QGSA 2MKHA 2C2KA 2IL1A 5KFEA 3SF8A 5F78A 3SKYA 3N59A 1JLGA 4GWLA 4ARZB 1SFRA 1J2RA 2VFVA 5AM2A 3DE5X 1GD1O 3A05A 2X1MA 5B64A 5F3RA 2WWGA 3UO8B 4B73A 5EUQB 1JQGA 4N82A 2I3DA 5TY0A 3MMAB 4DLAA 3S55A 3VKFA 3I8XA 3GE9A 2W9CA 3QMWA 4D9FA 3C15A 3D81A 5F7JA 5GJVC 1NN5A 4DWVA 1BU5A 2BACA 1P9RA 2V8GA 1Z4LA 1EFVA 2BE7D 4ZA1A 1MX9A 1S10A 4PCUA 1GEHA 4ZCKA 1LEHA 4X1YA 1LBTA 4RNOA 3A9CA 2NO0A 1FZQA 3VZBA 3SX2A 1U1PA 4XPZA 1Z74A 1VMAA 2JH9A 3KLVA 1EFCA 2ZJ2A 3UAVA 3DBLA 4FFDA 1GSOA 4MQ5A 2FSIA 3Q87B 4PYIA 3FPAA 4JDUA 1R88A 1UBRS 1SWVA 1DEKA 2G6BA 3MGCA 1R64A 1EVJA 5DBIA 1U02A 4F25A 1T2VA 2LQ5A 5E3CA 2P6NA 4F4FA 4Y6OA 1HQEB 3IQXA 4DDKA 4UPEA 4XUDA 1WUJS 3H9BA 4H15A 4REQA 4KNWA 3MCAA 1LWFA 2EOAA 4U7UD 3OX2A 3V34A 1UXGA 3H2VE 4CUKA 1SCUB 4M0FA 1S0UA 2QL9B 1OZFA 1XAHA 5KG7A 1BCSB 1IZ0A 3BCHA 4R01A 1AQ6A 3GLHB 4I1TA 5E5NA 2PX6A 2GVZA 3GPDG 3UJ3X 5TLSA 3CZ4A 3OVSA 4LNUB 4L75A 1L7PA 2MIIA 4QZVB 2B5WA 2VP2A 1OPZA 2FPGB 3M8PA 3KJQA 2GDJA 2GETA 4I68A 4NAHA 3A1CA 1GZHB 2PUAA 1L1EA 4A8FA 1XRLA 4FS8A 1N5MA 2AH5A 3E8XA 1R4AA 4IS3A 2CNBA 3FSEA 3O8CA 4CQJA 5JQGA 4TL7A 4Q9HA 4NH4A 1A5AB 3DBOB 1E2MA 3I2GA 5EJ6A 2H06A 1BYUA 3DAOA 4I5FA 2L9WA 3OTGA 4JJ6A 5SZHB 2JGEA 4A8WA 1T29A 3R1IA 5EJIA 2N1BA 3PHGA 4R9NA 3JYPA 3D6TB 2ARKA 1I2ZA 4GMXA 1GKUB 4BGVA 1JHXA 4TV8F 5I45A 1QK5A 3ZGZA 1RADB 1Q7YT 3RUPA 3STYA 3MGGA 3RR8A 3T7IA 3S70A 5H9EJ 2E1MC 5MN5A 3CCRS 1YF3A 3TL6A 1NJXA 3JWHA 2IYEA 5H9FJ 3VV2A 1EHIA 2VHYA 2B5OA 2V7EA 1JJ4A 3GJ4A 2P9QA 3A3OB 3W63A 4F6RB 2HUNA 3UN2A 2C57A 3HP1A 3W3ZB 4B9MA 1LDYA 1VQLS 1TRHA 2X4LA 4FEEA 2RGYA 1Z12A 5HM8A 2D74A 4LGYA 1TB4A 4D0GA 4KRXA 4OSPA 2YHAA 1SU7A 1DLOB 4D9GA 1WW2A 5K0SA 3OXFA 5LOVF 1HT0A 4QPNA 3W2WA 4C0LA 4ETNA 3BSAA 1JPJA 2Y05A 3ROQA 4NYPA 5DJ5A 5EINA 1C0UB 2AFVA 3ZLTA 1E2HA 3GYGA 3K1ZA 4Q7LA 3RM3A 5EKSA 3O4FA 1LFAA 2KU7A 4CQLB 3ESZA 1WUIS 3AEUB 3PD7A 1IXZA 4IH6A 2H18A 1WELA 4S35A 2GYYA 3ZNPA 2AVNA 2JNJA 4ZDNA 4GXRA 3X2EA 2HXGA 2AN4A 2R7AA 3WMEA 4CQMD 3ICEA 3OZGA 1RU1A 3MTAA 1IPFA 2QL6A 1T6ZA 4P2GA 4ACAA 2GZMA 3MCVA 2C2ZB 4ZQGA 4I3HA 4ZMRA 5MDHA 1HBMB 3G5UA 2QLXA 4LTDA 2QVYX 2PM8A 1Q17A 4MRRA 3DYAA 1C9DB 3JWJA 1OHHA 3HR4A 4OI4A 5EERA 3VJKA 4U7TB 3FF1A 5KOIA 1ZNYA 2FUG9 3PWTA 3JPWA 3HCXA 5F4ZA 3R7LA 4F3CA 2WJHA 2HHJA 3LZDA 1NR7A 1BEZA 3U7IA 2OP5A 1A9OA 1NK4A 3K0AA 3UWPA 4HLDA 4FZ3A 2CLHB 2ZJBA 4Y2JA 3N01A 3N0TA 3UK6A 4DC9A 1MAHA 3RJMA 3I04M 4R71A 4YR0A 3NNAA 2Q99A 2Z2YA 4DCPA 3AB7A 1CUAA 2VS1A 3K96A 5L1KA 3HM9A 5CEEA 3UE2A 5KYKA 3OG9A 1SO8A 3KKLA 4ER3A 1NHWA 3IE2A 1KQOA 1WQ1R 5CB4B 4ECZA 3O44A 1KWMA 1MJNA 3G02A 2GJIA 3IAAA 4ZN1A 5B3LA 1EB8A 3OKAA 5KNDA 5K7SA 5M2QA 3VGJA 1BA3A 1U1RA 2FXVA 4JYZA 4CMBA 4YLEA 3QIPB 4OAQA 4DSNA 3BR9A 1YRYE 2R2UA 1PG2A 4F9GA 3GR1A 1K2WA 4PSVA 2F3PA 1QGZA 4M9RA 1RHKB 2BVZA 4YMTA 3NH9A 2JW5A 2HQGA 4CQMB 7REQB 4O4IF 3CJQA 3KJXA 1TT7A 4ZALA 1MC5A 2COLA 4YONB 5BSEA 1RPAA 2IYYA 1K3TA 3L8DA 3I9LA 1U6JA 3LANA 1NEEA 1CTQA 2OOKA 4TSKA 5BPHA 2WYUA 1DBVO 4ES1A 3SVZA 4DNXA 4NENB 2YY3A 5AUPB 1IVZA 1MFPA 4NZOA 2KM8B 1OI2A 1FYFA 2FPPB 4ALZA 3DMFA 3GEGA 1HYQA 