3OBIA

Crystal structure of a formyltetrahydrofolate deformylase (np_949368) from rhodopseudomonas palustris cga009 at 1.95 a resolution
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
285
structure length
285
Chain Sequence
HHQYVLTLSCPDRAGIVSAVSTFLFENGQNILDAQQYNDTESGHFFMRVVFNAAAKVIPLASLRTGFGVIAAKFTMGWHMRDRETRRKVMLLVSQSDHCLADILYRWRVGDLHMIPTAIVSNHPRETFSGFDFGDIPFYHFPVNKDTRRQQEAAITALIAQTHTDLVVLARYMQILSDEMSARLAGRCINIHHSFLPGFKGAKPYHQAFDRGVKLIGATAHYVTSALDEGPIIDQDVERISHRDTPADLVRKGRDIERRVLSRALHYHLDDRVILNGRKTVVFTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Formyltetrahydrofolate deformylase
publication title Crystal structure of a formyltetrahydrofolate deformylase (NP_949368) from RHODOPSEUDOMONAS PALUSTRIS CGA009 at 1.95 A resolution
rcsb
source organism Rhodopseudomonas palustris
molecule tags Hydrolase
total genus 75
structure length 285
sequence length 285
chains with identical sequence B, C, D
ec nomenclature ec 3.5.1.10: Formyltetrahydrofolate deformylase.
pdb deposition date 2010-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00551 Formyl_trans_N Formyl transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3obiA01
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 3obiA02
4ZZ2A 1U8SA 2FMTA 3S1TA 3L7OA 3MWBA 2J0WA 3MTJA 3LUYA 2I9SA 2PC6A 1PSDA 2F8MA 4ZZ1A 4GMKA 4R8VA 4ZZ3A 3UW1A 3U7JA 3OFGA 4LUBA 1CDEA 1GARA 5CJJA 5FIIA 5J9FA 3ENWA 3HHEA 1RC1A 1JKXA 2JHEA 4DS3A 1LKZA 1RBQA 1RWUA 4ZYVA 2RE1A 4TTSA 2GARA 5J63A 1C3EA 1LK7A 2RQMA 4EW1A 2ZHOA 3KCQA 2LQJA 2QMWA 2FGCA 1UJ5A 3AB2B 2P9CA 1S3IA 3DHWC 1YGYA 2H9ZA 4ZYTA 3ENQA 5IT0A 4NMLA 4Q12A 2QRRA 4PWUA 3AAWB 2PA3A 2NYIA 3W7BA 3K5PA 1ZGHA 1ZLXA 1RC0A 3DC2A 3DHXA 3LOUA 2F1FA 2RQKA 1SC6A 3AV3A 4ZYUA 3IXQA 1RBYA 3TUZC 4TS4A 4EW2A 1GRCA 3NRBA 2LVWA 2CFIA 3R8XA 4ZYZA 4QPDA 4NV1A 3P9XA 3DDNA 2BLNA 1RBZA 4S1NA 1LK5A 4TT8A 3TQRA 4M8LA 3AB4B 1ZLYA 1KS2A 1O8BA 3P96A 1MEOA 1Y7PA 3GARA 3Q0IA 3DCJA 4IO1A 4GO5X 1MENA 3OFFA 4X84A 3KWMA 5IT4A 1MEJA 1YBAA 3OFHA 2DT9A 2JOQA 3TUJC 2DTJA 4YFVA 2KO1A 3TQQA 4EW3A 4ZZ0A 1ZPVA 2MDAA 2QSWA 4IQFA 2P9GA 3MAHA 2J0XA 3OFEA 5T41A 4YFYA 3ENVA 1UJ6A 2P9EA 1CDDA 3N0VA 4PZUA 3OBIA 1XTZA 3O1LA 1M0SA 2CDQA 4GO7X 4ZYWA 3IBWA 2QMXA 4QPCA 4ZYXA 4ZYYA 5IS2A 3TUIC 1FMTA 1YRWA 1RBMA 3CEDA 5JJBA 2YWRA 3DA8A 1NJSA 2BW0A 1C2TA 1UJ4A 3AUFA
chains in the Genus database with same CATH superfamily
2B7BA 5HN0A 3BH7B 4A9AA 2P6NA 3DTVB 2XMKA 4B9AA 5J58A 3DOLB 1A27A 3U7JA 1BX3A 4XYGA 4P5EA 4QAQA 4K28A 1JKXA 2ECPA 4B80A 2RILA 1E94E 3P7MA 4QULA 2O3RA 3OE4A 3W1EA 4E07A 4RZ3A 2PI4A 4G5GA 5CD1A 2QA4S 3KX2A 2YMQA 1IY2A 3FR8A 5CVCA 4X0EA 3FQLA 1FVFA 4IILA 4RNCA 3U40A 5K0SA 4B1FA 3E2MA 1XQWA 3ZVNA 2HA6A 4D45A 1IK6A 4TT8A 1N2CE 4QD3A 1NRJB 3A10A 1WY7A 2YV2A 3CRNA 4OJQA 3T5HA 4IVPA 4CCAA 5CH8A 5HFJA 4WK3A 1M10A 2WHPB 2GKSA 3N2NA 4TS3A 1EA7A 4G2NA 2O8DA 2OP1A 1FKOA 1TKTB 2BSAA 1A9OA 3IH5A 4UHDA 2DPHA 2P0AA 5FNVB 3D0GE 2HSDA 3STYA 4OJYA 2LDBA 3NYRA 4NV3A 2H7YA 3UNGC 1VHIA 3EWGA 4BGUA 1V71A 1FTGA 3FAZA 3B6MA 1JKHA 4WZQA 4FN5A 4LNUB 1F5NA 4GQIA 5EJ4A 3IMGA 3E15A 2ATCB 2BOAA 2WWRA 2OCGA 3NT5A 1R9NA 1FLVA 1IPEA 4LQ4A 2YWFA 1F2TA 1PT8A 1U1FA 4TX1A 2GNKA 1XK8A 1RYBA 3GGCA 1GQEA 3AI2A 1LW0B 1JXQA 1B70B 4LR8A 3WLAA 3COVA 5GZ3A 2ZRCA 1EU1A 3WGZA 1SXJD 1Z73A 4PXBA 4C78A 3PGVA 1AZLA 4UUPA 2IV3A 2B0GA 1BWRA 1ZRNA 1F2VA 2I9KA 4NI2A 3BT7A 3W05A 4GPEA 5CA0F 2W8ZA 1R37A 1N6QA 1C14A 3F5MA 1PK9A 1JQLB 3R1IA 1C8VB 3FLBA 2IVFB 4NCBA 2RKOA 5KYYB 2HYIC 3MW8A 1NW6A 3SN6A 4UVIA 1Z36A 1T4DA 4E5KA 2XB2D 4F9FA 4O4JA 1EEHA 2GEVA 4GNRA 3NAQA 2O8FB 3MD1A 3R1LA 3DVRX 4IW3B 5JO0A 2V8OA 1YZTA 2XMWA 1WETA 2R66A 3FVQA 2VDUE 3KYBA 1LJLA 2C5LA 4W7HA 5JAIA 2UVWA 4AJOA 3LL4A 4Z4EA 3TLAA 4YJDA 2HUPA 1PAUB 3PC3A 2KLHA 2DWOA 3KLEA 3CZ4A 3SKXA 2A7QA 1N75A 3K4PA 4FE4A 3BXOA 2QX0A 5TPWB 4DMRA 4KFSA 3AR5A 4UZCA 1YS6A 1TIKA 2QM7A 4OQXA 1T34A 3QEOA 2GAAA 4K4UA 2HRCA 3EZNA 1C4WA 5TQ2A 4GC5A 4W63A 1EWTA 3OCXA 1KFDA 5T8KA 4B9UA 3FI0A 4CFZA 5ALRA 2BUAA 2GJAA 3P2YA 2MTBA 1IY1A 3EWAA 1WTAA 4DU8A 4PWDB 5JDCA 3Q3GE 4C9BA 4EB6A 1ONSA 2E5HA 3E70C 1H66A 4TSRA 3Q7IA 3RM3A 3FZYA 1T03B 2DSTA 1LTQA 1EK2A 5BSFA 3CCQS 3V80A 2GJ8A 4KRGA 3KG4A 3CC2S 5IRCD 1LUAA 3Q40A 2BRUC 1W1WA 4DSZA 4I4TF 2PWAA 5IULC 4R41A 1R0ZA 1DTTB 3FYUC 1BMQB 2VAVA 5I42B 3C8YA 1GFSA 4DPYA 4QR0A 5IDVA 5G0TA 4D46A 2CN1A 3WJ2A 2LZ0A 2VPWA 3TSAA 1U2TA 2XVAA 2RI1A 4YCCA 4KPCA 1HMVB 4LQ9A 2W2TA 2XCTB 4KYZA 1WSAA 3HKCA 4MV1A 1OXSC 5CK5A 3F3SA 1R0XA 3Q0IA 4NNOA 5B6IA 3OJLA 3GHHA 4L0CA 3NP5A 4DX8H 5IAAA 1KORA 4LF8B 5J2UA 4RTNA 1CJTC 5DZ6A 1QIDA 3NNHA 2KFNA 3LT4A 3JD2A 1B0AA 2MHCA 2A3JA 3C3CA 4K4WA 3OOWA 3R76A 3WRVA 2ESRA 1N5TA 3KK3B 1Q7TA 3ZVRA 4ZI2A 5DTEA 1XMQB 1O6XA 1E2KA 3BKTA 3ZDYB 5ITSA 3E82A 4RVHA 4D7AA 3B53X 3HVWA 4H1WA 3HKEA 3VC2A 1P1IA 4IM7A 4ANFA 4LK2A 2REOA 1SUBA 4K6GA 4GKKB 1H2BA 1V8DA 4D96A 5KSWB 4KRWA 3I2YX 3KEGA 2RQMA 3IBCB 4B3RF 4OXKA 2HEGA 3GFXA 5DIFA 3L7CA 1GX5A 3T1VA 5A0YB 1U6JA 4KGVA 5LVAA 1C9JA 2QZSA 4PQFA 1OYOA 3FMPB 2FLPA 4TUYA 2Q4RA 1GTZA 2J7WA 4PSAA 1HD1A 3KXLA 2IRUA 3EZGA 2DNQA 4J75A 3A4YA 5LR6A 1OLUB 4ZYLA 3GFRA 4K5QA 1NXTA 1OYDA 