3OBVE

Autoinhibited formin mdia1 structure
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
442
structure length
419
Chain Sequence
KVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein diaphanous homolog 1
publication title Crystal structure of the Formin mDia1 in autoinhibited conformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 138
structure length 419
sequence length 442
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF06345 Drf_DAD DRF Autoregulatory Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3obvE02
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3obvE03
2J1DG 1UX5A 3O4XE 4EAHA 1Y64B 1UX4A 1V9DA 3OBVE 2Z6EA
chains in the Genus database with same CATH superfamily
3RRCA 4EV6A 2BG9A 3ZEFB 4PJNA 2HH7A 3HI2A 1GQEA 3SOLA 2XQ7A 2X0YA 4KBMB 4PNIA 3OBVE 1N32T 2H7VC 4IDOA 3O4XE 4L9IA 4M1PA 3M65A 5BR8T 4C91A 2WY2A 2JQ9A 4H9PC 5JDHA 2WS3A 4B6XA 1ZV4X 2XQ9A 5GONE 3FHNA 3UQ7A 4Q25A 3NKZA 2N2NA 5JVDE 4V1Av 3P4SA 2J47A 2AE9A 3WAKA 1QSDA 2W4XA 4MALA 4O8SA 2RP4A 2WDRA 1KNRA 2CBJA 3FXEB 2E2AA 5JQGE 5ABGA 4WBOA 4CQIA 4ANJA 3IHRA 3KINB 3NRXA 4O4IE 1N33T 1WR6A 2CA5A 2H88A 4AQFC 2X0HA 4QXHB 2LM9A 2YU1A 3MACA 2XQ5A 2LOPA 4U2YA 5HWXA 4TNVA 3V5SA 1X9BA 2HN1A 2UXCT 1MIWA 4X20E 4HN9A 4K0KT 3T1YT 5FY7A 5L3CB 1IZNB 3ESLA 2YK0A 5ABFB 2YKSA 4IDNA 3UFGA 2JQQA 4JI6T 5AQIB 4AI6A 5JR9B 4GKKT 2VKDA 3N9LA 3NRYA 4DBQA 2M6BA 3MZKB 2IUBA 4ILBA 1QLBA 3KVAA 4PW8A 3PUVF 1BR2A 3FZKB 3JC6D 2D2SA 2YDSA 5JDNA 4QX7B 1UX4A 3OYZA 3HKBE 2PFVA 1OEDA 4AKHA 1U5PA 5AQRB 3UU5A 3PE0A 2IMLA 4PK6A 2JQKA 4UV8B 1NAFA 2UXDT 5FYMA 5FL1A 2VQFT 3KV4A 2CLYC 2DI4A 1MIVA 1Z0PA 3I9YA 2K3WA 3VRAA 4CN6A 1WR0A 2I59A 4ZS3A 4IE6A 4GOUA 4MFRA 5H6RB 5AQVB 4JI0T 3LDQB 2XPKA 4I4TE 3NWIA 2Z6EA 3MA9A 3KBTA 1BR0A 2BS4A 4O2BE 5LGTB 3NBXX 5C3JA 3I0QA 3RLFF 3P4WA 3LBXA 5JH7E 4E7SA 2MOZA 2JMKA 4DR4T 5EK3A 3AAEB 4PJJA 2K9AA 2JRKA 3RIFA 2XM2A 2MYSA 1E2AA 2LOSA 1KEYA 3RH3A 2BG9E 2ODUA 2X66A 3ZJ1A 1WYCA 5LYJE 2F4VT 4UF0B 1D0ZA 2C5IT 5AQPB 1LKXA 1HNZT 4YTNA 2E9XB 2LEHA 5FNVE 5JDFA 5LG4A 3AAAB 3ZCJA 3I9WA 3CX6B 1I6ZA 3SFEA 4BJNA 4Z90A 3OKQA 2PBIA 2BS3A 3C4WA 4EZHA 4X1KE 4I43B 3A8YC 4FJOA 3VKGA 3EDUA 2QA7A 2W00A 2WSSV 4AKIA 4UVAB 2WU2A 4LF8T 4JV5T 4ZI3C 4X66T 3J7Yq 3AA7B 4PFOA 3PUYF 2IW5B 2NW7A 2JIWA 2WM9A 2VL0A 2EHOD 3AEFA 2BZBA 2HPLA 2E5VA 4UV9B 4L0RA 5HEOA 3E22E 4JI2T 5DQVA 4FI5A 4KMCA 4WW0A 3AXJB 4EAHA 2RPAA 1NENA 5EK2A 5AQKB 3RIUA 2ACZA 2NW9A 3CPZA 2D0UA 4HEAA 4P1NA 1W9RA 2E8IA 2LLYA 4I55E 4WZXA 4TWDA 2QRXA 1OEDB 2VQET 3PTRB 4O2AE 2E9XC 2XHEB 3H3MA 2EHOA 5AQNB 5LHHB 2YU2A 3ONJA 3UU8A 2Y8DA 4CZZB 1OXZA 3K1SA 2W2UA 2LKGA 5LHIB 2MPKA 1VCSA 3LG7A 4JEHB 3W15B 3RYHE 3AVRA 5L47A 4HGAA 5E0OA 4PAGA 3EUHA 3P50A 3FBLA 1WRDA 5HXHA 1X79A 3H37A 1OEDE 2DNXA 4UVBB 1S94A 2BKOA 2QGSA 2NR4A 5JRCB 3PJAJ 4G2AA 3WI3A 2CWYA 3P7IA 5LA6E 4ZS2A 5AFUL 3ZKRA 4EIWA 3AE2A 3EVYA 3Q2MA 1MMNA 1D0XA 3FZMB 3ZLIA 2OA5A 3N9MA 5ABHA 3O9XA 2KWIB 2ZLYA 3PUGA 4B3RT 2YOEA 3PV0F 4HKAA 1ZP0A 5AQUB 4AKRB 5HEUA 1M7KA 3HA4A 3FZFB 5ADXL 4KI0F 1D1CA 2JJ9A 4F8HA 4UR9A 1HF8A 3RKGA 4IDQA 4CN1A 4TWHA 3RC3A 4DO0A 4P09A 5M4YA 1VOMA 4OYJA 2Q9QC 2QYWA 3B13A 1T8BA 2BVLA 2LRLA 4IE5A 3N2KE 2YDRA 3QOFA 2IIUA 4DV5T 5IWAT 5LMNT 2K5BB 4KP3C 3UUBA 3MKDA 3LSVA 1XDPA 3AA1B 5DABA 4HTEA 4CXXA 2V1DB 4GK0E 4GIWA 2X0LB 2DLRA 3QC9A 5L3BB 5HEJA 5H6QB 1CHUA 5FL0A 2W63A 2UUBT 1Z8UA 4IE7A 4UXNB 2FJEA 2IC9A 5L4EA 4HE8A 2V6YA 2VWAA 2CM0A 4GYSA 5C2TA 2WBLA 4JBWF 3GN5B 2VK9A 2XJ7A 2LKHA 2X9YA 4KHPT 5J0ZA 4LFBT 4A98A 3ANWA 3UU4A 4IREA 4DR3T 2CBIA 3NZPA 5LJNA 2GK9A 4BA9A 1US7B 3ZSSA 3L09A 3AEAA 3O1IA 3UUNA 3AVSA 4YTPA 4A56A 2X51A 3V5UA 1J5WA 4H63V 1KK7A 2OV9A 1IJ6A 5LG3A 2CWOA 2XSAA 3MJXA 2LRKA 1IBMT 3RC8A 3OYXA 4YSYA 3C51A 2PTFA 3F2EA 1UGOA 2UXNB 2MTQA 4QX8B 3TKLB 1IBKT 2CHOA 4EZ4A 2VKHA 5L3GB 2JMHA 2VKOA 5DQWA 3KFWX 4MBQA 4Z8XA 4EEBA 1LRZA 3N9QA 5FP3A 3Q9DA 4COFA 3ZC0A 3VRBA 1HX1B 1SHZC 5HCJA 5IUXA 3RQWA 2V7LA 2BDEA 3ONXA 1LVFA 4CXWA 3CQGB 2XQ8A 4IDZA 4CXYA 1LVKA 1SE7A 4KX6A 2DL1A 4CI2B 1WLXA 5DJQC 2MAWA 2BKPA 5FVKA 5JDLA 2B1EA 4DMVA 4DV4T 3PUSA 2XAGB 1HS7A 3PJAA 1G8XA 2DWGA 3UT5E 1BR1A 2V6XA 3PUWF 5JREA 1YKHB 2XTLA 5LJMA 3TLVA 2I6HA 1YXRA 1KNPA 3VKHA 2WDVA 2NTXA 2WWUA 1YQ4A 2HPJA 3N9NA 5LOVE 4YTMA 3SRZA 3M3ZB 3F57A 