3OBVE

Autoinhibited formin mdia1 structure
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
442
structure length
419
Chain Sequence
KVYKPEVQLRRPNWSKFVAEDLSQDCFWTKVKEDRFENNELFAKLTLAFSAQVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLELTLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDETGVMDSLLEALQSGAAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of the Formin mDia1 in autoinhibited conformation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords Protein diaphanous homolog 1
total genus 138
structure length 419
sequence length 442
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF06345 Drf_DAD DRF Autoregulatory Domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3obvE02
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3obvE03
1UX4A 3O4XE 3OBVE 1UX5A 1Y64B 4EAHA 2Z6EA 2J1DG 1V9DA
chains in the Genus database with same CATH superfamily
2JIWA 4OX9T 2YK0A 3RYFE 1LVKA 1HCIA 4U74A 4PK6A 5JVDE 3X1DA 3NKZA 3ZKRA 3UU6A 2Y48B 2HPJA 3NRXA 4TWFA 1LRZA 5HXSA 1N36T 4NPPA 4X1KE 5FNVE 4TV9E 1SA0E 5JTGA 4DMVA 5C2TA 4JYAT 2AE9A 2NWBA 2BKOA 2E9XA 1OEDE 2KWIB 2V7JA 4UV8B 3M3ZB 5AQVB 4DMWA 5FMNA 4YJ2E 5L2LA 3F57A 3L09A 2CXDA 3LBXA 1HG5A 3KBTA 4H63H 2X9WA 4I43B 1MNEA 5AQQB 3UUBA 4AQYT 5F8PA 2IW5B 4L0RA 3RRWA 4EEBA 1ZHCA 4HWCA 3HKEE 2NW9A 2ZM2A 4UV9B 5LMNT 4QXBB 4DR4T 1W0BA 2IIUA 2QGSA 3AA1B 4QKNA 4QXHB 5LHIB 1HR0T 2VASA 4IL4A 3ZT6A 2JQHA 5M4YA 2HHHT 2WWUA 5AQSB 2X66A 3AB3B 5AQNB 4YY3T 4B3ST 1KNZA 4X1YE 2YDSA 4HFIA 1T72A 2H88A 3RH3A 5J0ZA 4LMKA 4FJOA 5JDQA 2CRBA 4AQGA 2BG9B 2XQ9A 3KINB 3AA7B 4BJMA 3HL6A 2Q9QA 3PTRB 3ONJA 3BQLA 5LG3A 3LJCA 2LT3A 4IREA 2BG9A 3CMLA 3FBZA 4YTMA 5KXJA 2C5KT 4LF6T 3N5LA 4WBOA 2LKGA 5FY1A 5IWAT 1T98A 5GONE 3CX7B 2GK9A 2VB6A 2W63A 2D0UA 4OYJA 4U33A 2PTFA 1G73A 4CXXA 3IBPA 2XSBA 4ZZCA 3KBUA 3ZMZB 5FL1A 2BKPA 2Y6XA 3N2OA 4KBMB 5CB4E 3Q2MA 4TNWA 1T7SA 2R6GF 2WS3A 4EZHA 4CN1A 4DR2T 5HYAA 4H9NC 4YFSA 5JH7E 4GYRA 4BJNA 4JI0T 1HNWT 1IBMT 2KWHA 2XTLA 3SRZA 4ZZBA 5JRCB 4CN6A 2CE7A 4AKHA 5H6RB 1VCTA 3SOLA 4DVDA 5JREA 4QH4A 4YSZA 2UUCT 4A97A 3H37A 2J47A 1J1JA 1CUNA 3K3NA 5LJNA 4KMCA 2WSSV 4TWHA 2W67A 3DP7A 2I0MA 5HEUA 3GN5B 4YXDA 5L3GB 2I6HA 1FJGT 2SPCA 1UX4A 3AE1A 4UF0B 5ABEA 2N2NA 5L4EA 5IYZE 4N78D 1WRDA 2V6YA 3RKOA 3RHWA 3UUNA 2FJAA 2JMHA 3FXDB 2NR4A 4JEHB 3J9X1 2XPKA 3CQCB 2BVLA 4JI3T 5LA6E 2HN1A 4IIJE 4CI1B 5LJMA 2PFVA 4LF7T 4IDNA 3GA8A 3Q5XA 2JMKA 3RF1A 3SWHA 1HX8A 4NXNT 2XQ7A 4EXTA 2QA7A 3PUGA 3PV0F 5L3CB 4HFVA 4LF9T 2V5DA 3R84B 3ZJ1A 2WMOA 1OEDB 2BBHA 3MJXA 5FKYA 4AQFA 5LMUT 1X79A 1N34T 2JJ9A 2LLYA 3AEGA 4HWFA 5AQTB 1M7KA 3N9PA 1MMNA 4PNIA 5CJ5A 1IJ5A 3MA9A 2BBJA 2WZHA 3PURA 4H63V 2A72A 5TAOA 3RPUA 4B3RT 2XAFB 4JI6T 1X9BA 4WNKA 4A98A 2JQ9A 3L3PA 2V7LA 2ZM8A 3OTOT 3TLWA 4EAHA 4JI8T 3AVSA 4DR5T 2IHR1 4LF5T 5FL0A 3N9LA 1JNZA 2RPAA 3NWIA 2XQAA 2K9AA 3VKGA 2J62A 3FZMB 4B3MT 1HS7A 2QYWA 4O8SA 3VR9A 4YSXA 1ZKEA 3RYHE 3CPZA 4AISA 1J5WA 4IL9A 1MMGA 2ACXA 3UQ4A 4QX7B 2BG9E 3AXJA 2H89A 5HCMA 3RIAA 3EVYA 3NZPA 2DI4A 4GK5E 5HXCA 3F31A 3ZYKA 3ZYLA 2YDQA 4PK5A 3TKLB 3ZCJA 2UUAT 4AKGA 1BR4A 2RP4A 4U3CA 1IJ6A 2MPKA 5LP6E 4XZCA 5HAXA 4X65T 1WR0A 5BMVE 1SE7A 2JQKA 3QC9A 3OBVE 1YKHB 3I0OA 3B57A 4ZI3D 3CQXC 5KDMC 5A1LA 2X0HA 4UR9A 2CHNA 4L5GA 3CX8B 3PUVF 4HWIB 2BS3A 2BG9C 2CBIA 4WYVA 2KMFA 2CPTA 5L4HA 4DV7T 2IC9A 4V1Av 2L8KA 3R6NA 5JDGA 1CHUA 5AQRB 3N2KE 4QH1A 1UURA 4CI3B 2EHOA 4DR7T 4PAGA 4GKKT 4ERRA 4CZZB 2D0TA 4U2YA 4DBQA 3IEEA 2WB5A 4AXPA 3P8CD 2N9DA 4AKRB 4B3TT 2X68A 2MOZA 2XAQB 3P4RA 2YKSA 3UU8A 2WU5A 3OYZA 3LK3B 2UXNB 1MIVA 4OHFA 5LXTE 2D5UA 4DV5T 1E7PA 4U7IA 3K1SA 2E9XB 4IE0A 2X0YA 2CBJA 4I50E 2PG8A 2WZIA 3AAIA 1NENA 3D0TA 5FXZA 5JDFA 5ABFB 2WMNA 3C50A 5AQJB 3JAFA 3VR8A 5LBQB 2J1DG 2V5CA 4GOUA 2HN2A 4HFHA 4U2ZA 2X9XA 2W62A 2Y8DA 4OK0A 4MHCA 2LSGA 5C8YE 2V7KA 2XAGB 3UFGA 4ZI2D 3O1HA 3VRBA 5FVKA 2X67A 3RGLA 3P7IA 2UXXB 1S35A 3AE8A 4KUMB 4KX6A 2YDRA 3LSVA 4NUUA 3KV6A 2X9YA 2CEAA 3C4ZA 4C91A 4JV5T 3AEAA 5E0OA 1R8IA 4ADZA 1L0VA 2VQFT 1WYBA 1MNDA 3JC6D 3P4PA 4YHJA 1E1HB 3ONXA 2XAHB 3Q9DA 3NBXX 1FMWA 5AQGB 3RI5A 3ZEFB 1I6ZA 3G06A 3Q5EA 2Q9QD 4AQFC 4BA9A 4O2AE 2J4GA 2BKNA 3LK2B 2WQYA 3V5UA 4K0KT 2XJ7A 2VKOA 3AE9A 3BK9A 1QLBA 2V7IA 2XAJB 5HXEA 3OJAA 4Q25A 2CXFA 4H9SE 2EHOD 4TV8E 4DO0A 2LEHA 2B76A 