3OBVE

Autoinhibited formin mdia1 structure
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
442
structure length
419
Chain Sequence
b'KVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein diaphanous homolog 1
publication title Crystal structure of the Formin mDia1 in autoinhibited conformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 138
structure length 419
sequence length 442
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF06345 Drf_DAD DRF Autoregulatory Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3obvE02
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3obvE03
4EAHA 1Y64B 3OBVE 2Z6EA 1UX5A 3O4XE 1UX4A 2J1DG 1V9DA
chains in the Genus database with same CATH superfamily
4AQGA 5AQJB 3IEEA 1MNEA 3MA9A 5DQVA 2WY2A 4DNDA 2ZM6T 3RQWA 3GN5A 3H3AA 4HWDA 2D9DA 2WBLA 4BJMA 1WYCA 5HEOA 3EAMA 4LFAT 5FXWA 3UQ4A 2LKGA 5L3EB 1LRZA 2YN6A 5HXHA 2J47A 3RGLA 4TX5A 5JTGA 5C8YE 4IIJE 2UXNB 4DUZT 4DUYT 4DR6T 2EHOB 3AXJB 4JBWF 3PJAJ 4NXMT 2IC6A 1XZYA 2J62A 3ONXA 3ZJ2A 3VKGA 3C98B 2I0MA 3N9QA 4HTEA 2LHNA 1X79A 5LMUT 1N36T 5L4EA 2D2SA 2IIUA 2YOEA 3N2KE 4EEBA 2XAJB 4X5TA 3AAIA 3O4XE 4L5GA 5AQFB 3LBXA 4CI1B 2HH7A 3IBPA 2Q9QC 4EAHA 3NRYA 3P4SA 3C64A 2UUCT 3RLFF 3GMIA 3ZKRA 4IE0A 1AJ3A 2V8SV 4IDPA 4B3RT 3SOLA 2ACZA 2X0LB 5HEJA 2RP4A 3KINB 2E9XC 4GOUA 4LF7T 3K3OA 2DHRA 1VCTA 4EEDA 3UT5E 3DTOA 5AQMB 1S35A 2HPJA 4ZI2D 2MOZA 1HG5A 1HFAA 4IREA 4U33A 3TLVA 2CHNA 5LBMA 5L3CB 2VVNA 2VB6A 4OX9T 4DR5T 3LJCA 1BR0A 4BJNA 1Z0PA 5AFUL 2NWBA 2Q9QA 3UUMA 2XSAA 3EDUA 3UU3A 3TKLB 1D0XA 1HS7A 1KK7A 2E9XA 5AQNB 2D5UA 3RHWA 4CN4A 4XBFB 2ODVA 3RX6A 2CBIA 5L2LA 2WMOA 2ZMAA 2V5CA 3PUWF 3ZYLA 4DV0T 4UF0A 2LHRA 3C50A 4KHZF 3AEFA 2XM1A 4TV9E 2BS3A 4PFPA 2XQAA 5ABFA 2W63A 1IBKT 1IBMT 3EABA 4FJOA 2J1DG 4IE4A 4IDNA 2NTYA 2K9AA 1YQ3A 2BBHA 1LVFA 3RRWA 4ZZCA 3PUGA 1WLXA 1VCSA 5L3FB 4B3ST 2Y48B 1IBLT 1FEWA 3RRCA 3NRXA 1WR0A 3FB2A 1WRDA 4YT0A 3EVYA 4E7SA 3CQGB 2KWHA 4PK6A 4JI5T 2L3LA 5ETWA 2ZM2A 4DV2T 5LCYA 3FZKB 3FHNA 3ZSSA 2X66A 3PU3A 2X9XA 5LNKA 1YW0A 4U31A 4TWDA 3Q9DA 3AE3A 3PU8A 2WDQA 3UU6A 5EK4A 4DR4T 4PFOA 3SFDA 3LK3B 5HWXA 4PK4A 2W2UA 5LBQB 5CFBA 2C5IT 1H7CA 1YKHB 2YINA 5IWAT 3V5SA 3OTOT 3G06A 2HPLA 2XAQB 3I0OA 2JQHA 2EHOD 4NXNT 4CZZB 1YD8G 4X20E 4IT4A 3FXEB 3UUBA 3AE7A 2UU9T 1N34T 4AXPA 4AISA 3D0TA 4P09A 1MMAA 4A97A 4YHJA 1BR1A 2W4XA 2WAUA 3FZMB 2XASB 4AI6A 3AAAB 3QB5K 2KSRA 2Y6XA 2BDEA 1ZOYA 5HXCA 2M6IA 3RYCE 4UVAB 4NUVA 2LEHA 2VQFT 2PFVA 4DV5T 2B1EA 4I50E 5KDMC 3ONJA 1XWMA 3JC6D 3RC3A 2LSIA 3S4UA 2FJAA 3QNUA 1LKXA 2V7MA 1XNQT 2OA5A 3LK42 2AE9A 4ZOLE 3H37A 4X1KE 5CJ5A 2DNXA 3MZKB 3R84B 4AIUA 3CIRA 2H89A 3W15B 5F3JA 1W09A 4AKHA 1FJGT 5FY1A 3QUJA 5F5WA 2CA5A 3GA8A 3SFEA 4H63V 1SA0E 4HN9A 4K0KT 2ZM8A 1T72A 2LOSA 4EGWA 4UV9B 1J5ET 4MFRA 4YTPA 2XAFB 4OYJA 2PBIA 3KV4A 2RPAA 2IUBA 4ZS3A 3RYHE 5FL1A 5H6QB 5AQGB 4O4HE 2DWKA 2BKOA 5LB7B 4U74A 1E7PA 3AB3B 2UXCT 3O1JA 2ZM0A 3PUQA 4EB6E 2IHR1 3AE2A 1KF6A 1OEDB 3VHLA 2JJ9A 1KEYA 4HFCA 4JI8T 5JDLA 2YDQA 2CXLA 3CK6A 2XTLA 5FP3A 5JRCA 2QGSA 5HXRA 5LXTE 1KNZA 1VOMA 2G0UA 2X51A 2DLRA 5JR9B 3AE4A 2VKJA 1NEKA 4G2AA 4NUUA 1BR4A 2YU2A 4QXHB 2K3WA 3PUXF 4DR2T 4MLKA 3KV5A 5HYAA 2QYWA 2CHOA 4HFBA 3ZLIA 4WNKA 2XAHB 3IF8B 4DBQA 3RPUA 4TV8E 3P4RA 4YSXA 2BG9B 5EK3A 3QOFA 1MMNA 4P1NA 5L3DB 5F8PA 2VK9A 2W67A 2V7KA 3E08A 2CLYB 3N9LA 4YTMA 2NR4A 3KBTA 2NW7A 3X1DA 3E22E 3I0QA 5HCJA 2K48A 2JIWA 1W0BA 3L09A 3JADA 3QK6A 2LSKA 5LGNB 4QX7B 4KI0F 1SE7A 3RI5A 4ZEYA 1D1CA 2XPKA 1KNPA 3K3NA 2XQ7A 2NTXA 3PUZF 2YDSA 3L3PA 1FIOA 1T98A 2KWIB 3AE1A 3WAKA 5DQWA 3ZMSB 3JAEA 4YTNA 2YK0A 2A72A 1I94T 3K8PC 3E0ZA 2XQ5A 2YEVC 1ZP0A 4DV3T 4LMLA 1MIWA 3AA6B 4GKJT 5C3JA 2X9YA 5IUXA 2MPKA 5JQGE 4XZCA 4YJ2E 4IL4A 4CXYA 4ZHQE 2XAGB 3RH3A 1HF8A 3AEBA 2X9WA 5J2UE 5AQLB 3C4XA 2JQ9A 5HEGA 3VKHA 2UXBT 2KINB 4ZXLA 5KXJA 1W0AA 3HI2A 5CA0E 4QHOA 4UELA 4O2AE 2BBJA 3PUAA 4Q25A 4YSYA 1G73A 2WQYA 3AVSA 3ANWA 2LE8A 3LFMA 3O1HA 3IA3A 3GWHA 5FXVA 4IE5A 1XMOT 1OXZA 2CXDA 4BAYB 5CA1E 3KBUA 4DV6T 1LVKA 3OVUA 3UULA 4TN7B 4JV5T 2JQQA 4PJMA 3UU5A 3AEEA 4HEAA 2I6HA 3N2OA 1YXRA 4B3MT 3R6NA 2JPFA 3ZCJA 3CQCB 4B3TT 3MXZA 4H9OC 1ZHCA 3KVAA 3ZT5A 2VASA 2LRKA 3HL6A 1IAPA 5AQUB 3UTKA 2VQET 5A1LA 3AA0B 4LF5T 4X1YE 4I4TE 5AQHB 3HR0A 5LGUB 4PJLA 2KLQA 