5LB7B 3L3PA 4EEDA 3RYIE 3BK9A 4DV1T 3CWZB 3AB3B 5HXSA 1SUMB 3FZHB 2LE8A 4QXCB 4QWNB 3ZMTB 4DIDB 2W62A 2V7KA 1IJ5A 1Y01A 3OTOT 2V7JA 2Q9QA 5IYZE 1N34T 4U74A 4NUVA 4QH4A 3KBUA 2A2FX 3QNUA 5L4HA 3KV5A 3U78A 5JR9C 3FZLB 1YW0A 1T7SA 2XQ6A 2BG9B 3AE5A 2X9XA 3PDYA 4O4LE 2LHRA 2NWBA 2X68A 4YLHA 5JDMA 4DR1T 3UULA 5HXRA 2YDQA 4JI7T 2ZM8A 3RX6A 4U7YA 3S4UA 2WZHA 5LNKA 3N9OA 5HXEA 4LF5T 4JI5T 1MMDA 1MNEA 3F31A 3MK7C 1BR4A 3RF1A 1MNDA 4U72A 3ZMVB 1KNZA 2ES0A 5AQLB 1T72A 3N5LA 3KV6A 5EZYE 4DV0T 3RI5A 5AQJB 4IE4A 3QB5K 3ZSTA 4O4JE 2XAQB 3OPCA 2FJBA 3Q5DA 3IBPA 5HCMA 2X9HA 2YN6A 3UQ4A 5EK4A 1U4QA 2BS2A 5ABEA 4H9NC 2V7IA 4DBRA 4UELA 3I0OA 5AQFB 5TAOA 2LM2A 2VKJA 5AQOB 3AE7A 3N9PA 2ACXA 1VRBA 3RYFE 2XUEA 3VU7H 3LK3B 2UXXB 2W61A 2BG9C 5CJ5A 2BVMA 3AAIA 4JI1T 2NOXA 3K3NA 2ODVA 3ONLC 2WDQA 4JI8T 5LBQB 1UURA 4YXDA 4ZZBA 2X9WA 5FMNA 3PU3A 4ISSA 5L2LA 4JEUB 3TLUA 4DV2T 5AQTB 1D1BA 1HG2A 4WBNE 4GYRA 4AQFA 2D0TA 2KINB 2XSBA 2WMOA 5L3EB 1NEKA 3JCFA 3K3OA 1HNXT 3L39A 4H9QC 3PUQA 2WAUA 2M6IA 3JAEA 2WCAA 1KFYA 3EAMA 5ETWA 2VASA 2XAHB 4H9OC 4X5TA 3ZJ2A 1Y64B 3E08A 2LSKA 3EDVA 2C5JA 4HFIA 4BAYB 2PG8A 3FBZA 3T1HT 2UXBT 3EHZA 1XMOT 3Q5XA 4HFHA 3I1AA 1HCIA 3CQCB 2BBJA 3P4PA 3AEBA 4Z91A 3GA8A 4ILCA 3N2GE 4NXMT 3KV9A 4DUYT 3HKCE 3AE3A 1XNRT 2Y6XA 2V5CA 3AE8A 5LXTE 1QUUA 4P0AA 4HWCA 5CGMA 2AXDS 3L8RA 4ISTA 2IAKA 2CMRA 4KUMB 4EGWA 3K3QC 2QVAA 4B3ST 1L0VA 1O3XA 3Q5WA 2LJLA 4ZOLE 4DVDA 4YSZA 3QK6A 3B57A 3TLSA 4JI3T 2WMNA 2FUPA 3LK42 2J1DG 3LBXB 2M67A 4AIUA 4DR6T 4PJMA 5FY1A 5KX5E 1OEDC 2ZM0A 5ABFA 1UUSA 3OJAA 1SA0E 1UX5A 4C90A 4ASKA 4JLEA 1M62A 4WNKA 4TV8E 2LSIA 3UUXB 3G06A 3P8CD 2XASB 3CQXC 2W67A 1MMAA 5L3DB 2UUAT 3P4QA 3UFEA 4DV6T 3ZT6A 2KWHA 4LMKA 3ETUA 4OHFA 3JC6C 2V5DA 5L3FB 1E7PA 2ZMAA 3AA6B 1D1AA 4YJ3E 5LMUT 3O1JA 5F3JA 2E5LT 4X62T 2JQHA 1VCTA 4ZI3D 2ZM6T 3DP7A 4PK4A 2ZM2A 3ZN1B 3PU8A 4IIJE 2CXLA 2RA1A 3VR8A 4AKLA 2A9UA 3FXDB 2JPFA 3AEGA 2VVNA 4TUYE 2KSRA 4TX5A 4UVCB 3CMLA 3H3AA 4YFSA 2J4GA 4QH1A 2LHNA 3PURA 2MBGA 2K24A 3C50A 1HNWT 4QHOA 4KHZF 2UUCT 2A3DA 4JYAT 2E9XD 2G0UA 4WYVA 5FXWA 2HHHT 4JI4T 2NTYA 2J62A 4LMLA 4P0BA 4I0UA 2EHOB 1HG5A 4IL4A 4ILAA 4IL9A 3PUXF 1ZKEA 4LF6T 3ZMSB 2L9QA 4IE0A 1J5ET 1IBLT 4U3CA 4G63A 1UCUA 2KMFA 2K48A 3E0ZA 4HFCA 2W66A 3EABA 2LSYA 4PJLA 5AQMB 3EI0A 2P9BA 4UF0A 3SWHA 3A5XA 3HR0A 1YQ3A 2E9XA 4DR5T 3C4XA 3VHLA 1WFDA 3B5MA 2SPCA 5KXJA 3UTKA 4DMWA 4X1IE 3NVOA 4HWIB 4EXTA 5FY0A 2VL8A 2CLYB 2YINA 4NIQA 4XBFB 2D9DA 2WB5A 2XQAA 4DV7T 3BQLA 3RIUC 3Q5EA 4MHCA 3P4RA 1WCRA 2DHRA 4K0UA 1AJ3A 5J2UE 4PK5A 1HTJF 5JDGA 2KT9A 3RGLA 2A72A 2XQ4A 2N1GA 3KVBA 3CVRA 3JADA 3RIAA 1KF6A 4CI1B 1V9DA 3J9X1 3ABVA 1OWAA 3O1HA 4TZ4C 2EHOC 1D0YA 5CA1E 1WYBA 1CUNA 4DNDA 2FJAA 3RKOA 3RPUA 2Q9QD 1FJGT 2WWVA 4NXNT 1XNQT 2XM1A 3FB2A 3AXJA 4ZEYA 4X1YE 2VB6A 4UIGA 2WP9A 1MMGA 2LT3A 4ILUA 2OLTA 4JUYA 1ZOYA 2CXDA 4DV3T 4YJ2E 4ZI7E 4DUZT 3CX8B 2CCQA 4H63H 2KXPB 1IAPA 4EYUA 4ZI2D 4IDPA 4DR2T 4LF4T 3NZQA 4B3MT 3CK6A 2H3RA 3C98B 2XAFB 1R8IA 2V6YB 1ZEEA 4YY3T 3JAFA 2XQYA 4TN7B 2CXFA 4OFZA 3X1DA 4TV9E 3AE4A 3DTOA 4HWHA 1YKEB 3ANWB 4DR7T 1EZ3A 4ZXLA 5JTGA 4HFDA 4ERRA 5CA0E 4NPPA 3LFMA 1HFAA 4I50E 3ZT5A 2V7MA 5JRCA 2XZEA 2NW8A 5LGNB 3QUJA 2CE7A 4YSXA 4X65T 4GKJT 3ZMUB 4AISA 3ZN0B 3RQUA 3TLTA 1E1HB 4QH5A 1DU2A 4HFEA 3SS1A 3PUAA 4U7IA 5LGUB 4OK0A 1J1JA 2HN2A 1FMWA 2IC6A 5LHGB 3HKEE 4EOZB 2V8SV 2XAJB 4B3TT 2D5UA 4IT4A 4AKGA 5AQQB 3RRWA 4LFCT 4HWFA 4XAXB 3AE9A 5FXVA 1MIYA 3N2OA 4LFAT 5FKYA 4NUUA 2IHR1 4J2CA 2KLQA 4AQGA 5AQSB 2X67A 5A1LA 4H9RC 2L3LA 4LF9T 5HAXA 4A97A 2WU5A 4EYYR 2IDOB 1W0BA 1W09A 2FJDA 5C8YE 3SFDA 4OYKA 5HEGA 4YHJA 4GK5E 3AEEA 2XQ3A 4LMJA 5F8PA 5AQGB 3UU6A 2BKNA 5J2TE 3HKDE 4PFPA 3ETVA 2VVSA 4U33A 3CX7B 2KZ7B 1JNZA 3GMIA 1NWMX 3BQIA 3PUZF 4UEMA 3ZMZB 2FBWA 3WAJA 4EB6E 4QXBB 2YEVC 5HYAA 3GN5A 3DJBA 4ZZCA 3CIRA 4H9SE 1ZHCA 4XZCA 5CB4E 4U2ZA 3LK2B 4L5GA 2V26A 5FXXA 2DWKA 3UU3A 4ADZA 3AECA 1G73A 4HFVA 3ZCIA 4F6RC 2XY8B 4O4HE 3UUMA 3RHWA 1XWMA 3ZC1A 4IGUA 3ZYMA 1JNRA 3HL6A 2DCFA 2N9DA 3D0TA 2PJQA 2CEAA 3C4ZA 4ZHQE 5HEHA 2Q9QB 3T8OA 1YD8G 3GWHA 4N78D 3AEDA 4BJMA 2CHNA 3BQKA 1FIOA 2Y48B 2LSJA 2BBHA 2R6GF 3IEEA 3AA0B 4HFBA 1T98A 1HR0T 3C64A 5LP6E 2C0SA 3CKDA 3ZPOA 2C5KT 4MLKA 3AE6A 3QB5A 4LF7T 3LJCA 3A7MA 2CPTA 4YHHT 4IHJE 3ZYLA 3TLWA 2I0MA 1H7CA 3MXZA 4X64T 4U31A 5JDQA 5JR9A 2VURA 5FVLA 4YT0A 2WQYA 2H89A 3ZT7A 5HXCA 5BMVE 2UU9T 5AQHB 5F5WA 5FXZA 4A5XA 2L8KA 5IHYA 5LCYA 3OVUA 4AQYT 2H7OA 1S35A 4CI3B 3R84B 2LSGA 3RYCE 1B7TA 5LBMA 2CRBA 5CFBA 5HWYA 4TWFA 4E7ZA 3U3IA 3IA3A 4CN4A 4HWDA 2B76A 3ZYKA 5KMGP 4ZI2C 2W0GA 3IF8B 2KNDA 1FEWA 5J1GA 1XDOA 4OX9T 1XZYA 2NP9A 3VR9A 1N36T 4TNWA 3R6NA 1I94T 4AXPA 1FMVA 1W0AA 5KDMC 3AE1A 3K8PC 3KDSE 1XMQT 2WZIA 1HX8A 4QKNA 1UK5A