2X0LB 3P4QA 3ZN1B 1SUMB 4YJ3E 5FY7A 4LF8T 2ZLYA 4QX8B 1KFYA 4UELA 2KINB 3ABVA 3ETUA 3RIUA 4IE7A 2N1GA 5AQLB 4EEDA 2Z6EA 1WYCA 4TWDA 3EUHA 3RYCE 2UXCT 2LJLA 1QUUA 2FJEA 4WBNE 4EV6A 5FY0A 5JDLA 3FB2A 4TNVA 3QB5A 5AQIB 1MMAA 3O1JA 5HEJA 3AECA 3ANWB 2KLQA 4MALA 5JQGE 1KNPA 2JPFA 3PU3A 3MXZA 2A3DA 5LHGB 1YKEB 3FZKB 4TZ4C 2VVNA 4ZEYA 3PJAA 2WWVA 3J7Yq 1D0YA 2K24A 3MK7C 4GIWA 2KNDA 2LSYA 3QNUA 4YLHA 5AQUB 2CXLA 3A7MA 5EK2A 3U3IA 3NRYA 1O3XA 5LB7B 1N33T 2YOEA 3F2EA 1W09A 3CVRA 2CLYB 2X9HA 3M65A 2V26A 3BQKA 4ISSA 3RX6A 4JLEA 2VVSA 4TN7B 3I9WA 4Z91A 4JI2T 2NW7A 2MBGA 1ZV4X 2E8IA 3QUJA 5FXWA 2LSIA 4P0AA 4DBRA 3AE6A 4C90A 4JI4T 4H9QC 4LMLA 1QSDA 4OYKA 3HKDE 4QH5A 2YINA 4PFPA 1JNRA 4JI7T 4GKJT 1HTJF 4KI0F 3OPCA 3UT5E 5LCYA 5DQWA 5KX5E 2OLTA 2YU2A 2JQQA 2NTXA 2PJQA 3C64A 3ZYMA 5CFBA 4EOZB 4HFEA 1NAFA 5ABFA 4H9PC 5LYJE 1VCSA 1W9RA 3FBLA 3H3AA 4H9RC 3RLFF 2BDEA 2DCFA 3N9QA 2ZMAA 3EAMA 5EK4A 5JR9A 1E2AA 5ETWA 1T8BA 3EDVA 2VK9A 3FZFB 3L39A 1D1BA 1NEKA 2E9XD 4HWDA 2PBIA 3HKBE 3IF8B 4QWNB 5HCJA 5JRCA 1DU2A 3ZMVB 1WR6A 1HFAA 2WDRA 2L3LA 3ANWA 3I9YA 3ONLC 4I4TE 4DR1T 2E5LT 4TUYE 1U5PA 2KT9A 3PU8A 4YTPA 4CXYA 3UQ7A 2IAKA 2LM9A 5L3DB 3SFEA 2ODUA 1IAPA 5HEGA 4GK0E 5HEHA 5LG4A 2L9QA 1HNXT 1HF8A 3UU3A 3DJBA 4EGWA 2F4VT 2WAUA 2YEVC 2XQ3A 3GWHA 3W15B 4PJMA 2H3RA 4E7SA 3T8OA 4CI2B 4ZI7E 5LGNB 3PUWF 4X64T 2ZM0A 3RKGA 2XQ8A 3AE5A 2ODVA 2FJBA 4DNDA 4J2CA 5C3JA 3N2GE 2ZM6T 4LFCT 3VU7H 4DV1T 1HX1B 1YW0A 2LRLA 3CWZB 4HTEA 4F6RC 3RIUC 1W0AA 2H7OA 5H6QB 4CQIA 5F3JA 3B5MA 4KP3C 2AXDS 1B7TA 2ACZA 4KHZF 3C4WA 5EZYE 4P1NA 3S4UA 5L3EB 4COFA 5F5WA 4EZ4A 4ZI2C 1KK7A 4EYUA 5JDHA 4JBWF 3AXJB 2WM9A 1ZOYA 1Y64B 3P4WA 3CIRA 4A56A 1UGOA 5JR9C 5DQVA 4JI5T 4ISTA 4EB6E 5AQHB 4LF4T 2VKDA 4DR3T 2MYSA 3OYXA 3HKCE 2DL1A 4NUVA 2H7VC 1D1AA 1UCUA 2LSKA 3AEDA 4I55E 4L9IA 3ZPOA 1UK5A 3KDSE 3K3OA 2XM2A 2XHEB 5HXRA 3ZLIA 2WBLA 3KVAA 2WY2A 3PUYF 5J1GA 4JEUB 4PJJA 4O4HE 2MAWA 2XY8B 5DJQC 3PDYA 3RYIE 3FXEB 5LBMA 3CQGB 3UUMA 2LSJA 4YTNA 5LHHB 3ZC0A 3PUXF 5CGMA 3KV4A 3PUZF 4EYYR 4DUZT 4DR6T 4LFBT 1LKXA 4HN9A 1HNZT 2LHRA 4PJNA 2BS2A 5FVLA 1ZEEA 4OFZA 5L3FB 2K48A 3O9XA 4DV4T 1XZYA 2DWKA 3RRCA 2XM1A 4PFOA 3EABA 5JDNA 1XMOT 1SHZC 3LFMA 2HH7A 4CXWA 3UU5A 4YHHT 2LE8A 3AA6B 3FHNA 3AVRA 3H3MA 3Q5WA 2I59A 4UVBB 4Z90A 3TLVA 4UF0A 5FYMA 4F8HA 3JCFA 3ZCIA 1KF6A 2LM2A 2LRKA 5CA0E 5BR8T 4JI1T 3EDUA 5HEOA 4AKIA 3ZC1A 4QXCB 2DWGA 4X5TA 2DNXA 2X51A 3C98B 1EZ3A 2P9BA 3PJAJ 4ZXLA 3PUSA 2B1EA 4EIWA 3WAJA 2V7MA 2A9UA 4AI6A 4ASKA 1M62A 2M6BA 4ILUA 4NIQA 4X20E 4HE8A 4UXNB 1N32T 1US7B 1VRBA 3LDQB 3JADA 3RQWA 2UXDT 1Y01A 3TLSA 4B6XA 1S94A 2C5JA 2CCQA 2W00A 3KVBA 4UVAB 2WU2A 5AQPB 3SS1A 2Q9QC 3AE4A 3B13A 2XZEA 3QK6A 3VKHA 3ZSSA 3O4XE 3E22E 2KXPB 2UUBT 4H9OC 1WFDA 5AQOB 3HA4A 4IT4A 3RIFA 1BR2A 5ADXL 2UU9T 2V1DB 5IHYA 1BR0A 4I0UA 4XAXB 2M6IA 3JC6C 1OWAA 1KEYA 5HWXA 2FUPA 4IHJE 4IDZA 4DV2T 4NXMT 4HFCA 1H7CA 3AE7A 4O4JE 3UU4A 4ZHQE 2BZBA 1XDOA 2KZ7B 2XQ4A 3LK42 4U7YA 3V5SA 2OA5A 2W4XA 4MFRA 3VRAA 4ZOLE 2IDOB 1UUSA 1D1CA 1UX5A 4O4LE 2Q9QB 4ILBA 5FXVA 4X1IE 4O4IE 5AFUL 1HG2A 3MZKB 4LMJA 4DV3T 3KV5A 2XQ6A 2W66A 1OEDA 4HWHA 2ES0A 3OVUA 4PW8A 2C0SA 2XSAA 2WP9A 3C4XA 2CMRA 2OV9A 3AE2A 1IBKT 5CA1E 2JRKA 4P09A 3K3QC 2K3WA 1FIOA 1VOMA 2CWOA 3QOFA 2K5BB 4UEMA 3UFEA 4IE6A 4A5XA 3I1AA 2CLYC 3E0ZA 3NZQA 4HEAA 1YQ4A 1WLXA 2C5IT 2IC6A 4DV6T 3ZJ2A 2LHNA 3KV9A 5LNKA 3A8YC 2XUEA 3GMIA 4UVCB 5L47A 4PJLA 3CX6B 3ZN0B 1OXZA 3ESLA 1D0ZA 2V8SV 2XASB 3GN5A 5J2TE 5LOVE 1AJ3A 1KNRA 2YN6A 2VKJA 3A5XA 3KFWX 2W2UA 3LG7A 2QRXA 2NP9A 5JR9B 2UXBT 3ZT7A 3FZLB 2G0UA 3PUQA 3AAAB 2D9DA 2VURA 3AA0B 3O1IA 4AIUA 4U72A 4UIGA 5LGUB 1MMDA 4IE5A 3AEEA 3P50A 3C51A 2W61A 2E2AA 4IDOA 5LGTB 2CHOA 1YXRA 4ZS3A 2NOXA 2WDVA 4X62T 1NWMX 4ANJA 4PK4A 2DHRA 5ABHA 5AQMB 1BR1A 2V6XA 5DABA 3ZMUB 3K8PC 3PUAA 4P0BA 2D2SA 2EHOC 3P4SA 3EHZA 3E08A 2BS4A 3HR0A 1U4QA 3AEBA 3TLTA 4U31A 5HWYA 1YD8G 1LVFA 2V6YB 1GQEA 2IMLA 2WDQA 3IHRA 1FMVA 3RC3A 5KMGP 1MIWA 2HPLA 2NW8A 1IBLT 2RA1A 3EI0A 1WCRA 4HKAA 4DV0T 1XDPA 1Z0PA 2YU1A 4ZS2A 3T1YT 5AQFB 3N9MA 1IZNB 4FI5A 4K0UA 4GYSA 3AEFA 2FBWA 3UULA 2DLRA 4DUYT 3AE3A 3ZSTA 1XNQT 2KSRA 2BVMA 1D0XA 1Z8UA 2VKHA 3N9OA 3Q5DA 3VHLA 1G8XA 2CWYA 4ILCA 4IDQA 4WW0A 3ZMTB 4HGAA 5IUXA 2VWAA 2XQYA 2M67A 1YQ3A 2QVAA 2VL8A 3FZHB 2W0GA 3MACA 3MKDA 4XBFB 4Z8XA 3BQIA 4G2AA 1MIYA 1XNRT 5L3BB 4DIDB 5HXHA 3L8RA 5AQKB 4QHOA 4IGUA 3DTOA 3SFDA 3U78A 2VL0A 4X66T 3RC8A 4TX5A 2WCAA 3CKDA 3CK6A 4MLKA 4ZI3C 4MBQA 1J5ET 3I0QA 4KHPT 3JAEA 1ZP0A 2LOPA 3LBXB 4WZXA 4BAYB 4G63A 1XWMA 5EK3A 4CN4A 2A2FX 1V9DA 2E5VA 4ILAA 2MTQA 4IDPA 4M1PA 4IE4A 4O2BE 3WAKA 2LKHA 3AAEB 3N9NA 3UTKA 3ZT5A 2LOSA 1XMQT 2FJDA 2VQET 3HI2A 3RQUA 3PE0A 4JUYA 3ETVA 3IA3A 5FP3A 4AKLA 3NVOA 2IUBA 3T1HT 5FXXA 4HFBA 2CM0A 5J2UE 1FEWA 2CA5A 5JDMA 4YT0A 1I94T 1OEDC 3OKQA 3QB5K 4E7ZA 5ABGA 2EHOB 3TLUA 4LFAT 2E9XC 3UUXB 3ZMSB 2NTYA 2XQ5A 3WI3A 4YSYA 4HFDA