3EVCA 1N0UA 3OU7A 2WFAA 3UFCX 3M82A 1X9GA 2C0CA 4JX9A 3AM3A 3IR7A 4AJ1A 1JHZA 1YIJS 1KOJA 1EFPB 1UT8A 5FI3A 3MYRA 5I9MA 4JSYA 1IZZA 2DIVA 1DOZA 4LZJA 3IEUA 4WY2A 1FXDA 3GJZA 5GONB 2IQIA 3ICLA 1RQXA 1SVDA 3H18A 2FDNA 5D5PA 5IHPA 4US0R 3Q8KA 5EXDA 4J3FA 4P7VA 4HVTA 2YTZA 1HA3A 4ZOLA 5D0HA 5C1PA 1TCUA 3P9NA 1ZOIA 1V1RB 3EQ6A 1Q1QA 3MJVA 2H2GA 3B2QA 4P75A 1MPXA 4TVAB 2BFWA 3FDZB 4HVZA 4ZKDA 2X0RA 1IN1A 4TTSA 3TR6A 1CY0A 3FSYA 3HB4X 3LO3A 3NCHA 3IIJA 4FZVA 3K70C 1EFLA 5T7BA 2BTOA 5FT9A 2G9OA 1JILA 1LEHA 2ZH9A 3U2QA 4ZCQA 3O4JA 3QGHA 5A8KA 1COWD 1SIZA 4GRSA 4QIHA 3W6UA 1EE9A 2JLVA 1W2BR 1P77A 4ITRC 5KYVA 2FZWA 4IV5A 3KLIA 3DV9A 3EZ6A 4EPVA 3M6AA 2PLNA 2GPWA 2LKCA 2DYKA 1LFPA 2FVPA 3DLEB 5HM6A 2HMIA 2R86A 1KETA 2NACA 3OD1A 3EN0A 2FLKA 4JKOA 1Y1TA 4PZDA 3N6VA 4QUDA 5ITVA 2YPZA 3RFTA 2QAIA 4P92A 1RQPA 1N6HA 5BWCA 4OU5A 1XRLA 1DBSA 2AG6A 3A0RB 1TM3E 3LPCA 3N01A 1EUQA 2FVRA 3SC4A 3SS8A 3OJEA 4NG5A 3TYTA 5E3HA 4EFLA 1LXCA 1NVVR 2X2EA 2C29D 1N6IA 1YR7A 3KSBC 4Q6WA 1WS6A 1XELA 5JY1A 2BJ3A 4P2MA 4LOLA 4KKVA 3DWFA 1CP3A 3Q8VA 2PR2A 2C2ZB 1PG5B 4IO9Q 2BL4A 4KYTA 4F7DA 1REVA 3ILYA 3N8HA 2W6ID 3I2HA 4YCAA 2ZC3A 3CIMA 2W0MA 4IGAA 2X0NA 1FS4A 1B6TA 2IGTA 4XWYA 3LX6A 1RTKA 2O48X 1U1RA 1TTTA 4XIGS 3F6YA 3N0XA 5A4KA 2GXAA 1XTBA 5LYJB 2B7CA 2PJDA 1QGYA 4CKXA 2QJRA 3BF4A 5K6RA 1NNUA 1ZINA 3QF4B 3LUBA 4WBSA 3DVAB 1BD3A 4D6XA 5I7RA 4D8VA 4O4GA 1FTCA 5ALIA 2M1XA 5CU7A 3IQEA 3G0CA 3STVA 2D3ZA 4KMRA 2ZIEA 4QXOA 2BGTA 3PX6A 3P19A 2AFHB 2PD3A 3RCBA 4U63A 3L18A 3ZWQA 3OEEA 4HI1A 3J80A 3X1XA 1QO0A 3HFSA 3U16A 1YJXA 4LXHA 3L4BA 2PUBA 1FK9B 2NZ2A 3TKYA 4RH1A 4FPXA 3D8UA 2NO4A 1BE6A 2HS3A 1WHYA 1CDOA 1CZKA 3EASA 5C42B 1ZI6A 4Q7MB 1D2HA 5L6MB 3CUWA 4O3MA 3OJSA 1SHZA 3PGKA 4HCJA 1DJ0A 5TGTA 2C2KB 2C82A 5TMEA 3SJZA 4ZVOB 2X0EA 3CNHA 3H5VA 4YJ2B 1SXJA 1YONA 2YQ3A 1TO2E 4RZ2A 1I3OA 4IX1A 3K30A 4QVIA 5M2UA 3GAZA 3AEZA 2NYIA 1L7VC 4O0LA 2R7UA 2UUAF 1N8KA 3QKSB 3U9TA 2IYZA 2XF2A 1IOVA 3KSRA 2O3DA 4XOUA 1X1AA 3U4QB 2AYBA 3M4XA 3UD5A 4JUZA 3S44A 2X19A 3RU7A 2L2QA 1J5OA 3QG1A 3JVVA 4WEOA 1ZNXA 1E66A 2I87A 2SECE 2RARA 2IJGX 2XQIA 4OUDA 3OQ1A 2XUZA 1KDZA 3PLAE 3R8FA 1V95A 2XODA 4HR7A 1E2DA 2GWRA 1MOSA 3UUWA 1MXFA 5E1DA 4MW0A 3DZJA 1PBUA 2QM0A 5K4GA 1RXVA 1GNPA 4YRCA 2ZUGA 2OV1A 4OGFA 3NGDA 2B8PA 4M1OA 3JD3A 4MS3A 1W4ZA 3FHCB 3RU2A 1GPWB 3M2RA 1KBOA 1M72A 3MR5A 2KMLA 3CX6A 4NABA 1E6LA 4EM6A 1WIWA 1J2JA 2GA9A 3DW3X 4CLKA 1EETA 1UOEA 4XIUA 3T41A 1XRSB 1A7GE 1YJBA 5JO9A 3P2EA 3ABOB 2NPIA 1UXJA 2MZ1A 4X91A 4MQEA 1SQSA 3LWNA 4Q4HB 4J0HA 3DAFA 4W8OA 2MQOA 4CM6A 1A69A 1RLIA 3HEAA 5AVXA 2AKAB 5EG5A 3F3MA 1E2FA 4YDSA 2PD6A 4A0QA 4OJ3A 2C2MB 3MAHA 2D5CA 3KOWA 1M76A 5CFOA 2WYUA 2FUG1 4OMUA 3OVMA 3N5KA 2GEFA 3CMAS 4I5IA 3U27A 4DNPA 1T9DA 1LA2A 3TRHA 1QUVA 3GJQA 4ARUA 2CIMA 4G25A 3ZHQA 1EKSA 2WWYA 2DR3A 1M90T 2F3SA 2HNKA 5BQ3A 3EGNA 1A5BB 2YH2A 4MEJA 4U7UD 3SMVA 2DM6A 4FYXA 3P0FA 3W77A 3IURA 5F1PA 1N5LA 1X7XA 2CJKA 1EHIA 2CLSA 4ID9A 2MSDB 5IABA 2HHLA 3JZFA 3FWPA 4EJ2A 4Y2TA 2R8IA 2GLXA 4TL8A 3S1AA 1IUNA 3H2HA 5LPNA 2VDWB 2IP2A 1NLKL 2MINB 4CQMB 3RROA 4AXBA 2AQ8A 4TL9A 2XNQA 3THSA 5KU1A 4RGVA 4C6AA 1F9FA 3TG8A 3IIIA 1RTHB 4TOIA 2FEOA 1SD1A 1VLHA 4WU2A 1Y33E 5GINE 3FUCA 1SC3A 3RIHA 2WWFA 3MM6A 2IDMA 2RH8A 2HMUA 3CVKA 2V59A 5CCBA 5ETLA 2PIIA 5EIBC 3P94A 3WQBA 2OCAA 4R84A 5LCXA 5JFGA 1CUFA 4YJ3B 1NW5A 3EVWA 1A8UA 2J9FB 5JCOC 2DNKA 1C9MA 3SXUB 1YS7A 2CQDA 1S89A 4FEAA 3JQFA 2O2JA 2W22A 1TW2A 1J27A 1YQHA 1REQB 3RS5A 5G40A 1TA4A 5KTOA 1W9MA 3M33A 1TEVA 1Z33A 4JYMA 1YI8A 2CT8A 4G2TA 3RAFC 3RYFA 2GC8A 2GQQA 3P97A 4AK9A 3GRZA 2Q4TA 4DOZA 5IC6A 3LFTA 4MP6A 2AYXA 1E96A 2HU5A 1ND5A 3OTDA 2VUTA 5HUHA 3OQ2A 3ZWDA 2EJWA 2YX1A 1ZU5A 2W2PP 3O1LA 2GM3A 1A8HA 2F7SA 2FMHA 3CD0A 1XXHA 2OAEA 4HHUA 4H7FA 3CLTD 3T54A 3VNSA 1XL1A 5M34A 4LRAA 4RTRA 1RRPA 1YACA 4ZVSB 4EZIA 4OHOA 1AQJA 3Q98A 4V1CI 3CC4S 5HVGA 1COWA 2BV3A 1DLIA 1ZIOA 4F06A 2NXUA 4TTQA 4K6OA 3TW4A 4QG3A 3IQZA 1RA7A 2CUZA 2W4MA 5HCUA 2F3UA 2HFJA 1VHFA 2KLBA 1U1OA 2WJZB 2WJ3A 4M4SA 5IZ4A 5JCZA 2XE7A 4IG0A 3WHLA 4I2QA 3G9XA 4E1AA 1XIQA 2AEMA 4WXRA 2FFHA 3GRYA 3P2JA 3JSYA 5EYPB 4DE5A 3DLIA 3JVUA 2D7DA 3ORRA 5K20A 4XDZA 2CNLB 3LCRA 3UC5A 5FJIA 5KJ1A 4K59A 3GR6A 3WL5A 4JHLA 2Y9MB 2ZOFA 1O95C 2NU8B 4ZARA 4KGZB 1XDZA 2XJ4A 5CIWA 3D8HA 3AF1A 3SK0A 2QJWA 2UZ1B 3RVPA 1RACA 2YFYA 1GTMA 1WUHS 2QMZA 4HAZA 5HHTA 1R8JA 4ZREA 5FD1A 3RKUA 5HANA 1YRYE 4BS9A 1Y8RB 4EI8A 4BFZA 5CTAA 3LI2A 3R9IA 2I9SA 4FFVA 4H1HA 2F1KA 3TQSA 3DFMA 3QA3E 4R83A 3DZBA 2E1PA 3RIXA 2GR9A 3PFEA 4DFDA 1M9NA 3MUOA 1IU9A 1SXJE 4B71A 5KFUA 4EG8A 1K75A 3ZXWA 4TWAA 4KITB 3E53A 3T94A 9ATCB 1PV2A 1NJXA 4EWTA 5EPUA 4CE6A 4YJGA 4DSJA 2SICE 1TIPA 3C7AA 1PVOA 5I7AA 3DV2A 1NVWQ 4FEEA 2VC0A 5EIAA 2JJMA 1OVMA 1DXOA 3TEFA 1IC6A 3RC9A 5KVAA 2QRZA 2Y3IA 4ZGBA 5DS7A 3P32A 4DCVA 4EG6A 4UW2A 1XHEA 2GVZA 3MXOA 3NOOA 4Q8FA 3FY4A 5A03A 4DT1A 1H38A 4OKSA 3C66A 1N8TA 4YXWA 2ZRPA 4WUVA 2VEOA 1Z07A 2VG7A 3IT1A 5CMLA 2VS1A 1YRWA 4HBZA 3LWLA 4H6VA 1ESDA 2J5RA 3PFNA 4L76A 4CMKA 4Q1AA 1GZDA 4G1MB 2IF2A 3ZCQA 4OOFA 3RRJA 2KE5A 2VFRA 3L0YA 5LA6A 2CL5A 2ZANA 4W9NC 3Q87B 4N5IX 4ZCTA 3C5EA 3CUEF 5BYAA 5BR8B 3B13B 2Z95A 