chains in the Genus database with same CATH topology
4PAGA 3EUHA 4H9NC 2V7IA 3RRCA 4DBRA 3ZEFB 3FBLA 4UELA 3FB2A 1WRDA 3I0OA 4PJNA 5HXHA 1X79A 2HH7A 4X1YE 3HI2A 3H37A 4UVBB 2DNXA 5TAOA 1S94A 2VKJA 2QGSA 2VB6A 3SOLA 4UIGA 1MMGA 2LT3A 2ACXA 1VRBA 3N9PA 2XUEA 4ILUA 4KBMB 3RYFE 4PNIA 3OBVE 5JRCB 4JUYA 2H7VC 3LK3B 4G2AA 3VU7H 2CWYA 3WI3A 2CXDA 3P7IA 2UXXB 5LA6E 3O4XE 4L9IA 4ZS2A 5AFUL 4YJ2E 4ZI7E 2W61A 4EIWA 4M1PA 3CX8B 3EVYA 2CCQA 3M65A 3Q2MA 2BVMA 4H63H 4C91A 1MMNA 1D0XA 3AAIA 2KXPB 4H9PC 1IAPA 2NOXA 3ZLIA 4EYUA 4ZI2D 2OA5A 5JDHA 3N9MA 4B6XA 3O9XA 1ZV4X 3K3NA 2KWIB 2ODVA 5GONE 2ZLYA 3FHNA 3PUGA 5LBQB 4HKAA 2N2NA 5JVDE 4V1Av 2X9WA 5FMNA 3NZQA 3WAKA 3PU3A 1QSDA 4ISSA 4MALA 4O8SA 4AKRB 3HA4A 5L2LA 2RP4A 4JEUB 5ADXL 1D1CA 2JJ9A 1D1BA 1HG2A 3FXEB 4WBNE 4GYRA 2H3RA 5JQGE 3C98B 4AQFA 2XAFB 1HF8A 2D0TA 2KINB 4WBOA 1ZEEA 4CQIA 2WMOA 5L3EB 3RC3A 4DO0A 4ANJA 4P09A 3IHRA 5M4YA 2XQYA 1VOMA 3K3OA 3KINB 3NRXA 4TN7B 2CXFA 4OFZA 4OYJA 4H9QC 4TV9E 4O4IE 3PUQA 2Q9QC 3B13A 1WR6A 3DTOA 2BVLA 2WAUA 2CA5A 1YKEB 3ANWB 4IE5A 4AQFC 1EZ3A 3N2KE 4QXHB 2LM9A 2YU1A 3MACA 4ERRA 5CA0E 2LOPA 3LFMA 5ETWA 2VASA 1HFAA 4I50E 5HWXA 2V7MA 3V5SA 5JRCA 2XAHB 2NW8A 1MIWA 4X20E 2K5BB 4KP3C 5LGNB 3QUJA 4H9OC 3ZJ2A 1Y64B 3MKDA 3E08A 2CE7A 2LSKA 3AA1B 3EDVA 4HN9A 5DABA 2C5JA 4BAYB 3ZMUB 2PG8A 4HTEA 3FBZA 5FY7A 3ZN0B 4CXXA 5L3CB 2V1DB 1IZNB 4GK0E 4GIWA 2X0LB 3ESLA 2DLRA 2YK0A 3QC9A 5L3BB 1E1HB 5H6QB 2W63A 3Q5XA 3I1AA 1HCIA 4IE7A 3SS1A 3PUAA 4UXNB 2IC9A 3CQCB 2JQQA 5LGUB 4AI6A 5JR9B 4HE8A 4OK0A 3GA8A 2VKDA 3N2GE 1FMWA 2IC6A 3KV9A 5LHGB 3N9LA 2VWAA 3HKEE 3NRYA 4EOZB 2CM0A 3HKCE 2XAJB 4GYSA 4DBQA 2D5UA 2Y6XA 3MZKB 4AKGA 2WBLA 3GN5B 3RRWA 5LXTE 2VK9A 2X9YA 3KVAA 4XAXB 4PW8A 5FXVA 1QUUA 4P0AA 3ANWA 1MIYA 3N2OA 1BR2A 4ISTA 3JC6D 2D2SA 3NZPA 2IAKA 2CMRA 4NUUA 5JDNA 4QX7B 1UX4A 4KUMB 3OYZA 2GK9A 4J2CA 3K3QC 5LJNA 4BA9A 1US7B 3HKBE 2KLQA 3L09A 1O3XA 2PFVA 3Q5WA 2LJLA 3O1IA 3UUNA 4AQGA 2X67A 1U5PA 4ZOLE 3AVSA 4H9RC 4DVDA 5A1LA 2L3LA 3QK6A 4AKHA 4A56A 5HAXA 4EYYR 3B57A 2X51A 3PE0A 2WMNA 3LK42 3V5UA 4PK6A 4H63V 1KK7A 2J1DG 3LBXB 2M67A 1IJ6A 4UV8B 1NAFA 5C8YE 5FYMA 4OYKA 2CWOA 3MJXA 4PJMA 5FY1A 4YHJA 4GK5E 5KX5E 3RC8A 3KV4A 2CLYC 2DI4A 2ZM0A 1MIVA 1Z0PA 3I9YA 3OYXA 5F8PA 3C51A 5J2TE 3OJAA 1SA0E 3F2EA 3HKDE 1UX5A 4C90A 4PFPA 2UXNB 4ASKA 3ETVA 4JLEA 4WNKA 4TV8E 2MTQA 2LSIA 4QX8B 3TKLB 3UUXB 4EZ4A 3P8CD 3CX7B 2I59A 2VKHA 2XASB 3CQXC 2KZ7B 3GMIA 4ZS3A 5L3GB 4IE6A 1NWMX 2JMHA 2VKOA 3BQIA 4GOUA 4MFRA 4UEMA 5DQWA 5H6RB 3ZMZB 3WAJA 3KFWX 1MMAA 5L3DB 4MBQA 4EB6E 4QXBB 4Z8XA 2YEVC 3UFEA 1LRZA 3N9QA 5HYAA 3GN5A 2KWHA 5FP3A 3ETUA 4I4TE 3DJBA 2Z6EA 4OHFA 3MA9A 3KBTA 4H9SE 1ZHCA 1BR0A 4O2BE 4XZCA 3Q9DA 5CB4E 5LGTB 3ZC0A 3JC6C 3LK2B 4L5GA 3NBXX 2V26A 1SHZC 5FXXA 2DWKA 4ADZA 3I0QA 5L3FB 1G73A 4HFVA 3ZCIA 4F6RC 2V7LA 2BDEA 3ONXA 1LVFA 4CXWA 2ZMAA 3AA6B 3CQGB 4O4HE 4IDZA 3UUMA 4CXYA 1D1AA 3LBXA 1LVKA 5JH7E 4YJ3E 4E7SA 2MOZA 3O1JA 5F3JA 2JMKA 3ZC1A 5EK3A 4CI2B 4IGUA 3ZYMA 1WLXA 3AAEB 4PJJA 5DJQC 4ZI3D 3DP7A 2K9AA 4PK4A 2ZM2A 3HL6A 2DCFA 2N9DA 2JRKA 3D0TA 3ZN1B 5JDLA 2PJQA 3PU8A 2CEAA 2B1EA 2MYSA 3C4ZA 4ZHQE 4DMVA 2Q9QB 2CXLA 2RA1A 4IIJE 2LOSA 1YD8G 3T8OA 4AKLA 3FXDB 3PUSA 3RH3A 3GWHA 2XAGB 4N78D 1HS7A 2JPFA 2X66A 2ODUA 3ZJ1A 4BJMA 1G8XA 1WYCA 3BQKA 5LYJE 1FIOA 4TUYE 2DWGA 4TX5A 4UVCB 3CMLA 2Y48B 3UT5E 2LSJA 3H3AA 4YFSA 3IEEA 1BR1A 3AA0B 4UF0B 2LHNA 1D0ZA 5JREA 1YKHB 2C5IT 3PURA 1LKXA 1T98A 2MBGA 2K24A 2E9XB 2LEHA 5FNVE 5JDFA 5LG4A 2XTLA 3AAAB 3C50A 3ZCJA 3C64A 5LJMA 3I9WA 3CX6B 5LP6E 2C0SA 4QHOA 3VKHA 4BJNA 2NTXA 2WWUA 3CKDA 2HPJA 3ZPOA 3N9NA 2C5KT 3OKQA 2A3DA 4MLKA 2PBIA 5LOVE 3C4WA 4EZHA 2E9XD 4X1KE 3SRZA 2G0UA 3F57A 4I43B 5FXWA 3LJCA 3L3PA 2NTYA 4FJOA 3RYIE 3BK9A 4IHJE 3ZYLA 4P0BA 3VKGA 2EHOB 3EDUA 2QA7A 3CWZB 1H7CA 3AB3B 2W00A 1HG5A 2WSSV 3MXZA 4UVAB 