3NZQA 3PUSA 4JI6T 2LJLA 1IJ6A 2VKHA 2K5BB 2XQ3A 5KMGP 3A8YC 2UXXB 2CWYA 4X66T 2V26A 1J1JA 1WR6A 4HWCA 5AQKB 2H3RA 2FUPA 3M3ZB 1QLBA 2GK9A 2ODUA 3PUVF 1YKEB 4EV6A 2FBWA 1HG2A 4GIWA 3A7MA 1T8BA 3ZSTA 3ESLA 2Z6EA 2V6YB 4ZI2C 2B76A 1T7SA 3CMLA 5JDNA 2ZLYA 2JMKA 4JI0T 4QH1A 4ZI3C 5LHIB 5J0ZA 5FMNA 4QXBB 5LYJE 5CB4E 3OBVE 2FJEA 2IW5B 2HN1A 4HFIA 4TZ4C 4UVBB 4F8HA 3MJXA 5FY7A 3AE6A 4ISTA 4Z90A 5JDMA 2Y8DA 2X67A 5HEUA 1W9RA 4C91A 3P4WA 3N9PA 2BG9C 5LG4A 1MMDA 4JEHB 1MNDA 3Q2MA 1IZNB 4O4LE 4PW8A 4YXDA 2W66A 3GN5B 2VURA 2PJQA 3VU7H 1HNXT 4HFDA 2P9BA 3MK7C 3B13A 2CLYC 1VRBA 3T8OA 4A98A 4NPPA 4HWHA 3RC8A 3PDYA 2VKDA 3UU4A 4X65T 3BK9A 1Z8UA 3HKDE 3VR9A 4YLHA 4GYRA 2LM2A 2V7LA 4IE6A 3SS1A 2BG9A 4OK0A 4CXXA 4ERRA 3ZCIA 2RA1A 2WWUA 2XZEA 1WFDA 3ZMVB 5LP6E 4DR1T 2LLYA 3J9X1 3ETVA 1UUSA 3EUHA 3LBXB 3FBLA 5IHYA 3CX8B 2X68A 3N9MA 1D0YA 4CXWA 3FZHB 4DMWA 4U72A 4IL9A 3TLTA 4OHFA 3O9XA 4X64T 3RIAA 4ASKA 4ZI7E 5AQVB 2XQ6A 1D0ZA 1X9BA 2WP9A 4DO0A 2X9HA 2WZHA 5LJMA 2N1GA 3RQUA 2H88A 2XM2A 4LF6T 1ZEEA 3N5LA 4JI1T 2EHOC 3T1YT 1J5WA 4YY3T 4CI2B 3ZYMA 4U7YA 3HKCE 4LF8T 1DU2A 3CQXC 4TUYE 5KX5E 1MMGA 3PURA 1WYBA 3F31A 3ZN0B 2M67A 3DJBA 2LRLA 3Q5EA 2E9XB 4ZZBA 3LG7A 4JLEA 3NKZA 3ZC0A 3T1HT 3I9YA 2CRBA 4BA9A 3EDVA 3AA1B 3ZN1B 3HKEE 1ZV4X 5LMNT 2UUBT 4YFSA 2DL1A 2E5VA 4TWFA 1YQ4A 5HXSA 2EHOA 3AXJA 1JNRA 5ABFB 3TLUA 4DR3T 1HR0T 3JC6C 3CWZB 3NVOA 3LSVA 2XQ8A 3Q5XA 5FVLA 2V1DB 5HAXA 3VR8A 3N2GE 3P4QA 2V7IA 2LSJA 5JREA 4O4JE 4H9PC 1I6ZA 3F2EA 2L8KA 2XUEA 2UUAT 4J2CA 3RKOA 3MACA 4HWIB 1E2AA 4QKNA 3TLWA 2JQKA 4XAXB 1E1HB 2QA7A 4O8SA 1CUNA 2JRKA 4I55E 2NW8A 2K24A 4QH4A 3BQKA 3AA7B 5LHGB 4PJJA 4ANJA 4AKRB 2BZBA 4OYKA 4G63A 4WBOA 4UVCB 4KBMB 4HFHA 3DP7A 4NIQA 4JUYA 1OWAA 2XHEB 2V7JA 5FL0A 4A56A 4DV1T 3WI3A 1GQEA 3CKDA 2WWVA 3KV6A 4U7IA 2IAKA 3CX7B 3I9WA 4GK0E 4ILAA 2PTFA 3ZMZB 3IHRA 4U2ZA 2WCAA 2CE7A 2I59A 4M1PA 3ZC1A 4GK5E 3SRZA 1UGOA 3OJAA 5JH7E 4HE8A 5AQQB 2BVLA 2HHHT 5E0OA 2WM9A 3ZT7A 2XY8B 3N9NA 5LA6E 2ACXA 5JVDE 2KZ7B 5LJNA 5HCMA 4V1Av 3EHZA 2VL0A 4MALA 3K1SA 3KVBA 1HNZT 5AQSB 1CHUA 3F57A 5TAOA 4N78D 3AE9A 4JYAT 3UFGA 4QX8B 2VWAA 2W0GA 4LF4T 5FY0A 2OLTA 4EYYR 4PK5A 4DIDB 3JCFA 2AXDS 3ZJ1A 2WSSV 2J4GA 3LK2B 5FXXA 3PJAA 1KNRA 2Q9QD 1HTJF 1Y01A 1MIVA 3KFWX 4EZ4A 2BG9E 2IDOB 2E9XD 4L9IA 3NZPA 4JI4T 4UXNB 4I43B 2MBGA 4L0RA 3L8RA 2KMFA 1HX8A 4EZHA 2ES0A 1N32T 2F4VT 1MIYA 3RIFA 2LM9A 2WMNA 4DVDA 5ABHA 2LSGA 5H6RB 2V5DA 4QXCB 3UUNA 2X0HA 4CI3B 1KFYA 5IYZE 5JRCB 3UFEA 5LOVE 2MYSA 4YHHT 3PE0A 4ILBA 2XQYA 4JEUB 3AEGA 4X1IE 5L3GB 1XDPA 3U3IA 2V6XA 3K3QC 4HFEA 3P8CD 5JDHA 3C4WA 2CMRA 1S94A 4IHJE 4CQIA 2MTQA 3ZMTB 2A9UA 3ZEFB 2XQ9A 4EXTA 2KXPB 4AKLA 4OFZA 2C0SA 4GYSA 3ZPOA 4UEMA 3LDQB 4TWHA 3RF1A 2CM0A 4A5XA 4AQFC 5AQOB 5M4YA 5AQRB 3V5UA 4PAGA 4ZI3D 4U3CA 2NP9A 3FZFB 2X0YA 4IDZA 4QWNB 1XMQT 1Y64B 2WDVA 2NW9A 1OEDC 4LMKA 4JI7T 2MAWA 3J7Yq 1QUUA 1L0VA 5LG3A 1FMWA 4QH5A 2A2FX 5JR9C 3AE5A 4O2BE 1U5PA 2LSYA 3VRAA 5AQTB 2WB5A 2D0TA 2IC9A 3BQIA 4AQFA 4LMJA 3ETUA 3U78A 5FVKA 2JMHA 1HNWT 2N9DA 3NBXX 3OYZA 4IDOA 4P0AA 2VKOA 2DWGA 3JAFA 4HWFA 2BKPA 1OEDA 2A3DA 4EOZB 5C2TA 3QB5A 3PUYF 4C90A 1ZKEA 2QVAA 5ADXL 4HKAA 3P7IA 2KT9A 5ABGA 2W61A 1D1AA 2VL8A 2CWOA 2PG8A 3M65A 1XNRT 5JR9A 2H7OA 4U2YA 2E2AA 5J2TE 4I0UA 4KUMB 4KP3C 5JDQA 2E5LT 3P4PA 4LFBT 4YSZA 3C4ZA 5EK2A 3CVRA 5HXEA 1FMVA 3NWIA 2BS2A 2XQ4A 4UIGA 3BQLA 1HX1B 4WZXA 4JI2T 5L4HA 4KX6A 4WW0A 4MHCA 5BMVE 4X62T 5DABA 3C51A 1SUMB 4CN6A 1UX4A 2LKHA 4DR7T 4YJ3E 3H3MA 4LF9T 1UURA 4ISSA 2HN2A 3ZT6A 3ANWB 2LOPA 3FXDB 1QSDA 4F6RC 4TNWA 3RYFE 4HGAA 1HCIA 4IDQA 5J1GA 5FNVE 2H7VC 2CXFA 2YKSA 2WS3A 3B5MA 2VVSA 2C5KT 2CEAA 4EYUA 2LT3A 3UU8A 1US7B 1EZ3A 2FJDA 1IJ5A 4PJNA 2BVMA 4EIWA 5DJQC 4UR9A 3RKGA 1NWMX 2N2NA 3SWHA 4ZS2A 3TLSA 5GONE 5LGTB 3L39A 3ABVA 2QRXA 2WDRA 4AKGA 2YDRA 3ZMUB 4COFA 2L9QA 2Q9QB 4ILUA 3N9OA 2W00A 5HWYA 4K0UA 3RYIE 2E8IA 1O3XA 3EI0A 3AEDA 2IMLA 5JDFA 4MBQA 3VRBA 3KV9A 1B7TA 2BS4A 2CBJA 5CGMA 2M6BA 1U4QA 1G8XA 3Q5DA 3ONLC 2DI4A 4CN1A 5EZYE 3AAEB 1D1BA 4UF0B 2FJBA 3PTRB 2W62A 5FKYA 3P50A 2DCFA 1JNZA 2XSBA 4WBNE 3OKQA 4IGUA 1SHZC 3RIUC 5LHHB 3WAJA 2CPTA 4Z91A 4GKKT 4UV8B 2YU1A 1UK5A 2SPCA 3AEAA 3CX6B 3Q5WA 4LFCT 4IE7A 4WYVA 1WCRA 4KHPT 4E7ZA 3PV0F 3AE8A 3O1IA 4PNIA 4KMCA 3AECA 1M7KA 2R6GF 4DBRA 4DV4T 4AKIA 5FYMA 5L47A 4H9RC 4FI5A 1BR2A 4H9QC 4TNVA 4H63H 3OYXA 3HKBE 3RIUA 4DMVA 5ABEA 2CCQA 5L3BB 2XJ7A 1UX5A 2WZIA 3AVRA 4HFVA 3B57A 1N33T 4ADZA 3I1AA 2WU5A 3A5XA 3FBZA 3KDSE 4B6XA 3OPCA 1R8IA 4O4IE 5AQPB 4Z8XA 3UUXB 5FXZA 5JDGA 1XDOA 1M62A 3CPZA 4ILCA 1UCUA 2V6YA 3HA4A 4DV7T 2D0UA 3UQ7A 3QC9A 3FZLB 2WU2A 2NOXA 1OEDE 4AQYT 4H9SE 2KNDA 2OV9A 1NAFA 1NENA 5HEHA 4H9NC 2C5JA 1V9DA 3ZYKA 2BKNA 2UXDT 4P0BA 5AQIB 5BR8T 4JI3T 3MKDA