3H8VA 2IV7A 3SEZA 1IHXA 2L82A 1X86B 4GVBB 3CY6A 1X9IA 3QUSA 4X7RA 4ONEA 1CEEA 1KOLA 3N70A 1W4CA 3H1PA 1PILA 1MJGA 4EX7A 1EZ4A 1Z4UA 1FJ7A 2AW3A 1CIPA 3EY4A 2QTLA 3QBVA 1BA3A 4F0JA 1FMLA 4CQNA 4KYUA 1CC1S 3UAZA 1KO5A 4EEZA 4EGQA 4DL2A 4H54A 3TTSA 1KK2A 2G9UA 4G41A 3ASYA 1WMBA 1RQGA 4ON9A 4A8WA 2V3WA 1VLJA 3MAAC 3SQXA 4GPBA 4UAGA 1Z5WA 2BM0A 3P9CA 4I55A 3V4PB 5LXTA 4PZUA 2Q5CA 1NPPA 1AKQA 4LOKA 1XB2A 3TD6A 5F1KA 3FFTA 1RI5A 1NAQA 4AAYA 3IPXA 4XJVA 4BB0A 4XO0A 2VP9A 1VRVA 1JHMA 4U2BA 4DR3J 2L9NA 1H2TZ 1G3MA 3OT1B 2RI6A 4JT9A 3KQKA 3GXBA 3W5SA 2AYEA 2DBYA 3SHVA 1AN0A 3M9XA 1OIVA 3IR5B 2EJUA 3V4RA 1MG0A 3A9TA 4WW0A 4B47A 1L8OA 1OJLA 3BMXA 3FTPA 3JS9A 1Z9BA 2P2DA 2JVJA 2FUG6 4RMJA 3HZOA 3RE1A 1T9GS 1ZXLA 3RHZA 3TQ1A 3DO6A 3PRYA 1J9EA 1MPTA 5BVGA 4XAQA 4PAAA 1F12A 4M98A 4MX8A 4CF5A 2X5JO 2R3SA 4C5CA 3I4LA 5A8WA 1EAYC 5A02A 4JLDA 3CNBA 4S0MA 2WJVA 4KN8A 1WHSA 1RXOB 4UUOA 5AVTA 1P5FA 5ICGA 2JRSA 1MU2B 3ZW8A 3NYIA 3AETA 1QONA 4UEJA 5JSZA 5FTNA 2HBQA 2Z1NA 3ZZOA 1SOUA 3TDMA 3GIIA 1P72A 4AG3A 1G6BA 1PR1A 1TXGA 3D64A 3S40A 4LF6J 2Q9AA 4JI3B 2BE2A 5EZ5A 3FNIA 5IXJA 2M6LA 1V9SA 3COZA 3E35A 2VAXA 2RUGA 2RGWA 4KJZA 2LCIA 4R8VA 2CGEA 2QUBA 5JYBA 3EA4A 3UAVA 1HBNA 1VJ0A 1WA5A 3ZO7A 3RYHA 2PYDA 1ORHA 3MGBA 2X6TA 2FVXA 4DEVA 1FTWA 1F1BA 2HHTA 1N8SA 4Q9KA 3CJQA 1F7VA 2ZE2A 1YRTA 2M4MA 4HJXA 1XCMA 2E1AA 2XKJE 3NOVA 5ETTA 4E88A 4X20B 5HQ3A 3QSYB 2R2SA 4X1YB 1L5QA 2EHDA 4Y9RA 1H22A 4C06A 2HNYA 1JLHA 4BX3A 2O3QA 2H1YA 3EZ2A 3LC2O 5K5MA 4QYIB 2XZWA 2PHZA 4O08A 4RK1A 2OFHX 2IEDA 4YVFA 3T3NA 2JFYA 2D1YA 3V6KA 4NLRA 1NVXQ 2QTVA 1XXHE 3QYJA 2YOHA 4ENWA 1VPVA 2J85A 1RAIB 3R3JA 3UH0A 2NO1A 2ZJFA 1G42A 2BISA 5HL7Q 2A0XA 4BLQA 4XPZA 1ZQ9A 2OIHA 2IIQA 2ODWA 2XXAA 5D77A 2HNZA 4OLBA 1DEAA 4J1TA 3VXKA 3RRNA 1OXXK 1ZTTA 2HJHA 1IG3A 3RFVA 5J1EB 1DIRA 3OIVA 1MHPA 1IG0A 4QBIA 2Y92A 2ZHAA 4ZQCB 2YQ5A 1PBTA 3BB4A 4L27A 1PO6A 3ZWBA 1EFTA 3RG8A 3KHGA 4YYZA 5ILQA 4XVUA 1RT5A 2KWIA 1NK9A 1X7VA 4XQGA 1VHTA 3KR0A 4J16A 2RK3A 3IVAA 3UN1A 1NJIT 3BZBA 1NWHA 2O2ZA 2EKZA 5AW7A 3GHYA 4A8JC 4FD3A 3SBXA 3CNQP 2KH9A 1EM8B 4D41A 1SUPA 2WSMA 1NK8A 3TVYA 4MVXA 1FDBA 4LFCJ 2VP5A 3EBPA 1J2RA 1YBAA 3DKIA 5LJ3Y 5D3QA 5JZBA 2B6NA 3FEXB 2NS1B 3GAMA 4JP1A 4FT2A 3TX0A 1AUPA 1E3MA 2RGNA 3AHPA 2R0QC 2H57A 4U67Q 1CRWG 4IIHA 4E5NA 4DPOA 2OPQB 3LX5A 2RDIA 3G82B 3T35A 5BQXA 5GMKa 1FXLA 1DDIA 2YH1A 1KY5A 2ECFA 3ZWMA 4OFZA 3B3JA 3H13A 4CTAB 4COOA 4UZFA 3TK1A 1TVKB 4YROA 4P7FA 2Z4TA 4FF1A 1PL8A 3OPQA 4GT1A 3PEVA 2WVGA 2DKNA 2QM3A 1W0KD 4LC0A 1P7VA 3UAOA 1R0LA 3HU1A 4D3XA 2H51B 4OH1A 2PT5A 4DQXA 1VJDA 4MS4A 2JEOA 4AKHA 2ZBEA 3MGKA 4E2XA 1LI4A 1NQUA 3HDYA 3NP7A 1T9BA 2G71A 1CPYA 2YKGA 2CJWB 1E3SA 2PGLA 2WKRA 4ARCA 3LHFA 2R25B 2MSNA 2JFNA 3RADC 5AM1A 4LYGA 1ZN9A 1W34A 3OICA 3LT1A 1JLKA 3CFYA 2BACA 4LZOA 5FHQA 5EESA 4UQPA 1U6KA 4MVJM 3E7WA 3OR2B 1FX0A 1YRAA 2BCJQ 1OZGA 1WRBA 5IKPA 3AKDA 2Q7DA 4A26A 3FOZA 2HAFA 1SH0A 5EP1A 3ZZYA 5TMDA 2A35A 2Z9CA 4UEOA 4II7A 2I8EA 3TRJA 1T4CA 4N0MA 2JAPA 4WNIA 2P5VA 5CXSA 3K6KA 1R74A 3WB9A 2CDRB 1HHQA 3AHFA 2R8PA 5G3ZA 5TS2A 4OX8A 2WQZA 5L7WA 1B7YB 3FUVA 3SLGA 4TM8A 2C2YA 5A5VA 3WGKA 5D51S 3BCSA 5KHLB 3HA3A 1OBCA 4PPQA 2IEBA 3OPNA 3TZKA 1K1EA 3D2CA 4ANEA 1S2DA 3F9CA 3QLUC 3OVAA 2ZYHA 3QJYA 4XLTA 3B9QA 1E60A 5KOHA 4OX9Y 4UZBA 5CA1B 2HFOA 4F3OA 1FW8A 4U2KA 2Z3ZA 4IUDS 5C24A 4K9QA 1Z25A 2WA2A 5M2RA 1G3QA 3PGLA 4XD7D 3T99A 1KERA 4OEHA 1UKAA 4YEAA 2JIPA 3DSRA 2QRMA 4LE1A 2HBYB 5EOVA 3TG2A 4HXFB 2NZJA 3FRJA 1S9EB 4PYIA 1BDIA 3ZJUA 3KLMX 4ND3A 1NM5A 1DQSA 3ZTRA 2HFVA 2V45A 2R6AA 3W5CA 4UW9A 2QIOA 1IQ0A 1Z38A 2YYZA 3OE7D 5BSUA 4I50F 1Q77A 4KK3A 3RC1A 2P77A 4KR6A 1K86A 4J5OA 2BFCA 4RSGA 2D74A 3E7PA 2JL9A 4TV8F 3OZIA 3ABRB 4KXFB 3MRSA 3GDWA 4IHKA 5KSPA 3ET6B 3DGPA 1MWQA 3WBKA 4F3QA 3WLOA 2P2CA 3KZMA 4F1JA 1TA9A 2ID4A 4M6WB 4K50A 3COSA 3T9EA 1RE0A 2OLWA 2RD5C 4ZJLA 5G3YA 3CVOA 2GCFA 5IP5A 3ONQA 1JR4A 2BX6A 3G8QA 3NT2A 4RETA 2PH7A 2JLUA 4LFAB 3ZZ0A 2OPSB 4M46A 2WFLA 4DLUA 3E7DA 4L0DA 1T26A 3JQBC 1ZWLA 2QX7A 1M75A 1P1BA 1TQ4A 1VKHA 4INAA 3WG9A 2JWNA 2EG5A 4BP9A 1W26A 5C7PA 2A0UA 4R69A 3KFWX 2GZOA 3EG9B 3UWDA 1XF9A 4ND2A 1S79A 1TJNA 4PZVA 1FZTA 3DA8A 4LF6F 2KX7A 1RXUA 2CXXA 1ONBA 5LLDA 3QHQA 3KJXA 3F0TA 2MR6A 3ASUA 1PGZA 2EKPA 3FBFA 4RS4A 6REQB 2F8MA 1LBQA 1B0ZA 2OORC 4IQXA 1U3FA 1Y7HA 1UBGA 4DMGA 1G6KA 3M4JA 4B6OA 2Y1GA 4FXWA 1CUAA 2AX0A 4KQ6A 4MTLA 5E6SA 1PV1A 3WI7A 4OV6A 3PXUA 1AKTA 4LY9A 1WUUA 2H9AA 4JA0A 2Y0BB 2QS9A 3PJFA 3BXFA 5KNCD 2GPYA 4JAVC 2JAXA 2HREA 3F6EX 2WM3A 4F6LA 2I6SA 3NAGA 1AGRA 2PX6A 3CPSA 1SL0A 4LE0A 1XJQA 3HD1A 3GGDA 3VU8A 2XDQB 4EKEA 5GADl 3CM0A 2QG4A 3ZE6A 3W3ZB 1XLUA 4WE1A 4C2AA 3GRAA 4CLHA 3NBXX 3RWBA 2CFOA 3CZAA 2HL6A 3I56S 2DECA 5A5FA 3G49A 4M1TA 2QZ4A 3V34A 5KX5F 5ICSA 3V00A 2BANB 2JC3A 1AS0A 1GR1A 1MMNA 1SVKA 2X6RA 3CVUA 2Q49A 1M2WA 1SJ1A 1I3NA 1HT0A 1R2QA 3GN2A 4MYHA 1NN0A 2DT5A 4DWWA 1OFGA 4JVNA 2O1XA 4EJSB 1YRUA 5E2AA 1NRXA 1ZN8A 3NTUA 1OKKD 1MO4A 4LOJA 1WO8A 5JHGB 3EPPA 3HJVA 4YP0A 1D4ZA 4JFAA 3K58A 3WRYA 1NKTA 3W5VA 2VFTA 2WUFA 5ICEA 4FQ5A 3W5YA 1IEWA 3CEPB 4R1OA 1GYPA 4CIDA 5KOWA 2HIMA 4A8KA 1JV2B 1XLVA 2CSUA 3PVXA 4TKUB 1D9XA 3S2UA 