chains in the Genus database with same CATH topology
2YK0A 3RYFE 1LVKA 1HCIA 4U74A 4PK6A 5JVDE 4ANJA 2Y48B 2HPJA 3NRXA 5HXSA 1LRZA 4X1KE 5FNVE 4TV9E 1SA0E 4DMVA 2NWBA 2V7JA 2E9XA 2KWIB 4DMWA 4UV8B 4YJ2E 5FMNA 5L2LA 3F57A 3L09A 2CXDA 3LBXA 1HG5A 3KBTA 4H63H 2X9WA 4I43B 1MNEA 5F8PA 2IW5B 4L0RA 3RRWA 1ZHCA 3HKEE 2NW9A 2ZM2A 4UV9B 4QXBB 2QGSA 3AA1B 4QKNA 4QXHB 5LHIB 2VASA 2WWUA 2X66A 3AB3B 4X1YE 3RH3A 4FJOA 5JDQA 4AQGA 3KINB 3AA7B 4BJMA 3HL6A 2Q9QA 3PTRB 3BQLA 3LJCA 2LT3A 3CMLA 3FBZA 2C5KT 3N5LA 4WBOA 5FY1A 1T98A 5GONE 3CX7B 2GK9A 2VB6A 2W63A 2D0UA 4OYJA 4CXXA 1G73A 3IBPA 3KBUA 3N2OA 2Y6XA 4KBMB 5CB4E 3Q2MA 4EZHA 5HYAA 4H9NC 4YFSA 5JH7E 4GYRA 4BJNA 2KWHA 2XTLA 3SRZA 5JRCB 2CE7A 4AKHA 5H6RB 3SOLA 4DVDA 5JREA 3H37A 5LJNA 1CUNA 3K3NA 4KMCA 2WSSV 3DP7A 3GN5B 5L3GB 2SPCA 1UX4A 4UF0B 2N2NA 5IYZE 4N78D 1WRDA 3RKOA 3ZMZB 3UUNA 4E7SA 2JMHA 3FXDB 4JEHB 3J9X1 3CQCB 2BVLA 5LA6E 4IIJE 4CI1B 5LJMA 2PFVA 3GA8A 3Q5XA 2JMKA 3SWHA 1HX8A 4EXTA 2QA7A 3PUGA 5L3CB 4HFVA 3R84B 3ZJ1A 2WMOA 3MJXA 4AQFA 1X79A 2JJ9A 3N9PA 1MMNA 4PNIA 1IJ5A 3MA9A 3PURA 4H63V 5TAOA 2A72A 3RPUA 2XAFB 4WNKA 3L3PA 2V7LA 2ZM8A 4EAHA 3AVSA 3N9LA 2K9AA 3VKGA 1HS7A 4O8SA 1ZKEA 3RYHE 3CPZA 1MMGA 2ACXA 4QX7B 3ZYKA 3EVYA 3NZPA 2DI4A 4GK5E 5HXCA 3F31A 3ZYLA 4AKGA 4PK5A 3ZCJA 3TKLB 1BR4A 2RP4A 1IJ6A 5LP6E 4XZCA 5HAXA 5BMVE 3QC9A 3OBVE 1YKHB 3I0OA 3B57A 4ZI3D 3CQXC 5KDMC 5A1LA 4L5GA 3CX8B 2KMFA 2IC9A 4V1Av 2L8KA 3R6NA 5JDGA 3N2KE 4CI3B 2EHOA 4PAGA 4ERRA 4CZZB 2D0TA 4DBQA 3IEEA 4AXPA 3P8CD 2N9DA 4AKRB 2X68A 2MOZA 2XAQB 3OYZA 3LK3B 2UXNB 1MIVA 4OHFA 5LXTE 2D5UA 2E9XB 4IE0A 4I50E 2PG8A 3AAIA 3D0TA 5FXZA 5JDFA 2WMNA 3C50A 4C90A 5LBQB 2J1DG 4GOUA 2X9XA 2W62A 2Y8DA 4OK0A 4MHCA 2LSGA 5C8YE 2V7KA 2XAGB 4ZI2D 5J2UE 3O1HA 2X67A 3P7IA 2UXXB 1S35A 4KUMB 4C91A 4NUUA 3KV6A 2X9YA 2CEAA 3C4ZA 5E0OA 4ADZA 1WYBA 1MNDA 3JC6D 4YHJA 1E1HB 3ONXA 2XAHB 3Q9DA 3NBXX 1FMWA 3ZEFB 2Q9QD 4AQFC 4BA9A 4O2AE 3V5UA 3LK2B 2VKOA 3BK9A 2XAJB 2V7IA 5HXEA 3OJAA 2CXFA 4H9SE 2EHOD 4TV8E 4DO0A 2LEHA 2X0LB 3ZN1B 4YJ3E 5FY7A 2ZLYA 4QX8B 4UELA 2KINB 3ETUA 4IE7A 2N1GA 2Z6EA 1WYCA 3RYCE 3EUHA 2LJLA 1QUUA 4WBNE 5JDLA 5FY0A 3FB2A 1MMAA 3O1JA 3ANWB 2KLQA 4MALA 5JQGE 2JPFA 3PU3A 3MXZA 2A3DA 5LHGB 1YKEB 4TZ4C 3J7Yq 1D0YA 2K24A 3MK7C 4GIWA 2KNDA 2LSYA 4YLHA 2CXLA 5EK2A 3U3IA 3NRYA 1O3XA 3F2EA 3RX6A 3CVRA 2CLYB 2X9HA 3M65A 2V26A 3BQKA 4ISSA 4JLEA 4TN7B 3I9WA 2NW7A 2MBGA 1ZV4X 2E8IA 3QUJA 5FXWA 2LSIA 4P0AA 4DBRA 4H9QC 1QSDA 4OYKA 3HKDE 2YINA 4PFPA 1HTJF 3UT5E 5LCYA 5DQWA 5KX5E 2YU2A 2JQQA 2NTXA 2PJQA 3C64A 3ZYMA 4EOZB 1NAFA 5LYJE 4H9PC 3FBLA 3H3AA 4H9RC 2BDEA 2DCFA 3N9QA 2ZMAA 5EK4A 5JR9A 5ETWA 3EDVA 2VK9A 1D1BA 2E9XD 2PBIA 3HKBE 3IF8B 4QWNB 5JRCA 3ZMVB 1WR6A 1HFAA 3ANWA 2L3LA 4I4TE 3I9YA 4TUYE 1U5PA 2KT9A 3PU8A 4CXYA 2IAKA 2LM9A 5L3DB 2ODUA 1IAPA 4GK0E 2L9QA 1HF8A 3DJBA 2WAUA 2YEVC 3GWHA 3W15B 4PJMA 2H3RA 3T8OA 4CI2B 4ZI7E 5LGNB 2ZM0A 4DNDA 2ODVA 4J2CA 3N2GE 3VU7H 1YW0A 3CWZB 4F6RC 4HTEA 4CQIA 5H6QB 2H7OA 4KP3C 1B7TA 3S4UA 3C4WA 5EZYE 5L3EB 4EZ4A 4ZI2C 1KK7A 4EYUA 5JDHA 2WM9A 1Y64B 4A56A 5DQVA 4EB6E 4ISTA 2VKDA 2MYSA 3OYXA 3HKCE 4NUVA 2H7VC 1D1AA 1UCUA 2LSKA 4I55E 4L9IA 3ZPOA 3KDSE 3K3OA 2XHEB 5HXRA 3ZLIA 2WBLA 3KVAA 5J1GA 4JEUB 4PJJA 4O4HE 5DJQC 3PDYA 3RYIE 3FXEB 5LBMA 3CQGB 3UUMA 2LSJA 3ZC0A 5LHHB 3KV4A 4EYYR 1LKXA 4HN9A 2LHRA 4PJNA 1ZEEA 4OFZA 5L3FB 2K48A 3O9XA 2DWKA 3RRCA 4PFOA 5JDNA 1SHZC 3LFMA 2HH7A 4CXWA 2LE8A 3AA6B 3FHNA 3AVRA 3Q5WA 4UVBB 2I59A 5F3JA 5LGTB 1KNZA 4UF0A 5FYMA 4XBFB 3ZCIA 5CA0E 3EDUA 4AKIA 3ZC1A 4QXCB 2DWGA 2DNXA 2X51A 3C98B 1EZ3A 2P9BA 3PUSA 2B1EA 4EIWA 3WAJA 2V7MA 4AI6A 4ASKA 4ILUA 4X20E 4HE8A 4UXNB 1US7B 1VRBA 4B6XA 1S94A 2C5JA 2CCQA 2W00A 3KVBA 4UVAB 3SS1A 