5HXSA 4AKIA 5JDQA 2LE8A 4QXCB 1ZKEA 4QWNB 3ZMSB 4ZI3C 5JR9A 3ZMTB 2L9QA 4IE0A 3J7Yq 3AA7B 2W62A 4PFOA 2IW5B 4G63A 2NW7A 2V7KA 5HXCA 1UCUA 1IJ5A 2KMFA 5BMVE 2K48A 2WM9A 3E0ZA 2V7JA 2Q9QA 2EHOD 5IYZE 4U74A 4NUVA 3KBUA 2A2FX 5FXZA 2LSYA 4PJLA 2BZBA 2HPLA 4UV9B 4L0RA 3E22E 3KV5A 3U78A 5JR9C 1YW0A 2L8KA 5IHYA 5LCYA 5DQVA 4FI5A 2H7OA 1S35A 2P9BA 2X9XA 3PDYA 4KMCA 4UF0A 4WW0A 4O4LE 3SWHA 4CI3B 3A5XA 4EAHA 3HR0A 3R84B 2LSGA 2LHRA 3RYCE 5EK2A 2NWBA 2E9XA 2X68A 4YLHA 1B7TA 5JDMA 3C4XA 5LBMA 3VHLA 3UULA 5HXRA 2NW9A 3CPZA 2D0UA 2SPCA 2ZM8A 4HEAA 3UTKA 4DMWA 4X1IE 2E8IA 3RX6A 4I55E 4EXTA 3S4UA 5FY0A 5HWYA 2VL8A 5LNKA 2CLYB 2YINA 3N9OA 4XBFB 5HXEA 4E7ZA 3U3IA 3PTRB 1MMDA 1MNEA 4O2AE 3F31A 2E9XC 3BQLA 2XHEB 3MK7C 1BR4A 4MHCA 1MNDA 4U72A 2DHRA 4K0UA 2EHOA 3ZMVB 1KNZA 1AJ3A 3ZYKA 2ES0A 5J2UE 5LHHB 5KMGP 4PK5A 2YU2A 4ZI2C 3N5LA 2Y8DA 4CZZB 2W0GA 3KV6A 1OXZA 3IF8B 2KNDA 1HTJF 1FEWA 5EZYE 5J1GA 5JDGA 2KT9A 4IE4A 2A72A 2N1GA 2NP9A 3KVBA 5LHIB 3CVRA 4CI1B 1V9DA 3LG7A 3J9X1 4O4JE 1OWAA 2XAQB 3O1HA 3R6NA 4AXPA 4JEHB 4TZ4C 1FMVA 3W15B 5KDMC 2EHOC 3RYHE 1D0YA 5CA1E 3IBPA 3K8PC 3KDSE 1WYBA 1CUNA 4DNDA 3AVRA 2X9HA 5EK4A 3RKOA 1U4QA 4HGAA 1HX8A 4QKNA 3RPUA 2Q9QD 5E0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1D G;  1UX5 A;  3O4X E;  4EAH A;  1Y64 B;  1UX4 A;  1V9D A;  3OBV E;  2Z6E A; 
#chains in the Genus database with same CATH topology
 3RRC A;  4EV6 A;  2BG9 A;  3ZEF B;  4PJN A;  2HH7 A;  3HI2 A;  1GQE A;  3SOL A;  2XQ7 A;  2X0Y A;  4KBM B;  4PNI A;  3OBV E;  1N32 T;  2H7V C;  4IDO A;  3O4X E;  4L9I A;  4M1P A;  3M65 A;  5BR8 T;  4C91 A;  2WY2 A;  2JQ9 A;  4H9P C;  5JDH A;  2WS3 A;  4B6X A;  1ZV4 X;  2XQ9 A;  5GON E;  3FHN A;  3UQ7 A;  4Q25 A;  3NKZ A;  2N2N A;  5JVD E;  4V1A v;  3P4S A;  2J47 A;  2AE9 A;  3WAK A;  1QSD A;  2W4X A;  4MAL A;  4O8S A;  2RP4 A;  2WDR A;  1KNR A;  2CBJ A;  3FXE B;  2E2A A;  5JQG E;  5ABG A;  4WBO A;  4CQI A;  4ANJ A;  3IHR A;  3KIN B;  3NRX A;  4O4I E;  1N33 T;  1WR6 A;  2CA5 A;  2H88 A;  4AQF C;  2X0H A;  4QXH B;  2LM9 A;  2YU1 A;  3MAC A;  2XQ5 A;  2LOP A;  4U2Y A;  5HWX A;  4TNV A;  3V5S A;  1X9B A;  2HN1 A;  2UXC T;  1MIW A;  4X20 E;  4HN9 A;  4K0K T;  3T1Y T;  5FY7 A;  5L3C B;  1IZN B;  3ESL A;  2YK0 A;  5ABF B;  2YKS A;  4IDN A;  3UFG A;  2JQQ A;  4JI6 T;  5AQI B;  4AI6 A;  5JR9 B;  4GKK T;  2VKD A;  3N9L A;  3NRY A;  4DBQ A;  2M6B A;  3MZK B;  2IUB A;  4ILB A;  1QLB A;  3KVA A;  4PW8 A;  3PUV F;  1BR2 A;  3FZK B;  3JC6 D;  2D2S A;  2YDS A;  5JDN A;  4QX7 B;  1UX4 A;  3OYZ A;  3HKB E;  2PFV A;  1OED A;  4AKH A;  1U5P A;  5AQR B;  3UU5 A;  3PE0 A;  2IML A;  4PK6 A;  2JQK A;  4UV8 B;  1NAF A;  2UXD T;  5FYM A;  5FL1 A;  2VQF T;  3KV4 A;  2CLY C;  2DI4 A;  1MIV A;  1Z0P A;  3I9Y A;  2K3W A;  3VRA A;  4CN6 A;  1WR0 A;  2I59 A;  4ZS3 A;  4IE6 A;  4GOU A;  4MFR A;  5H6R B;  5AQV B;  4JI0 T;  3LDQ B;  2XPK A;  4I4T E;  3NWI A;  2Z6E A;  3MA9 A;  3KBT A;  1BR0 A;  2BS4 A;  4O2B E;  5LGT B;  3NBX X;  5C3J A;  3I0Q A;  3RLF F;  3P4W A;  3LBX A;  5JH7 E;  4E7S A;  2MOZ A;  2JMK A;  4DR4 T;  5EK3 A;  3AAE B;  4PJJ A;  2K9A A;  2JRK A;  3RIF A;  2XM2 A;  2MYS A;  1E2A A;  2LOS A;  1KEY A;  3RH3 A;  2BG9 E;  2ODU A;  2X66 A;  3ZJ1 A;  1WYC A;  5LYJ E;  2F4V T;  4UF0 B;  1D0Z A;  2C5I T;  5AQP B;  1LKX A;  1HNZ T;  4YTN A;  2E9X B;  2LEH A;  5FNV E;  5JDF A;  5LG4 A;  3AAA B;  3ZCJ A;  3I9W A;  3CX6 B;  1I6Z A;  3SFE A;  4BJN A;  4Z90 A;  3OKQ A;  2PBI A;  2BS3 A;  3C4W A;  4EZH A;  4X1K E;  4I43 B;  3A8Y C;  4FJO A;  3VKG A;  3EDU A;  2QA7 A;  2W00 A;  2WSS V;  4AKI A;  4UVA B;  2WU2 A;  4LF8 T;  4JV5 T;  4ZI3 C;  4X66 T;  3J7Y q;  3AA7 B;  4PFO A;  3PUY F;  2IW5 B;  2NW7 A;  2JIW A;  2WM9 A;  2VL0 A;  2EHO D;  3AEF A;  2BZB A;  2HPL A;  2E5V A;  4UV9 B;  4L0R A;  5HEO A;  3E22 E;  4JI2 T;  5DQV A;  4FI5 A;  4KMC A;  4WW0 A;  3AXJ B;  4EAH A;  2RPA A;  1NEN A;  5EK2 A;  5AQK B;  3RIU A;  2ACZ A;  2NW9 A;  3CPZ A;  2D0U A;  4HEA A;  4P1N A;  1W9R A;  2E8I A;  2LLY A;  4I55 E;  4WZX A;  4TWD A;  2QRX A;  1OED B;  2VQE T;  3PTR B;  4O2A E;  2E9X C;  2XHE B;  3H3M A;  2EHO A;  5AQN B;  5LHH B;  2YU2 A;  3ONJ A;  3UU8 A;  2Y8D A;  4CZZ B;  1OXZ A;  3K1S A;  2W2U A;  2LKG A;  5LHI B;  2MPK