4LFCF 1EA5A 3HVUA 3RAJA 1T24A 1KQOA 2EEPA 3QE2A 4AF8A 1NYQA 2W7TA 3PSHA 4IIVA 3KMQA 1WD7A 3R23A 1X8JA 2G08A 5B1YA 4RACA 4F5ZA 5K0LA 2J33A 4YR0A 1S57A 3DWIA 3TCNA 1LJUA 3N7AA 1JXMA 4WLFA 1C3OB 1BIFA 3Q8XB 3GG9A 3PYMA 1W73A 2NW6A 1GPJA 1YR8A 1ZOOA 1A96A 3HJFA 2PUTA 3RG2A 3HM9A 1N0IA 2QN9A 1PKXA 3ID6C 3O73A 2BKPA 5IJ9A 4LV8B 4D4HA 3H98A 3NOCA 1RLUA 3I9V9 3G96A 4X4UA 1L5VA 4G67A 3V8VA 5K9ZA 3ZZ1A 4G36A 4RA9B 2HJSA 1I9CA 3O5AA 4KKOA 1FDIA 4NXNJ 4M7WA 1GKIA 4FCTA 2EJTA 2RGYA 1N2CA 2YHIA 4U4AA 4A0HA 4EAQA 4L72B 1LF0A 1URNA 2YUTA 3ML1A 1U3DA 4LQ3A 4KC5A 1AM4D 2BFBA 5A6SA 3GPAA 3WLEA 3DR3A 5ELLA 2XW6A 2D2VA 5KYWA 1RWBA 3JQ8B 3ZD9A 4Y6RA 3PP8A 2AN4A 2MGZA 3ZLUA 4ED3A 2VJAA 3QW2A 2CYAA 3IP7A 3U4IA 1YHQS 2PMZD 4BV3A 1PW7A 4C8NA 1XZFA 1AB8A 3PUZA 1WVIA 5DHFA 3WHPA 3EWIA 4LF9J 3FTCA 1DL5A 3GBPA 3ZBPA 2HA3A 1NHVA 4JLWA 4GBMA 1QCZA 2BPOA 2R8JA 5IFLA 2XKAA 3MWDB 2UU9B 4BFTA 1BE8A 1L5YA 2SCUA 4EF4A 2HXYA 3JAMY 2R79A 1C7IA 1S0OA 2IDLA 1Z6XA 3WLKX 1B42A 3O92A 1JI0A 5FOXA 1S1CA 2FW0A 1MB4A 3HB7A 2VT6A 4P9SA 2BIFA 2GI4A 3VALA 2KM1A 2CFTA 5EE9A 1XT6A 1KOHA 3V1UA 3T6BA 2C95A 3WGTA 5AICA 3H4DA 1THMA 4FE3A 1UR5A 3NIBA 2RHOA 3TBKA 4XWOA 1I1GA 2GYWA 2G88A 1OV4A 2QRUA 3MOZA 4HEA6 4YALA 2IDEA 1E3IA 2ONYA 3CT6A 3TUJC 2OA0A 1PR6A 1KFKB 1SHJA 2ZJPQ 2GETA 4IXMA 1YMVA 1LPMA 4GH5A 3LUFA 1RAFA 4O3FA 1M1KT 2VJKA 1R4MA 1QYDA 4AFFA 3SOPA 3MYYA 2CPDA 1OASA 5AHXA 3TX8A 4ZTUB 1K0TA 1HY3A 2H3EA 2AIRA 5KCZA 2PD4A 1TLTA 3W7VA 3CKLA 2IJFA 2B43A 4IBOA 4JP3A 5EKTA 5ESDA 1E1MA 4TN1A 5HBGA 3FLEA 2Z5LA 1D9DA 1VGQA 1J8FA 3LZ6A 4CDGA 2FPIA 3H25A 1CJUC 3PDIA 3F74A 3ZX4A 4UTOA 2PWBA 4G0XA 5KFDA 5DLDA 1KI6A 2QIPA 3RB3A 3GB9A 1IZ7A 3VFDA 5I7OA 1LEOA 3KUKA 2CDCA 3WTBA 1XTKA 1LK5A 4BWFB 1GO2A 4ZK7M 3TLGB 1LXNA 1O7JA 3UR3C 4ZVLA 3E05A 4B45A 4ZV9A 1U1CA 1W25A 1ZIYA 2WIAA 3CUKA 3WHIA 1U7HA 1H2HA 1T8PA 1LRKA 2WTAA 1T0TV 2QX9A 4PS1A 2NO9A 4NXMJ 1JDTA 1BHO1 4X7PA 3QY0A 4QWBA 4EG4A 2BFFA 3VZHA 3NCTA 3KWLA 4URFA 1ZW6A 3L92A 3A8KA 3REGA 3Q1KA 3KT3A 7AT1A 1PI3A 1SBHA 5I4BA 3G6WA 4TTPA 1Y3FE 2GEBA 1IBSA 1FX2A 5DM6Q 3LLUA 4D9NA 2HHJA 4QDKA 4NBUA 3PVSA 3G68A 2CFCA 2ADBA 5I7VA 3AUUA 1YD7A 1FEZA 4JZKA 4NBNA 4F3YA 3IUEA 2A10A 1K4YA 3BWDD 1ZW1A 1JQ5A 2D4HA 2P6PA 4XSVA 2A1BA 4M9XA 2F9JA 3ROMA 2HHHB 4HDKA 4JYBA 4JHXA 4A6XA 3PJ9A 1JF8A 4NYMR 3RTAA 4Y34A 3L7KA 1OC2A 3TXXA 2HKIA 1LSUA 3RAEC 1IJEB 4B2LA 2E89A 3OD2A 4RPJA 4AB1A 1QVVA 2BEVB 2O8CA 1E3JA 1T9ZA 1Z15A 3HJAA 1II0A 5K8LA 2FJXA 4PO8A 3LIPA 4B9VA 3TR0A 1Z1ZA 4O02B 4F84A 5GVSA 4JI1F 1NU8A 1L4MA 2QV6A 5THQA 4U9UA 4H4OA 3H5UA 5F77A 5LQAA 3D1JA 2E4UA 3WOHA 1W46A 5FIUA 2XNCA 2JW5A 4IDHA 2BKEA 4X3OA 4DR4B 1FXWA 3G86A 4RL6A 4DQVA 2I2WA 3OJCA 4BRZA 4G1IA 2IHYA 3HBNA 2V7WA 5AI4A 3P9PA 2LD4A 3AR7A 3R7SB 1BMFA 4KQMA 3POTB 5JMWA 3IXLA 4WZMA 1O8BA 2V9CA 1FK8A 3J81A 5CDYA 4KB5A 2BGWA 3L8EA 3DBLB 1HG0A 2WJPA 3EA5A 4U6PA 2RF2B 2BJ8A 1WQ3A 3GAAA 3AUFA 1TT5A 2EG9A 1OKKA 5ALHA 2QG6A 4OHYA 5KT4A 3KLFA 1DLOB 4UUMA 3SQWA 2BHSA 2YXNA 3MJFA 2G70A 4D9CA 1IM8A 4LCJA 4BFLA 3EJ6A 3K8OE 1O5TA 5L1JA 3GFBA 1SZDA 2NAFA 4F4KA 4GI2A 2H9ZA 4CKYA 4FYMA 2XTJA 3ZGLA 1PEDA 2DFLA 5CHYA 4UF4A 2WIKA 3R20A 4Q2MA 2CUKA 3CURA 3ZZZA 5IVDA 3GONA 3AXKA 4NXNF 2UXCB 5JCPA 1A95A 3HDGA 1O3YA 1V1MB 2GPJA 2PPVA 4FHZA 4DMZA 2EBUA 1PZXA 2XYPA 2GYYA 2F43A 4EBFA 2FCAA 3NH9A 3RW9A 1IWOA 3E22A 3QWPA 1Z56C 3PFFA 4BO4A 2BDPA 4YR7A 1UJ6A 1JXOA 4UBMA 2F64A 4CMIA 4XM1A 3KLHA 4NOKA 4QHTA 1OO0B 4J6FA 4YUWA 1VIYA 4JI6B 1RTIA 4LF9F 2JPDA 4P7GA 2PA0A 3VGUA 3ZCPA 1ZJJA 3JZDA 3MS4A 4J0CA 4GX0A 2AMCB 3V81B 4C7MA 2G8LA 2JFHA 4JQOA 4U7FA 1CY2A 4JZYA 2AE1A 3OTCA 4TWJA 2DMRA 4HC4A 2P8IA 1Q50A 4HNSA 5AUNB 1UC9A 4HYYA 4UU0A 2QJTA 1BQXA 4LJSA 2KHZA 3PWTA 3FB1A 3GR0A 2OI2A 2GCOA 1TW3A 1JA0A 4TYPA 3S99A 1TQLA 5EE5B 4DCTA 1W6UA 3P0HA 2B78A 1LVGA 5DNDA 1M1NB 1UBRS 5A04A 2YH0A 3KUHA 1EBBA 5U4XA 5EMKA 4BLOA 5J4KA 3LX8A 2V7XA 3BXZA 4ZXPA 1J1UA 4LC9A 3QU4A 5ALWA 5E2BA 2E7VA 1H2ZA 5LKRA 4UHJA 4OZJA 4RY0A 1RYHA 3MLBA 4F04A 4PYJA 1YKFA 4GXRA 2C7OA 4YAUA 3TSZA 4JJ8A 3KK1B 4BMYA 2JLWA 4C3MA 1NJ2A 2FN3A 1RS0A 4KR0A 1L5HB 2VV5A 4UBKA 1RT3B 3CJKB 4M89A 5HIAA 3ZNNA 1KIFA 3H2LA 1FTQA 1XAIA 3I1JA 2B9XA 3UENA 3BAFA 2NSYA 1EX9A 5AK0A 4UNRA 3SE7A 1SBYA 1SG9A 3BYPA 5A2QU 2ZJ2A 1N1DA 1L6RA 2WDPA 1HWLA 3UF0A 2APOA 2GA7A 2P75A 4N8DA 3O2QB 1QZXA 5E3RA 1FEHA 1DQRA 3LP1B 1UEUA 4WRRA 4WZBE 3PSAA 5JPCA 2H52A 1CR0A 4IQ8A 5DDIP 1AA1B 1GYQA 4TV9F 4XYMA 5FA6A 1J7JA 3DJFA 1JQJC 1I7DA 3ANSA 1X1CA 2Y6UA 3HFRA 1O2DA 3L1KA 4O3OA 3M9NB 5IJWA 3EGVA 3RTEA 2BD0A 3U49A 4KT0C 3DYAA 1RXWA 1Z4KA 1O97C 1VG1A 1AZSC 2ZGVA 4AXJA 4AYWA 2P27A 5GAEU 3LAWA 4DLBA 4BGVA 2CCGA 5DGDA 5EXEA 2QMUB 1YC2A 1VSTA 2OJ3A 5G0VA 1C0UA 1R4ZA 2RGBA 1KZ4A 4FYVA 4TMYA 2MMYA 3W1VA 1UBCA 5E3AA 4NXMF 5HMXA 1E4YA 3T5TA 2B8TA 1BTOA 1LS6A 4O1IA 3PQ7A 4JVOA 4BPRA 2VG5B 2ZG6A 4BE7B 2OCYC 1H9CA 4BV2A 2IZ7A 2I1WA 3QIVA 3CXCR 1G5RA 1EUDB 2V63A 3H20A 2XOXA 4ID3A 1T2NA 1CEQA 2MSSA 1MCZA 1JJIA 4DB2A 3FYCA 2CMKA 4DMCA 4R5MA 2YY3A 3NGRA 4GPTA 4QUHA 5CUQA 3FOFC 1E2PA 1LPAB 5FR2A 1K63A 2Y6VA 4OGKA 2HDHA 3LBIA 4QASA 3WC2A 4Q15A 1NMSA 3T06B 3S2ZA 1CY1A 1V5IB 3RK0A 5IEJA 1SV5B 2O5VA 3I0SA 3WNZA 4MRPA 3EGDA 