2Q9QC 3B13A 3QK6A 3VKHA 3O4XE 3E22E 2KXPB 4H9OC 5ADXL 3HA4A 1BR2A 2V1DB 5IHYA 1BR0A 4XAXB 3JC6C 1OWAA 5HWXA 4IHJE 4IDZA 1H7CA 4O4JE 4ZHQE 2BZBA 3LK42 2KZ7B 3V5SA 2OA5A 4MFRA 4ZOLE 1D1CA 1UX5A 4O4LE 2Q9QB 5FXVA 4X1IE 4O4IE 5AFUL 1HG2A 3MZKB 3KV5A 2ES0A 4PW8A 2C0SA 3C4XA 2CMRA 5CA1E 2JRKA 4P09A 3K3QC 1FIOA 1VOMA 2CWOA 4UEMA 2K5BB 3UFEA 4IE6A 3I1AA 2CLYC 3E0ZA 3NZQA 4HEAA 1WLXA 2C5IT 2IC6A 3ZJ2A 2LHNA 3KV9A 5LNKA 2XUEA 3GMIA 4UVCB 4PJLA 3CX6B 3ZN0B 1OXZA 3ESLA 1D0ZA 3GN5A 2XASB 1AJ3A 5J2TE 5LOVE 3A5XA 2VKJA 3KFWX 3LG7A 5JR9B 2NP9A 2G0UA 3PUQA 3AAAB 3AA0B 3O1IA 4U72A 4UIGA 5LGUB 1MMDA 4IE5A 3C51A 2W61A 4ZS3A 2NOXA 1NWMX 4PK4A 2DHRA 1BR1A 5DABA 3ZMUB 3K8PC 3PUAA 2D2SA 2EHOC 3E08A 3HR0A 1U4QA 5HWYA 1YD8G 1LVFA 5M4YA 5KMGP 3IHRA 3RC3A 1FMVA 1MIWA 2HPLA 2NW8A 2RA1A 4HKAA 1Z0PA 2YU1A 4ZS2A 3N9MA 1IZNB 4FI5A 4K0UA 4GYSA 3UULA 2DLRA 2BVMA 1D0XA 2VKHA 3N9OA 3VHLA 1G8XA 2CWYA 4WW0A 3ZMTB 4HGAA 2VWAA 2XQYA 2M67A 2VL8A 3MACA 2W0GA 3MKDA 4Z8XA 3BQIA 4G2AA 1MIYA 5L3BB 5HXHA 4QHOA 4IGUA 3DTOA 3U78A 3RC8A 4TX5A 3CKDA 4MLKA 4ZI3C 4MBQA 3I0QA 2LOPA 3LBXB 4BAYB 4G63A 5EK3A 5JR9C 5LG4A 2A2FX 1V9DA 2MTQA 4M1PA 4IE4A 4O2BE 3WAKA 3N9NA 3AAEB 3UTKA 2LOSA 3HI2A 3PE0A 4JUYA 3ETVA 5FP3A 4AKLA 5FXXA 2CM0A 1FEWA 2CA5A 5JDMA 3OKQA 4E7ZA 2EHOB 2E9XC 3UUXB 3ZMSB 2NTYA 3WI3A 4P0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UX4 A;  3O4X E;  3OBV E;  1UX5 A;  1Y64 B;  4EAH A;  2Z6E A;  2J1D G;  1V9D A; 
#chains in the Genus database with same CATH topology
 2JIW A;  4OX9 T;  2YK0 A;  3RYF E;  1LVK A;  1HCI A;  4U74 A;  4PK6 A;  5JVD E;  3X1D A;  3NKZ A;  3ZKR A;  3UU6 A;  2Y48 B;  2HPJ A;  3NRX A;  4TWF A;  1LRZ A;  5HXS A;  1N36 T;  4NPP A;  4X1K E;  5FNV E;  4TV9 E;  1SA0 E;  5JTG A;  4DMV A;  5C2T A;  4JYA T;  2AE9 A;  2NWB A;  2BKO A;  2E9X A;  1OED E;  2KWI B;  2V7J A;  4UV8 B;  3M3Z B;  5AQV B;  4DMW A;  5FMN A;  4YJ2 E;  5L2L A;  3F57 A;  3L09 A;  2CXD A;  3LBX A;  1HG5 A;  3KBT A;  4H63 H;  2X9W A;  4I43 B;  1MNE A;  5AQQ B;  3UUB A;  4AQY T;  5F8P A;  2IW5 B;  4L0R A;  3RRW A;  4EEB A;  1ZHC A;  4HWC A;  3HKE E;  2NW9 A;  2ZM2 A;  4UV9 B;  5LMN T;  4QXB B;  4DR4 T;  1W0B A;  2IIU A;  2QGS A;  3AA1 B;  4QKN A;  4QXH B;  5LHI B;  1HR0 T;  2VAS A;  4IL4 A;  3ZT6 A;  2JQH A;  5M4Y A;  2HHH T;  2WWU A;  5AQS B;  2X66 A;  3AB3 B;  5AQN B;  4YY3 T;  4B3S T;  1KNZ A;  4X1Y E;  2YDS A;  4HFI A;  1T72 A;  2H88 A;  3RH3 A;  5J0Z A;  4LMK A;  4FJO A;  5JDQ A;  2CRB A;  4AQG A;  2BG9 B;  2XQ9 A;  3KIN B;  3AA7 B;  4BJM A;  3HL6 A;  2Q9Q A;  3PTR B;  3ONJ A;  3BQL A;  5LG3 A;  3LJC A;  2LT3 A;  4IRE A;  2BG9 A;  3CML A;  3FBZ A;  4YTM A;  5KXJ A;  2C5K T;  4LF6 T;  3N5L A;  4WBO A;  2LKG A;  5FY1 A;  5IWA T;  1T98 A;  5GON E;  3CX7 B;  2GK9 A;  2VB6 A;  2W63 A;  2D0U A;  4OYJ A;  4U33 A;  2PTF A;  1G73 A;  4CXX A;  3IBP A;  2XSB A;  4ZZC A;  3KBU A;  3ZMZ B;  5FL1 A;  2BKP A;  2Y6X A;  3N2O A;  4KBM B;  5CB4 E;  3Q2M A;  4TNW A;  1T7S A;  2R6G F;  2WS3 A;  4EZH A;  4CN1 A;  4DR2 T;  5HYA A;  4H9N C;  4YFS A;  5JH7 E;  4GYR A;  4BJN A;  4JI0 T;  1HNW T;  1IBM T;  2KWH A;  2XTL A;  3SRZ A;  4ZZB A;  5JRC B;  4CN6 A;  2CE7 A;  4AKH A;  5H6R B;  1VCT A;  3SOL A;  4DVD A;  5JRE A;  4QH4 A;  4YSZ A;  2UUC T;  4A97 A;  3H37 A;  2J47 A;  1J1J A;  1CUN A;  3K3N A;  5LJN A;  4KMC A;  2WSS V;  4TWH A;  2W67 A;  3DP7 A;  2I0M A;  5HEU A;  3GN5 B;  4YXD A;  5L3G B;  2I6H A;  1FJG T;  2SPC A;  1UX4 A;  3AE1 A;  4UF0 B;  5ABE A;  2N2N A;  5L4E A;  5IYZ E;  4N78 D;  1WRD A;  2V6Y A;  3RKO A;  3RHW A;  3UUN A;  2FJA A;  2JMH A;  3FXD B;  2NR4 A;  4JEH B;  3J9X 1;  2XPK A;  3CQC B;  2BVL A;  4JI3 T;  5LA6 E;  2HN1 A;  4IIJ E;  4CI1 B;  5LJM A;  2PFV A;  4LF7 T;  4IDN A;  3GA8 A;  3Q5X A;  2JMK A;  3RF1 A;  3SWH A;  1HX8 A;  4NXN T;  2XQ7 A;  4EXT A;  2QA7 A;  3PUG A;  3PV0 F;  5L3C B;  4HFV A;  4LF9 T;  2V5D A;  3R84 B;  3ZJ1 A;  2WMO A;  1OED B;  2BBH A;  3MJX A;  5FKY A;  4AQF A;  5LMU T;  1X79 A;  1N34 T;  2JJ9 A;  2LLY A;  3AEG A;  4HWF A;  5AQT B;  1M7K A;  3N9P A;  1MMN A;  4PNI A;  5CJ5 A;  1IJ5 A;  3MA9 A;  2BBJ A;  2WZH A;  3PUR A;  4H63 V;  2A72 A;  5TAO A;  3RPU A;  4B3R T;  2XAF B;  4JI6 T;  1X9B A;  4WNK A;  4A98 A;  2JQ9 A;  3L3P A;  2V7L A;  2ZM8 A;  