3OC1A

Conformational plasticity of p38 map kinase dfg motif mutants in response to inhibitor binding
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oc1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oc1A01
3BHTA 1XH4A 4QMTA 1WBSA 3KF4A 2CKQA 3EHAA 3ZZWA 5DR6A 1KV2A 2IVSA 2X39A 3FZRA 5AV3A 3S00A 3RMFA 2XS0A 4OTDA 5L2QA 4O86A 2X9FA 4G6OA 3PG1A 3IW4A 4LOQA 5EHLA 4ZSAA 5FD2A 3C4ZA 3FPMA 1WBPA 4GIIA 1PYXA 5LVOA 3Q6UA 5KBRA 1K3AA 3BLHA 3D7TA 4PRJA 4H3BA 2XKCA 2PY3A 4MBLA 1YW2A 3V04A 5GJFA 5HIEA 2R3GA 3EFKA 5HOAA 3F5GA 2Z60A 4FI1A 3OC1A 3ZTXA 4IACA 1DM2A 4FKLA 5D7VA 3DAEA 4ZJVA 4LGHA 3VHKA 4E1ZA 3SLSA 2QHMA 3RHXA 4F99A 4L6QA 3SX9A 4C7TA 5JEBA 5BMSA 2BVAA 3PWDA 3VBYA 4GG7A 1UU8A 4FYNA 3LLTA 3LJ2A 4ANNA 1O6LA 4RRVA 3QU0A 4QMMA 5HZNA 3KRWA 2O5KA 4MNEB 2G2IA 1AGWA 3OWKA 4AN3A 2BKKA 5AP5A 2WZJA 4WA9A 2A2AA 3ZSIA 3QCSA 3COMA 4KAOA 2W1HA 5GHVA 1APME 5EH0A 3FMDA 5GJGA 3TZ9A 4E5AX 2BROA 5C4LA 4RIXB 2JDVA 3FBVA 3UIBA 2VGPA 3Q9YA 2FO0A 1FGIA 5KZ0A 4FKRA 2X9EA 4Y5HA 3WZKA 2WQNA 3UBDA 4C4EA 4YO4A 3U87A 2PUIA 5AFVA 2PZPA 4O6EA 5A9UA 4CFMA 5HIDA 3RI1A 3W33A 4B99A 4RVKA 2XMYA 3F6XA 2Y4PA 4M8TA 4FG7A 3U6HA 1OIQA 4DGOA 4HVHA 2ZM1A 4DLJA 2CLQA 2X2MA 4AE9A 3POZA 4FT3A 3V3VA 3ZSHA 3HMOA 3NNWA 3OG7A 3TZ8A 3QC9A 4GFOA 3AGMA 3FI2A 3ZDIA 4EOPA 4N0SA 4BFMA 3MTLA 4MTAA 3EN4A 3BHYA 4IC8A 4OGRA 2X7GA 4TWPA 2QOBA 3A4PA 1Q8WA 3BEGA 4PQNA 5FQDC 3UOLA 3H10A 3WF8A 3TV7A 4EOSA 3FI8A 4F6UA 2NPQA 3C51A 3EFLA 3QZIA 4IVDA 2W05A 4M97A 3CR0A 2VNWA 4KS7A 3OW4A 5AM6A 3RP9A 1Y8GA 1BMKA 1T46A 3TNHA 4EQMA 1I44A 4OTIA 3NEWA 5AP2A 1WMKA 4EOMA 3O8TA 3LXNA 2BRNA 3HVCA 5K9IA 4FSMA 3MJ2A 3NYVA 1LUFA 3QRJA 2VO7A 2GNHA 4YURA 3I5ZA 4FTMA 2ZB0A 2OFVA 3E8DA 3A8XA 3EQIA 1KOAA 4EZ3A 3GVUA 3R00A 4ZS0A 3I60A 1XH9A 1PY5A 3K5VA 5H8EA 2C0OA 1IASA 4ALUA 4R77A 2NO3A 5DRBA 4E5WA 4FEQA 3PJ8A 2EXCX 4FV2A 4FSNA 2PVYA 4ONAA 2ZM3A 3O71A 3MY1A 4BI1A 5IQDA 3HDMA 4N57A 5IQHA 2VTRA 4EH4A 2B7AA 5H3QA 4HNFA 1QCFA 2YDJA 3VQUA 2XNOA 2A27A 4BDHA 3UPZA 