5FYQA 3ELYA 1D1PA 5ARDA 4YUXA 2EKQA 2IMOA 2PKQP 3F47A 3UFXA 2R7XA 3RBVA 2E5WA 1UK7A 5TEVA 1HNVB 4Q3CA 3DJYA 1CG2A 2DPYA 2QPOA 4USJC 3CWJA 1CUYA 3KVVA 4JOQA 3SVLA 5T57A 4R0JA 4W9RA 3LV8A 3EIWA 4MQMA 2O5DA 1YDLA 1DTWA 4CO2A 3MG9A 5EI5A 1BHNA 3QQ5A 2R6DA 4MRNA 3MFYA 4PNHA 1BWEA 5BY2A 3PJRA 2W0SA 1RXIA 3AQIA 1QV9A 1L3CA 2X1HA 4I64A 4ROSA 4EDHA 4BLRA 2MSCB 3O21A 2KZZA 4G5OA 1CJVA 3GLIA 4NAUA 4C97A 3SSRA 1QGDA 5LZ5A 2ERCA 3KOXA 3AJ8A 5CFZA 1KD1T 2ZJBA 4C0SA 4BHTA 3RJTA 3U1TA 5JQGF 1H94A 2IY8A 1RHKB 3BSOA 4MUAA 3QYAA 4GLJA 4L3WA 1DKQA 4B6PA 2YCBA 3HCWA 4Q7LA 4CW7A 4DFPA 3FEZA 2F1IA 4FU0A 2WP8J 1Z39A 3R6GB 5EJEA 1GOTA 3QE4A 4W5WA 3U9SA 3CNNA 4LYHA 5D0GA 5L8RC 2ZBDA 1X4FA 4MT1A 5KQMA 1LVUA 4LVUA 1RDFA 3L6OO 1KFSA 4MW7A 4KO0B 1F9EB 3M7VA 1FD8A 3I83A 4Y7DA 4QYTA 3LY5A 3A70A 1N8NA 3G2JA 1U0BB 2E29A 2JHEA 4PUOB 1L7XA 2GFIA 1BX0A 4K0RA 3RBEA 1G20B 3MCVA 5KFVA 2HLHA 3M6VA 1J2EA 3PFCA 3O8NA 5KNCH 5JXSA 1VB3A 4O6VA 3ITEA 4PE5B 4DMKA 4BFUA 1S5ZA 4Y30A 3IN5A 3UIEA 2A4MA 4FYKA 1UWBB 3AVVA 1X1RA 1QHEA 4XWWA 4KX3A 1TYAE 1S1WA 5AHRA 4KNYA 2HK8A 1HL3A 1T5DX 2ZRBA 1YZNA 2Z8QA 3W8PA 2CZCA 1UFOA 1UVMA 1TKZB 1T7PA 2B30A 3TIXB 3MWEA 3UQYS 3FRIA 4RMNA 3A6FA 1ZNWA 4PY2A 5LZ4A 5C32A 1ZITA 4DL4A 2QMHA 3F78A 1AURA 2OD7A 5B58T 2P3SA 2C7RA 4OYRA 3K6SA 2C4NA 2GHPA 2CMGA 4EQ6B 1LSOA 4MCJA 3U7GA 2ASDA 1JTFA 1VOMA 2I55A 2W6CX 3IIMA 1Z35A 1ZZEA 4N0PA 4AC9A 5JG7A 5I48A 4YN3A 5J2TB 4BO6A 3SF0A 3RV4A 3H3JA 1MC8A 1Y6GA 2EJVA 2WINI 2CQ4A 3PDCA 1KP6A 5HUJA 3O8RA 1CY6A 5L51A 4ZODA 3IAUA 3H5WA 3BVPA 2PSJA 1BWPA 3PFGA 1USVA 4B87A 4FXPA 3F98A 1KSFX 2GS8A 3AV3A 3G88A 4A2CA 3IUNA 1FX4A 3AT1B 3OWHA 3FSIA 4ES6A 4Q5VA 3G87A 2C00A 2YWHA 3R27A 3DOEA 3OZAA 3SZRA 3MEEB 3EZ9A 3H42B 4IWNA 3CD7A 2LU2A 4BV8A 2GHRA 1DKUA 4JJ4A 2GN4A 1LK0A 2M9KA 4II3A 1JR6A 2VJYA 4JX8A 4K3UA 2EBHX 1ODIA 1R3NA 4KTVE 4OQEA 5KJEA 5HKAA 1JH8A 2ZUCA 1FFGB 1XBTA 3LUYA 3RYCB 4YMEA 3VR2D 3WK9A 3ND5A 2ECKA 3J7YU 1QAYA 3C6MA 3ADAC 1NB2A 2IUSA 4P53A 1MC1A 4QRIA 1FSFA 1NVDA 4KB7A 3BE4A 1RWUA 2H7VA 1NJZA 1USGA 2H2HA 3ELBA 3PNQA 4JBWA 1AK2A 2HF2A 2NTEA 3CCBA 3GDFA 3D7SA 1MJHA 1UZNA 1VQ6S 4NE9C 4EMDA 5JJLA 4MYSA 3A9RA 3G2NA 1ECBA 3OUYA 2XB2A 2JFFA 4OJHA 4EH1A 5IH3A 1I9GA 3VKHA 3PEUA 3PLNA 2R9LA 1BYIA 4AJ9A 1HWIA 1Z2OX 2HMVA 5F52A 2AJFE 3HVIA 1XKQA 3LLVA 4NYIR 4HWSA 2Q1XA 1QAOA 2DWPA 4HRVA 2V1XA 1Z2DA 4QIGA 1TMYA 1E64A 3E23A 4C2UA 4ZJYA 2WMOB 3OE5A 3VDXA 3CX4A 3W0LB 2EFQA 3IP0A 2ZXFA 3L09A 1JNRB 5CT4A 1GV1A 3FKJA 4RHFA 4I2PB 4ITVA 4K4YA 2NVBA 5K8PA 4EHAA 5L95A 3QXSA 3FZNA 2VBGA 1U9IA 2OBFA 2ZE6A 4XM2A 1OB2A 1U99A 3ER6A 1RE1A 3C3DA 3ZU4A 1VLMA 8ADHA 2GZHA 3BGDA 1NKEA 2XY4A 5BYBA 1TNDA 4RDCA 3D31A 1LWNA 3GY0A 2FGOA 3K4HA 1ZAYA 2VG6B 3KHLA 4EQZA 3KQUA 1YVRA 1YVPA 2RCYA 3BM7A 4HG2A 5KFPA 2J4DA 1PWEA 1VRTB 4ETNA 4GSKA 3A1CA 3WBJA 3NS7B 2FJWA 5E6UB 4PPYA 3Q41A 3QMQA 5DM4A 1HHTP 4QRDA 1VA5A 1PYSB 2XRFA 4YMVA 5FCDA 2UVRA 3D6AA 1S76D 1RBAA 4QGGA 2OEMA 2FPXA 1DP4A 1N1EA 5KPJA 4O23A 1B4SA 4GMHA 4DS4A 3ABZA 3BCHA 4R3UC 1HE8B 1I4LD 5L7TA 4BPBA 2XLJA 2JEZA 1EP1B 4D0LB 3ZIDA 4KHMA 2Q1TA 2H1VA 4R05A 3GCZA 4QQFA 3KVNA 2IC3A 4A16A 4NCGB 3OEWA 1LI5A 2OSBA 3GLIE 3C3YA 1RUSA 2ZR7A 3WVNA 5G4KA 5JW6A 4F11A 1JPVA 4DG1A 4RW6A 4ER3A 1CJKC 4N6GA 2B7BB 4KPGA 1XZEA 2NUAA 5JCXA 3BGIA 4WX2B 4X6XA 3IOBA 3V1TC 2U2FA 2VRCD 1WP9A 3C8ZA 3AZQA 2ISSD 1NDKA 4EY4A 4KSBA 3PL5A 3L46A 4FZ5A 4YY3J 2DZDA 4L5BA 2F5GA 4ZDKA 2BTEA 3GCWP 1J8VA 1NUQA 2PBRA 1B8NA 4BO8A 2BGJA 1ECLA 4MYTA 3C0KA 1YX2A 3BTSA 2VZ9A 2YVAA 3H4VA 3DLPX 2ZI5A 3HB5X 2XSJA 5FTJA 1D8AA 4XQCA 1P33A 4DDHA 2W37A 4PYNA 1WF6A 1G18A 2IJRA 1Z2CA 2I6UA 3CH7A 4JB0A 3T3IA 5CYJA 3LCCA 3A9WA 4N48A 1AB6A 1GGKA 3Q72A 4O33A 3G17A 3DDOA 2O8DB 1FKOB 1NN1A 3G8YA 1SZPA 3BULA 4DV3J 2ZHBA 2NQTA 2KXFA 4DLYA 3V8EA 4L73A 3CCRS 2Z2JA 5JALA 4DSLA 4PNPA 3AEUA 3VKVA 5IKXA 3A28A 4HD8A 4HGRA 1OPRA 3RC3A 2ALZA 2BGLA 1JKHB 2PL1A 2P5TB 1BQ4A 3UMVA 1E79D 2RGAA 1FNOA 4NHEA 1A7KA 2AGPA 3R8XA 1NA5A 2YQ1A 1XOIA 4R68A 3M5PA 1ACMA 1F2TB 1EVQA 3K9GA 2JCXA 4Q39A 4HLCA 3P9SA 4G97A 1FUEA 2E21A 3LQVA 2H2AA 3U56A 1UPFA 1Y3DE 1R16A 3TBFA 4M1WA 3GIDA 2NTNA 2AG0A 5JSHA 3W79A 2DHRA 5JNLA 3UJ3X 1YHYA 1A4UA 1AMOA 2FMTA 1M73E 4NI2B 3CC7S 2VN8A 4JVSB 3H2IA 1JNZB 3IJEB 3MHPA 1N6QB 1FJEB 3EGIA 4LF5J 4PYQA 1N6PA 4F71A 3OTOB 4MLCA 4KBYA 2AJQA 5A1TA 2VQ3A 3WK6A 3A4VA 2GX6A 1XZ8A 4M60A 4O4JB 1V8OA 3F44A 4HDHA 1KAHA 1WZCA 1JKJA 5KFCA 4ICLA 3AG6A 4Z0HO 1MUUA 1RU1A 3ET5A 4Y98A 3MR2A 2IXBA 3ZE7A 3PE6A 5KWVA 2HBRA 4E13A 1WB4A 5AH0A 5FO1A 4LZAA 2ZRFA 3E9YA 3R5GA 1C1DA 3PD0A 1RPZA 3GOHA 3UO0A 4YREA 3AEKA 1NXVA 2VSFA 2LYVA 3KLEB 4X95A 3RYIA 2CB0A 1NMEA 2IITA 4A8SA 2VT3A 3FWNA 4QNMA 5KUTA 4LRXA 2W6IA 5HKLA 3ZHXA 4C48A 4DF3A 6YASA 3EW7A 1LDBA 4RM3A 1XE3A 1B8UA 1M8FA 4MKYA 3LF2A 2OZPA 2ODTX 4QSMA 4P4LA 5TQ2B 3T7TA 1EK6A 3BDAA 2YOGA 2FE1A 3PZBA 5DLQC 4OBEA 4KIJA 4IH1A 1BYUA 3OR1B 4OD0A 3FF1A 5B4TA 5HUQA 1Q3HA 4EK2A 2DNYA 1WD5A 1GP2A 4EB6B 4Q9IA 4I1PA 5C8YA 1BE1A 4HAVA 2FYXA 2UXBJ 5F23A 4XD2A 4PZZA 3IPLA 2W7AA 4UAVA 3MWGA 4AN0A 3SZOA 4Y2JA 1S7IA 2OUGA 1RHJA 1BAPA 1IKYA 1R9MA 1IN6A 2JZCA 1QHNA 2NQ8A 2O7SA 4DEYA 1T29A 5DB4A 1ZM2A 3IP6A 2QLFA 3AERA 3CZMA 