3TH5A 4I5EA 1OTYA 3AJEA 1GUZA 3QJ5A 1HFWA 4PWZA 3JSXA 2IUYA 5I9BA 5JDIA 3KKNA 4IIEA 2AFIA 3H90A 4UM7A 1VRCA 3VVMA 3ULKA 3VNAA 1BQMB 2GAIA 2GHRA 1H2EA 1VE3A 4FEGA 1FFGB 3QJJA 1EIWA 4JX8A 1MAWA 3N8DA 1HNXF 2P0EA 5E1BA 3WYFA 3LP0B 3GBVA 2BMJA 1RZ3A 4RH0A 1HYBA 2W4CA 5ALWA 4X7PA 5JAUA 2G2OA 2OAQ1 3PPIA 5LP1A 2ZYDA 2GPAA 5H8WA 2RHBA 3FRIA 3VDXA 3RVSA 3ZEIA 2I65A 2EG1A 2IY7A 1JDZA 4BECA 1Y10A 1FX1A 1LXCA 2ZWAA 3NEKA 2VWPA 5HRAA 3GIKA 3MMCA 1N8NA 1ZIPA 1UPTA 1II0A 3MJHA 3FPHA 4CM2A 4AXXA 3SFTA 4OHZA 1RAHB 2XCRB 4UTNA 4RY2A 1C1BB 2HR1A 2LXUA 2VK2A 2H4YB 4INJA 4PIMA 3NS5A 4NG4A 2X9QA 3H65A 1CZNA 2F64A 2PQ0A 2QTGA 3B48A 3HN2A 1WMFA 1U45A 1P4HA 3Q1LA 1N6OA 1XDUA 4OG2A 3M1IA 4ZVOA 1CJKA 1SH7A 2HT6A 1IJKA 5KU7A 2VQEB 2UXCJ 1AUVA 2BA9A 4C0HA 1WG8A 1XYVA 1G3UA 4C0AC 2GCIA 3OFNA 2H4HA 3JQ8B 4J1SA 4HDKB 4Z2YA 1CR2A 4MJLA 2CWXA 2WYIA 3INNA 4Q15A 1RE0A 2ATXA 5KAKA 2CDNA 5LMNB 3C1UA 4HDSA 1VJ0A 2J1LA 3M05A 3DT9A 3C41J 4DN6A 3F6CA 4D0NA 2O2XA 1CZUA 1YVEI 5BO5A 5JJBA 2A1BA 3GRFA 2WB1D 3M6UA 4WZBE 2COKA 5GP1A 3W60A 3IXMA 2RKIB 2ZXFA 2BOAA 3AR5A 4QJIA 3P0JA 4JI2B 3F3MA 4CLYA 2EXUA 4RLSA 2L17A 3EBPA 1UEKA 3I9V1 3JZAA 1SVKA 1EWKA 1N8SA 4FFLA 1VB3A 3S2YA 3B6ZA 1X7DA 5AW0A 1KK1A 1K5PA 4EEXA 2GJ8A 3CR7A 4NU8X 5J2UF 4I1RA 4PLFA 2XUOA 3CYFA 2WVDA 4AK9A 2W9CB 1S6OA 1L9KA 2B1IA 3PWKA 5J3JA 2Z95A 4MRNA 4FW9A 2YKMB 4NCIA 5KX5F 3PKIA 1QP0A 3HHEA 1FVXA 4WCVA 1FUUA 4K4WA 3TMKA 1UIMA 3H1PA 3ZNQA 1UZHA 1QVWA 4I5GA 4XGQA 2HMIB 2J6BA 3M2TA 5A8RA 2HAEA 3QVKA 2A5LA 4L9AA 4FUQA 1R27A 1BQMA 3CWCA 2IF2A 1T0JB 2AOTA 1T5HX 2JK1A 3DLPX 3IA7A 4GE0A 2BCJQ 1Y1QA 4EYKA 2EGUA 3SHQA 2DHHA 2CLIB 5FPSA 1KOJA 1CUGA 1ECBA 4F3RA 2O8BA 5CIQA 4RDHA 4J5OA 2A4KA 3NS7A 2MLYA 1OUMA 1HOXA 1EUDA 4EGQA 2FHOB 3X1JA 4OHKA 2AI1A 4JL6A 1I6KA 3SLKA 5CD1A 3U4MA 3TR0A 4RHFA 2XCLA 2FRDC 3JAMU 3VPGA 3UMSA 2JLCA 3V7NA 2WZBA 1MROA 3FKQA 4NG5A 2IEYA 1NKTA 3UVJB 1AKEA 4X84A 2YX1A 3TTVA 3CWQA 3P71T 5ADZA 2BFFB 3GRRA 3V42A 4BUZA 1Q82T 1HBNA 4NEZA 2NPFA 1TAUA 4PINA 2GA9A 2NXEA 5AKGA 5CW2A 4HG2A 5BRJA 2I4RA 1X4FA 3GSDA 2WJWA 1WC3A 4KH0B 3HABA 3COYA 5AVQA 4CLOA 4X8MA 2MZSA 2B7CB 2R2RA 1O4VA 4Q3KA 2RDIA 2UZAA 3SC6A 4X85A 2DWQA 5EHIA 5BV8A 3NNHA 5FPPA 3QPIA 4LYJA 3R6GA 2Q2VA 2Z8YM 1S2DA 4BMXA 5I6DA 3N9UC 4M54A 1XXHB 3MMJA 3UTDA 4NK4A 4UUAA 4FYJA 3MC1A 4DR1F 2WWXA 1NF2A 3EIFA 2WSEC 4ZPCA 2HYIC 4X20A 4IUCS 3VVUA 1G5QA 3M9NB 2V34A 3OP1A 4Q37A 3I45A 3WGGA 2P35A 1QLWA 5F7XA 4RW9B 1UBUS 3OVMA 5EYPA 1FTWA 3X1ZA 2FZKB 3LXRA 1ESZA 3WKEA 4LFAJ 1OVGA 3VV3A 5LLTA 4H1WA 5FEMA 2BEVB 3BIWA 5J5AA 1PQYA 4C8LA 3OOHA 1EWTA 1QC5B 5L45A 2P9CA 2RHRA 5KTNA 2BE9A 3SQGA 3OQPA 3TLMA 3LP1B 5DT9A 5IP5A 1N9KA 5C1BA 3R6LA 4J2TA 5JXHA 3JAWB 4I4TB 3HNRA 4WTYA 1NXXA 1TTQB 5ITZA 5B4VA 3O9MA 1N3LA 3BRWD 3ID6C 4FCVA 4WTOA 2RC6A 1ZC4A 2V54A 2NSBA 1AF7A 2J0EA 4ZN3A 1LWOA 2NU8B 1A04A 1YS9A 3NR2A 2B8TA 2YKPA 4HPJB 4X64F 3O2QB 5KT3A 1U2QA 3NEPX 3FOBA 3K5MA 2OAP1 5I9LA 2C00A 3ZNOA 3L8ZA 1Q8BA 4CYUA 3CCZA 4FEYA 4UMVA 5U4QA 1X60A 5HR5A 4G1QA 4JYAJ 4HYYA 5A6PA 2V4UA 5BQ3A 2GZHA 1NBWB 2G70A 2HWYA 4LQ3A 4OX9F 