chains in the Genus database with same CATH topology
3V5UA 4PAGA 3O1JA 2ZM0A 4ZI3D 3PUQA 2RA1A 3ZCIA 2NP9A 4EB6E 4AQGA 3VHLA 2WWUA 4IDZA 4QWNB 2JJ9A 3IEEA 1Y64B 3ZMVB 1MNEA 3MA9A 5DQVA 4DNDA 5LP6E 5JDLA 2NW9A 2CXLA 3J9X1 2XTLA 3ETVA 5FP3A 5JRCA 3EUHA 3GN5A 3H3AA 2QGSA 3LBXB 5HXRA 3FBLA 5IHYA 2WBLA 4BJMA 5LXTE 3J7Yq 1QUUA 1KNZA 3CX8B 1VOMA 2X68A 3N9MA 1D0YA 2G0UA 2X51A 1WYCA 4CXWA 2DLRA 5JR9B 1FMWA 5FXWA 2VKJA 4DMWA 5L3EB 1LRZA 4G2AA 4U72A 5HXHA 4NUUA 1BR4A 4OHFA 2YU2A 4QXHB 2A2FX 3O9XA 4TX5A 5JR9C 4ASKA 4MLKA 4O2BE 3KV5A 4ZI7E 5C8YE 5HYAA 1U5PA 2LSYA 3ZLIA 4IIJE 1D0ZA 4DO0A 4WNKA 2UXNB 2D0TA 2XAHB 2IC9A 2X9HA 3BQIA 3IF8B 4AQFA 5LJMA 2N1GA 2EHOB 3ETUA 3U78A 4DBQA 3RPUA 2JMHA 1ZEEA 4TV8E 2N9DA 3N5LA 2IC6A 3NBXX 3ONXA 3OYZA 3ZJ2A 3VKGA 4P0AA 3C98B 5EK3A 2EHOC 1MMNA 2VKOA 3N9QA 5L3DB 2DWGA 4HTEA 4ERRA 2LHNA 1X79A 5F8PA 4CI2B 2A3DA 2D2SA 3ZYMA 4EOZB 2VK9A 3N2KE 4C90A 3HKCE 1ZKEA 5ADXL 2V7KA 3CQXC 2XAJB 3E08A 4HKAA 2CLYB 4TUYE 3AAIA 3O4XE 3N9LA 3P7IA 4L5GA 5KX5E 3KBTA 3LBXA 2KT9A 2NW7A 1MMGA 4CI1B 3PURA 1WYBA 3F31A 3ZN0B 2HH7A 2W61A 2M67A 3IBPA 2Q9QC 1D1AA 3DJBA 2VL8A 3E22E 2CWOA 3I0QA 2E9XB 4EAHA 2PG8A 2K48A 3NRYA 3C64A 3M65A 3GMIA 2H7OA 3L09A 4IE0A 5JR9A 1AJ3A 3LG7A 3SOLA 4JLEA 3ZC0A 2X0LB 3QK6A 3I9YA 4BA9A 2RP4A 5J2TE 2LSKA 3EDVA 2E9XC 3KINB 4GOUA 4QX7B 5LGNB 3K3OA 4KUMB 2DHRA 4KP3C 5JDQA 1D1CA 3AA1B 3ZN1B 3K3NA 3HKEE 1ZV4X 3UT5E 3C4ZA 5EK2A 3CVRA 3DTOA 5HXEA 2NTXA 1FMVA 4YFSA 3L3PA 4UIGA 3BQLA 5HXSA 1S35A 2HPJA 2EHOA 4ZI2D 1FIOA 2MOZA 4WW0A 1HG5A 1HFAA 1T98A 4MHCA 2KWIB 5BMVE 3WAKA 5DQWA 3ZMSB 5LBMA 3JC6C 5L3CB 5DABA 3CWZB 2VB6A 3C51A 2YK0A 3LJCA 1BR0A 4BJNA 3Q5XA 1UX4A 2V1DB 5HAXA 2A72A 3N2GE 3K8PC 1Z0PA 5AFUL 4YJ3E 3E0ZA 2NWBA 2V7IA 2LSJA 2Q9QA 2YEVC 4ISSA 3UUMA 5JREA 3ANWB 3EDUA 4O4JE 2LOPA 4H9PC 3FXDB 3TKLB 1QSDA 1D0XA 3F2EA 1HS7A 4F6RC 1MIWA 3AA6B 3RYFE 2L8KA 2XUEA 4J2CA 3RKOA 4HGAA 3MACA 1HCIA 2X9YA 1KK7A 2E9XA 4QKNA 5JQGE 5J1GA 5FNVE 2H7VC 4XZCA 4XAXB 2D5UA 2CXFA 4YJ2E 1E1HB 2QA7A 4O8SA 1CUNA 2JRKA 4I55E 4CXYA 2NW8A 4ZHQE 2ODVA 4XBFB 3RX6A 2K24A 2C5KT 2CEAA 2XAGB 4EYUA 2LT3A 3RH3A 3BQKA 1US7B 5L2LA 1HF8A 2WMOA 2ZMAA 3AA7B 1EZ3A 5LHGB 4PJJA 1IJ5A 4PJNA 3ZYLA 4ANJA 2BVMA 4AKRB 4EIWA 2X9WA 2BZBA 5DJQC 4OYKA 5J2UE 4G63A 1NWMX 2N2NA 2LHRA 4UF0A 4WBOA 4UVCB 3C50A 3SWHA 4ZS2A 3C4XA 4KBMB 3VKHA 4TV9E 3DP7A 4PFPA 2KINB 2W63A 4JUYA 5GONE 1OWAA 4FJOA 2J1DG 3HI2A 5LGTB 5CA0E 4IE4A 4QHOA 4UELA 2XHEB 2V7JA 4O2AE 4AKGA 2NTYA 3ZMUB 2K9AA 3PUAA 4A56A 1G73A 2L9QA 2Q9QB 3WI3A 4ILUA 1LVFA 3CKDA 3N9OA 3AVSA 2W00A 5HWYA 4K0UA 3RYIE 2E8IA 3ANWA 2LE8A 3LFMA 3KV6A 3RRWA 3PUGA 1WLXA 1O3XA 3O1HA 2IAKA 5L3FB 2Y48B 3CX7B 1FEWA 3RRCA 3I9WA 4GK0E 3GWHA 3NRXA 5FXVA 3FB2A 4IE5A 1WRDA 3ZMZB 1OXZA 2CXDA 5JDFA 3IHRA 3KBUA 4BAYB 5CA1E 3EVYA 1LVKA 2CE7A 2I59A 4M1PA 3CQGB 4MBQA 4E7SA 2KWHA 4PK6A 3KV9A 3UULA 3ZC1A 1B7TA 4TN7B 2L3LA 5ETWA 2ZM2A 2JQQA 5LCYA 4PJMA 4GK5E 3SRZA 4HEAA 1U4QA 3FHNA 3N2OA 1G8XA 2X66A 2DI4A 3PU3A 2X9XA 3OJAA 5JH7E 4HE8A 5LNKA 1YW0A 2BVLA 5EZYE 3Q9DA 3AAEB 3R6NA 3PU8A 1D1BA 4UF0B 5EK4A 5E0OA 2JPFA 3ZCJA 2WM9A 3CQCB 3PTRB 2W62A 3MXZA 3N9NA 4H9OC 5LA6E 2ACXA 5JVDE 2KZ7B 1ZHCA 3KVAA 5LJNA 2VASA 4PFOA 2DCFA 3HL6A 3LK3B 1IAPA 5HWXA 3UTKA 5A1LA 3AA0B 4V1Av 4X1YE 4PK4A 4I4TE 4MALA 3KVBA 5LBQB 3OKQA 4WBNE 3HR0A 5LGUB 2C5IT 1H7CA 4PJLA 1YKHB 2YINA 4IGUA 3V5SA 3F57A 2KLQA 3NZQA 1SHZC 5TAOA 4N78D 5LHHB 3WAJA 2HPLA 2XAQB 3I0OA 3PUSA 2LJLA 1IJ6A 4UV8B 2VKHA 2K5BB 2YU1A 5KMGP 2SPCA 2EHOD 2UXXB 4QX8B 2VWAA 3CX6B 2W0GA 4CZZB 3Q5WA 2CWYA 5FY0A 2V26A 1YD8G 4IE7A 4X20E 1WR6A 3FXEB 4EYYR 4PK5A 2H3RA 3ZJ1A 2GK9A 4E7ZA 2ODUA 4AXPA 2WSSV 3O1IA 4PNIA 1YKEB 4KMCA 3D0TA 3LK2B 4P09A 1MMAA 5FXXA 1HG2A 4YHJA 1BR1A 4GIWA 2Q9QD 4DBRA 2WAUA 3ESLA 1HTJF 4AKIA 2Z6EA 5FYMA 1MIVA 3KFWX 2XASB 4EZ4A 4AI6A 4ZI2C 3AAAB 3CMLA 