3EFBA 4C0KA 4UC0A 4LX0A 3L8GA 1Z5OA 2HA4A 5CIQA 1XYVA 3L3BA 3HHLC 3KJQA 4DUZJ 2VPWB 4XX0A 4ZT6A 3NYWA 2GJSA 3NM4A 3VR2A 3N75A 3UGKA 4MVCA 1EJ0A 2C8JA 2O05A 4WGGA 3HKCB 1UXGA 5JD5A 3TMYA 3ZQ6A 2XZOA 3UD3P 1E2UA 4USTA 2ACYA 1ACLA 3LECA 2ZWIA 3GPIA 3CINA 4PQUA 2H5EA 5J2UB 2G83A 2I2XB 3L1UA 1YRQA 3ZWYA 3I28A 4WDQA 5AOVA 5FAXA 1VHDA 2CHFA 1WKJA 1I7QB 2GIRA 2OXFA 3PUKA 2GSDA 2DUWA 4O3QA 3R5SA 3VBCA 2MZSA 4J9LA 5DDQC 2P6TA 2A57A 1RAHA 2IHUA 5AXAA 1VFNA 4LG1A 1VDMA 4HADA 3HKEB 3L0IB 3QX3A 1KEEA 3AKEA 4YCBA 1Z4LA 2YMMA 1XD9A 4R1NA 2YXEA 1IM6A 3U37A 2OQ2A 1Y6ZA 5SYAA 1PFUA 5KFTA 4ZHQF 5IWAB 3PHTA 4Q1FA 4FS3A 1V47A 4KGVB 2OFGX 4FOSA 2FJDB 1VISA 2JX2A 2IHJA 3V55A 1S2LA 1XTVA 4TUYB 2EEZA 4R2MA 3RTGA 1CE8A 1BVHA 4O2BA 1RKUA 3HKZD 3GE9A 1ZCJA 4ZIRA 3PL1A 2NUBA 2O4CA 3P9YA 3UJHA 4PGAA 1EGAA 2J41A 3A9UA 3FCWA 3PACA 1V2HE 4EL5A 3D1OA 3WSWA 4RTPA 1CVIA 1L3IA 1EGHA 3EQ2A 1I7PA 3D4LA 3NKFA 3IR7B 4AUMA 5FLEX 4QLBA 1F6TA 3GYGA 3LZDA 1WMDA 5DG7A 3R5DA 4AICA 5BT8A 4OH7A 3MMJA 2HQGA 4NMLA 2C9CA 2CVQA 2GK6A 1HF3A 1U0TA 1FYWA 4WFYA 4ZOLB 1NLUA 4ZP9A 2HWUA 2JHGA 3KB6A 4ES2A 2FWPA 3FCCA 4Z99A 1RQ2A 2CADA 4AMYA 1G6OA 5F8GA 2C98A 2IV2X 3FZBA 4YY3F 3ILLA 4D4IA 5LYYA 1K9SA 3OH8A 1T0UA 3IO3A 4PG5A 3KPJA 1VKNA 4DV2B 1NHKL 4DY6A 3SCIE 2ODEA 2PTGA 4M1KA 5A8KB 2ZS7A 4OLJA 1HK7A 1PS0A 3D7LA 2XMQA 5ALYA 2MY7A 5I4IA 1IM2A 4CCWA 3PFOA 5HGXA 1XZJA 1EFRD 2G0NA 3OZVA 1YR2A 2FVQA 3KLIB 3AVYA 5K4AA 3EISA 4P8RA 1GRQA 3W3SA 3VAFA 2OD6A 2HMIB 4M21A 2E85A 5GAHI 2VRCA 1HDGO 3GGOA 5F7ZA 2PGDA 3WIEA 2R2GA 2G2OA 4UOQA 3UB3A 1W7WA 4DV3F 3DHWC 1TEZA 1H72C 1SUCA 5HA5A 3E2EA 1FFCA 3RUEA 2QSJA 4NBWA 1W19A 3QOYA 1FTRA 3OEYA 4E03A 2JF0A 2PX3A 1P60A 3V4SA 3IRUA 4LSWA 1HA1A 1KDTA 2YOFA 3D8RA 3UH1A 4Y1RB 4CLPA 4PLHA 3HKWA 2WAMA 1MJNA 3NH6A 1SOMA 4KH0A 2XUKA 1BJKA 2DQSA 3C6BA 3COWA 2C9DA 5AVZA 3ND8A 1IM4A 2FHMA 3PO4A 5EKXA 1REVB 1R8XA 3C43A 1RYEA 1ZHOA 1OXMA 5CJ2A 3QVMA 3I2KA 3K0KA 1FCAA 1H3EA 4J29A 5T3YA 3IV9A 3L6CA 3SQDA 3Q3JB 3M05A 1YMUA 2B7CB 3I8OA 3HVJA 1YOBA 5HP1B 1YS4A 2VKTA 2GKOA 1ZEMA 4LS3A 1V2GA 2V9ZA 4AJLA 3OUUA 1OV6A 4Q1DA 4FW9A 2MTLA 2P2LA 4O4GB 4P5DA 4B3MB 4XJTA 1IBLJ 1JLAA 2PGCA 2KYRA 3ER8A 4BC0A 2H00A 1BWVA 1A2BA 3ZY4A 2P2YA 4AY6A 4M7OA 1DO8A 4P58A 4NCHA 4FDUA 1XCJA 5DT9A 2C3PA 2ZUTA 4W1SA 3DTNA 3UY4A 3S29A 3KWJA 1RWXA 4I8IA 4RKUC 2QTRA 4IH4A 3LQ2A 5CX1A 2QORA 4IOCQ 3RVLA 1IHYA 1B23P 2FE4A 4Z9BA 1JHQA 4P22A 4OFBA 2RH3A 5KB3A 4LX8A 3IELA 2LXNA 3FSGD 1SXJB 3NNNA 1I3OB 1ZD9A 2R8ZA 1E8NA 1Z63A 2CW5A 2F63A 3MR7A 2MYPA 1V11A 3JD4A 1GM5A 4JOBA 1U2ZA 1T3NA 2A1UA 3N5FA 5DNEA 2LECA 3DBHA 4QQNA 4P81A 2X0DA 3H8SA 1J5OB 2FDRA 3Q8QB 4ETWA 2WD7A 2QD4A 3BS4A 1CZLA 4CVNA 1VJQA 1Y0HA 2OLJA 4OUDB 1DRKA 2QRQA 1S5PA 2ID7A 4HH4A 1XKTA 5LMZA 3I30X 1ZGZA 4DLPA 1ONNA 2KYZA 1ZC3A 2LKDA 4BNFA 2DKFA 4Q12A 4JLMA 4NWIA 3BGLA 4M5HA 1ZH5A 5GM1A 3HZRA 2DHGA 2GRJA 4MS3B 5K3CA 4LXXA 2AQIA 5K0BA 3M2RB 4P3YA 1U2CA 1GKLA 3QU7A 5J2NA 2GD2A 2UXDJ 3DMPA 3IWNC 4F4WA 5FJ4A 4TROA 1CHDA 4UDNA 4MKXA 3G8AA 4KLAA 2MMGA 1YT5A 1LZLA 2MB0B 2BC9A 4CEHA 1C7RA 2CJ9A 4DUZF 1JXAA 2KJVA 3GVXA 2IPAB 3H1BA 3AW9A 4I2VA 3F9RA 3BEOA 3Q5GA 5IBQA 3FPAA 4MQEB 3B3FA 4HEA1 3IXMA 1N9GA 3RB4A 3G9ZA 4Y2RA 4YUAA 4Q9NA 2FKNA 1B14A 1P6TA 4RHXA 3RARA 5A5GA 1NK7A 2GFQA 2YVLA 5JEEA 4M7PA 4DLVA 2G17A 3KXIA 1NDLA 1H4QA 4PR3A 3IESA 3GLVA 3RAMA 1CUEA 1C80A 3BKXA 3OTHA 1IBKJ 3H5SA 2Q99A 3W5IA 3GJQB 1QIGA 3GH3A 2ZJYA 3B3GA 1PS9A 2FEXA 1JVBA 4N0QA 1NXOA 4GD3Q 4ZCPA 3KQMA 3J80U 3S1LA 4FYXB 1EZZA 2SKDA 2QTBA 2XZDA 1R0RE 3M1YA 3MR3A 1W88A 3CNLA 3ACCA 1VPEA 4LCEA 2REQA 4D1YA 3CF4G 1YFKA 2CXNA 3UQSA 1V45E 2QNIA 3K73O 4RWZA 3S1AB 1IH8A 4DR3F 1EX8A 3GCXP 3TZZA 1PJLA 2WYVA 3BWBA 3IMEA 2JJYA 3RVMA 1MVLA 2RT3A 1QWSA 1IVSA 2ODAA 2IEIA 2P4EA 1KZYC 4ECEA 4XUDA 1Y3IA 1HQEA 3IJPA 2DULA 4AX8A 2QJFA 4KOAA 4LUBA 4C8ZA 1JU3A 3TSOA 1DRJA 2HGLA 4P98A 4C30A 3FIJA 3B78A 1JG1A 2WK1A 4JLNA 3ANMA 3HA7A 4JR1A 1U2DA 5FQOA 3VSDA 2W2OP 3KJZA 5ELMA 2OMLA 1SC3B 2AZTA 1UZHA 2DXDA 1JDJA 1UWKA 3MM6B 1ZLXA 1HWYA 4X00A 2K2PA 4CL8A 4GM1A 4Z51A 3GELA 1WCYA 3OPYA 2XNDD 2W11A 2OAP1 5HK8A 4DQRA 2QUKA 1D2EA 3ANXA 1Q81T 5B4UA 4BMPB 4YB7A 3WJ7A 3R7NA 2NZYA 1GAXA 3RRMA 1MB3A 4IZOA 1T9CA 1H0HB 1FFXA 2Q9UA 2UYOA 4UULA 4DGQA 4FHDA 3ZIAD 1M54A 3RYFB 4OHPA 1HE2A 1PL6A 3HYLA 4P3OA 3DNMA 1LW2A 5IC6B 4WFIA 2PUFA 2A2ZA 2HFKA 1I5RA 2ZB3A 6CHYA 5B58C 4OKIA 2RKBA 1AC5A 2MOKA 1PSZA 1NQ5A 5EQDA 4E2WA 3VZRA 3LT5A 1JEAA 5JAPA 4C04A 1Q6ZA 3H9BA 3RQIA 1GZ6A 3MOGA 1SULA 2IWHA 3F90A 1XXHB 2PKQO 2JGIA 3V4IA 2ZREA 4QPJC 5EZYA 3BFVA 1N7IA 3ZHYA 2VH5R 4M38A 3Q8SB 2X5NA 5DCWA 4I6WA 5FBQB 3BGOS 3AFNA 2CNDA 5CT8A 1BLUA 3GJRB 5DK4A 2C58A 4A2WA 3SY8A 3ADKA 4L5CA 3HUDA 4TXHA 4DQSA 3O47A 1XNRB 4ARVA 1HHSA 4BB9A 1U6IA 2ROQA 3S1SA 1ULAA 4IG0B 4AO6A 4I1RA 4I2QB 1R0YA 3BD8A 3E5RA 4P82A 2B1RA 4EECA 1V5GA 1WXWA 2JA1A 1VG8A 3R3XA 5K20B 1N1MA 3CJ2A 3X1DA 2C7VA 4KQWA 5ALNA 1UP6A 3HR4A 4QR1A 4PSKA 5K99A 3A12A 3K92A 2ZFUA 1O4WA 2AT1A 5AOBA 2ZKLA 4JT2A 2D00A 2I0XA 1KRPA 3NGKA 5ITZA 3A32A 2XCQA 4QPPA 4MAMA 1RACB 3HWSA 2B5WA 2VF2A 2XDYA 2YC4C 3FPJA 3ZS9A 5DTMA 4P2XA 1ZI8A 1IN7A 4EY8A 2JGNA 2W25A 3IHWA 1T6YA 2V54A 4KE6A 3TGPA 2QRRA 