1UAWA 1BSVA 1P1JA 1YRQA 1F2TB 1YJCA 4DV1F 5DYWA 4B1FA 1SBZA 2PE8A 3X1LB 4TTVA 3MUEA 1RHQB 3CUYA 4ER0A 1R7RA 4WBNB 1P4JA 3DLEB 2LKZA 2IELA 3JRNA 1AX9A 1KTQA 2VUHB 4GWGA 5H70A 1HDOA 1V35A 4PG8A 1UZAA 5DGIA 3RG8A 5C46F 3R3TA 2O2SA 3CB2A 4OHXA 3MD1A 5C7YA 1EK5A 4ESVA 2HF8A 3D66A 1GG9A 1YSCA 1N34F 2R00A 4JY7A 2IXEA 1XTIA 3IM9A 4UOEA 3IIJA 1KZYC 4I4CA 1S1TB 1UJ6A 2QBYA 1EVKA 3IWNC 5E4JA 2Q1UA 5AUQA 1I30A 1CE8B 3ILVA 1GFZA 1GUFA 4KQKA 2WKWA 1BOOA 2ZRQA 2BYTA 1DAIA 4BMCA 3RIMA 4J3FA 4Q93A 4F0MA 2B3DA 1ID1A 3KSRA 2D0DA 3QNWB 1DTWB 3UXMA 4KK3A 1V39A 1ULRA 3F7NA 1X70A 1SA0A 1CKEA 3VSAA 2B5JA 2GJ4A 4DUYB 4JYCA 2VJQA 4LF6B 4M7RA 4BPRA 3VOSA 3M5DA 4BO4A 1WPRA 1KJNA 3G0CA 4YREA 2PCJA 4M1ZA 4IQGA 5GAEU 4HEHA 8ABPA 1TFYA 2HK7A 1PT6A 3K89A 4E31A 1NNEA 1JQJC 5IZCC 1FHTA 2C83A 1QOQB 5T4BA 3VDQA 4RTOA 3AL3A 4AYTA 2JIQA 4K6KA 4RCZA 1YH3A 2QAJA 3B51X 3F49S 1X19A 2YMLA 4K6MA 2QXTA 3CO9A 1Z75A 2O0JA 3QT8A 4GRSA 2O0MA 1SJ3P 2AGVA 4JJZA 3T1HB 1AH2A 1A4IA 3WNZA 1U7WA 3TWZA 1GKKA 3GRKA 3KT3A 4PXAA 2OEPA 1M8KA 3E8MA 1BX3A 1GQFA 3ESCA 1TU0B 5I51A 4XYGA 4QTXA 5AVSA 5BOSA 1YQWA 2E5LF 4Z7NB 2O3QA 2IW3A 3MF4A 1XAGA 2EKPA 2KT5A 5CK4A 2IFXA 1I24A 1X4AA 1DBPA 3D8BA 3QYJA 2IVFB 2R751 3IJPA 1NXTA 3SI8A 5ALJA 4N47A 5FPTA 2J6IA 1Q6ZA 4LXYA 5G0RA 3UG6A 2UKDA 4NJMA 1WG1A 4JNKA 5KCMA 4Q19A 5G1PA 2J8SA 3FCCA 1WO8A 1W36C 4G5RA 4HR2A 2BGIA 3QHPA 5ESDA 2B3TB 2JBAA 3NTUA 2ZE2B 4Z9AA 5DP2A 4V3CA 1G4UR 4C43A 1ZP6A 4PAQA 1TQ6A 4HC4A 4B3DA 4R1TA 4MUJA 4R05A 2G08A 4E07A 2IZOA 2C4TA 2CQGA 2QRGA 3ANSA 4PYQA 1ZC3A 5CNIA 1CDDA 4NCGA 4X95A 3PXAA 2OHFA 3UCUP 4HVZA 2RHGB 2IYAA 1OYOA 3KB8A 3G9ZA 4GL4A 4CIVA 1TL1B 2ZBFA 2FLPA 1FSGA 1UL3A 1KOLA 2QMQA 2ZJ3A 5I48A 4IHAA 4ONEA 1P31A 5K14A 3JZMA 1K8YB 1ZR4A 1UKZA 1L0BA 3UVEA 1L8QA 4NJEB 1AM4D 4KHPF 2OZLB 5FOSA 3MINA 1L7BA 1EQAA 1SCNE 1JIIA 3RRNA 3SQGB 1QF7A 4KYTA 2QJWA 3V00A 3FJOA 1U8XX 3EIHA 3SJAA 5E8JA 2NZJA 2YJ3A 5T14A 3UYLA 2VH1A 1Y6GA 4C0OC 3IE1A 1SJ9A 1Z7GA 4DL0C 5LYYA 5M2RA 3QIVA 5HIKA 3LWBA 2NZVG 2VRBA 1NJSA 1KAOA 5CPFA 3S6JA 4Z0NA 1TF7A 3DI6A 1IXKA 2HSGA 1IZYA 1O8CA 1YQGA 4DA8A 1IUJA 4O44A 2AN5A 2XRMA 5L3QA 5FBQB 4CG2A 1TKBA 1VJ5A 1YS6A 3ILYA 3R7SA 4CLRB 1Y6FA 1DTQA 1UMBB 3OZDA 3W8RA 4AXBA 4LJYA 2WOMB 1ZZFA 4QQFA 5HJ2A 3OU7A 3R5XA 4IMIB 3GZNB 4AUMA 3NIGB 4PC3A 5K2MA 2FEMA 2OBBA 4V0KA 4YRQA 3C3YA 2BC9A 1H2AS 3DOKB 1H2TZ 3UO0A 1RSZA 2FPIB 4HHEA 4PPDA 2ENWA 5DM70 4IDKA 3C3AA 1NM5A 2OM6A 1H0HA 3URMA 2FMFA 4F9TA 3W5DA 3V81A 3EPRA 2ZRKA 2Q4BA 2AG6A 1UDXA 2W2MP 1GYQA 2KQUA 5DFAA 3QVJA 5HMMA 2HNYA 5NLLA 2VSQA 3AYXB 5CTAA 4ZVPA 3RVDA 2LA6A 1CY8A 5JBQA 1WEHA 4MQEB 3D28A 1FK9B 5LA6A 5C35A 1L3SA 3WLRA 5HI7A 5AQEA 1R5JA 2JVIA 3RS8A 3U1MA 3GLHA 4Q4AB 3WL7A 3R7BB 4LJ5A 3DWGA 1IOWA 1QY7A 4XB6B 3WQHA 3RYHA 1T35A 3UAOA 5H82A 3I4LA 1FTRA 5LYJA 5FB3A 3PR2B 3I73A 3PNBA 2Q50A 1GPBA 3FI0A 4FB5A 2ZPTX 4NKRA 3U4GA 1PJBA 5EJMA 4F0KA 2CEKA 3MEGA 1DHRA 4XUGB 2B8NA 2NUAA 2DPHA 2Q8PA 4E12A 4QWBA 2OFGX 1SXHA 4LQCA 3BO3A 1X5PA 4MA4A 1AJEA 5JI3E 1W4CA 2HMUA 4X4OA 4PSAA 4N8OA 1Q1QA 1Z0SA 3G7SA 2AFRA 4GW3A 2GMJA 