A;  1VCS A;  3LG7 A;  4JEH B;  3W15 B;  3RYH E;  3AVR A;  5L47 A;  4HGA A;  5E0O A;  4PAG A;  3EUH A;  3P50 A;  3FBL A;  1WRD A;  5HXH A;  1X79 A;  3H37 A;  1OED E;  2DNX A;  4UVB B;  1S94 A;  2BKO A;  2QGS A;  2NR4 A;  5JRC B;  3PJA J;  4G2A A;  3WI3 A;  2CWY A;  3P7I A;  5LA6 E;  4ZS2 A;  5AFU L;  3ZKR A;  4EIW A;  3AE2 A;  3EVY A;  3Q2M A;  1MMN A;  1D0X A;  3FZM B;  3ZLI A;  2OA5 A;  3N9M A;  5ABH A;  3O9X A;  2KWI B;  2ZLY A;  3PUG A;  4B3R T;  2YOE A;  3PV0 F;  4HKA A;  1ZP0 A;  5AQU B;  4AKR B;  5HEU A;  1M7K A;  3HA4 A;  3FZF B;  5ADX L;  4KI0 F;  1D1C A;  2JJ9 A;  4F8H A;  4UR9 A;  1HF8 A;  3RKG A;  4IDQ A;  4CN1 A;  4TWH A;  3RC3 A;  4DO0 A;  4P09 A;  5M4Y A;  1VOM A;  4OYJ A;  2Q9Q C;  2QYW A;  3B13 A;  1T8B A;  2BVL A;  2LRL A;  4IE5 A;  3N2K E;  2YDR A;  3QOF A;  2IIU A;  4DV5 T;  5IWA T;  5LMN T;  2K5B B;  4KP3 C;  3UUB A;  3MKD A;  3LSV A;  1XDP A;  3AA1 B;  5DAB A;  4HTE A;  4CXX A;  2V1D B;  4GK0 E;  4GIW A;  2X0L B;  2DLR A;  3QC9 A;  5L3B B;  5HEJ A;  5H6Q B;  1CHU A;  5FL0 A;  2W63 A;  2UUB T;  1Z8U A;  4IE7 A;  4UXN B;  2FJE A;  2IC9 A;  5L4E A;  4HE8 A;  2V6Y A;  2VWA A;  2CM0 A;  4GYS A;  5C2T A;  2WBL A;  4JBW F;  3GN5 B;  2VK9 A;  2XJ7 A;  2LKH A;  2X9Y A;  4KHP T;  5J0Z A;  4LFB T;  4A98 A;  3ANW A;  3UU4 A;  4IRE A;  4DR3 T;  2CBI A;  3NZP A;  5LJN A;  2GK9 A;  4BA9 A;  1US7 B;  3ZSS A;  3L09 A;  3AEA A;  3O1I A;  3UUN A;  3AVS A;  4YTP A;  4A56 A;  2X51 A;  3V5U A;  1J5W A;  4H63 V;  1KK7 A;  2OV9 A;  1IJ6 A;  5LG3 A;  2CWO A;  2XSA A;  3MJX A;  2LRK A;  1IBM T;  3RC8 A;  3OYX A;  4YSY A;  3C51 A;  2PTF A;  3F2E A;  1UGO A;  2UXN B;  2MTQ A;  4QX8 B;  3TKL B;  1IBK T;  2CHO A;  4EZ4 A;  2VKH A;  5L3G B;  2JMH A;  2VKO A;  5DQW A;  3KFW X;  4MBQ A;  4Z8X A;  4EEB A;  1LRZ A;  3N9Q A;  5FP3 A;  3Q9D A;  4COF A;  3ZC0 A;  3VRB A;  1HX1 B;  1SHZ C;  5HCJ A;  5IUX A;  3RQW A;  2V7L A;  2BDE A;  3ONX A;  1LVF A;  4CXW A;  3CQG B;  2XQ8 A;  4IDZ A;  4CXY A;  1LVK A;  1SE7 A;  4KX6 A;  2DL1 A;  4CI2 B;  1WLX A;  5DJQ C;  2MAW A;  2BKP A;  5FVK A;  5JDL A;  2B1E A;  4DMV A;  4DV4 T;  3PUS A;  2XAG B;  1HS7 A;  3PJA A;  1G8X A;  2DWG A;  3UT5 E;  1BR1 A;  2V6X A;  3PUW F;  5JRE A;  1YKH B;  2XTL A;  5LJM A;  3TLV A;  2I6H A;  1YXR A;  1KNP A;  3VKH A;  2WDV A;  2NTX A;  2WWU A;  1YQ4 A;  2HPJ A;  3N9N A;  5LOV E;  4YTM A;  3SRZ A;  3M3Z B;  3F57 A;  5LB7 B;  3L3P A;  4EED A;  3RYI E;  3BK9 A;  4DV1 T;  3CWZ B;  3AB3 B;  5HXS A;  1SUM B;  3FZH B;  2LE8 A;  4QXC B;  4QWN B;  3ZMT B;  4DID B;  2W62 A;  2V7K A;  1IJ5 A;  1Y01 A;  3OTO T;  2V7J A;  2Q9Q A;  5IYZ E;  1N34 T;  4U74 A;  4NUV A;  4QH4 A;  3KBU A;  2A2F X;  3QNU A;  5L4H A;  3KV5 A;  3U78 A;  5JR9 C;  3FZL B;  1YW0 A;  1T7S A;  2XQ6 A;  2BG9 B;  3AE5 A;  2X9X A;  3PDY A;  4O4L E;  2LHR A;  2NWB A;  2X68 A;  4YLH A;  5JDM A;  4DR1 T;  3UUL A;  5HXR A;  2YDQ A;  4JI7 T;  2ZM8 A;  3RX6 A;  4U7Y A;  3S4U A;  2WZH A;  5LNK A;  3N9O A;  5HXE A;  4LF5 T;  4JI5 T;  1MMD A;  1MNE A;  3F31 A;  3MK7 C;  1BR4 A;  3RF1 A;  1MND A;  4U72 A;  3ZMV B;  1KNZ A;  2ES0 A;  5AQL B;  1T72 A;  3N5L A;  3KV6 A;  5EZY E;  4DV0 T;  3RI5 A;  5AQJ B;  4IE4 A;  3QB5 K;  3ZST A;  4O4J E;  2XAQ B;  3OPC A;  2FJB A;  3Q5D A;  3IBP A;  5HCM A;  2X9H A;  2YN6 A;  3UQ4 A;  5EK4 A;  1U4Q A;  2BS2 A;  5ABE A;  4H9N C;  2V7I A;  4DBR A;  4UEL A;  3I0O A;  5AQF B;  5TAO A;  2LM2 A;  2VKJ A;  5AQO B;  3AE7 A;  3N9P A;  2ACX A;  1VRB A;  3RYF E;  2XUE A;  3VU7 H;  3LK3 B;  2UXX B;  2W61 A;  2BG9 C;  5CJ5 A;  2BVM A;  3AAI A;  4JI1 T;  2NOX A;  3K3N A;  2ODV A;  3ONL C;  2WDQ A;  4JI8 T;  5LBQ B;  1UUR A;  4YXD A;  4ZZB A;  2X9W A;  5FMN A;  3PU3 A;  4ISS A;  5L2L A;  4JEU B;  3TLU A;  4DV2 T;  5AQT B;  1D1B A;  1HG2 A;  4WBN E;  4GYR A;  4AQF A;  2D0T A;  2KIN B;  2XSB A;  2WMO A;  5L3E B;  1NEK A;  3JCF A;  3K3O A;  1HNX T;  3L39 A;  4H9Q C;  3PUQ A;  2WAU A;  2M6I A;  3JAE A;  2WCA A;  1KFY A;  3EAM A;  5ETW A;  2VAS A;  2XAH B;  4H9O C;  4X5T A;  3ZJ2 A;  1Y64 B;  3E08 A;  2LSK A;  3EDV A;  2C5J A;  4HFI A;  4BAY B;  2PG8 A;  3FBZ A;  3T1H T;  2UXB T;  3EHZ A;  1XMO T;  3Q5X A;  4HFH A;  3I1A A;  1HCI A;  3CQC B;  2BBJ A;  3P4P A;  3AEB A;  4Z91 A;  3GA8 