5JDNA 2E9XD 4H9RC 4FI5A 1BR2A 2ZLYA 2JMKA 4H9QC 4L9IA 3NZPA 2Y6XA 4ZI3C 5LHIB 5FMNA 4QXBB 5LYJE 4H63H 2BDEA 3OYXA 5CB4E 3HKBE 3OBVE 4UXNB 4I43B 5HXCA 2MBGA 4DMVA 3RYCE 4L0RA 4UVAB 4NUVA 2IW5B 4TZ4C 2LEHA 2KMFA 4UVBB 1HX8A 2PFVA 3MJXA 5FY7A 4EZHA 2CCQA 2B1EA 2ES0A 5L3BB 4I50E 4ISTA 1UX5A 5KDMC 1MIYA 2LM9A 5JDMA 3AVRA 4HFVA 3JC6D 3B57A 2Y8DA 3RC3A 4ADZA 2X67A 2LSIA 2WMNA 3S4UA 4DVDA 4C91A 2LSGA 3I1AA 5H6RB 3N9PA 4QXCB 5LG4A 1MMDA 4JEHB 3A5XA 3UUNA 1LKXA 1MNDA 2V7MA 2OA5A 3LK42 4CI3B 4ZOLE 3H37A 3Q2MA 1IZNB 4O4LE 4PW8A 4X1KE 2DNXA 5IYZE 3FBZA 3MZKB 3R84B 5JRCB 3GN5B 3KDSE 3UFEA 4B6XA 4O4IE 5LOVE 2PJQA 3VU7H 2MYSA 4Z8XA 3UUXB 3W15B 5FXZA 5JDGA 2P9BA 3PE0A 5F3JA 3MK7C 3B13A 2CLYC 1VRBA 3T8OA 2XQYA 4JEUB 4AKHA 3CPZA 4X1IE 5FY1A 1UCUA 3QUJA 5L3GB 2CA5A 3RC8A 3GA8A 3U3IA 3PDYA 4H63V 3HA4A 1SA0E 3K3QC 2D0UA 4HN9A 2VKDA 3QC9A 3P8CD 5JDHA 3C4WA 2CMRA 2ZM8A 2LOSA 2NOXA 4UV9B 1S94A 4IHJE 4MFRA 4CQIA 2MTQA 2XAFB 3ZMTB 4H9SE 4OYJA 2PBIA 3KV4A 2KNDA 1NAFA 4ZS3A 4H9NC 3ZEFB 3RYHE 3BK9A 2C5JA 5H6QB 3HKDE 1V9DA 4EXTA 4O4HE 2KXPB 3ZYKA 4AKLA 4YLHA 4GYRA 4OFZA 2C0SA 4GYSA 3ZPOA 2DWKA 2V7LA 4UEMA 4P0BA 4IE6A 2CM0A 4AQFC 4U74A 4OK0A 3SS1A 4CXXA 5M4YA 3AB3B 3MKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EAH A;  1Y64 B;  3OBV E;  2Z6E A;  1UX5 A;  3O4X E;  1UX4 A;  2J1D G;  1V9D A; 
#chains in the Genus database with same CATH topology
 4AQG A;  5AQJ B;  3IEE A;  1MNE A;  3MA9 A;  5DQV A;  2WY2 A;  4DND A;  2ZM6 T;  3RQW A;  3GN5 A;  3H3A A;  4HWD A;  2D9D A;  2WBL A;  4BJM A;  1WYC A;  5HEO A;  3EAM A;  4LFA T;  5FXW A;  3UQ4 A;  2LKG A;  5L3E B;  1LRZ A;  2YN6 A;  5HXH A;  2J47 A;  3RGL A;  4TX5 A;  5JTG A;  5C8Y E;  4IIJ E;  2UXN B;  4DUZ T;  4DUY T;  4DR6 T;  2EHO B;  3AXJ B;  4JBW F;  3PJA J;  4NXM T;  2IC6 A;  1XZY A;  2J62 A;  3ONX A;  3ZJ2 A;  3VKG A;  3C98 B;  2I0M A;  3N9Q A;  4HTE A;  2LHN A;  1X79 A;  5LMU T;  1N36 T;  5L4E A;  2D2S A;  2IIU A;  2YOE A;  3N2K E;  4EEB A;  2XAJ B;  4X5T A;  3AAI A;  3O4X E;  4L5G A;  5AQF B;  3LBX A;  4CI1 B;  2HH7 A;  3IBP A;  2Q9Q C;  4EAH A;  3NRY A;  3P4S A;  3C64 A;  2UUC T;  3RLF F;  3GMI A;  3ZKR A;  4IE0 A;  1AJ3 A;  2V8S V;  4IDP A;  4B3R T;  3SOL A;  2ACZ A;  2X0L B;  5HEJ A;  2RP4 A;  3KIN B;  2E9X C;  4GOU A;  4LF7 T;  3K3O A;  2DHR A;  1VCT A;  4EED A;  3UT5 E;  3DTO A;  5AQM B;  1S35 A;  2HPJ A;  4ZI2 D;  2MOZ A;  1HG5 A;  1HFA A;  4IRE A;  4U33 A;  3TLV A;  2CHN A;  5LBM A;  5L3C B;  2VVN A;  2VB6 A;  4OX9 T;  4DR5 T;  3LJC A;  1BR0 A;  4BJN A;  1Z0P A;  5AFU L;  2NWB A;  2Q9Q A;  3UUM A;  2XSA A;  3EDU A;  3UU3 A;  3TKL B;  1D0X A;  1HS7 A;  1KK7 A;  2E9X A;  5AQN B;  2D5U A;  3RHW A;  4CN4 A;  4XBF B;  2ODV A;  3RX6 A;  2CBI A;  5L2L A;  2WMO A;  2ZMA A;  2V5C A;  3PUW F;  3ZYL A;  4DV0 T;  4UF0 A;  2LHR A;  3C50 A;  4KHZ F;  3AEF A;  2XM1 A;  4TV9 E;  2BS3 A;  4PFP A;  2XQA A;  5ABF A;  2W63 A;  1IBK T;  1IBM T;  3EAB A;  4FJO A;  2J1D G;  4IE4 A;  4IDN A;  2NTY A;  2K9A A;  1YQ3 A;  2BBH A;  1LVF A;  3RRW A;  4ZZC A;  3PUG A;  1WLX A;  1VCS A;  5L3F B;  4B3S T;  2Y48 B;  1IBL T;  1FEW A;  3RRC A;  3NRX A;  1WR0 A;  3FB2 A;  1WRD A;  4YT0 A;  3EVY A;  4E7S A;  3CQG B;  2KWH A;  4PK6 A;  4JI5 T;  2L3L A;  5ETW A;  2ZM2 A;  4DV2 T;  5LCY A;  3FZK B;  3FHN A;  3ZSS A;  2X66 A;  3PU3 A;  2X9X A;  5LNK A;  1YW0 A;  4U31 A;  4TWD A;  3Q9D A;  3AE3 A;  3PU8 A;  2WDQ A;  3UU6 A;  5EK4 A;  4DR4 T;  4PFO A;  3SFD A;  3LK3 B;  5HWX A;  4PK4 A;  2W2U A;  5LBQ B;  5CFB A;  2C5I T;  1H7C A;  1YKH B;  2YIN A;  5IWA T;  3V5S A;  3OTO T;  3G06 A;  2HPL A;  2XAQ B;  3I0O A;  2JQH A;  2EHO D;  4NXN T;  4CZZ B;  1YD8 G;  4X20 E;  4IT4 A;  3FXE B;  3UUB A;  3AE7 A;  2UU9 T;  1N34 T;  4AXP A;  4AIS A;  3D0T A;  4P09 A;  1MMA A;  4A97 A;  4YHJ A;  1BR1 A;  2W4X A;  2WAU A;  3FZM B;  2XAS B;  4AI6 A;  3AAA B;  3QB5 K;  2KSR A;  2Y6X A;  2BDE A;  1ZOY A;  5HXC A;  2M6I A;  3RYC E;  4UVA B;  4NUV A;  2LEH A;  2VQF T;  2PFV A;  4DV5 T;  2B1E A;  4I50 E;  5KDM C;  3ONJ A;  1XWM A;  3JC6 D;  3RC3 A;  2LSI A;  3S4U A;  2FJA A;  3QNU A;  1LKX A;  2V7M A;  1XNQ T;  2OA5 A;  3LK4 2;  2AE9 A;  4ZOL E;  3H37 A;  4X1K E;  5CJ5 A;  2DNX A;  3MZK B;  3R84 B;  4AIU A;  3CIR A;  2H89 