5T4FA 3L7OA 5HDBB 4L3WA 3O5AA 2AF3C 1KU6A 5CA5A 4DCMA 4WNAB 2ZRLA 2WG2A 2PI4A 2VEOA 2CD7A 3G0GA 1M1YE 1N6QA 3F5SA 4QO7A 4RHEA 2GM5A 2IV7A 3ZHCA 3BD9A 1P73A 4QFCA 1SKMA 3SYKA 3DTVD 5EESA 2MGZB 2Q5IA 2AZMA 4KQGA 3W66A 2XWSA 1KS2A 4V38A 3L0OA 4KX3A 3HUFA 4X1IA 4F9EA 4USIA 1HWLA 1BX1A 2QTWB 2QYGA 1WG5A 2YINC 2JEFA 2EFOA 4GKBA 4LSLA 3HDJA 5CMLA 4U7WA 1SKSA 1FRXA 4UE2A 5GMOA 3EWNA 5I5EA 2BKUA 1Y6JA 1KO7A 2O2YA 3SM9A 4H60A 1ISRA 1CQIB 3L77A 3S99A 4KGVB 2W25A 3ZE0B 1CW2B 3H86A 4ZCTA 2CWDA 2U2FA 1NUQA 3UJDA 1FFDA 1T6YA 3AETB 2J3QA 1KJQA 3SC4A 5KYWB 1SV5B 4FNHA 4RHYA 2Y9HA 1U9ZA 4BGIA 3HXOA 3TX0A 3B6KA 4QUAA 3W05A 3TLBA 2V96A 1HTWA 1E6EA 3EXHB 4OYIA 4D6PA 3FQKA 1V4BA 4CL2A 5EWJA 1TVKA 2CEAA 2WT8A 1QE0A 4UAJA 5GJCA 2X6TA 2X86A 3NP7A 1YQEA 2V74B 3URKA 2REQA 4OATA 3U80A 4L16A 4NHOA 4QA9A 3EDRB 1RKVA 3GFTA 3R44A 4WESA 1IKWA 5TGTA 4D0LB 3J80A 2WIDA 4UM9B 3U4QB 3NBXX 3OP4A 3WGYA 1EETA 2JVRA 4ODIA 4NDZA 5IBRA 1ZNWA 1BMFD 1RYRA 1J09A 1RAIB 4NA2A 1CEQA 5G0RB 2ST1A 3D6MB 1TVCA 3ZE2B 5HS4A 2GBPA 3K2EA 2H5JB 1KYWA 2XCIA 3AXKA 3KZOA 2EJUA 4OHUA 3EVWA 4OJYA 4GI2A 3DPSA 2JBAB 2QGZA 1H22A 1CJUB 2Y77A 1H8HA 4ECVA 1RT3B 1SU6A 4F4YA 3FPJA 1H8HD 3IQFA 5IAAA 3HO6A 5DSXA 3UKJA 2BGTA 3QF4A 3L0SA 4RNCA 4LRFA 2KHDA 1NR1A 2XWXA 5EMKA 1YVRA 4HWSA 1OAAA 1NJ2A 2LR0A 2ZITA 3MJSA 4DDWA 3FBTA 3WAGA 1ZMXA 1PAUA 5FO1A 4F3YA 1OV4A 5ERGB 1X1EA 3ISNC 1TKXA 1C0LA 1N1MA 2J41A 2OENG 4YXWA 2EFDB 4QLOA 1CJVA 3SP1A 4JL8A 4ZEWA 3ZWXA 2DBQA 3PUVA 1UBEA 2VOEA 4EB6B 3TQ1A 4YB8A 4FXDA 4M4SA 3MMXA 4AIRA 4DCNA 4LBYA 5BRNA 5JADA 4JB0A 5ETTA 4RH3A 1UBSB 2KXNB 3TRDA 2R11A 2KSQA 5EPUA 2VP0A 5K8IA 3QNWA 3UJ8A 3F56A 3FVYA 1KLNA 2O8CB 1N6QB 1DL5A 1GLGA 3BWYA 3VH1A 3BM5A 2W90A 3G7NA 2RHMA 2EDCA 1S3IA 2FHPA 2VBYA 4J91A 2N42A 3NDRA 4MWDA 5BSRA 4O3MA 1AHNA 2HSWA 4I9FA 1E1KA 1RCUA 4D5GA 1RIIA 2Z09A 1E2JA 4H6VA 1ZW6A 1JH9A 2IYLD 4J0CA 2Z56A 1N2ZA 2GF0A 1E1QA 2XIJA 3BH7A 5KT7A 1QK4A 1ZOSA 4NYJQ 2ZULA 3T1VA 1LD3A 3SSQA 4IH7A 3O8NA 1TELA 1L7RA 2ID9A 1UFWA 2GKGA 4C3UA 2CQ2A 3LYAA 1U8EA 1XDWA 3J7YU 3EWSA 3NXSA 5EE3A 1FW8A 4LISA 2VRNA 3EGNA 1PK8A 4JLWA 2BGWA 1FMCA 3KG2A 2R8YA 2Q6OA 1USUA 3KKEA 3EOZA 2QLMA 4FE4A 4BASA 4R1NA 3C16C 4MOWA 2AN1A 4EGLA 3GJRA 3FC9A 4TS9A 2LVBA 1NT4A 2XYGB 3KVRA 1QAMA 4KOAA 1CUZA 3VYSB 4QTZA 4ED1A 4HDRA 5LBIA 3UB4A 2Q3FA 1NSKL 4UBNA 4Q0MA 2EFQA 3KK2B 4MV0A 3UH0A 1WI8A 1QYVA 4NICA 3MEGB 3Q8SB 1I94J 3MEKA 1KBQA 3GX1A 5K20B 1E1LA 2GJFA 2FFQA 1NKBA 5HZHA 5K9ZA 4ME6A 3EOAI 3V4RA 1UJCA 2QRZA 4EMUA 2CNWD 4P6QA 3TBKA 4DLEA 4XDDA 4GAEA 4XLZA 4HTFB 4QQKA 4GMFA 4YCBA 1FJ7A 4CGYA 3K0SA 4NEYA 5LZ4A 4XO0A 3RRBA 4ZCQA 1C0IA 4B8WA 1KONA 1CIJA 4QFBA 2MYFA 5HE9A 1FLDA 1E5VA 4RE6A 3GB0A 4JB8B 1ESMA 4Q43A 5E6UA 3CHYA 1ZUD1 1EFVB 2G0NA 1D1QA 2FLOA 4ZZIA 1N92A 3KAPA 1XLTA 4G85A 3MT8A 1OXVA 4OXKA 3TXXA 3D7NA 1BH6A 5D2CA 1XMIA 2XE6A 4FOLA 3OJWA 1QH8B 4QYZJ 4I3GA 1UJ2A 3BE6A 5A0YA 1SU4A 3AEQB 4C20A 1DU4A 3O4VA 3E4CA 2HGNA 4CUJA 2QMHA 3IYLW 5EIAA 3W1YC 4Y2XA 4D8TA 4Y6PA 5B7WA 4YY3F 1RTHA 2DEJA 2XTZA 2W93A 1FEZA 1SU8A 2Z9DA 2A94A 3BC1A 3ORQA 5TNXA 