A;  4ILC A;  3N2G E;  4NXM T;  3KV9 A;  4DUY T;  3HKC E;  3AE3 A;  1XNR T;  2Y6X A;  2V5C A;  3AE8 A;  5LXT E;  1QUU A;  4P0A A;  4HWC A;  5CGM A;  2AXD S;  3L8R A;  4IST A;  2IAK A;  2CMR A;  4KUM B;  4EGW A;  3K3Q C;  2QVA A;  4B3S T;  1L0V A;  1O3X A;  3Q5W A;  2LJL A;  4ZOL E;  4DVD A;  4YSZ A;  3QK6 A;  3B57 A;  3TLS A;  4JI3 T;  2WMN A;  2FUP A;  3LK4 2;  2J1D G;  3LBX B;  2M67 A;  4AIU A;  4DR6 T;  4PJM A;  5FY1 A;  5KX5 E;  1OED C;  2ZM0 A;  5ABF A;  1UUS A;  3OJA A;  1SA0 E;  1UX5 A;  4C90 A;  4ASK A;  4JLE A;  1M62 A;  4WNK A;  4TV8 E;  2LSI A;  3UUX B;  3G06 A;  3P8C D;  2XAS B;  3CQX C;  2W67 A;  1MMA A;  5L3D B;  2UUA T;  3P4Q A;  3UFE A;  4DV6 T;  3ZT6 A;  2KWH A;  4LMK A;  3ETU A;  4OHF A;  3JC6 C;  2V5D A;  5L3F B;  1E7P A;  2ZMA A;  3AA6 B;  1D1A A;  4YJ3 E;  5LMU T;  3O1J A;  5F3J A;  2E5L T;  4X62 T;  2JQH A;  1VCT A;  4ZI3 D;  2ZM6 T;  3DP7 A;  4PK4 A;  2ZM2 A;  3ZN1 B;  3PU8 A;  4IIJ E;  2CXL A;  2RA1 A;  3VR8 A;  4AKL A;  2A9U A;  3FXD B;  2JPF A;  3AEG A;  2VVN A;  4TUY E;  2KSR A;  4TX5 A;  4UVC B;  3CML A;  3H3A A;  4YFS A;  2J4G A;  4QH1 A;  2LHN A;  3PUR A;  2MBG A;  2K24 A;  3C50 A;  1HNW T;  4QHO A;  4KHZ F;  2UUC T;  2A3D A;  4JYA T;  2E9X D;  2G0U A;  4WYV A;  5FXW A;  2HHH T;  4JI4 T;  2NTY A;  2J62 A;  4LML A;  4P0B A;  4I0U A;  2EHO B;  1HG5 A;  4IL4 A;  4ILA A;  4IL9 A;  3PUX F;  1ZKE A;  4LF6 T;  3ZMS B;  2L9Q A;  4IE0 A;  1J5E T;  1IBL T;  4U3C A;  4G63 A;  1UCU A;  2KMF A;  2K48 A;  3E0Z A;  4HFC A;  2W66 A;  3EAB A;  2LSY A;  4PJL A;  5AQM B;  3EI0 A;  2P9B A;  4UF0 A;  3SWH A;  3A5X A;  3HR0 A;  1YQ3 A;  2E9X A;  4DR5 T;  3C4X A;  3VHL A;  1WFD A;  3B5M A;  2SPC A;  5KXJ A;  3UTK A;  4DMW A;  4X1I E;  3NVO A;  4HWI B;  4EXT A;  5FY0 A;  2VL8 A;  2CLY B;  2YIN A;  4NIQ A;  4XBF B;  2D9D A;  2WB5 A;  2XQA A;  4DV7 T;  3BQL A;  3RIU C;  3Q5E A;  4MHC A;  3P4R A;  1WCR A;  2DHR A;  4K0U A;  1AJ3 A;  5J2U E;  4PK5 A;  1HTJ F;  5JDG A;  2KT9 A;  3RGL A;  2A72 A;  2XQ4 A;  2N1G A;  3KVB A;  3CVR A;  3JAD A;  3RIA A;  1KF6 A;  4CI1 B;  1V9D A;  3J9X 1;  3ABV A;  1OWA A;  3O1H A;  4TZ4 C;  2EHO C;  1D0Y A;  5CA1 E;  1WYB A;  1CUN A;  4DND A;  2FJA A;  3RKO A;  3RPU A;  2Q9Q D;  1FJG T;  2WWV A;  4NXN T;  1XNQ T;  2XM1 A;  3FB2 A;  3AXJ A;  4ZEY A;  4X1Y E;  2VB6 A;  4UIG A;  2WP9 A;  1MMG A;  2LT3 A;  4ILU A;  2OLT A;  4JUY A;  1ZOY A;  2CXD A;  4DV3 T;  4YJ2 E;  4ZI7 E;  4DUZ T;  3CX8 B;  2CCQ A;  4H63 H;  2KXP B;  1IAP A;  4EYU A;  4ZI2 D;  4IDP A;  4DR2 T;  4LF4 T;  3NZQ A;  4B3M T;  3CK6 A;  2H3R A;  3C98 B;  2XAF B;  1R8I A;  2V6Y B;  1ZEE A;  4YY3 T;  3JAF A;  2XQY A;  4TN7 B;  2CXF A;  4OFZ A;  3X1D A;  4TV9 E;  3AE4 A;  3DTO A;  4HWH A;  1YKE B;  3ANW B;  4DR7 T;  1EZ3 A;  4ZXL A;  5JTG A;  4HFD A;  4ERR A;  5CA0 E;  4NPP A;  3LFM A;  1HFA A;  4I50 E;  3ZT5 A;  2V7M A;  5JRC A;  2XZE A;  2NW8 A;  5LGN B;  3QUJ A;  2CE7 A;  4YSX A;  4X65 T;  4GKJ T;  3ZMU B;  4AIS A;  3ZN0 B;  3RQU A;  3TLT A;  1E1H B;  4QH5 A;  1DU2 A;  4HFE A;  3SS1 A;  3PUA A;  4U7I A;  5LGU B;  4OK0 A;  1J1J A;  2HN2 A;  1FMW A;  2IC6 A;  5LHG B;  3HKE E;  4EOZ B;  2V8S V;  2XAJ B;  4B3T T;  2D5U A;  4IT4 A;  4AKG A;  5AQQ B;  3RRW A;  4LFC T;  4HWF A;  4XAX B;  3AE9 A;  5FXV A;  1MIY A;  3N2O A;  4LFA T;  5FKY A;  4NUU A;  2IHR 1;  4J2C A;  2KLQ A;  4AQG A;  5AQS B;  2X67 A;  5A1L A;  4H9R C;  2L3L A;  4LF9 T;  5HAX A;  4A97 A;  2WU5 A;  4EYY R;  2IDO B;  1W0B A;  1W09 A;  2FJD A;  5C8Y E;  3SFD A;  4OYK A;  5HEG A;  4YHJ A;  4GK5 E;  3AEE A;  2XQ3 A;  4LMJ A;  5F8P A;  5AQG B;  3UU6 A;  2BKN A;  5J2T E;  3HKD E;  4PFP A;  3ETV A;  2VVS A;  4U33 A;  3CX7 B;  2KZ7 B;  1JNZ A;  3GMI A;  1NWM X;  3BQI A;  3PUZ F;  4UEM A;  3ZMZ B;  2FBW A;  3WAJ A;  4EB6 E;  4QXB B;  2YEV C;  5HYA A;  3GN5 A;  3DJB A;  4ZZC A;  3CIR A;  4H9S E;  1ZHC A;  4XZC A;  5CB4 E;  4U2Z A;  3LK2 B;  4L5G A;  2V26 A;  5FXX A;  2DWK A;  3UU3 A;  4ADZ A;  3AEC A;  1G73 A;  4HFV A;  3ZCI A;  4F6R C;  2XY8 B;  4O4H E;  3UUM A;  3RHW A;  1XWM A;  3ZC1 A;  4IGU A;  3ZYM A;  1JNR A;  3HL6 A;  2DCF A;  2N9D A;  3D0T A;  2PJQ A;  2CEA A;  3C4Z A;  4ZHQ E;  5HEH A;  2Q9Q B;  3T8O A;  1YD8 G;  3GWH A;  4N78 D;  3AED A;  4BJM