A;  3W15 B;  5F3J A;  1W09 A;  4AKH A;  1FJG T;  5FY1 A;  3QUJ A;  5F5W A;  2CA5 A;  3GA8 A;  3SFE A;  4H63 V;  1SA0 E;  4HN9 A;  4K0K T;  2ZM8 A;  1T72 A;  2LOS A;  4EGW A;  4UV9 B;  1J5E T;  4MFR A;  4YTP A;  2XAF B;  4OYJ A;  2PBI A;  3KV4 A;  2RPA A;  2IUB A;  4ZS3 A;  3RYH E;  5FL1 A;  5H6Q B;  5AQG B;  4O4H E;  2DWK A;  2BKO A;  5LB7 B;  4U74 A;  1E7P A;  3AB3 B;  2UXC T;  3O1J A;  2ZM0 A;  3PUQ A;  4EB6 E;  2IHR 1;  3AE2 A;  1KF6 A;  1OED B;  3VHL A;  2JJ9 A;  1KEY A;  4HFC A;  4JI8 T;  5JDL A;  2YDQ A;  2CXL A;  3CK6 A;  2XTL A;  5FP3 A;  5JRC A;  2QGS A;  5HXR A;  5LXT E;  1KNZ A;  1VOM A;  2G0U A;  2X51 A;  2DLR A;  5JR9 B;  3AE4 A;  2VKJ A;  1NEK A;  4G2A A;  4NUU A;  1BR4 A;  2YU2 A;  4QXH B;  2K3W A;  3PUX F;  4DR2 T;  4MLK A;  3KV5 A;  5HYA A;  2QYW A;  2CHO A;  4HFB A;  3ZLI A;  4WNK A;  2XAH B;  3IF8 B;  4DBQ A;  3RPU A;  4TV8 E;  3P4R A;  4YSX A;  2BG9 B;  5EK3 A;  3QOF A;  1MMN A;  4P1N A;  5L3D B;  5F8P A;  2VK9 A;  2W67 A;  2V7K A;  3E08 A;  2CLY B;  3N9L A;  4YTM A;  2NR4 A;  3KBT A;  2NW7 A;  3X1D A;  3E22 E;  3I0Q A;  5HCJ A;  2K48 A;  2JIW A;  1W0B A;  3L09 A;  3JAD A;  3QK6 A;  2LSK A;  5LGN B;  4QX7 B;  4KI0 F;  1SE7 A;  3RI5 A;  4ZEY A;  1D1C A;  2XPK A;  1KNP A;  3K3N A;  2XQ7 A;  2NTX A;  3PUZ F;  2YDS A;  3L3P A;  1FIO A;  1T98 A;  2KWI B;  3AE1 A;  3WAK A;  5DQW A;  3ZMS B;  3JAE A;  4YTN A;  2YK0 A;  2A72 A;  1I94 T;  3K8P C;  3E0Z A;  2XQ5 A;  2YEV C;  1ZP0 A;  4DV3 T;  4LML A;  1MIW A;  3AA6 B;  4GKJ T;  5C3J A;  2X9Y A;  5IUX A;  2MPK A;  5JQG E;  4XZC A;  4YJ2 E;  4IL4 A;  4CXY A;  4ZHQ E;  2XAG B;  3RH3 A;  1HF8 A;  3AEB A;  2X9W A;  5J2U E;  5AQL B;  3C4X A;  2JQ9 A;  5HEG A;  3VKH A;  2UXB T;  2KIN B;  4ZXL A;  5KXJ A;  1W0A A;  3HI2 A;  5CA0 E;  4QHO A;  4UEL A;  4O2A E;  2BBJ A;  3PUA A;  4Q25 A;  4YSY A;  1G73 A;  2WQY A;  3AVS A;  3ANW A;  2LE8 A;  3LFM A;  3O1H A;  3IA3 A;  3GWH A;  5FXV A;  4IE5 A;  1XMO T;  1OXZ A;  2CXD A;  4BAY B;  5CA1 E;  3KBU A;  4DV6 T;  1LVK A;  3OVU A;  3UUL A;  4TN7 B;  4JV5 T;  2JQQ A;  4PJM A;  3UU5 A;  3AEE A;  4HEA A;  2I6H A;  3N2O A;  1YXR A;  4B3M T;  3R6N A;  2JPF A;  3ZCJ A;  3CQC B;  4B3T T;  3MXZ A;  4H9O C;  1ZHC A;  3KVA A;  3ZT5 A;  2VAS A;  2LRK A;  3HL6 A;  1IAP A;  5AQU B;  3UTK A;  2VQE T;  5A1L A;  3AA0 B;  4LF5 T;  4X1Y E;  4I4T E;  5AQH B;  3HR0 A;  5LGU B;  4PJL A;  2KLQ A;  3NZQ A;  3PUS A;  4JI6 T;  2LJL A;  1IJ6 A;  2VKH A;  2K5B B;  2XQ3 A;  5KMG P;  3A8Y C;  2UXX B;  2CWY A;  4X66 T;  2V26 A;  1J1J A;  1WR6 A;  4HWC A;  5AQK B;  2H3R A;  2FUP A;  3M3Z B;  1QLB A;  2GK9 A;  2ODU A;  3PUV F;  1YKE B;  4EV6 A;  2FBW A;  1HG2 A;  4GIW A;  3A7M A;  1T8B A;  3ZST A;  3ESL A;  2Z6E A;  2V6Y B;  4ZI2 C;  2B76 A;  1T7S A;  3CML A;  5JDN A;  2ZLY A;  2JMK A;  4JI0 T;  4QH1 A;  4ZI3 C;  5LHI B;  5J0Z A;  5FMN A;  4QXB B;  5LYJ E;  5CB4 E;  3OBV E;  2FJE A;  2IW5 B;  2HN1 A;  4HFI A;  4TZ4 C;  4UVB B;  4F8H A;  3MJX A;  5FY7 A;  3AE6 A;  4IST A;  4Z90 A;  5JDM A;  2Y8D A;  2X67 A;  5HEU A;  1W9R A;  4C91 A;  3P4W A;  3N9P A;  2BG9 C;  5LG4 A;  1MMD A;  4JEH B;  1MND A;  3Q2M A;  1IZN B;  4O4L E;  4PW8 A;  4YXD A;  2W66 A;  3GN5 B;  2VUR A;  2PJQ A;  3VU7 H;  1HNX T;  4HFD A;  2P9B A;  3MK7 C;  3B13 A;  2CLY C;  1VRB A;  3T8O A;  4A98 A;  4NPP A;  4HWH A;  3RC8 A;  3PDY A;  2VKD A;  3UU4 A;  4X65 T;  3BK9 A;  1Z8U A;  3HKD E;  3VR9 A;  4YLH A;  4GYR A;  2LM2 A;  2V7L A;  4IE6 A;  3SS1 A;  2BG9 A;  4OK0 A;  4CXX A;  4ERR A;  3ZCI A;  2RA1 A;  2WWU A;  2XZE A;  1WFD A;  3ZMV B;  5LP6 E;  4DR1 T;  2LLY A;  3J9X 1;  3ETV A;  1UUS A;  3EUH A;  3LBX B;  3FBL A;  5IHY A;  3CX8 B;  2X68 A;  3N9M A;  1D0Y A;  4CXW A;  3FZH B;  4DMW A;  4U72 A;  4IL9 A;  3TLT A;  4OHF A;  3O9X A;  4X64 T;  3RIA A;  4ASK A;  4ZI7 E;  5AQV B;  2XQ6 A;  1D0Z A;  1X9B A;  2WP9 A;  4DO0 A;  2X9H A;  2WZH A;  5LJM A;  2N1G A;  3RQU A;  2H88 A;  2XM2 A;  4LF6 T;  1ZEE A;  3N5L A;  4JI1 T;  2EHO C;  3T1Y T;  1J5W A;  4YY3 T;  4CI2 B;  3ZYM A;  4U7Y A;  3HKC E;  4LF8 T;  1DU2 A;  3CQX C;  4TUY E;  5KX5 E;  1MMG A;  3PUR A;  1WYB A;  3F31 A;  3ZN0 B;  2M67 A;  3DJB A;  2LRL A;  3Q5E A;  2E9X B;  4ZZB A;  3LG7 A;  4JLE A;  3NKZ A;  3ZC0 A;  3T1H