3V8BA 3VNVA 2RNEA 3MAQA 1VKRA 1ZBDA 4X61A 3OX1A 4YAOA 4UUPA 2D9OA 5IPFA 1FYDA 1S1WB 2NXCA 2CPZA 2XSZA 3W8EA 1TRKA 5EIFA 4H4KC 5HF9A 1P1RA 5LBUA 2BJ8A 3ITDA 2YTZA 1HYSB 2SECE 5AJZA 2I6QA 4WASA 2AEEA 3Q8YA 1KFEB 1WMAA 3KLOA 3TRKA 1SELA 2AMCB 3O73A 1U2EA 2GXQA 5F33A 1Z7EA 2WWFA 1I3MA 3ILJA 2XHWA 1YJXA 3U3OA 3RU2A 1UWBB 4X6XA 5CA1F 2QJTA 2IUEA 2FEPA 1FLVA 2VAMA 1WW8A 4KPUB 4KR9A 4R16A 1APSA 2GN8A 1RP1A 4DIDA 3H6GA 4TKZA 1N1EA 2DLNA 2GNPA 1EFHA 1Z34A 4YP9A 1CPZA 3FVQA 5FTMA 5FYDA 4K1LA 2PGDA 4WZBA 3CCTA 5JU6A 1VMDA 1KOOA 3K59A 1IYZA 3VVLA 2AG5A 4ZXPA 3W3SA 2C2MB 3DUFA 2QA2A 1T24A 2Z3ZA 4D41A 4XIIA 3BE4A 3FAZA 1IG3A 3NMRA 1NVEA 1OBOA 1UP7A 2QRVA 3SVLA 1G64A 4DR7B 3K0FA 2Z5VA 4N7BA 4QEKA 2BDPA 2BJHA 1ZOIA 3G2QA 3QYYA 3O7MA 1M5PC 1EJ0A 1QFZA 1GRQA 1K1EA 3S8YA 3LGAA 4LFBJ 3LS2A 1U0NA 2L18A 2RGDA 4PCLA 2E5IA 2FA9A 1Z2ZA 1IL0A 3E48A 3KUHA 2VQEJ 3N6MA 3D2WA 2CDCA 2CJ9A 1U7LA 2ZG6A 2OV8A 5L7WA 2HF2A 2DHQA 3ZDZB 1YS7A 3FSGA 1DWUA 4UEOA 4E21A 3K7RA 4QBGB 2JLQA 3ZWWA 2GPYA 3KK0A 3W7AA 3MR7A 4G8BA 5CB0A 1NHVA 2R62A 4GFDA 3BB5A 2QE6A 3E9NA 3AZQA 1KTVA 4JGGA 3MMBA 2RHTA 4LDZA 1L5KA 2FQYA 2XKBA 3OJUA 2J08A 3T38A 3U1NA 3KELA 5HMWA 3H1AA 1YB6A 2ZJPQ 1I2CA 2NZYA 3AOGA 2VQSA 3ICVA 1G5TA 5IVHA 1VIXA 4N5NA 2RH8A 1GFWA 2GF2A 4EB8A 2ZYHA 3C8UA 3GIMA 2NZ4A 2H3EB 1S2LA 3ANXA 4ZPJA 5TDHA 2FE1A 3BZBA 4DZDA 1FRLA 5EJAA 5JNTA 4NRUA 3AUAA 3R27A 1XC9A 1WL8A 3KOZA 1SD1A 3QPAA 3F7MA 4J0EA 1DOZA 4MWCA 4OGKA 2ZOFA 3DRXA 4EY5A 2CZVC 4EBCA 2ZBGA 3LDAA 3IUNA 5EVCA 1QH0A 2O1SA 2VDUE 4Y6QA 1RU2A 2FVYA 3HLYA 4ZYYA 4W5RA 2P0YA 3EFEA 3OX4A 3WGZA 2CXUA 2QS9A 4RACA 4HAXA 4WOBA 3PNYA 1UEIA 2GVDC 3CISA 2Q2WA 3IBSA 3QWIA 2PV7A 2PLNA 3Q7QA 1RC1A 3K57A 1NJ8A 1EKRA 5DGXA 2FN3A 4E13A 3PYLA 2OXRA 1L5WA 2PG3A 1K89A 3A1EA 2J0UB 1E0JA 4JUAA 2VDQB 2C9ZA 4TYBA 2O9JA 1IOVA 1LX6A 2UV8G 2NIPA 3GMSA 3F71A 1A76A 2DBRA 3R7FA 1QKJA 3DGPA 3KLGA 2PANA 1Y3KA 1DLIA 1T5IA 4IYQA 1BJTA 2DGWA 1A82A 1K6EA 2G13A 1QV9A 2GX6A 1U3CA 2OP1A 1MU2B 3OPNA 3HKBA 1WF6A 2IY9A 3OJSA 1Z15A 3AM1A 3WC0A 1VKNA 3KJZA 2GN0A 3VAGA 1SBQA 4PR6A 4G89A 4QOFA 1CUFA 4RPGA 3I5AA 1L1QA 3HACA 2WT9A 4BB6A 3H98A 3UB2A 2Y92A 2JBHA 5LIRA 1YQTA 4XPCA 2QENA 2G04A 2XZPA 1KI6A 1IKYA 3G9XA 1XA0A 2PO5A 4DR7J 3Q6MA 3ZCPA 5JZBA 1MOQA 2VPQA 2GIQA 4MTCA 1RTHB 3WJ1A 2OV6A 2GEJA 1OGJA 2QUZA 3KSZO 3QXXA 3P3DA 3PHTA 1VRTA 2PV0A 4JHXA 1KFCB 5E38A 3D7SB 4TU9A 2WOMA 1NOKA 2P3LA 1YDGA 1ZTTA 4FOPA 1U5BB 4REQB 5ALRA 3WHPA 3VAJA 2GX8A 3AA9A 4YUZA 3F5FA 5AW8A 4C1NA 4O2BA 3BD8A 3ACBA 4V1CI 2BQRA 2O8EA 3HU5A 4X66F 1PJ7A 4C0SA 3FYUB 3TDMA 4K86A 2VBIA 1J8FA 1NFQA 2D3UA 4RESA 4M76B 1T1RA 3EJWA 1XRMA 2HVDA 4DV5J 1JIJA 1JT9A 5A5EA 4WWHA 1JI0A 1RUSA 3V8MA 4GH5A 3I5XA 1JU3A 3L8HA 1I5OB 2XMGA 4TMFA 1RYFA 1VBFA 1PWHA 5JZMA 2VDRB 1CZOA 1YR2A 3SJ7A 3VTKA 3Q40A 1P1FA 5HIIA 2CCKA 2W4IA 3LUPA 2E21A 4B46A 3DDWA 3EYZA 4B17A 1DAPA 1I4LD 1CQMA 4G09A 1NI4B 1JPVA 2VHZA 1M2FA 2YRWA 2ZVPX 3GD7A 3AVPA 4LBIA 3V55A 4G5XA 3COVA 4MIKA 1VBKA 2CJPA 1HLWA 5IVIA 1ZPWX 1UBCA 4M36A 1OY1A 1Z0IA 5KYNA 4YOEA 1PJCA 2OSQA 4A4DA 4RHCA 4EJSB 