A;  2CHN A;  3BQK A;  1FIO A;  2Y48 B;  2LSJ A;  2BBH A;  2R6G F;  3IEE A;  3AA0 B;  4HFB A;  1T98 A;  1HR0 T;  3C64 A;  5LP6 E;  2C0S A;  3CKD A;  3ZPO A;  2C5K T;  4MLK A;  3AE6 A;  3QB5 A;  4LF7 T;  3LJC A;  3A7M A;  2CPT A;  4YHH T;  4IHJ E;  3ZYL A;  3TLW A;  2I0M A;  1H7C A;  3MXZ A;  4X64 T;  4U31 A;  5JDQ A;  5JR9 A;  2VUR A;  5FVL A;  4YT0 A;  2WQY A;  2H89 A;  3ZT7 A;  5HXC A;  5BMV E;  2UU9 T;  5AQH B;  5F5W A;  5FXZ A;  4A5X A;  2L8K A;  5IHY A;  5LCY A;  3OVU A;  4AQY T;  2H7O A;  1S35 A;  4CI3 B;  3R84 B;  2LSG A;  3RYC E;  1B7T A;  5LBM A;  2CRB A;  5CFB A;  5HWY A;  4TWF A;  4E7Z A;  3U3I A;  3IA3 A;  4CN4 A;  4HWD A;  2B76 A;  3ZYK A;  5KMG P;  4ZI2 C;  2W0G A;  3IF8 B;  2KND A;  1FEW A;  5J1G A;  1XDO A;  4OX9 T;  1XZY A;  2NP9 A;  3VR9 A;  1N36 T;  4TNW A;  3R6N A;  1I94 T;  4AXP A;  1FMV A;  1W0A A;  5KDM C;  3AE1 A;  3K8P C;  3KDS E;  1XMQ T;  2WZI A;  1HX8 A;  4QKN A;  1UK5 A; 
#chains in the Genus database with same CATH homology
 4PAG A;  3EUH A;  4H9N C;  2V7I A;  3RRC A;  4DBR A;  3ZEF B;  3FBL A;  4UEL A;  3FB2 A;  1WRD A;  3I0O A;  4PJN A;  5HXH A;  1X79 A;  2HH7 A;  4X1Y E;  3HI2 A;  3H37 A;  4UVB B;  2DNX A;  5TAO A;  1S94 A;  2VKJ A;  2QGS A;  2VB6 A;  3SOL A;  4UIG A;  1MMG A;  2LT3 A;  2ACX A;  1VRB A;  3N9P A;  2XUE A;  4ILU A;  4KBM B;  3RYF E;  4PNI A;  3OBV E;  5JRC B;  4JUY A;  2H7V C;  3LK3 B;  4G2A A;  3VU7 H;  2CWY A;  3WI3 A;  2CXD A;  3P7I A;  2UXX B;  5LA6 E;  3O4X E;  4L9I A;  4ZS2 A;  5AFU L;  4YJ2 E;  4ZI7 E;  2W61 A;  4EIW A;  4M1P A;  3CX8 B;  3EVY A;  2CCQ A;  3M65 A;  3Q2M A;  2BVM A;  4H63 H;  4C91 A;  1MMN A;  1D0X A;  3AAI A;  2KXP B;  4H9P C;  1IAP A;  2NOX A;  3ZLI A;  4EYU A;  4ZI2 D;  2OA5 A;  5JDH A;  3N9M A;  4B6X A;  3O9X A;  1ZV4 X;  3K3N A;  2KWI B;  2ODV A;  5GON E;  2ZLY A;  3FHN A;  3PUG A;  5LBQ B;  4HKA A;  2N2N A;  5JVD E;  4V1A v;  2X9W A;  5FMN A;  3NZQ A;  3WAK A;  3PU3 A;  1QSD A;  4ISS A;  4MAL A;  4O8S A;  4AKR B;  3HA4 A;  5L2L A;  2RP4 A;  4JEU B;  5ADX L;  1D1C A;  2JJ9 A;  1D1B A;  1HG2 A;  3FXE B;  4WBN E;  4GYR A;  2H3R A;  5JQG E;  3C98 B;  4AQF A;  2XAF B;  1HF8 A;  2D0T A;  2KIN B;  4WBO A;  1ZEE A;  4CQI A;  2WMO A;  5L3E B;  3RC3 A;  4DO0 A;  4ANJ A;  4P09 A;  3IHR A;  5M4Y A;  2XQY A;  1VOM A;  3K3O A;  3KIN B;  3NRX A;  4TN7 B;  2CXF A;  4OFZ A;  4OYJ A;  4H9Q C;  4TV9 E;  4O4I E;  3PUQ A;  2Q9Q C;  3B13 A;  1WR6 A;  3DTO A;  2BVL A;  2WAU A;  2CA5 A;  1YKE B;  3ANW B;  4IE5 A;  4AQF C;  1EZ3 A;  3N2K E;  4QXH B;  2LM9 A;  2YU1 A;  3MAC A;  4ERR A;  5CA0 E;  2LOP A;  3LFM A;  5ETW A;  2VAS A;  1HFA A;  4I50 E;  5HWX A;  2V7M A;  3V5S A;  5JRC A;  2XAH B;  2NW8 A;  1MIW A;  4X20 E;  2K5B B;  4KP3 C;  5LGN B;  3QUJ A;  4H9O C;  3ZJ2 A;  1Y64 B;  3MKD A;  3E08 A;  2CE7 A;  2LSK A;  3AA1 B;  3EDV A;  4HN9 A;  5DAB A;  2C5J A;  4BAY B;  3ZMU B;  2PG8 A;  4HTE A;  3FBZ A;  5FY7 A;  3ZN0 B;  4CXX A;  5L3C B;  2V1D B;  1IZN B;  4GK0 E;  4GIW A;  2X0L B;  3ESL A;  2DLR A;  2YK0 A;  3QC9 A;  5L3B B;  1E1H B;  5H6Q B;  2W63 A;  3Q5X A;  3I1A A;  1HCI A;  4IE7 A;  3SS1 A;  3PUA A;  4UXN B;  2IC9 A;  3CQC B;  2JQQ A;  5LGU B;  4AI6 A;  5JR9 B;  4HE8 A;  4OK0 A;  3GA8 A;  2VKD A;  3N2G E;  1FMW A;  2IC6 A;  3KV9 A;  5LHG B;  3N9L A;  2VWA A;  3HKE E;  3NRY A;  4EOZ B;  2CM0 A;  3HKC E;  2XAJ B;  4GYS A;  4DBQ A;  2D5U A;  2Y6X A;  3MZK B;  4AKG A;  2WBL A;  3GN5 B;  3RRW A;  5LXT E;  2VK9 A;  2X9Y A;  3KVA A;  4XAX B;  4PW8 A;  5FXV A;  1QUU A;  4P0A A;  3ANW A;  1MIY A;  3N2O A;  1BR2 A;  4IST A;  3JC6 D;  2D2S A;  3NZP A;  2IAK A;  2CMR A;  4NUU A;  5JDN A;  4QX7 B;  1UX4 A;  4KUM B;  3OYZ A;  2GK9 A;  4J2C A;  3K3Q C;  5LJN A;  4BA9 A;  1US7 B;  3HKB E;  2KLQ A;  3L09 A;  1O3X A;  2PFV A;  3Q5W A;  2LJL A;  3O1I A;  3UUN A;  4AQG A;  2X67 A;  1U5P A;  4ZOL E;  3AVS A;  4H9R C;  4DVD A;  5A1L A;  2L3L A;  3QK6 A;  4AKH A;  4A56 A;  5HAX A;  4EYY R;  3B57 A;  2X51 A;  3PE0 A;  2WMN A;  3LK4 2;  3V5U A;  4PK6 A;  4H63 V;  1KK7 A;  2J1D G;  3LBX B;  2M67 A;  1IJ6 A;  4UV8 B;  1NAF A;  5C8Y E;  5FYM A;  4OYK A;  2CWO A;  3MJX A;  4PJM A;  5FY1 A;  4YHJ A;  4GK5 E;  5KX5 E;  3RC8 A;  3KV4 A;  2CLY C;  2DI4 A;  2ZM0 A;  1MIV