T;  3I9Y A;  2CRB A;  4BA9 A;  3EDV A;  3AA1 B;  3ZN1 B;  3HKE E;  1ZV4 X;  5LMN T;  2UUB T;  4YFS A;  2DL1 A;  2E5V A;  4TWF A;  1YQ4 A;  5HXS A;  2EHO A;  3AXJ A;  1JNR A;  5ABF B;  3TLU A;  4DR3 T;  1HR0 T;  3JC6 C;  3CWZ B;  3NVO A;  3LSV A;  2XQ8 A;  3Q5X A;  5FVL A;  2V1D B;  5HAX A;  3VR8 A;  3N2G E;  3P4Q A;  2V7I A;  2LSJ A;  5JRE A;  4O4J E;  4H9P C;  1I6Z A;  3F2E A;  2L8K A;  2XUE A;  2UUA T;  4J2C A;  3RKO A;  3MAC A;  4HWI B;  1E2A A;  4QKN A;  3TLW A;  2JQK A;  4XAX B;  1E1H B;  2QA7 A;  4O8S A;  1CUN A;  2JRK A;  4I55 E;  2NW8 A;  2K24 A;  4QH4 A;  3BQK A;  3AA7 B;  5LHG B;  4PJJ A;  4ANJ A;  4AKR B;  2BZB A;  4OYK A;  4G63 A;  4WBO A;  4UVC B;  4KBM B;  4HFH A;  3DP7 A;  4NIQ A;  4JUY A;  1OWA A;  2XHE B;  2V7J A;  5FL0 A;  4A56 A;  4DV1 T;  3WI3 A;  1GQE A;  3CKD A;  2WWV A;  3KV6 A;  4U7I A;  2IAK A;  3CX7 B;  3I9W A;  4GK0 E;  4ILA A;  2PTF A;  3ZMZ B;  3IHR A;  4U2Z A;  2WCA A;  2CE7 A;  2I59 A;  4M1P A;  3ZC1 A;  4GK5 E;  3SRZ A;  1UGO A;  3OJA A;  5JH7 E;  4HE8 A;  5AQQ B;  2BVL A;  2HHH T;  5E0O A;  2WM9 A;  3ZT7 A;  2XY8 B;  3N9N A;  5LA6 E;  2ACX A;  5JVD E;  2KZ7 B;  5LJN A;  5HCM A;  4V1A v;  3EHZ A;  2VL0 A;  4MAL A;  3K1S A;  3KVB A;  1HNZ T;  5AQS B;  1CHU A;  3F57 A;  5TAO A;  4N78 D;  3AE9 A;  4JYA T;  3UFG A;  4QX8 B;  2VWA A;  2W0G A;  4LF4 T;  5FY0 A;  2OLT A;  4EYY R;  4PK5 A;  4DID B;  3JCF A;  2AXD S;  3ZJ1 A;  2WSS V;  2J4G A;  3LK2 B;  5FXX A;  3PJA A;  1KNR A;  2Q9Q D;  1HTJ F;  1Y01 A;  1MIV A;  3KFW X;  4EZ4 A;  2BG9 E;  2IDO B;  2E9X D;  4L9I A;  3NZP A;  4JI4 T;  4UXN B;  4I43 B;  2MBG A;  4L0R A;  3L8R A;  2KMF A;  1HX8 A;  4EZH A;  2ES0 A;  1N32 T;  2F4V T;  1MIY A;  3RIF A;  2LM9 A;  2WMN A;  4DVD A;  5ABH A;  2LSG A;  5H6R B;  2V5D A;  4QXC B;  3UUN A;  2X0H A;  4CI3 B;  1KFY A;  5IYZ E;  5JRC B;  3UFE A;  5LOV E;  2MYS A;  4YHH T;  3PE0 A;  4ILB A;  2XQY A;  4JEU B;  3AEG A;  4X1I E;  5L3G B;  1XDP A;  3U3I A;  2V6X A;  3K3Q C;  4HFE A;  3P8C D;  5JDH A;  3C4W A;  2CMR A;  1S94 A;  4IHJ E;  4CQI A;  2MTQ A;  3ZMT B;  2A9U A;  3ZEF B;  2XQ9 A;  4EXT A;  2KXP B;  4AKL A;  4OFZ A;  2C0S A;  4GYS A;  3ZPO A;  4UEM A;  3LDQ B;  4TWH A;  3RF1 A;  2CM0 A;  4A5X A;  4AQF C;  5AQO B;  5M4Y A;  5AQR B;  3V5U A;  4PAG A;  4ZI3 D;  4U3C A;  2NP9 A;  3FZF B;  2X0Y A;  4IDZ A;  4QWN B;  1XMQ T;  1Y64 B;  2WDV A;  2NW9 A;  1OED C;  4LMK A;  4JI7 T;  2MAW A;  3J7Y q;  1QUU A;  1L0V A;  5LG3 A;  1FMW A;  4QH5 A;  2A2F X;  5JR9 C;  3AE5 A;  4O2B E;  1U5P A;  2LSY A;  3VRA A;  5AQT B;  2WB5 A;  2D0T A;  2IC9 A;  3BQI A;  4AQF A;  4LMJ A;  3ETU A;  3U78 A;  5FVK A;  2JMH A;  1HNW T;  2N9D A;  3NBX X;  3OYZ A;  4IDO A;  4P0A A;  2VKO A;  2DWG A;  3JAF A;  4HWF A;  2BKP A;  1OED A;  2A3D A;  4EOZ B;  5C2T A;  3QB5 A;  3PUY F;  4C90 A;  1ZKE A;  2QVA A;  5ADX L;  4HKA A;  3P7I A;  2KT9 A;  5ABG A;  2W61 A;  1D1A A;  2VL8 A;  2CWO A;  2PG8 A;  3M65 A;  1XNR T;  5JR9 A;  2H7O A;  4U2Y A;  2E2A A;  5J2T E;  4I0U A;  4KUM B;  4KP3 C;  5JDQ A;  2E5L T;  3P4P A;  4LFB T;  4YSZ A;  3C4Z A;  5EK2 A;  3CVR A;  5HXE A;  1FMV A;  3NWI A;  2BS2 A;  2XQ4 A;  4UIG A;  3BQL A;  1HX1 B;  4WZX A;  4JI2 T;  5L4H A;  4KX6 A;  4WW0 A;  4MHC A;  5BMV E;  4X62 T;  5DAB A;  3C51 A;  1SUM B;  4CN6 A;  1UX4 A;  2LKH A;  4DR7 T;  4YJ3 E;  3H3M A;  4LF9 T;  1UUR A;  4ISS A;  2HN2 A;  3ZT6 A;  3ANW B;  2LOP A;  3FXD B;  1QSD A;  4F6R C;  4TNW A;  3RYF E;  4HGA A;  1HCI A;  4IDQ A;  5J1G A;  5FNV E;  2H7V C;  2CXF A;  2YKS A;  2WS3 A;  3B5M A;  2VVS A;  2C5K T;  2CEA A;  4EYU A;  2LT3 A;  3UU8 A;  1US7 B;  1EZ3 A;  2FJD A;  1IJ5 A;  4PJN A;  2BVM A;  4EIW A;  5DJQ C;  4UR9 A;  3RKG A;  1NWM X;  2N2N A;  3SWH A;  4ZS2 A;  3TLS A;  5GON E;  5LGT B;  3L39 A;  3ABV A;  2QRX A;  2WDR A;  4AKG A;  2YDR A;  3ZMU B;  4COF A;  2L9Q A;  2Q9Q B;  4ILU A;  3N9O A;  2W00 A;  5HWY A;  4K0U A;  3RYI E;  2E8I A;  1O3X A;  3EI0 A;  3AED A;  2IML A;  5JDF A;  4MBQ A;  3VRB A;  3KV9 A;  1B7T A;  2BS4 A;  2CBJ A;  5CGM A;  2M6B A;  1U4Q A;  1G8X A;  3Q5D A;  3ONL C;  2DI4 A;  4CN1 A;  5EZY E;  3AAE B;  1D1B A;  4UF0 B;  2FJB A;  3PTR B;  2W62 A;  5FKY A;  3P50 A;  2DCF A;  1JNZ A;  2XSB A;  4WBN E;  3OKQ A;  4IGU