2W6JA 4QBUA 3DKKA 4J6EA 1AW0A 2AHOA 3ESBA 2K06A 2BOPA 1SB8A 1GILA 2NYVA 2DNZA 2ZTHA 2N4CA 4ZZ0A 4UZSA 3NWPA 4B2IA 1AROP 4CM4B 1P91A 2W2KA 3OCCA 1S1TA 2YASA 1T7PA 2OOSA 1X7ZA 4Q1BA 5CB6A 3PLAE 1V3RA 2X4DA 1OW3B 2DE0X 3BTSA 1Q1EA 3EXEA 3PWZA 5HCUA 3V80A 1XNRJ 4X60A 4N65A 1K4MA 4R83A 2XE8A 4AY5A 3CF2A 3U7EB 3KUCA 5J1TB 2EFCB 3S68A 3D6AA 2GYWA 3RSLA 4JD5A 4PGGA 1GRVA 2QAIA 1B0PA 2HAIA 2FOLA 2G0AA 4IDBA 3P94A 4RGYA 4X45A 3DNFA 2WP0A 3E58A 4XTRA 2DNYA 2DCLA 1U47A 1RLUA 2QEXS 1Y9OA 1RVV1 1S1VA 3ABRB 4ZAFA 3AHHA 4DREA 1T3GA 1ZGGA 4BGUA 4ECXA 1M2JA 5CFQA 1Z4JA 1AU9A 1LDNA 5B0BA 3NWEA 4Z9YA 1E6VB 2E6KA 2PRSA 1Z68A 1OR8A 4B6QA 4CM1A 1F17A 5A8KA 1LV8A 3KKKA 2W9XA 1E5XA 1MXHA 4J0QA 5KTKA 4PPZA 1A8QA 2X8JA 1RHJB 2PZKA 2LPMA 2XMPA 1M10A 5COAA 4YXWD 3OM0A 2H7VA 3WJAA 2BMBA 2HMIA 3N0WA 2G9UA 1UPFA 5EEGA 3W5CA 3TNVA 4JI7J 2LV8A 3PRVA 4IXNA 1P2GA 4OI0A 5T4EA 1CP2A 4X6LA 2ZHOA 5H1YA 4Y6LA 2R8JA 2OAUA 4H4EA 4UM9D 1BWEA 1G21A 2R4QA 1CQPA 2I7DA 2VJOA 3QBEA 1YRBA 1NLUA 2A7QA 2CNKA 1U6FA 3QKTA 4OFXA 5J2TB 2PS0A 3ORRA 5JVDF 2VONA 3ZE1B 1ZH6A 8AT1A 1WVMA 2J45A 2IIBA 3ESYA 1DEOA 1ADBA 4AYXA 5JFTA 4CCSA 1RRVA 5FTKA 3T5AA 2IMOA 2BGKA 2LU1A 1O7JA 3ER8A 4HSEA 3QFTA 1T05A 2YH0A 3MPDA 1BD4A 3U3JA 4KO8A 1O0CA 1T5SA 3R5JA 2MYNA 3NBUA 4WACA 1DIGA 1F06A 4K9OA 4UVEA 3E9EA 4FGWA 4QXAA 1J25A 1ZI9A 4W6QA 4EGFA 1X5OA 3RLFA 2DH7A 4DX7A 3E35A 4JL5A 1QZTA 2RBKA 1K7SN 1ML4A 3VDMA 3WHLA 4P4UA 1BS1A 3GCXP 1RFGE 5DK4A 3LCMA 4ZVPB 3WLJA 3U5TA 6AT1A 2GHIA 4GKKF 3Q5GA 1RWOB 3O74A 4PVDA 2J76E 2GN1A 4UHDA 2GN6A 3ND9A 5JARA 1AKYA 1LBIA 3PL1A 1Y5LB 3T52A 4JLJA 4RL6A 3E9RA 1S01A 5ELXA 2NUTA 4AP9A 3T3HA 1XCGB 4N4AA 1VLQA 4AULA 2D59A 5CVUA 3WDKA 2CPEA 4EZBA 2JS7A 2V6JA 1QIEA 1XVUA 5K3FB 5FA6A 1QAQA 4TV9B 4MH0R 1G7RA 1KHVA 5DHPA 4EFMA 4PRLA 4EGJA 1FRVA 5J2QB 3OSNA 2Q3BA 4AM8A 4RM3A 4MW7A 3TZLA 2A0FB 3PJWA 2O2DA 3DOMA 2ZVJA 3FCVA 1P80A 2W6CX 2IVMA 3MSXA 1BGWA 3S7ZA 1AS2A 4IHJF 4QYTA 3IP7A 2CDRA 4PX3A 3A6PC 1FRQA 1W36D 3CDWA 5C1DA 4ID5B 1DJPA 5CYJA 4MVJI 4MGZR 1VL8A 4D7AA 2IU3A 2YQ5A 3CJTA 2MZRA 3X1YA 5K01A 1WXWA 2AOVA 2H08A 3AQOA 2JEYA 1OH6A 3LY9A 2ZTVA 4YP1A 5FPQA 3OMLA 3TG2A 3MD3A 2Z4SA 2X1BA 1CS4A 2RRNA 2PFSA 4FFVA 4N5MA 2HQCA 1XTBA 2BH9A 3DP9A 4CO1A 5AW9A 4HXFB 2XZLA 2VC1A 2QIPA 3H3FA 4Z4GA 4OLAA 3V1NA 1E6LA 2CUTA 2I3AA 2D41A 2YPYA 2UZ0A 1QVAA 2DGSA 5JHHB 4CZ2A 2DBYA 5AVKA 1TZJA 7AT1A 1P33A 2GR9A 2NU6B 4DJFC 3EC2A 1YKSA 2W48A 4FFRA 4Y2VA 3RC8A 5CAEA 1ETHA 3FMBA 5CXXA 1W0CA 4FKBA 3DMRA 4KKOB 2MB0B 3UNXA 4WMLA 5CURA 3SQDA 2VBGA 2QTBA 4TLBA 1YHZA 1M7GA 3ASVA 3FVWA 1JXAA 2A2CA 1EK1A 3O8QB 1SMKA 2A9FA 1MJHA 4MQFA 2Q3DA 3UT0A 3ZQJA 2HIYA 3GXOA 2NR0A 2DF8A 1ZVVA 3ZGNA 3T1YF 4CLTA 3VR0A 3GJQA 1WE2A 4G37A 4TSRA 1FCJA 3MURP 4TXMA 1S1VB 4BLGA 4OZ0A 4B35A 4P2MA 4MSUA 3DAFA 2CADA 2QLNA 2GPSA 2XXBA 2WAQD 4KIWA 4O2LA 1E6VA 2G1HA 4RF4A 1UKAA 4WDRA 3EY4A 3G23A 4YALA 4E14A 3WP0A 3C5EA 4WKCA 4ZP6A 5L38A 4Y28C 3ABOB 3N2GA 5A62A 1Y8QB 2BY4A 4LOIA 3QPWA 4ER8A 3JS5A 1HR0F 2VNJA 4EY4A 5ALXA 4L7QA 2DVMA 1X4CA 4CZCA 4KACA 1RWVA 1SUPA 1W5AA 5BYBA 4RZHA 