A;  1Z0P A;  3I9Y A;  3OYX A;  5F8P A;  3C51 A;  5J2T E;  3OJA A;  1SA0 E;  3F2E A;  3HKD E;  1UX5 A;  4C90 A;  4PFP A;  2UXN B;  4ASK A;  3ETV A;  4JLE A;  4WNK A;  4TV8 E;  2MTQ A;  2LSI A;  4QX8 B;  3TKL B;  3UUX B;  4EZ4 A;  3P8C D;  3CX7 B;  2I59 A;  2VKH A;  2XAS B;  3CQX C;  2KZ7 B;  3GMI A;  4ZS3 A;  5L3G B;  4IE6 A;  1NWM X;  2JMH A;  2VKO A;  3BQI A;  4GOU A;  4MFR A;  4UEM A;  5DQW A;  5H6R B;  3ZMZ B;  3WAJ A;  3KFW X;  1MMA A;  5L3D B;  4MBQ A;  4EB6 E;  4QXB B;  4Z8X A;  2YEV C;  3UFE A;  1LRZ A;  3N9Q A;  5HYA A;  3GN5 A;  2KWH A;  5FP3 A;  3ETU A;  4I4T E;  3DJB A;  2Z6E A;  4OHF A;  3MA9 A;  3KBT A;  4H9S E;  1ZHC A;  1BR0 A;  4O2B E;  4XZC A;  3Q9D A;  5CB4 E;  5LGT B;  3ZC0 A;  3JC6 C;  3LK2 B;  4L5G A;  3NBX X;  2V26 A;  1SHZ C;  5FXX A;  2DWK A;  4ADZ A;  3I0Q A;  5L3F B;  1G73 A;  4HFV A;  3ZCI A;  4F6R C;  2V7L A;  2BDE A;  3ONX A;  1LVF A;  4CXW A;  2ZMA A;  3AA6 B;  3CQG B;  4O4H E;  4IDZ A;  3UUM A;  4CXY A;  1D1A A;  3LBX A;  1LVK A;  5JH7 E;  4YJ3 E;  4E7S A;  2MOZ A;  3O1J A;  5F3J A;  2JMK A;  3ZC1 A;  5EK3 A;  4CI2 B;  4IGU A;  3ZYM A;  1WLX A;  3AAE B;  4PJJ A;  5DJQ C;  4ZI3 D;  3DP7 A;  2K9A A;  4PK4 A;  2ZM2 A;  3HL6 A;  2DCF A;  2N9D A;  2JRK A;  3D0T A;  3ZN1 B;  5JDL A;  2PJQ A;  3PU8 A;  2CEA A;  2B1E A;  2MYS A;  3C4Z A;  4ZHQ E;  4DMV A;  2Q9Q B;  2CXL A;  2RA1 A;  4IIJ E;  2LOS A;  1YD8 G;  3T8O A;  4AKL A;  3FXD B;  3PUS A;  3RH3 A;  3GWH A;  2XAG B;  4N78 D;  1HS7 A;  2JPF A;  2X66 A;  2ODU A;  3ZJ1 A;  4BJM A;  1G8X A;  1WYC A;  3BQK A;  5LYJ E;  1FIO A;  4TUY E;  2DWG A;  4TX5 A;  4UVC B;  3CML A;  2Y48 B;  3UT5 E;  2LSJ A;  3H3A A;  4YFS A;  3IEE A;  1BR1 A;  3AA0 B;  4UF0 B;  2LHN A;  1D0Z A;  5JRE A;  1YKH B;  2C5I T;  3PUR A;  1LKX A;  1T98 A;  2MBG A;  2K24 A;  2E9X B;  2LEH A;  5FNV E;  5JDF A;  5LG4 A;  2XTL A;  3AAA B;  3C50 A;  3ZCJ A;  3C64 A;  5LJM A;  3I9W A;  3CX6 B;  5LP6 E;  2C0S A;  4QHO A;  3VKH A;  4BJN A;  2NTX A;  2WWU A;  3CKD A;  2HPJ A;  3ZPO A;  3N9N A;  2C5K T;  3OKQ A;  2A3D A;  4MLK A;  2PBI A;  5LOV E;  3C4W A;  4EZH A;  2E9X D;  4X1K E;  3SRZ A;  2G0U A;  3F57 A;  4I43 B;  5FXW A;  3LJC A;  3L3P A;  2NTY A;  4FJO A;  3RYI E;  3BK9 A;  4IHJ E;  3ZYL A;  4P0B A;  3VKG A;  2EHO B;  3EDU A;  2QA7 A;  3CWZ B;  1H7C A;  3AB3 B;  2W00 A;  1HG5 A;  2WSS V;  3MXZ A;  4UVA B;  5HXS A;  4AKI A;  5JDQ A;  2LE8 A;  4QXC B;  1ZKE A;  4QWN B;  3ZMS B;  4ZI3 C;  5JR9 A;  3ZMT B;  2L9Q A;  4IE0 A;  3J7Y q;  3AA7 B;  2W62 A;  4PFO A;  2IW5 B;  4G63 A;  2NW7 A;  2V7K A;  5HXC A;  1UCU A;  1IJ5 A;  2KMF A;  5BMV E;  2K48 A;  2WM9 A;  3E0Z A;  2V7J A;  2Q9Q A;  2EHO D;  5IYZ E;  4U74 A;  4NUV A;  3KBU A;  2A2F X;  5FXZ A;  2LSY A;  4PJL A;  2BZB A;  2HPL A;  4UV9 B;  4L0R A;  3E22 E;  3KV5 A;  3U78 A;  5JR9 C;  1YW0 A;  2L8K A;  5IHY A;  5LCY A;  5DQV A;  4FI5 A;  2H7O A;  1S35 A;  2P9B A;  2X9X A;  3PDY A;  4KMC A;  4UF0 A;  4WW0 A;  4O4L E;  3SWH A;  4CI3 B;  3A5X A;  4EAH A;  3HR0 A;  3R84 B;  2LSG A;  2LHR A;  3RYC E;  5EK2 A;  2NWB A;  2E9X A;  2X68 A;  4YLH A;  1B7T A;  5JDM A;  3C4X A;  5LBM A;  3VHL A;  3UUL A;  5HXR A;  2NW9 A;  3CPZ A;  2D0U A;  2SPC A;  2ZM8 A;  4HEA A;  3UTK A;  4DMW A;  4X1I E;  2E8I A;  3RX6 A;  4I55 E;  4EXT A;  3S4U A;  5FY0 A;  5HWY A;  2VL8 A;  5LNK A;  2CLY B;  2YIN A;  3N9O A;  4XBF B;  5HXE A;  4E7Z A;  3U3I A;  3PTR B;  1MMD A;  1MNE A;  4O2A E;  3F31 A;  2E9X C;  3BQL A;  2XHE B;  3MK7 C;  1BR4 A;  4MHC A;  1MND A;  4U72 A;  2DHR A;  4K0U A;  2EHO A;  3ZMV B;  1KNZ A;  1AJ3 A;  3ZYK A;  2ES0 A;  5J2U E;  5LHH B;  5KMG P;  4PK5 A;  2YU2 A;  4ZI2 C;  3N5L A;  2Y8D A;  4CZZ B;  2W0G A;  3KV6 A;  1OXZ A;  3IF8 B;  2KND A;  1HTJ F;  1FEW A;  5EZY E;  5J1G A;  5JDG A;  2KT9 A;  4IE4 A;  2A72 A;  2N1G A;  2NP9 A;  3KVB A;  5LHI B;  3CVR A;  4CI1 B;  1V9D A;  3LG7 A;  3J9X 1;  4O4J E;  1OWA A;  2XAQ B;  3O1H A;  3R6N A;  4AXP A;  4JEH B;  4TZ4 C;  1FMV A;  3W15 B;  5KDM C;  2EHO C;  3RYH E;  1D0Y A;  5CA1 E;  3IBP A;  3K8P C;  3KDS E;  1WYB A;  1CUN A;  4DND A;  3AVR A;  2X9H A;  5EK4 A;  3RKO A;  1U4Q A;  4HGA A;  1HX8 A;  4QKN A;  3RPU A;  2Q9Q D;  5E0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...