3OTO T;  3TLW A;  4EAH A;  4JI8 T;  3AVS A;  4DR5 T;  2IHR 1;  4LF5 T;  5FL0 A;  3N9L A;  1JNZ A;  2RPA A;  3NWI A;  2XQA A;  2K9A A;  3VKG A;  2J62 A;  3FZM B;  4B3M T;  1HS7 A;  2QYW A;  4O8S A;  3VR9 A;  4YSX A;  1ZKE A;  3RYH E;  3CPZ A;  4AIS A;  1J5W A;  4IL9 A;  1MMG A;  2ACX A;  3UQ4 A;  4QX7 B;  2BG9 E;  3AXJ A;  2H89 A;  5HCM A;  3RIA A;  3EVY A;  3NZP A;  2DI4 A;  4GK5 E;  5HXC A;  3F31 A;  3ZYK A;  3ZYL A;  2YDQ A;  4PK5 A;  3TKL B;  3ZCJ A;  2UUA T;  4AKG A;  1BR4 A;  2RP4 A;  4U3C A;  1IJ6 A;  2MPK A;  5LP6 E;  4XZC A;  5HAX A;  4X65 T;  1WR0 A;  5BMV E;  1SE7 A;  2JQK A;  3QC9 A;  3OBV E;  1YKH B;  3I0O A;  3B57 A;  4ZI3 D;  3CQX C;  5KDM C;  5A1L A;  2X0H A;  4UR9 A;  2CHN A;  4L5G A;  3CX8 B;  3PUV F;  4HWI B;  2BS3 A;  2BG9 C;  2CBI A;  4WYV A;  2KMF A;  2CPT A;  5L4H A;  4DV7 T;  2IC9 A;  4V1A v;  2L8K A;  3R6N A;  5JDG A;  1CHU A;  5AQR B;  3N2K E;  4QH1 A;  1UUR A;  4CI3 B;  2EHO A;  4DR7 T;  4PAG A;  4GKK T;  4ERR A;  4CZZ B;  2D0T A;  4U2Y A;  4DBQ A;  3IEE A;  2WB5 A;  4AXP A;  3P8C D;  2N9D A;  4AKR B;  4B3T T;  2X68 A;  2MOZ A;  2XAQ B;  3P4R A;  2YKS A;  3UU8 A;  2WU5 A;  3OYZ A;  3LK3 B;  2UXN B;  1MIV A;  4OHF A;  5LXT E;  2D5U A;  4DV5 T;  1E7P A;  4U7I A;  3K1S A;  2E9X B;  4IE0 A;  2X0Y A;  2CBJ A;  4I50 E;  2PG8 A;  2WZI A;  3AAI A;  1NEN A;  3D0T A;  5FXZ A;  5JDF A;  5ABF B;  2WMN A;  3C50 A;  5AQJ B;  3JAF A;  3VR8 A;  5LBQ B;  2J1D G;  2V5C A;  4GOU A;  2HN2 A;  4HFH A;  4U2Z A;  2X9X A;  2W62 A;  2Y8D A;  4OK0 A;  4MHC A;  2LSG A;  5C8Y E;  2V7K A;  2XAG B;  3UFG A;  4ZI2 D;  3O1H A;  3VRB A;  5FVK A;  2X67 A;  3RGL A;  3P7I A;  2UXX B;  1S35 A;  3AE8 A;  4KUM B;  4KX6 A;  2YDR A;  3LSV A;  4NUU A;  3KV6 A;  2X9Y A;  2CEA A;  3C4Z A;  4C91 A;  4JV5 T;  3AEA A;  5E0O A;  1R8I A;  4ADZ A;  1L0V A;  2VQF T;  1WYB A;  1MND A;  3JC6 D;  3P4P A;  4YHJ A;  1E1H B;  3ONX A;  2XAH B;  3Q9D A;  3NBX X;  1FMW A;  5AQG B;  3RI5 A;  3ZEF B;  1I6Z A;  3G06 A;  3Q5E A;  2Q9Q D;  4AQF C;  4BA9 A;  4O2A E;  2J4G A;  2BKN A;  3LK2 B;  2WQY A;  3V5U A;  4K0K T;  2XJ7 A;  2VKO A;  3AE9 A;  3BK9 A;  1QLB A;  2V7I A;  2XAJ B;  5HXE A;  3OJA A;  4Q25 A;  2CXF A;  4H9S E;  2EHO D;  4TV8 E;  4DO0 A;  2LEH A;  2B76 A;  2X0L B;  3P4Q A;  3ZN1 B;  1SUM B;  4YJ3 E;  5FY7 A;  4LF8 T;  2ZLY A;  4QX8 B;  1KFY A;  4UEL A;  2KIN B;  3ABV A;  3ETU A;  3RIU A;  4IE7 A;  2N1G A;  5AQL B;  4EED A;  2Z6E A;  1WYC A;  4TWD A;  3EUH A;  3RYC E;  2UXC T;  2LJL A;  1QUU A;  2FJE A;  4WBN E;  4EV6 A;  5FY0 A;  5JDL A;  3FB2 A;  4TNV A;  3QB5 A;  5AQI B;  1MMA A;  3O1J A;  5HEJ A;  3AEC A;  3ANW B;  2KLQ A;  4MAL A;  5JQG E;  1KNP A;  2JPF A;  3PU3 A;  3MXZ A;  2A3D A;  5LHG B;  1YKE B;  3FZK B;  4TZ4 C;  2VVN A;  4ZEY A;  3PJA A;  2WWV A;  3J7Y q;  1D0Y A;  2K24 A;  3MK7 C;  4GIW A;  2KND A;  2LSY A;  3QNU A;  4YLH A;  5AQU B;  2CXL A;  3A7M A;  5EK2 A;  3U3I A;  3NRY A;  1O3X A;  5LB7 B;  1N33 T;  2YOE A;  3F2E A;  1W09 A;  3CVR A;  2CLY B;  2X9H A;  3M65 A;  2V26 A;  3BQK A;  4ISS A;  3RX6 A;  4JLE A;  2VVS A;  4TN7 B;  3I9W A;  4Z91 A;  4JI2 T;  2NW7 A;  2MBG A;  1ZV4 X;  2E8I A;  3QUJ A;  5FXW A;  2LSI A;  4P0A A;  4DBR A;  3AE6 A;  4C90 A;  4JI4 T;  4H9Q C;  4LML A;  1QSD A;  4OYK A;  3HKD E;  4QH5 A;  2YIN A;  4PFP A;  1JNR A;  4JI7 T;  4GKJ T;  1HTJ F;  4KI0 F;  3OPC A;  3UT5 E;  5LCY A;  5DQW A;  5KX5 E;  2OLT A;  2YU2 A;  2JQQ A;  2NTX A;  2PJQ A;  3C64 A;  3ZYM A;  5CFB A;  4EOZ B;  4HFE A;  1NAF A;  5ABF A;  4H9P C;  5LYJ E;  1VCS A;  1W9R A;  3FBL A;  3H3A A;  4H9R C;  3RLF F;  2BDE A;  2DCF A;  3N9Q A;  2ZMA A;  3EAM A;  5EK4 A;  5JR9 A;  1E2A A;  5ETW A;  1T8B A;  3EDV A;  2VK9 A;  3FZF B;  3L39 A;  1D1B A;  1NEK A;  2E9X D;  4HWD A;  2PBI A;  3HKB E;  3IF8 B;  4QWN B;  5HCJ A;  5JRC A;  1DU2 A;  3ZMV B;  1WR6 A;  1HFA A;  2WDR A;  2L3L A;  3ANW A;  3I9Y A;  3ONL C;  4I4T E;  4DR1 T;  2E5L T;  4TUY E;  1U5P A;  2KT9 A;  3PU8 A;  4YTP A;  4CXY A;  3UQ7 A;  2IAK A;  2LM9 A;  5L3D B;  3SFE A;  2ODU A;  1IAP A;  5HEG A;  4GK0 E;  5HEH A;  5LG4 A;  2L9Q A;  1HNX T;  1HF8 A;  3UU3 A;  3DJB A;  4EGW A;  2F4V T;  2WAU A;  2YEV C;  2XQ3 A;  3GWH A;  3W15 B;  4PJM A;  2H3R A;  4E7S A;  3T8O A;  4CI2 B;  4ZI7 E;  5LGN