3Q7PA 2VG6B 3R97A 1DXHA 2AZDA 3M5PA 2OSBA 2V3WA 2LNDA 4RTSA 2H2FA 4BVHA 2YVUA 3ORFA 3RSFA 2HDHA 2LD4A 2DH8A 1E20A 2II6A 4YCJA 4TL8A 1V9LA 2JCSA 2RKOA 3K0AB 1M34A 2ZDQA 5G0SA 3TWOA 4U67Q 4F9FA 1RKUA 1GUDA 4MW5A 4JFAA 3COWA 4ON9A 1YUMA 1XEZA 2ILTA 4P74A 4FGJA 1PP4A 5D84A 1UZDA 1RTDA 5EL0A 1KK2A 5B58T 3UMJA 1GNTA 1QDUB 1ZJ6A 3PXGa 4C3LA 2HNBA 4KXMA 2GIFA 5L9AA 3KXLA 2O8CA 1T8UA 2CVEA 1ONBA 3TEGA 1JR2A 2XLBA 3H5VA 1WC1A 3QP9A 1ULUA 4ZYLA 4C4PA 2GAFA 1HD0A 1Y34E 1Z8HA 3KVYA 2X3UA 2WTXA 4AD6A 1B43A 4TS3A 3PUIA 2W4MA 3SDZA 1SZDA 3P32A 4FNGA 3MM9A 4N5DA 4LF6F 3N2NA 4LHSA 1ZXXA 5E41A 4OX8A 3ZHSA 3EC1A 3RWOA 2CYBA 4UZCA 3PITA 2A57A 2ZH3A 4GZMA 4HEA9 3W2IA 4DLVA 3NI2A 3DVLA 3I1JA 3CC7S 1OWXA 4RA6A 3IS9B 3IOBA 1L7DA 3PXXA 3F9CA 1FP6A 5D4PA 3KNAA 1RU3A 2DHSA 1H2FA 4DQDA 1N0IA 4W90B 2WIBA 3EH2A 3QBDA 1GR0A 3QNMA 4FF1A 3BBLA 3N74A 5EPEA 4IHJB 4W1SA 1ONSA 3K71B 5DS7A 4KGMA 1QH1A 2KX7A 3RAJA 5HSGA 4EZ9A 2O1XA 3ZWBA 2DJIA 4KIAA 1N34B 3AXMA 1EFRA 1WC0A 5HE8A 1E79D 2W2NP 2GT1A 4E5SA 4CEHB 2BBOA 2JCXA 5FBRB 4ECYA 4FT2A 1CVRA 1DDIA 1LLQA 3LY7A 1T9TA 2JAXA 1PZHA 4DMUB 2L69A 4QTYA 2YHIB 4FX5A 4X93A 5E0KB 2IPAB 1J2YA 4DV1B 4ZVNA 1S9GA 4COOA 1JLMA 4C4XA 1I36A 2PGCA 3UWSA 1FW6A 3FRZA 5HROA 2GI4A 2W1BA 2X41A 1EBBA 1WVIA 1D0VA 2HB6A 2CPXA 3GFRA 5IUNC 1J0DA 4WK0B 1AQIA 4JYAB 3HFSA 2PZ8A 2O7SA 5HQ3A 3A4IA 4Z7YA 4G0XA 1UP6A 4IYRA 2O2JA 4C14A 1BMQB 3QX8A 3T7SA 5C24B 4LR7A 4NONA 3AGPA 2VF4X 4KL8S 5EJ8A 2OBLA 4JOSA 2CYYA 4XAKA 3JARB 2W7AA 1HEUA 4CYUB 4GX0A 2BFAA 4LNUA 4DZRA 5L51A 1N6IA 3DDSA 4YDXA 2KM8C 2QP4A 1Q7GA 3P20A 3P0IA 4KY3A 1BJRE 4UAGA 4KREA 4KPEC 2J5QA 3F67A 4WFIA 1L4FA 4WUVA 4NTZA 4CRWB 2JA2A 4XJVA 3REOA 1KHHA 2CMGA 4HQFA 4NS1A 3A36A 3GZJA 1Y8CA 2PMHA 1P0IA 1JLQA 4JYAF 4MYHA 1SULA 4R8LA 1R3DA 4IFTA 3UHAA 2WTBA 3HDGA 3UNGC 4PHHA 1UVIA 5A3JA 1JYSA 1CUJA 1LBHA 3OPXA 2XXAA 4MV9A 2EFYA 4KPYA 2O2IA 3AR8A 4ANDA 1NX6A 3A14A 4M5HA 3C8MA 3B2NA 4US1R 4G81A 5FTNA 1N5JA 3SZLA 1FF2A 2BHNA 4INOA 2B0JA 1XCBA 4RFLA 2PCLA 2C4VA 5EQTA 4NLUA 2D7DA 1QYXA 3EMDA 2CSXA 4L4ZA 2MR6A 4URXR 3NOOA 2X2FA 3PGXA 4DU7A 3F0TA 3S7TA 3ADAC 1JQLB 5DW0A 1N5TA 2VG8A 4ZS6A 4JLSA 4MR8A 1QX4A 4RD1A 4NIMA 3B7WA 4W1RA 1T9GR 5ALGA 4FVTA 3T54A 4B7UA 4URWR 2VUTA 2WFLA 5KTYA 4KI0A 5ETPA 3GHHA 1P0MA 1ZUWA 1NPKA 1TC1A 3AZPA 3PC2A 4YUVA 2FJAB 5AP9A 3CDBA 1L5SA 5K4HA 2FR8C 3NO4A 2X5OA 2GWRA 1G18A 4OQMA 1DEHA 2YZNA 4EJSC 1BDIA 1KJ9A 1D4FA 1Q3TA 2WVGA 2WR8A 1IBMF 2HC9A 3HO8A 5GONB 2VFSA 5DXFA 2QMEA 4N3GA 1Z6GA 3L6BA 2ZSDA 3KR9A 2R47A 3UOGA 4KR2A 5IWAB 1SK9A 2DPYA 3GFSA 5K8NA 1G8KA 3D1QA 4D9BA 1K7XB 3OLAA 3EHDA 2WCXA 3A9TA 3DFFA 3DEIA 4II2A 1A77A 3UFBA 2FYXA 4V1Ak 4TMVA 4JR2A 2RAVA 3PKJA 3GRVA 2GCOB 1FKPA 4X4VA 1PT9A 2KRRA 1DB3A 1US8A 2X1HA 5H68A 3R4VA 5TMBA 1KI1A 4X5OA 3SDEB 2EK6A 3QNUA 1KC8T 1QSYA 3HJUA 5B4UA 4UOHA 2F00A 5CYMB 3BPSA 2OPHA 2RONA 1BMQA 5ETVA 2L19A 1WDWB 5I42A 4LSMA 1Q0RA 3KDPA 3WA6A 5AESA 1PFKA 1TK5A 4QBKA 4B4WA 4EHDA 1HE4A 1ZGCA 4MWSA 4JBCA 1Y4ZB 4GOLD 4K7JA 2C2EA 5EWLB 4Y7DA 4DSOA 5KAMA 1M7HA 2VT2A 1D2GA 4EUHA 1D9XA 2VFRA 3E1KA 1I9CA 