2PA3A 2QX8A 4GKVA 6NULA 4RHUA 5K0FA 3O0DA 4CU2A 3FE2A 4D3HA 4FS1A 1ZSVA 1CHNA 1T94A 1TVMA 4YJGB 4H4CA 3QXCA 3MD3A 2R9VA 4GVXA 1U6FA 4X1KA 1U3TA 4IDPA 2JA2A 5DSZA 3E9EA 4C1NA 4QAJA 1VL6A 3UMBA 3V6JA 4W4TA 1I36A 1E69A 2FF7A 5JISA 1ISPA 4E2YA 3ZNPA 1YJ5A 2XOKD 1FP7A 4Q21A 2B56A 1P1LA 3UKDA 1P5JA 1YE3A 4M1SA 4MW1A 1TL5A 1SKSA 1NXWA 3Q2IA 2HK9A 2BT4A 3B9RA 2RHHA 4EVQA 3GFPA 2GVZB 2GYVA 3NC4A 4A0GA 1J06A 4DT1B 2BEKA 3GAFA 3ENWA 4AO7A 4OZ0A 4OXNA 4LF2A 1N2SA 5DQGA 2ZYSA 4NLWA 1CG6A 4Q8EA 4DQ0A 4BBAA 3UJPA 1ADJA 2JFVA 3KJFA 4EG7A 3ONWA 1DT3A 3QE0A 3EC7A 2JLSA 3PNVA 2GLTA 1M6WA 2V6MA 1WDLA 1XMOB 2J1LA 4Y6OA 5LA6B 1VHQA 1EKXA 3NOXA 4HDMA 1A71A 3MJEA 1BXGA 1ZKDA 2CBGA 1X4GA 3ONDA 1MMLA 2VPYA 2HV8A 2P2GA 3SJAA 3R5JA 2UXDF 4RE5A 5ENVA 2FC9A 3RC7A 3RHFA 3AKZA 1W0KA 4RIFA 4QYRA 2IPMA 4YMSA 4ED5A 3AA8A 1LWFA 4J9VA 4JVLA 1JHVA 3RTVA 1W0JD 2HSEA 4LMBA 3DDHA 2QI9C 4QU7A 4BWVA 2EXXA 3IULA 4QXRA 4UVGA 1J7KA 4QOJA 2DY1A 1FZQA 1NBWB 1BA2A 5JMTA 3RRZA 4DN0A 1F2UA 4OO3A 4M9ZA 1JG3A 4PCVA 3CVVA 3LHKA 4YBRA 4OREX 4Z7YA 3RF7A 4EEYA 4I55B 3BB5A 5LXTB 4KP7A 3R9XA 3N58A 3RLIA 4IHAA 4RIEA 4J03A 2ZVSA 3KZ1E 3P2OA 2YFQA 1QHXA 3K5HA 2A8YA 4F5EA 1X7WB 1IBKF 5FA8A 7YASA 5K14A 5TXGA 1OWLA 5CW2A 1ZVKA 4FUTA 3T4EA 4UQOA 4RVGA 4Q24A 2WQ6A 2J4CA 2YVUA 3JSRA 3G0IA 1SUQA 3AX6A 3R3VA 3VPBA 1QXSA 4RBNA 3EE3A 3FWKA 4D9MA 4PLWA 3ANTA 2K8GA 3KQLA 4ALKA 4QOEA 5BVGB 2MJUA 3L5KA 1RT2A 4QCLA 4X4NA 1V3VA 5A8WB 4YRRA 3NKVA 1A4XA 2QFIA 3PW4A 1WHSB 4N7TA 3R77A 3IMCA 3B6ZA 4XD7A 3PW5A 3RSCA 1CQJA 1TI7A 3I52A 1U0SY 3T0GA 5JSZB 4MS1A 2HBQB 1HX7A 4R5HA 2VHVA 2PE8A 4LOIA 4DR1B 3KV3O 5BYRA 4WZBA 1YDHA 2DHQA 1YRHA 2NXEA 1CBUA 4KG7A 1O0SA 2BE2B 1H8HD 2ZBRA 4ZPWR 1JEYA 1KMCA 2O4UX 2C4MA 4F5WA 2VUGA 5JOQA 3DOUA 2BJ9A 2I1VB 3OE7A 2NVWA 1ZD4A 1HBNB 4MWBA 1RB0A 3PCOB 3RYHB 2P9JA 1JJFA 1F1BB 4C07A 2HIYA 1NR1A 3S7TA 1R66A 5LOQA 2QLNA 3DCJA 4UMDA 3WXMA 3CYFA 1I7LA 1JLRA 3VTKA 2JI9A 2IHNA 2ZE2B 2B99A 3PIIA 1KVIA 5HQ3B 1GGVA 3LQYA 5B6PA 5JS2A 4RM2A 1I3KA 3WYBA 5HW0A 3FTNA 4BVBA 5I9IA 1AS2A 3E5HA 4QO7A 2JFZA 5TT1A 2AR0A 1XQYA 3VCDA 2EJCA 3TIIA 4EHDA 5K8OA 4BVFA 1XXLA 4MQ6A 2YVKA 3HRKA 1PNQA 4D4LA 3C8DA 1XCBA 4Q1VA 4U95A 2JIDA 1X0FA 1YK0A 2IH2A 3CCSS 2QTVB 5L3QA 1E4VA 4PYRA 1G8AA 1AGNA 2X3FA 2RS2A 3BMCA 1OMSA 4CIAA 3QMPA 1I8TA 3AJ2A 4L3OA 3P5TL 4A27A 2XNDA 3E0QA 3RR8A 5BWBA 2XXAB 2HNZB 3DN9A 3MMPA 4LW8A 4RNFA 3QHAA 2WM8A 1BY9A 4BZXA 1WF2A 3VYUB 3EQ9A 5ANRB 1JQAA 2W8KA 2QTWA 4ZYUA 2OVBA 4YMHA 3S70A 1EDEA 1GPBA 1L5OA 3P4XA 3NAZA 2HS0A 3Q5EA 3ZIAA 3DEHA 1NE7A 1RBOB 3MUVP 2EFEB 4XJSA 1W8IA 4CG1A 1RT5B 4RK0A 5IC5A 4ETZA 3TRGA 4G0WA 3BF7A 2A92A 5CB8A 3FNGA 1V35A 1I13A 3SR3A 1LWCA 5KNCA 4ND6A 5H4GA 3MSXA 4Z0NA 3H87A 3PIDA 1ZHHA 1JLGA 2A9JA 3D66A 1BW9A 5CDTA 3QIPA 3F71A 2APJA 4FZRA 4L16A 3U5TA 1WX1A 4MAKA 3F49S 3ZE2B 2R7QA 4AJ4A 4N1AA 4LREA 2NG1A 3HKBA 4GLFA 5M5BA 1W47A 2Z3VA 2WZDA 4Q4AA 2WI8A 1WF1A 3D4OA 3P9QA 2CV2A 4FGJA 5I51A 3G71S 2I62A 3ADBA 3E9NA 1RT7A 2O8BA 4K2AA 2EZUA 3ZDQA 2E0IA 3ZU2A 3AMVA 1K97A 5HOEA 1MAWA 3EEQA 1LVHA 4USWA 3U48A 4OXQA 3QM1A 4Y0FA 1S1VA 2YIMA 3PCTA 3K2IA 4B8ZA 2RMLA 1DX9A 4W5NA 2H5JA 3EZOA 4W7IA 4HVAA 5DM7Q 2VBIA 1JR3D 2C83A 2R60A 4MS4B 4CETA 3GLQA 4Y2QA 1DQAA 1U1EA 4GP6A 4LWZA 3JRXA 4YMUA 1S0UA 4L08A 2IUEA 3NDRA 4TWZA 4MGZR 4ENRA 2V67A 4ZCLA 2QL6A 4F1KA 5C1BA 3V8BA 4H6WA 3V3TA 1D4OA 3GNLA 4CDMA 5LFAA 4IDEA 3JQ9C 2Q43A 2YXPX 3GFVA 5EUCA 5D3GA 1DAPA 4J2HA 1MQ9A 2GEJA 3E3MA 1FX0B 3PG5A 1DOHA 2Z1MA 3HG7A 5I7UA 2M70A 3NXSA 1OTHA 2DQZA 1LNZA 2YZGA 2XGMA 4R1UA 3CLHA 4WL0A 1IN5A 5DCYA 1T4CB 4B02A 1WV0A 3X2SA 3I42A 1GKKA 1OQAA 1RNLA 1C41A 4EUSA 2ADOA 5IX8A 3LXRA 1YVDA 1KFEB 1XEXA 1GG5A 3OIFA 4LRFA 3TVKA 3C2QA 3GFHA 5KTRA 2OTJS 2ZKUA 3MJCA 1F20A 5HG0A 4LHVA 2XOKA 4UAJA 3SYRA 2PXCA 1VK3A 5D1HA 3O8BA 1JN0A 1V8FA 2GTHA 5KOHB 4YB8A 3VH3A 4DPWA 4M3NA 3LWMA 3BG5A 2OFPA 4FPRA 4KAFA 5C24B 4W5RA 4QELA 4QIEA 4I67A 5CXXA 3O4VA 4LBYA 5EINA 1DDGA 2P6MA 3L6RA 4J9SA 3FFXA 4PRZA 2J0WA 1QX3A 4UUNA 1PD1A 2V5AA 3THOA 2ZT7A 1G2EA 1XN4A 4YMWA 3BQ2A 1N2GA 3A04A 3Q8UA 5C80A 5DYGA 3OP1A 2XGPA 4DDWA 2VDKB 2CE2X 4FNOA 3IJ5A 2FSVC 2XEDA 4P36A 1GTRA 5JZSA 4D6PA 3IQDB 2Y0SD 1P8GA 1H69A 5BV7A 4NHOA 2BFCB 2D74B 4E94A 4FI3C 1N4DA 1ML3A 5IN4A 1KOOA 3DGPB 4KQHA 3QNWA 1P9OA 1QO9A 3UN3A 2R4UA 2P2CB 1L0BA 4MW5A 3TUPA 5A6PA 5AW0A 3R0QA 4MP3A 4F8YA 2PSDA 3QLVA 2OFWA 2Y1XA 1AB5A 1ORTA 3KZKA 3MM8A 4D98A 3BPDA 3OVBA 3UXYA 1OI4A 4A10A 2WTXA 2HHVA 5FADA 3OE1A 3DQQA 4GBJA 2W43A 5JZVA 5IT9A 3QXXA 1ULRA 3HFVA 3FX2A 1U6BA 1XIVA 2WFLB 3R9KA 4RPKA 4UDYX 2PZFA 4USUA 1K8AT 3R5HA 1DC7A 2RMKA 4KXYA 3BQ9A 3W2TA 2CPFA 4KV8A 2KFZA 1V0JA 4YB1P 4Z53A 1TF7A 3WGIA 2CJYA 3IRXA 1QG4A 2J87A 3CJ0A 4UY85 1NTOA 2YIVX 4M87A 5G4DA 4FGWA 2WMYA 2WPDD 2GTPA 4K9LA 4NAHA 5IQ6A 1F8FA 2QR2A 3P4UA 4XIYA 5K0TA 4YGYA 3A1NA 4FYHA 1DELA 3UICA 5FPTA 2ZTSA 3E0XA 3K57A 3WDSA 3VSAA 5PGMA 2GN2A 5E6SB 5BN1A 4OV6B 3FOCA 5KT7A 5U4QA 3ICVA 1A1SA 2Y1DA 1U3GA 3V46A 1O89A 3FQKA 1H8ED 4J1QA 2BHTA 4GR9A 3V97A 4DHVA 2KT2A 4B7XA 3KQTA 5DIZA 1GQSA 2HGSA 4OYOA 4B3DA 4F4CA 1XWLA 5AJTA 3UWSA 2FEPA 3QWUA 3MIIA 1QE1A 5EIWA 1AUQA 4JEUA 1COZA 2XIJA 3GROA 2X4IA 4WE1B 3D4PA 