A;  1SHZ C;  3RIU C;  5LHH B;  3WAJ A;  2CPT A;  4Z91 A;  4GKK T;  4UV8 B;  2YU1 A;  1UK5 A;  2SPC A;  3AEA A;  3CX6 B;  3Q5W A;  4LFC T;  4IE7 A;  4WYV A;  1WCR A;  4KHP T;  4E7Z A;  3PV0 F;  3AE8 A;  3O1I A;  4PNI A;  4KMC A;  3AEC A;  1M7K A;  2R6G F;  4DBR A;  4DV4 T;  4AKI A;  5FYM A;  5L47 A;  4H9R C;  4FI5 A;  1BR2 A;  4H9Q C;  4TNV A;  4H63 H;  3OYX A;  3HKB E;  3RIU A;  4DMV A;  5ABE A;  2CCQ A;  5L3B B;  2XJ7 A;  1UX5 A;  2WZI A;  3AVR A;  4HFV A;  3B57 A;  1N33 T;  4ADZ A;  3I1A A;  2WU5 A;  3A5X A;  3FBZ A;  3KDS E;  4B6X A;  3OPC A;  1R8I A;  4O4I E;  5AQP B;  4Z8X A;  3UUX B;  5FXZ A;  5JDG A;  1XDO A;  1M62 A;  3CPZ A;  4ILC A;  1UCU A;  2V6Y A;  3HA4 A;  4DV7 T;  2D0U A;  3UQ7 A;  3QC9 A;  3FZL B;  2WU2 A;  2NOX A;  1OED E;  4AQY T;  4H9S E;  2KND A;  2OV9 A;  1NAF A;  1NEN A;  5HEH A;  4H9N C;  2C5J A;  1V9D A;  3ZYK A;  2BKN A;  2UXD T;  4P0B A;  5AQI B;  5BR8 T;  4JI3 T;  3MKD A; 
#chains in the Genus database with same CATH homology
 3V5U A;  4PAG A;  3O1J A;  2ZM0 A;  4ZI3 D;  3PUQ A;  2RA1 A;  3ZCI A;  2NP9 A;  4EB6 E;  4AQG A;  3VHL A;  2WWU A;  4IDZ A;  4QWN B;  2JJ9 A;  3IEE A;  1Y64 B;  3ZMV B;  1MNE A;  3MA9 A;  5DQV A;  4DND A;  5LP6 E;  5JDL A;  2NW9 A;  2CXL A;  3J9X 1;  2XTL A;  3ETV A;  5FP3 A;  5JRC A;  3EUH A;  3GN5 A;  3H3A A;  2QGS A;  3LBX B;  5HXR A;  3FBL A;  5IHY A;  2WBL A;  4BJM A;  5LXT E;  3J7Y q;  1QUU A;  1KNZ A;  3CX8 B;  1VOM A;  2X68 A;  3N9M A;  1D0Y A;  2G0U A;  2X51 A;  1WYC A;  4CXW A;  2DLR A;  5JR9 B;  1FMW A;  5FXW A;  2VKJ A;  4DMW A;  5L3E B;  1LRZ A;  4G2A A;  4U72 A;  5HXH A;  4NUU A;  1BR4 A;  4OHF A;  2YU2 A;  4QXH B;  2A2F X;  3O9X A;  4TX5 A;  5JR9 C;  4ASK A;  4MLK A;  4O2B E;  3KV5 A;  4ZI7 E;  5C8Y E;  5HYA A;  1U5P A;  2LSY A;  3ZLI A;  4IIJ E;  1D0Z A;  4DO0 A;  4WNK A;  2UXN B;  2D0T A;  2XAH B;  2IC9 A;  2X9H A;  3BQI A;  3IF8 B;  4AQF A;  5LJM A;  2N1G A;  2EHO B;  3ETU A;  3U78 A;  4DBQ A;  3RPU A;  2JMH A;  1ZEE A;  4TV8 E;  2N9D A;  3N5L A;  2IC6 A;  3NBX X;  3ONX A;  3OYZ A;  3ZJ2 A;  3VKG A;  4P0A A;  3C98 B;  5EK3 A;  2EHO C;  1MMN A;  2VKO A;  3N9Q A;  5L3D B;  2DWG A;  4HTE A;  4ERR A;  2LHN A;  1X79 A;  5F8P A;  4CI2 B;  2A3D A;  2D2S A;  3ZYM A;  4EOZ B;  2VK9 A;  3N2K E;  4C90 A;  3HKC E;  1ZKE A;  5ADX L;  2V7K A;  3CQX C;  2XAJ B;  3E08 A;  4HKA A;  2CLY B;  4TUY E;  3AAI A;  3O4X E;  3N9L A;  3P7I A;  4L5G A;  5KX5 E;  3KBT A;  3LBX A;  2KT9 A;  2NW7 A;  1MMG A;  4CI1 B;  3PUR A;  1WYB A;  3F31 A;  3ZN0 B;  2HH7 A;  2W61 A;  2M67 A;  3IBP A;  2Q9Q C;  1D1A A;  3DJB A;  2VL8 A;  3E22 E;  2CWO A;  3I0Q A;  2E9X B;  4EAH A;  2PG8 A;  2K48 A;  3NRY A;  3C64 A;  3M65 A;  3GMI A;  2H7O A;  3L09 A;  4IE0 A;  5JR9 A;  1AJ3 A;  3LG7 A;  3SOL A;  4JLE A;  3ZC0 A;  2X0L B;  3QK6 A;  3I9Y A;  4BA9 A;  2RP4 A;  5J2T E;  2LSK A;  3EDV A;  2E9X C;  3KIN B;  4GOU A;  4QX7 B;  5LGN B;  3K3O A;  4KUM B;  2DHR A;  4KP3 C;  5JDQ A;  1D1C A;  3AA1 B;  3ZN1 B;  3K3N A;  3HKE E;  1ZV4 X;  3UT5 E;  3C4Z A;  5EK2 A;  3CVR A;  3DTO A;  5HXE A;  2NTX A;  1FMV A;  4YFS A;  3L3P A;  4UIG A;  3BQL A;  5HXS A;  1S35 A;  2HPJ A;  2EHO A;  4ZI2 D;  1FIO A;  2MOZ A;  4WW0 A;  1HG5 A;  1HFA A;  1T98 A;  4MHC A;  2KWI B;  5BMV E;  3WAK A;  5DQW A;  3ZMS B;  5LBM A;  3JC6 C;  5L3C B;  5DAB A;  3CWZ B;  2VB6 A;  3C51 A;  2YK0 A;  3LJC A;  1BR0 A;  4BJN A;  3Q5X A;  1UX4 A;  2V1D B;  5HAX A;  2A72 A;  3N2G E;  3K8P C;  1Z0P A;  5AFU L;  4YJ3 E;  3E0Z A;  2NWB A;  2V7I A;  2LSJ A;  2Q9Q A;  2YEV C;  4ISS A;  3UUM A;  5JRE A;  3ANW B;  3EDU A;  4O4J E;  2LOP A;  4H9P C;  3FXD B;  3TKL B;  1QSD A;  1D0X A;  3F2E A;  1HS7 A;  4F6R C;  1MIW A;  3AA6 B;  3RYF E;  2L8K A;  2XUE A;  4J2C A;  3RKO A;  4HGA A;  3MAC A;  1HCI A;  2X9Y A;  1KK7 A;  2E9X A;  4QKN A;  5JQG E;  5J1G A;  5FNV E;  2H7V C;  4XZC A;  4XAX B;  2D5U A;  2CXF A;  4YJ2 E;  1E1H B;  2QA7 A;  4O8S A;  1CUN A;  2JRK A;  4I55 E;  4CXY A;  2NW8 A;  4ZHQ E;  2ODV A;  4XBF B;  3RX6 A;  2K24 A;  2C5K T;  2CEA A;  2XAG B;  4EYU A;  2LT3 A;  3RH3 A;  3BQK A;  1US7 B;  5L2L A;  1HF8 A;  2WMO A;  2ZMA A;  3AA7 B;  1EZ3 A;  5LHG B;  4PJJ A;  1IJ5 A;  4PJN A;  3ZYL A;  4ANJ A;  2BVM A;  4AKR B;  4EIW