B;  3PUW F;  4X64 T;  2ZM0 A;  3RKG A;  2XQ8 A;  3AE5 A;  2ODV A;  2FJB A;  4DND A;  4J2C A;  5C3J A;  3N2G E;  2ZM6 T;  4LFC T;  3VU7 H;  4DV1 T;  1HX1 B;  1YW0 A;  2LRL A;  3CWZ B;  4HTE A;  4F6R C;  3RIU C;  1W0A A;  2H7O A;  5H6Q B;  4CQI A;  5F3J A;  3B5M A;  4KP3 C;  2AXD S;  1B7T A;  2ACZ A;  4KHZ F;  3C4W A;  5EZY E;  4P1N A;  3S4U A;  5L3E B;  4COF A;  5F5W A;  4EZ4 A;  4ZI2 C;  1KK7 A;  4EYU A;  5JDH A;  4JBW F;  3AXJ B;  2WM9 A;  1ZOY A;  1Y64 B;  3P4W A;  3CIR A;  4A56 A;  1UGO A;  5JR9 C;  5DQV A;  4JI5 T;  4IST A;  4EB6 E;  5AQH B;  4LF4 T;  2VKD A;  4DR3 T;  2MYS A;  3OYX A;  3HKC E;  2DL1 A;  4NUV A;  2H7V C;  1D1A A;  1UCU A;  2LSK A;  3AED A;  4I55 E;  4L9I A;  3ZPO A;  1UK5 A;  3KDS E;  3K3O A;  2XM2 A;  2XHE B;  5HXR A;  3ZLI A;  2WBL A;  3KVA A;  2WY2 A;  3PUY F;  5J1G A;  4JEU B;  4PJJ A;  4O4H E;  2MAW A;  2XY8 B;  5DJQ C;  3PDY A;  3RYI E;  3FXE B;  5LBM A;  3CQG B;  3UUM A;  2LSJ A;  4YTN A;  5LHH B;  3ZC0 A;  3PUX F;  5CGM A;  3KV4 A;  3PUZ F;  4EYY R;  4DUZ T;  4DR6 T;  4LFB T;  1LKX A;  4HN9 A;  1HNZ T;  2LHR A;  4PJN A;  2BS2 A;  5FVL A;  1ZEE A;  4OFZ A;  5L3F B;  2K48 A;  3O9X A;  4DV4 T;  1XZY A;  2DWK A;  3RRC A;  2XM1 A;  4PFO A;  3EAB A;  5JDN A;  1XMO T;  1SHZ C;  3LFM A;  2HH7 A;  4CXW A;  3UU5 A;  4YHH T;  2LE8 A;  3AA6 B;  3FHN A;  3AVR A;  3H3M A;  3Q5W A;  2I59 A;  4UVB B;  4Z90 A;  3TLV A;  4UF0 A;  5FYM A;  4F8H A;  3JCF A;  3ZCI A;  1KF6 A;  2LM2 A;  2LRK A;  5CA0 E;  5BR8 T;  4JI1 T;  3EDU A;  5HEO A;  4AKI A;  3ZC1 A;  4QXC B;  2DWG A;  4X5T A;  2DNX A;  2X51 A;  3C98 B;  1EZ3 A;  2P9B A;  3PJA J;  4ZXL A;  3PUS A;  2B1E A;  4EIW A;  3WAJ A;  2V7M A;  2A9U A;  4AI6 A;  4ASK A;  1M62 A;  2M6B A;  4ILU A;  4NIQ A;  4X20 E;  4HE8 A;  4UXN B;  1N32 T;  1US7 B;  1VRB A;  3LDQ B;  3JAD A;  3RQW A;  2UXD T;  1Y01 A;  3TLS A;  4B6X A;  1S94 A;  2C5J A;  2CCQ A;  2W00 A;  3KVB A;  4UVA B;  2WU2 A;  5AQP B;  3SS1 A;  2Q9Q C;  3AE4 A;  3B13 A;  2XZE A;  3QK6 A;  3VKH A;  3ZSS A;  3O4X E;  3E22 E;  2KXP B;  2UUB T;  4H9O C;  1WFD A;  5AQO B;  3HA4 A;  4IT4 A;  3RIF A;  1BR2 A;  5ADX L;  2UU9 T;  2V1D B;  5IHY A;  1BR0 A;  4I0U A;  4XAX B;  2M6I A;  3JC6 C;  1OWA A;  1KEY A;  5HWX A;  2FUP A;  4IHJ E;  4IDZ A;  4DV2 T;  4NXM T;  4HFC A;  1H7C A;  3AE7 A;  4O4J E;  3UU4 A;  4ZHQ E;  2BZB A;  1XDO A;  2KZ7 B;  2XQ4 A;  3LK4 2;  4U7Y A;  3V5S A;  2OA5 A;  2W4X A;  4MFR A;  3VRA A;  4ZOL E;  2IDO B;  1UUS A;  1D1C A;  1UX5 A;  4O4L E;  2Q9Q B;  4ILB A;  5FXV A;  4X1I E;  4O4I E;  5AFU L;  1HG2 A;  3MZK B;  4LMJ A;  4DV3 T;  3KV5 A;  2XQ6 A;  2W66 A;  1OED A;  4HWH A;  2ES0 A;  3OVU A;  4PW8 A;  2C0S A;  2XSA A;  2WP9 A;  3C4X A;  2CMR A;  2OV9 A;  3AE2 A;  1IBK T;  5CA1 E;  2JRK A;  4P09 A;  3K3Q C;  2K3W A;  1FIO A;  1VOM A;  2CWO A;  3QOF A;  2K5B B;  4UEM A;  3UFE A;  4IE6 A;  4A5X A;  3I1A A;  2CLY C;  3E0Z A;  3NZQ A;  4HEA A;  1YQ4 A;  1WLX A;  2C5I T;  2IC6 A;  4DV6 T;  3ZJ2 A;  2LHN A;  3KV9 A;  5LNK A;  3A8Y C;  2XUE A;  3GMI A;  4UVC B;  5L47 A;  4PJL A;  3CX6 B;  3ZN0 B;  1OXZ A;  3ESL A;  1D0Z A;  2V8S V;  2XAS B;  3GN5 A;  5J2T E;  5LOV E;  1AJ3 A;  1KNR A;  2YN6 A;  2VKJ A;  3A5X A;  3KFW X;  2W2U A;  3LG7 A;  2QRX A;  2NP9 A;  5JR9 B;  2UXB T;  3ZT7 A;  3FZL B;  2G0U A;  3PUQ A;  3AAA B;  2D9D A;  2VUR A;  3AA0 B;  3O1I A;  4AIU A;  4U72 A;  4UIG A;  5LGU B;  1MMD A;  4IE5 A;  3AEE A;  3P50 A;  3C51 A;  2W61 A;  2E2A A;  4IDO A;  5LGT B;  2CHO A;  1YXR A;  4ZS3 A;  2NOX A;  2WDV A;  4X62 T;  1NWM X;  4ANJ A;  4PK4 A;  2DHR A;  5ABH A;  5AQM B;  1BR1 A;  2V6X A;  5DAB A;  3ZMU B;  3K8P C;  3PUA A;  4P0B A;  2D2S A;  2EHO C;  3P4S A;  3EHZ A;  3E08 A;  2BS4 A;  3HR0 A;  1U4Q A;  3AEB A;  3TLT A;  4U31 A;  5HWY A;  1YD8 G;  1LVF A;  2V6Y B;  1GQE A;  2IML A;  2WDQ A;  3IHR A;  1FMV A;  3RC3 A;  5KMG P;  1MIW A;  2HPL A;  2NW8 A;  1IBL T;  2RA1 A;  3EI0 A;  1WCR A;  4HKA A;  4DV0 T;  1XDP A;  1Z0P A;  2YU1 A;  4ZS2 A;  3T1Y T;  5AQF B;  3N9M A;  1IZN B;  4FI5 A;  4K0U A;  4GYS A;  3AEF A;  2FBW A;  3UUL A;  2DLR A;  4DUY T;  3AE3 A;  3ZST A;  1XNQ T;  2KSR A;  2BVM A;  1D0X A;  1Z8U A;  2VKH A;  3N9O A;  3Q5D A;  3VHL A;  1G8X A;  2CWY A;  4ILC A;  4IDQ A;  4WW0 A;  3ZMT B;  