3D6VA 1H8HA 2MCFA 3P52A 3HVKA 4WKNA 4Y9SA 4C11A 1WXIA 3OFJA 1ETHA 2FWBA 3CR3C 1GTG1 3SXJA 2BH2A 5B2ZA 4UTGA 1W2HA 2VAPA 3GT3A 3BSNA 3GBVA 1GG9A 1VLZA 4IFVA 1GAJA 2ZRIA 1DLJA 1HT1E 1CQIA 2ZIFA 2HFZA 2OXRA 1KPIA 4YAOA 3Q7TA 2V5VA 3UJ9A 4ESHA 4NBKA 4HDRA 4WLEA 3HHKA 4RK7A 4V2IA 4X92A 1ZJ5A 4J0JA 4LF4J 1OQ6A 1DAKA 5KYGA 4LYAA 4IMPA 1ZWKA 1U0HA 3FPHA 4OX7A 2ZTUA 4V0RA 5IM4A 1ZGJA 1C4XA 3F6BX 1IXZA 5ETJA 4PTLA 4HO1X 4MPJA 4EATA 3TA1A 3NDJA 4EG5A 121PA 1B43A 2WE8A 3I5XA 4GE3A 3RSLA 2HEKA 1A8IA 3FNEA 1CS4A 4TZ0A 3DVSX 4P10A 3VJRA 4ZDNA 2H29A 3F8WA 5ABPA 1R0WA 2CNKA 4ZHRA 3TIGA 1T9XA 4ARZA 4F0MA 5KFNA 2OE2A 2MQMA 4B3BA 3CLUD 2OG1A 4ZEXA 1KZHA 2VAMA 4PICA 5FIIA 3P8ZA 4P54A 3IMQJ 4DILA 2K5UA 4RJLA 2Y3YA 4E12A 2CJXA 4YQEA 1HDCA 2PKCA 1F60A 2CHGA 3STWA 3OXGA 3NG8A 3O6QA 3HDQA 3C7KA 3CA8A 5LJLA 4KWIA 1KJ9A 1X14A 3MTGA 3NI2A 4I1TA 3WWEA 1JLEA 5K51A 2HX1A 4OHWA 4LDZA 2OEJA 2QUHA 2WAAA 4BCAA 1SBQA 4WNCA 3I1FA 1BDJA 4ABYA 2QQ0A 1Z34A 3AVOA 2EWMA 1NH7A 3WB2A 4EGAA 3FDFA 4GOLD 1AGXA 5IJ9B 3LT0A 1JJVA 1UPBA 4UPVA 1DV1A 3TDKA 1ZA1A 4GZLA 3WTCA 3QYFA 4JP5A 2X9VA 1SEPA 4LXUA 3EVTA 2XZTA 1GQRA 4KKOB 1U1IA 4YR9A 2LQ8A 5ILGA 4MRSA 1N2CB 2YHIB 3AY6A 4EYEA 3CEJA 4RZQA 1IZ0A 2XVZA 2BFBB 5A6SB 4WACA 2VHTA 4B6EA 2OO5A 2VDVE 1GJRA 5KYWB 2F1RA 3QYPA 2WU8A 3GEIA 4KMOA 2MGZB 1UODA 4J9NA 1LLFA 3FCSB 2H31A 3GPBA 5AI9A 3BSSA 3TNVA 4UBIA 3T3OA 2CQBA 3PR3A 1DV2A 1Q5YA 2VFUA 4XTRA 2QVXX 1H2VZ 4ED2A 1NP6A 2A58A 3W3AD 4B44A 2W83A 2WR8A 3W5ZA 3I9MA 4Y6IA 1JR3A 1KQFA 3BSYA 2NVUA 2EERA 3RSFA 2WICA 1ZJYA 3X2FA 1AH2A 4Q03A 3C7CB 5CB4F 3K4QA 2C9MA 1A9XA 3UG6A 4C7VA 2LEAA 2WK4A 2SCUB 2HJVA 2E5LJ 1N2BA 3MB5A 5L40A 1Q0ZA 3I01M 4ZI5A 1HQCA 2AKYA 5IDXA 4HDNA 3HY6A 3SDZA 2ONJA 1P81A 2XAUA 5IAEA 3UM9A 3UK7A 5DG8A 4J43A 1C81A 1FUUA 4O3NA 1DHMA 2D5LA 1N6LA 1X39A 3EA0A 2JHFA 4RW0A 3VGTA 4HUQA 2VDQB 1LBTA 3DFIA 3OT4A 1PZNA 1SK8A 2ZJQQ 3RVQA 3QZUA 1VTKA 4Y1GA 3ROEA 3UO8B 2QP9X 2Q1UA 3SEOA 4ZYVA 1E5LA 1JMYA 4MKFA 2I4OA 1RAFB 1JLFA 2HRBA 1R4MB 4PO3X 5AJ3J 4OMDA 4UBLA 3O7MA 1C7FA 2HXGA 2PMWA 4ENVA 3LQRA 4EHKA 1LJ8A 4HX5A 2BZSA 2FX5A 1Z5PA 2H3EB 1M7GA 2OHXA 3B9BA 3LYHA 2RHQB 3ESDA 3KT0A 3HDJA 5IUJC 1ENPA 4G8BA 1I5EA 3U4CA 3G6KA 3P9XA 1P7YA 3UWMA 2FPIB 4JL5A 1GZUA 5AMXA 5E2IA 3PDIB 3UT6A 1SVMA 2GHVC 4KIGA 3F4BA 4IFTA 1PYTA 1KI6B 5HNKA 3D28A 4MIKA 2GO8A 2BAGA 4LRBA 1YS2X 3CO0S 1TKAA 3KJIA 5FUXA 2CQCA 4MR8A 1ODTC 2QD1A 1RWPA 1X4BA 4YCMA 2J45A 2VK2A 1F9HA 1S02A 4EA8A 1JTEA 5F4BA 2BZ1A 2QL7A 5FBRB 3T52A 2NR0A 3D3EA 1S9GA 1XQ6A 3PD1A 2G1PA 3NONA 3ZLBA 4R1PA 1XLTC 4KO1S 2I8LA 1LW6E 5TF4A 2MKHA 1MVOA 2B8NA 5FI1B 3JAKA 5JATA 1KRXA 2BFFB 3OPXA 1GNTA 3SX0A 3A1DA 4G5QA 2CNNA 3ETLA 3CSSA 4PSCA 2J9EA 5AKIA 7AT1B 4ECZA 2OV6A 2OECA 5DBGA 1XYGA 1AXEA 4HFRA 3UK1A 3QVUA 3EICA 1L8XA 1PJQA 3C6TA 4KDCA 1Y82A 2C99A 2HCBA 2OBMA 1X4HA 3IS9B 4PRFA 2DTDA 3NEKA 1KP9A 4E98A 1V5EA 3BK7A 5LU8A 3FHLA 2DOKA 2I1RA 2UZ4A 2MQQA 1YQDA 5CCEA 4XB1A 2PSFA 2E37A 3GYXB 3PYLA 1TAQA 2KHCA 2G2ZA 2GUWA 1JDZA 1FQJA 3QA9A 3STUA 1LS1A 1RADA 4R0NA 1FBTA 5A76A 1BGVA 3VTZA 4CUKA 4HDKB 3JVEA 4Q82A 3IP3A 4WK1A 4F4ZA 5L46A 1U3CA 3CZCA 3MEQA 1BVUA 2WPDA 1GPMA 1D9AA 3CTPA 2YKNA 1JS1X 1M8JA 3NHZA 4FILA 5MN6A 3ITNA 3A3KA 1K8YB 3EW9A 3W64A 1WACA 4Q37A 5KO2A 4ID5A 1X0XA 2OGTA 5LJIA 3A3YA 2O8CB 4WZAE 4YMLA 5DTRA 3HVTA 2CA9A 1SU4A 2X5KO 2VR1A 2PNJA 5LMNB 1H8EA 4O4IF 2V0CA 3JARA 3LXUX 1HI0P 2WU0A 4YP7A 2NLOA 4H4OB 4GC6A 1QGOA 1EARA 3GZ4A 3WGJA 5FAKA 2FN9A 5LQRA 2R68A 1JBQA 5D3KA 3KB2A 5I3UA 1UANA 5DLGA 2AOTA 5EGSA 3C45A 4UXJA 4F2RA 5JZMA 1QPZA 1CC7A 1I4TD 2HWKA 3A6EA 2QUZA 4QARA 2BE7D 4DA6A 3OX1A 3PDHA 4MULA 2VJCA 3A7DA 4JBIA 3QGMA 1OA1A 1AKYA 1PKEA 3RJMA 2DR0A 5LC1A 5BV0A 4RLEA 4NWBA 3DFKA 3A2MA 3OFND 2OCXA 2HWYA 1G7TA 2WSIA 2NZ4A 2EHJA 4O0MA 3UYKA 5C5IA 3CCLS 2D5AA 2DWCA 2VH1A 1I2BA 4CFSA 4LGMA 2X0FA 3VYVA 2I65A 4BXOA 4B2YA 2O8NA 1TT5B 1E1RD 4ZXFA 2I54A 2WHEA 4ND8A 1CF9A 2JBWA 4K6HA 4DV7J 2FRDA 3E7XA 2LXIA 4RL1A 3ERCA 3TUZC 5JV5A 1QSGA 4G65A 1LPNA 1FRJA 1D2CA 3IGFA 5JS8A 1HQ2A 5DXFA 3EUAA 4RWWA 3L1VA 3D02A 1REGX 2HJWA 4RYDA 1XDWA 3DR5A 3KHSA 3FKBA 1QANA 3GJSA 4YDRA 4BCBA 4NKRA 3GLFA 1Y3KA 2IXAA 2DHXA 3W6PA 2Y1KA 3HCEA 4YO7A 1BROA 2N4DA 4WINA 3MTDA 5LQKA 1TZBA 3ROGA 2GO7A 3ESRA 3IQGX 3W2EA 4L0QA 1WVGA 1XP5A 5JARA 1RM3A 2XYPB 3I9NA 2FTKE 5DLFA 1X87A 2F43B 3E22B 1JYEA 2CJPA 1V1JA 5EERA 1A9SA 1JR3E 4CMIB 2WVFA 3KLHB 5D5HA 2F55A 2ZWMA 4AE5A 1RTIB 5DM2A 2XS2A 2JEGA 4NPOA 4IIJA 3DAHA 4ZJUA 3A2KA 1M66A 2SKCA 1OH6A 2NZXA 2ZIWB 2X13A 4NPAA 5ETNA 1OH7A 4IDDA 1ULTA 2PE5A 1KMQA 4B84A 3B51X 4DL5A 3LUGA 4D92A 1JIJA 3UKJA 2GCOB 4D56A 4I99A 2BOPA 4K81B 1X15A 4LSMA 4C2TA 2XWYA 2XG8A 1S1MA 2M6SA 4C21A 3WE7A 3B89A 2I6FA 3W3AA 3JSMA 2IXGA 1UBLS 1PG2A 3K7RA 3L1JA 3PE4A 4F04B 5CJJA 1LTKA 3LDFA 5DXAA 5GGXA 1JQ3A 5FBWB 1XMXA 4H4KC 5K0GA 1TE2A 1YBTA 1W49A 4K0KJ 2YY5A 4KR0B 2RCNA 4DX5A 4GSLA 5CCDA 4L7VA 3J81U 2D69A 4LY6A 1DNPA 2AW5A 4LC1A 5IKOA 3DL4A 3WGNA 2WBRA 1OILA 2F1FA 3Q2SC 3GEGA 3S0JA 4EVRA 2GEKA 2IM0A 1Z4QA 4FD2A 5JAOA 4GSYA 1HNZJ 2X1VA 5DBHX 2X0KA 4BBPA 3KKMA 2NWQA 4Z7OB 5C2CA 4BB6A 3SZGA 3FJ1A 4DUGD 2PMHA 3K9NA 1HT3A 4CH1A 1PO7A 1F17A 3LY9A 5AJVB 3AIIA