A;  2X9W A;  2BZB A;  5DJQ C;  4OYK A;  5J2U E;  4G63 A;  1NWM X;  2N2N A;  2LHR A;  4UF0 A;  4WBO A;  4UVC B;  3C50 A;  3SWH A;  4ZS2 A;  3C4X A;  4KBM B;  3VKH A;  4TV9 E;  3DP7 A;  4PFP A;  2KIN B;  2W63 A;  4JUY A;  5GON E;  1OWA A;  4FJO A;  2J1D G;  3HI2 A;  5LGT B;  5CA0 E;  4IE4 A;  4QHO A;  4UEL A;  2XHE B;  2V7J A;  4O2A E;  4AKG A;  2NTY A;  3ZMU B;  2K9A A;  3PUA A;  4A56 A;  1G73 A;  2L9Q A;  2Q9Q B;  3WI3 A;  4ILU A;  1LVF A;  3CKD A;  3N9O A;  3AVS A;  2W00 A;  5HWY A;  4K0U A;  3RYI E;  2E8I A;  3ANW A;  2LE8 A;  3LFM A;  3KV6 A;  3RRW A;  3PUG A;  1WLX A;  1O3X A;  3O1H A;  2IAK A;  5L3F B;  2Y48 B;  3CX7 B;  1FEW A;  3RRC A;  3I9W A;  4GK0 E;  3GWH A;  3NRX A;  5FXV A;  3FB2 A;  4IE5 A;  1WRD A;  3ZMZ B;  1OXZ A;  2CXD A;  5JDF A;  3IHR A;  3KBU A;  4BAY B;  5CA1 E;  3EVY A;  1LVK A;  2CE7 A;  2I59 A;  4M1P A;  3CQG B;  4MBQ A;  4E7S A;  2KWH A;  4PK6 A;  3KV9 A;  3UUL A;  3ZC1 A;  1B7T A;  4TN7 B;  2L3L A;  5ETW A;  2ZM2 A;  2JQQ A;  5LCY A;  4PJM A;  4GK5 E;  3SRZ A;  4HEA A;  1U4Q A;  3FHN A;  3N2O A;  1G8X A;  2X66 A;  2DI4 A;  3PU3 A;  2X9X A;  3OJA A;  5JH7 E;  4HE8 A;  5LNK A;  1YW0 A;  2BVL A;  5EZY E;  3Q9D A;  3AAE B;  3R6N A;  3PU8 A;  1D1B A;  4UF0 B;  5EK4 A;  5E0O A;  2JPF A;  3ZCJ A;  2WM9 A;  3CQC B;  3PTR B;  2W62 A;  3MXZ A;  3N9N A;  4H9O C;  5LA6 E;  2ACX A;  5JVD E;  2KZ7 B;  1ZHC A;  3KVA A;  5LJN A;  2VAS A;  4PFO A;  2DCF A;  3HL6 A;  3LK3 B;  1IAP A;  5HWX A;  3UTK A;  5A1L A;  3AA0 B;  4V1A v;  4X1Y E;  4PK4 A;  4I4T E;  4MAL A;  3KVB A;  5LBQ B;  3OKQ A;  4WBN E;  3HR0 A;  5LGU B;  2C5I T;  1H7C A;  4PJL A;  1YKH B;  2YIN A;  4IGU A;  3V5S A;  3F57 A;  2KLQ A;  3NZQ A;  1SHZ C;  5TAO A;  4N78 D;  5LHH B;  3WAJ A;  2HPL A;  2XAQ B;  3I0O A;  3PUS A;  2LJL A;  1IJ6 A;  4UV8 B;  2VKH A;  2K5B B;  2YU1 A;  5KMG P;  2SPC A;  2EHO D;  2UXX B;  4QX8 B;  2VWA A;  3CX6 B;  2W0G A;  4CZZ B;  3Q5W A;  2CWY A;  5FY0 A;  2V26 A;  1YD8 G;  4IE7 A;  4X20 E;  1WR6 A;  3FXE B;  4EYY R;  4PK5 A;  2H3R A;  3ZJ1 A;  2GK9 A;  4E7Z A;  2ODU A;  4AXP A;  2WSS V;  3O1I A;  4PNI A;  1YKE B;  4KMC A;  3D0T A;  3LK2 B;  4P09 A;  1MMA A;  5FXX A;  1HG2 A;  4YHJ A;  1BR1 A;  4GIW A;  2Q9Q D;  4DBR A;  2WAU A;  3ESL A;  1HTJ F;  4AKI A;  2Z6E A;  5FYM A;  1MIV A;  3KFW X;  2XAS B;  4EZ4 A;  4AI6 A;  4ZI2 C;  3AAA B;  3CML A;  5JDN A;  2E9X D;  4H9R C;  4FI5 A;  1BR2 A;  2ZLY A;  2JMK A;  4H9Q C;  4L9I A;  3NZP A;  2Y6X A;  4ZI3 C;  5LHI B;  5FMN A;  4QXB B;  5LYJ E;  4H63 H;  2BDE A;  3OYX A;  5CB4 E;  3HKB E;  3OBV E;  4UXN B;  4I43 B;  5HXC A;  2MBG A;  4DMV A;  3RYC E;  4L0R A;  4UVA B;  4NUV A;  2IW5 B;  4TZ4 C;  2LEH A;  2KMF A;  4UVB B;  1HX8 A;  2PFV A;  3MJX A;  5FY7 A;  4EZH A;  2CCQ A;  2B1E A;  2ES0 A;  5L3B B;  4I50 E;  4IST A;  1UX5 A;  5KDM C;  1MIY A;  2LM9 A;  5JDM A;  3AVR A;  4HFV A;  3JC6 D;  3B57 A;  2Y8D A;  3RC3 A;  4ADZ A;  2X67 A;  2LSI A;  2WMN A;  3S4U A;  4DVD A;  4C91 A;  2LSG A;  3I1A A;  5H6R B;  3N9P A;  4QXC B;  5LG4 A;  1MMD A;  4JEH B;  3A5X A;  3UUN A;  1LKX A;  1MND A;  2V7M A;  2OA5 A;  3LK4 2;  4CI3 B;  4ZOL E;  3H37 A;  3Q2M A;  1IZN B;  4O4L E;  4PW8 A;  4X1K E;  2DNX A;  5IYZ E;  3FBZ A;  3MZK B;  3R84 B;  5JRC B;  3GN5 B;  3KDS E;  3UFE A;  4B6X A;  4O4I E;  5LOV E;  2PJQ A;  3VU7 H;  2MYS A;  4Z8X A;  3UUX B;  3W15 B;  5FXZ A;  5JDG A;  2P9B A;  3PE0 A;  5F3J A;  3MK7 C;  3B13 A;  2CLY C;  1VRB A;  3T8O A;  2XQY A;  4JEU B;  4AKH A;  3CPZ A;  4X1I E;  5FY1 A;  1UCU A;  3QUJ A;  5L3G B;  2CA5 A;  3RC8 A;  3GA8 A;  3U3I A;  3PDY A;  4H63 V;  3HA4 A;  1SA0 E;  3K3Q C;  2D0U A;  4HN9 A;  2VKD A;  3QC9 A;  3P8C D;  5JDH A;  3C4W A;  2CMR A;  2ZM8 A;  2LOS A;  2NOX A;  4UV9 B;  1S94 A;  4IHJ E;  4MFR A;  4CQI A;  2MTQ A;  2XAF B;  3ZMT B;  4H9S E;  4OYJ A;  2PBI A;  3KV4 A;  2KND A;  1NAF A;  4ZS3 A;  4H9N C;  3ZEF B;  3RYH E;  3BK9 A;  2C5J A;  5H6Q B;  3HKD E;  1V9D A;  4EXT A;  4O4H E;  2KXP B;  3ZYK A;  4AKL A;  4YLH A;  4GYR A;  4OFZ A;  2C0S A;  4GYS A;  3ZPO A;  2DWK A;  2V7L A;  4UEM A;  4P0B A;  4IE6 A;  2CM0 A;  4AQF C;  4U74 A;  4OK0 A;  3SS1 A;  4CXX A;  5M4Y A;  3AB3 B;  3MKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...