4HGA A;  5IUX A;  2VWA A;  2XQY A;  2M67 A;  1YQ3 A;  2QVA A;  2VL8 A;  3FZH B;  2W0G A;  3MAC A;  3MKD A;  4XBF B;  4Z8X A;  3BQI A;  4G2A A;  1MIY A;  1XNR T;  5L3B B;  4DID B;  5HXH A;  3L8R A;  5AQK B;  4QHO A;  4IGU A;  3DTO A;  3SFD A;  3U78 A;  2VL0 A;  4X66 T;  3RC8 A;  4TX5 A;  2WCA A;  3CKD A;  3CK6 A;  4MLK A;  4ZI3 C;  4MBQ A;  1J5E T;  3I0Q A;  4KHP T;  3JAE A;  1ZP0 A;  2LOP A;  3LBX B;  4WZX A;  4BAY B;  4G63 A;  1XWM A;  5EK3 A;  4CN4 A;  2A2F X;  1V9D A;  2E5V A;  4ILA A;  2MTQ A;  4IDP A;  4M1P A;  4IE4 A;  4O2B E;  3WAK A;  2LKH A;  3AAE B;  3N9N A;  3UTK A;  3ZT5 A;  2LOS A;  1XMQ T;  2FJD A;  2VQE T;  3HI2 A;  3RQU A;  3PE0 A;  4JUY A;  3ETV A;  3IA3 A;  5FP3 A;  4AKL A;  3NVO A;  2IUB A;  3T1H T;  5FXX A;  4HFB A;  2CM0 A;  5J2U E;  1FEW A;  2CA5 A;  5JDM A;  4YT0 A;  1I94 T;  1OED C;  3OKQ A;  3QB5 K;  4E7Z A;  5ABG A;  2EHO B;  3TLU A;  4LFA T;  2E9X C;  3UUX B;  3ZMS B;  2NTY A;  2XQ5 A;  3WI3 A;  4YSY A;  4HFD A; 
#chains in the Genus database with same CATH homology
 2YK0 A;  3RYF E;  1LVK A;  1HCI A;  4U74 A;  4PK6 A;  5JVD E;  4ANJ A;  2Y48 B;  2HPJ A;  3NRX A;  5HXS A;  1LRZ A;  4X1K E;  5FNV E;  4TV9 E;  1SA0 E;  4DMV A;  2NWB A;  2V7J A;  2E9X A;  2KWI B;  4DMW A;  4UV8 B;  4YJ2 E;  5FMN A;  5L2L A;  3F57 A;  3L09 A;  2CXD A;  3LBX A;  1HG5 A;  3KBT A;  4H63 H;  2X9W A;  4I43 B;  1MNE A;  5F8P A;  2IW5 B;  4L0R A;  3RRW A;  1ZHC A;  3HKE E;  2NW9 A;  2ZM2 A;  4UV9 B;  4QXB B;  2QGS A;  3AA1 B;  4QKN A;  4QXH B;  5LHI B;  2VAS A;  2WWU A;  2X66 A;  3AB3 B;  4X1Y E;  3RH3 A;  4FJO A;  5JDQ A;  4AQG A;  3KIN B;  3AA7 B;  4BJM A;  3HL6 A;  2Q9Q A;  3PTR B;  3BQL A;  3LJC A;  2LT3 A;  3CML A;  3FBZ A;  2C5K T;  3N5L A;  4WBO A;  5FY1 A;  1T98 A;  5GON E;  3CX7 B;  2GK9 A;  2VB6 A;  2W63 A;  2D0U A;  4OYJ A;  4CXX A;  1G73 A;  3IBP A;  3KBU A;  3N2O A;  2Y6X A;  4KBM B;  5CB4 E;  3Q2M A;  4EZH A;  5HYA A;  4H9N C;  4YFS A;  5JH7 E;  4GYR A;  4BJN A;  2KWH A;  2XTL A;  3SRZ A;  5JRC B;  2CE7 A;  4AKH A;  5H6R B;  3SOL A;  4DVD A;  5JRE A;  3H37 A;  5LJN A;  1CUN A;  3K3N A;  4KMC A;  2WSS V;  3DP7 A;  3GN5 B;  5L3G B;  2SPC A;  1UX4 A;  4UF0 B;  2N2N A;  5IYZ E;  4N78 D;  1WRD A;  3RKO A;  3ZMZ B;  3UUN A;  4E7S A;  2JMH A;  3FXD B;  4JEH B;  3J9X 1;  3CQC B;  2BVL A;  5LA6 E;  4IIJ E;  4CI1 B;  5LJM A;  2PFV A;  3GA8 A;  3Q5X A;  2JMK A;  3SWH A;  1HX8 A;  4EXT A;  2QA7 A;  3PUG A;  5L3C B;  4HFV A;  3R84 B;  3ZJ1 A;  2WMO A;  3MJX A;  4AQF A;  1X79 A;  2JJ9 A;  3N9P A;  1MMN A;  4PNI A;  1IJ5 A;  3MA9 A;  3PUR A;  4H63 V;  5TAO A;  2A72 A;  3RPU A;  2XAF B;  4WNK A;  3L3P A;  2V7L A;  2ZM8 A;  4EAH A;  3AVS A;  3N9L A;  2K9A A;  3VKG A;  1HS7 A;  4O8S A;  1ZKE A;  3RYH E;  3CPZ A;  1MMG A;  2ACX A;  4QX7 B;  3ZYK A;  3EVY A;  3NZP A;  2DI4 A;  4GK5 E;  5HXC A;  3F31 A;  3ZYL A;  4AKG A;  4PK5 A;  3ZCJ A;  3TKL B;  1BR4 A;  2RP4 A;  1IJ6 A;  5LP6 E;  4XZC A;  5HAX A;  5BMV E;  3QC9 A;  3OBV E;  1YKH B;  3I0O A;  3B57 A;  4ZI3 D;  3CQX C;  5KDM C;  5A1L A;  4L5G A;  3CX8 B;  2KMF A;  2IC9 A;  4V1A v;  2L8K A;  3R6N A;  5JDG A;  3N2K E;  4CI3 B;  2EHO A;  4PAG A;  4ERR A;  4CZZ B;  2D0T A;  4DBQ A;  3IEE A;  4AXP A;  3P8C D;  2N9D A;  4AKR B;  2X68 A;  2MOZ A;  2XAQ B;  3OYZ A;  3LK3 B;  2UXN B;  1MIV A;  4OHF A;  5LXT E;  2D5U A;  2E9X B;  4IE0 A;  4I50 E;  2PG8 A;  3AAI A;  3D0T A;  5FXZ A;  5JDF A;  2WMN A;  3C50 A;  4C90 A;  5LBQ B;  2J1D G;  4GOU A;  2X9X A;  2W62 A;  2Y8D A;  4OK0 A;  4MHC A;  2LSG A;  5C8Y E;  2V7K A;  2XAG B;  4ZI2 D;  5J2U E;  3O1H A;  2X67 A;  3P7I A;  2UXX B;  1S35 A;  4KUM B;  4C91 A;  4NUU A;  3KV6 A;  2X9Y A;  2CEA A;  3C4Z A;  5E0O A;  4ADZ A;  1WYB A;  1MND A;  3JC6 D;  4YHJ A;  1E1H B;  3ONX A;  2XAH B;  3Q9D A;  3NBX X;  1FMW A;  3ZEF B;  2Q9Q D;  4AQF C;  4BA9 A;  4O2A E;  3V5U A;  3LK2 B;  2VKO A;  3BK9 A;  2XAJ B;  2V7I A;  5HXE A;  3OJA A;  2CXF A;  4H9S E;  2EHO D;  4TV8 E;  4DO0 A;  2LEH A;  2X0L B;  3ZN1 B;  4YJ3 E;  5FY7 A;  2ZLY A;  4QX8 B;  4UEL A;  2KIN B;  3ETU A;  4IE7 A;  2N1G A;  2Z6E A;  1WYC A;  3RYC E;  3EUH A;  2LJL A;  1QUU A;  4WBN E;  5JDL A;  5FY0 A;  3FB2 A;  1MMA A;  3O1J A;  3ANW B;  2KLQ A;  4MAL A;  5JQG E;  2JPF A;  3PU3 A;  