1XLVA 521PA 4E4RA 5G0UA 1XXHE 3CEDA 2C77A 1NYLA 4IG4A 1IBCB 2CQ1A 4U8GA 5JEDA 1E0KA 1QF9A 5K0ZA 4G63A 2JATA 5TMDA 1L4UA 4FD3A 4P7VA 3RVQA 1RT7A 3IAEA 2CRLA 1KZ7B 3NJ8A 1H98A 3OY2A 4ZVRB 4RHUA 4Q7QA 1ZGAA 1L4NA 2CD9A 1MPXA 3LUFA 4BX2A 2VUUA 1BRTA 121PA 1YI0A 4P8RA 2DYAA 4HH4A 1EFTA 5EG5A 4WKGA 4O2BF 4TMTA 3SSMA 3Q23A 1AUOA 4CTNA 2YW9A 3OD2A 5JMNA 3TOCA 5J2PA 3W77A 1JWBB 5C4GB 1HNIA 3UDCA 4DA4A 4NHEA 4P7TA 1GN8A 2IM3A 5JROA 1LGYA 4NQRA 2NYRA 1W0KD 4DUZB 3SBOA 2FZKA 3DNPA 4MYTA 3GFXA 1GN9A 1G8PA 4J3JA 4R3WA 1W34A 4IIXA 3FZQA 1ZNXA 1ETUA 4CLPA 3JPYA 4ZI7F 3EVBA 4GQIA 3DLLQ 1QP7A 2B34A 3RRHA 4RPKA 2G7MC 5CJ2A 4DV4F 5T5QA 3UFCX 2NACA 1V6CA 3F73A 4YQYA 3THWA 2XNKA 2RGGA 4M37A 5U9CA 3BPDA 2GVDB 2ACKA 2WK4A 3VNQA 1L6IA 1HFJA 4GM0A 2DFVA 2O23A 4Q9KA 5HUHA 5HK8A 1S7IA 2NSCA 2BV3A 2QL5B 1P5HA 4MUBA 1JDVA 4PVCA 4UW9A 4G07A 5GM2A 4DLBA 3JAMY 2UYQA 3OT5A 1WETA 2G3YA 3N2KB 3B53X 3D0GE 1IY9A 1HNNA 4QC2A 3DMYA 4ZT6A 1IVNA 3AU9A 3PDNA 1VL5A 2I6UA 4P5EA 4INPA 1S6QA 2ZREA 2WKQA 1WC6A 2RS8A 4HR7A 4E5PA 3PJ9A 1UWBA 4J9SA 2Z5LA 1E89A 3IAS1 1G19A 1BEUB 5FNVA 5CD4A 3TW8B 4Z1MD 2DETA 2A92A 5AM4A 3RGGA 3G9CA 1CDOA 4EB3A 4JI0F 1PI3A 2DNMA 1NMXA 2WFAA 3SCKE 3OZVA 4NLDA 2AFHA 4B79A 1EE2A 3CD6S 4G24A 4YMWA 1PJLA 3WWOA 4OKIA 4I6EA 3GLQA 2HM7A 1R6UA 3G0BA 4CF4A 4OK6A 4X7BA 2ZR7A 1YDWA 3N7UA 3UR0A 3MT0A 1PYOA 4OVKA 1EM8B 5C8VA 4LXUA 1YJBA 5IAEA 3JR7A 5AT1B 3PDJA 2L3MA 1GZ5A 3H11B 3RU7A 3LMKA 4DOMA 5A02A 2CVHA 1KDTA 5JVGQ 2CK3D 1KZ9A 3C45A 3GUYA 3TTXA 4G0VA 3TSCA 5JVDA 2ADMA 2ORIA 2O7RA 5GV8A 3AVVA 1NI4A 4B9EA 4V19X 3FYUC 4FVCA 4EMDA 4KMSA 4BEJA 2YNIB 3VR2D 3N8IA 3HU3A 2WU8A 5EMNA 2HMTA 4K6GA 3F9RA 3PSAA 1N78A 4IV5A 1SJ4P 5LDHA 1S77D 3W34A 3KWFA 3AF2A 3R8FA 3RU3A 2P6PA 2XTJP 1XZHA 1IHDA 2FWJA 1SKRA 1H2ZA 4F4JA 5HZGA 2D2VA 1EIYB 3HBNA 2RHHA 1QAXA 3LHFA 2LIPA 4KSYA 4UUWA 1WY5A 3RTAA 3N8GA 3G13A 4FM9A 3I9V6 3ADOA 4O0NA 4KYUA 4DC0A 3WGTA 4I1OA 4G5QA 1ZVJA 2V2ZA 4H7PA 5A4IS 3AAWB 2NO7A 4M2LA 4BYMA 2E44A 2Q7OE 1ZA2A 4GZ5A 2Y0BB 1YCHA 1SC3B 5EZ6B 1O0PA 2EZ9A 2Y1FA 3WYNA 1Y81A 4ZARA 3DW3X 1FNBA 4YJ2A 1OPIA 3FG9A 3DG9A 3DTVA 4A27A 4RADA 2R7WA 2XDYA 2CUNA 1UODA 2YXPX 3MJ4A 2P2SA 3II6X 2HQOA 1B76A 1D6NA 4D9CA 4FBTA 5FFFA 2Y27A 4U6SA 1YTUA 3BSSA 3M6XA 1RXWA 4KT0C 4Y9TA 2IH2A 2NZCA 1YE5A 4Q0BA 1TAHA 3WLFA 2J07A 1VYTA 3GV8B 1FFEA 2VJDA 1UJBA 2Y1WA 2QYTA 2E4ZA 4XQEA 3RS5A 3AL2A 1G5RA 3SV4A 4WN3A 4QW8A 4K2JA 3SYZA 4TSFD 1UMJA 1KMIY 2WFMA 2CF6A 1SPBS 2OG1A 4QICA 2ERYA 4TYAA 2DJWA 2QX0A 2V03A 1KR5A 5KTQA 3IP5A 3VGVA 2D7JA 1WXFA 3TLEA 1Z2NX 4CTMA 3HWRA 3RVMA 4C29A 4DKXA 4PPQA 2AE1A 4P9NA 3LDUA 4A15A 3LX6A 2F59A 3OC0A 2AC2A 2V2QA 2AKAB 3Q15C 4CIYA 3W2VA 5H9FK 1M6VB 4CU5A 3D7MA 5AKLA 3QK7A 3IIKA 4P1ZA 5EXEA 4JT9A 1XNHA 3FZGA 2KFNA 5LZ9A 5E7JA 2OC9A 2HPHA 2R7MA 4H6WA 3RR7A 5AI0A 4YY3B 1RBLA 2VQ6A 1N2SA 3MQFA 3K2YA 4L5JA 4AS3A 1XD2A 1ZUHA 3AW9A 2OEMA 1WD6A 1CU1A 4HAWA 3IR7A 1U3UA 2QPAA 1O9BA 1SOUA 2B1GA 4DKJA 3BK1A 2VCEA 4U2CA 1TTHB 2D62A 4KH1B 1M0TA 4B3MB 3T4EA 1GDTA 4MZXA 1H3FA 1TU3A 2NV2B 2ZJOA 4QGHA 1V7CA 3OT4A 2NG1A 5EE9A