3MXZ A;  2A3D A;  5LHG B;  1YKE B;  4TZ4 C;  3J7Y q;  1D0Y A;  2K24 A;  3MK7 C;  4GIW A;  2KND A;  2LSY A;  4YLH A;  2CXL A;  5EK2 A;  3U3I A;  3NRY A;  1O3X A;  3F2E A;  3RX6 A;  3CVR A;  2CLY B;  2X9H A;  3M65 A;  2V26 A;  3BQK A;  4ISS A;  4JLE A;  4TN7 B;  3I9W A;  2NW7 A;  2MBG A;  1ZV4 X;  2E8I A;  3QUJ A;  5FXW A;  2LSI A;  4P0A A;  4DBR A;  4H9Q C;  1QSD A;  4OYK A;  3HKD E;  2YIN A;  4PFP A;  1HTJ F;  3UT5 E;  5LCY A;  5DQW A;  5KX5 E;  2YU2 A;  2JQQ A;  2NTX A;  2PJQ A;  3C64 A;  3ZYM A;  4EOZ B;  1NAF A;  5LYJ E;  4H9P C;  3FBL A;  3H3A A;  4H9R C;  2BDE A;  2DCF A;  3N9Q A;  2ZMA A;  5EK4 A;  5JR9 A;  5ETW A;  3EDV A;  2VK9 A;  1D1B A;  2E9X D;  2PBI A;  3HKB E;  3IF8 B;  4QWN B;  5JRC A;  3ZMV B;  1WR6 A;  1HFA A;  3ANW A;  2L3L A;  4I4T E;  3I9Y A;  4TUY E;  1U5P A;  2KT9 A;  3PU8 A;  4CXY A;  2IAK A;  2LM9 A;  5L3D B;  2ODU A;  1IAP A;  4GK0 E;  2L9Q A;  1HF8 A;  3DJB A;  2WAU A;  2YEV C;  3GWH A;  3W15 B;  4PJM A;  2H3R A;  3T8O A;  4CI2 B;  4ZI7 E;  5LGN B;  2ZM0 A;  4DND A;  2ODV A;  4J2C A;  3N2G E;  3VU7 H;  1YW0 A;  3CWZ B;  4F6R C;  4HTE A;  4CQI A;  5H6Q B;  2H7O A;  4KP3 C;  1B7T A;  3S4U A;  3C4W A;  5EZY E;  5L3E B;  4EZ4 A;  4ZI2 C;  1KK7 A;  4EYU A;  5JDH A;  2WM9 A;  1Y64 B;  4A56 A;  5DQV A;  4EB6 E;  4IST A;  2VKD A;  2MYS A;  3OYX A;  3HKC E;  4NUV A;  2H7V C;  1D1A A;  1UCU A;  2LSK A;  4I55 E;  4L9I A;  3ZPO A;  3KDS E;  3K3O A;  2XHE B;  5HXR A;  3ZLI A;  2WBL A;  3KVA A;  5J1G A;  4JEU B;  4PJJ A;  4O4H E;  5DJQ C;  3PDY A;  3RYI E;  3FXE B;  5LBM A;  3CQG B;  3UUM A;  2LSJ A;  3ZC0 A;  5LHH B;  3KV4 A;  4EYY R;  1LKX A;  4HN9 A;  2LHR A;  4PJN A;  1ZEE A;  4OFZ A;  5L3F B;  2K48 A;  3O9X A;  2DWK A;  3RRC A;  4PFO A;  5JDN A;  1SHZ C;  3LFM A;  2HH7 A;  4CXW A;  2LE8 A;  3AA6 B;  3FHN A;  3AVR A;  3Q5W A;  4UVB B;  2I59 A;  5F3J A;  5LGT B;  1KNZ A;  4UF0 A;  5FYM A;  4XBF B;  3ZCI A;  5CA0 E;  3EDU A;  4AKI A;  3ZC1 A;  4QXC B;  2DWG A;  2DNX A;  2X51 A;  3C98 B;  1EZ3 A;  2P9B A;  3PUS A;  2B1E A;  4EIW A;  3WAJ A;  2V7M A;  4AI6 A;  4ASK A;  4ILU A;  4X20 E;  4HE8 A;  4UXN B;  1US7 B;  1VRB A;  4B6X A;  1S94 A;  2C5J A;  2CCQ A;  2W00 A;  3KVB A;  4UVA B;  3SS1 A;  2Q9Q C;  3B13 A;  3QK6 A;  3VKH A;  3O4X E;  3E22 E;  2KXP B;  4H9O C;  5ADX L;  3HA4 A;  1BR2 A;  2V1D B;  5IHY A;  1BR0 A;  4XAX B;  3JC6 C;  1OWA A;  5HWX A;  4IHJ E;  4IDZ A;  1H7C A;  4O4J E;  4ZHQ E;  2BZB A;  3LK4 2;  2KZ7 B;  3V5S A;  2OA5 A;  4MFR A;  4ZOL E;  1D1C A;  1UX5 A;  4O4L E;  2Q9Q B;  5FXV A;  4X1I E;  4O4I E;  5AFU L;  1HG2 A;  3MZK B;  3KV5 A;  2ES0 A;  4PW8 A;  2C0S A;  3C4X A;  2CMR A;  5CA1 E;  2JRK A;  4P09 A;  3K3Q C;  1FIO A;  1VOM A;  2CWO A;  4UEM A;  2K5B B;  3UFE A;  4IE6 A;  3I1A A;  2CLY C;  3E0Z A;  3NZQ A;  4HEA A;  1WLX A;  2C5I T;  2IC6 A;  3ZJ2 A;  2LHN A;  3KV9 A;  5LNK A;  2XUE A;  3GMI A;  4UVC B;  4PJL A;  3CX6 B;  3ZN0 B;  1OXZ A;  3ESL A;  1D0Z A;  3GN5 A;  2XAS B;  1AJ3 A;  5J2T E;  5LOV E;  3A5X A;  2VKJ A;  3KFW X;  3LG7 A;  5JR9 B;  2NP9 A;  2G0U A;  3PUQ A;  3AAA B;  3AA0 B;  3O1I A;  4U72 A;  4UIG A;  5LGU B;  1MMD A;  4IE5 A;  3C51 A;  2W61 A;  4ZS3 A;  2NOX A;  1NWM X;  4PK4 A;  2DHR A;  1BR1 A;  5DAB A;  3ZMU B;  3K8P C;  3PUA A;  2D2S A;  2EHO C;  3E08 A;  3HR0 A;  1U4Q A;  5HWY A;  1YD8 G;  1LVF A;  5M4Y A;  5KMG P;  3IHR A;  3RC3 A;  1FMV A;  1MIW A;  2HPL A;  2NW8 A;  2RA1 A;  4HKA A;  1Z0P A;  2YU1 A;  4ZS2 A;  3N9M A;  1IZN B;  4FI5 A;  4K0U A;  4GYS A;  3UUL A;  2DLR A;  2BVM A;  1D0X A;  2VKH A;  3N9O A;  3VHL A;  1G8X A;  2CWY A;  4WW0 A;  3ZMT B;  4HGA A;  2VWA A;  2XQY A;  2M67 A;  2VL8 A;  3MAC A;  2W0G A;  3MKD A;  4Z8X A;  3BQI A;  4G2A A;  1MIY A;  5L3B B;  5HXH A;  4QHO A;  4IGU A;  3DTO A;  3U78 A;  3RC8 A;  4TX5 A;  3CKD A;  4MLK A;  4ZI3 C;  4MBQ A;  3I0Q A;  2LOP A;  3LBX B;  4BAY B;  4G63 A;  5EK3 A;  5JR9 C;  5LG4 A;  2A2F X;  1V9D A;  2MTQ A;  4M1P A;  4IE4 A;  4O2B E;  3WAK A;  3N9N A;  3AAE B;  3UTK A;  2LOS A;  3HI2 A;  3PE0 A;  4JUY A;  3ETV A;  5FP3 A;  4AKL A;  5FXX A;  2CM0 A;  1FEW A;  2CA5 A;  5JDM A;  3OKQ A;  4E7Z A;  2EHO B;  2E9X C;  3UUX B;  3ZMS B;  2NTY A;  3WI3 A;  4P0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...