2GHGA 1UU7A 5FRIA 4FMQA 4M66A 3SXRA 3CD8A 3TKUA 2UZUE 3V51A 1E9HA 3UO4A 3VS3A 2XZSA 4E7WA 4CXAA 3I6WA 3QKLA 4L53A 5HORA 1G3NA 5FEQA 5CASA 3PLAE 3A7IA 3GEQA 2HZ0A 5E8YA 3PXFA 4O0RA 4DINA 3QYWA 4QP9A 1FPUA 4EC9A 5AR5A 1KV1A 3V6RA 3FXXA 5GIPE 5AR7A 5HQ0A 1H28A 3NSZA 4YP8A 4IZAA 4F6SA 3LFQA 3IK3A 3R7IA 3VN9A 2R3FA 4BI2A 4W9WA 4WNKA 2EB2A 4X3FA 4OTGA 4X3FC 4O0UA 4J52A 4DFNA 2GTMA 4PWNA 1P4OA 2UZDA 2YM8A 4LL5A 4QMZA 3QC4A 3DLSA 2PUNA 5M09A 5DEYA 5CLPA 2WMBA 2B53A 5AUYA 5J79A 3F5XA 3PZEA 1JBPE 3E3BX 3WZJA 4BDEA 4FTAA 4TYHB 3K3IA 4P4CA 1GZNA 4Y95A 4HVDA 5IUHA 4EQUA 3TCPA 4FK6A 3CJFA 3ODZX 5EKOA 3V5TA 4XX9A 5AR2A 2CGVA 3DKOA 4YTCA 2R2PA 5AWMA 3Q6WA 4NM3A 3WF6A 2J5FA 4M15A 5FTQA 3D5WA 3R21A 3R01A 2WTDA 1ZOEA 2UW6A 2PUUA 1OM1A 1PF8A 3FXZA 2OICA 1RW8A 4TWCA 4G9RA 3JPVA 3FMHA 4NFNA 3ZYAA 3UZRA 3KXZA 3NW6A 5AAEA 1WBVA 4ITIA 4CG8A 3CKWA 1FQ1B 4EEVA 3AQVA 1IG1A 1OPJA 2VTJA 3FZTA 4PMTA 3R7VA 4XP0A 5B7VA 3DLZA 5ACKA 3MGYA 2F49A 5DOSA 4ALVA 4NCTA 4NCTC 4G1WA 3P9JA 5EM6A 3CPCA 3K2LA 4J97A 4U5JA 4FKOA 5HBEA 3VUHA 4AGWA 1ZMVA 4O7TA 3WF5A 3NW7A 3G90X 1AD5A 4IX3A 2XP2A 1OL6A 4ARKA 3FY0A 4DN5A 4B4LA 4APPA 3DDQA 2QOHA 3HGKA 3HLLA 5CANA 4FKJA 3QD4A 4LYNA 2O0UA 3VRYA 2OZAB 3BEAA 1W0XC 2BIKB 4ANQA 4BN1A 2QOOA 4MBIA 1GZ8A 2YAKA 3FE3A 1XO2B 4ZXTA 5C26A 3LFEA 3FPQA 3IPHA 2BDJA 3C4EA 3DBFA 4GFMA 4UBAA 5FGKA 2PMIA 4OTWA 2F7EE 3AD4A 3HMIA 2CDZA 5I0BA 3DJ6A 4BCKA 4PY1A 1IRKA 3QL8A 2QU6A 3G6HA 4USDA 4U42A 3QBNA 1R78A 1WVYA 4RX8A 3KULB 2XIZA 1XHAA 2A1AB 3OUNB 4D28A 4EZ7A 3V5WA 4AUAA 4C62A 3L8PA 4B7TA 2PHKA 3BRBA 3PY3A 4DT8A 4H1JA 3QWKA 4GU9A 2FYSA 5EG3A 4BKZA 2HCKA 2YM7A 3NPCA 4JQEA 3QXOA 3NYXA 3P4KA 4EOOA 4YUQA 4I20A 3ETAA 4O7NA 3C1XA 4I3ZA 3M1SA 4YO6A 4C34A 1Q97A 4DH8A 3FC2A 4U3ZA 4AGUA 4S31A 2PZ5A 3ORZA 4EOJA 4IQ6A 5C03A 2C0IA 3ZM9A 4A4LA 2YM6A 4R3PA 5C1QB 5L2WA 1V0PA 4FNXA 2OGVA 4AOIA 1PXKA 3BPRA 3RM6A 4OW8A 3EQFA 3KKVA 4L8MA 4S33A 4WUNA 5IA0A 4RFYA 3FKNA 3Q4UA 4QTBA 1KE7A 3UP7A 3ITZA 3QA8A 3ZO4A 2X2KA 2FVDA 1ZAOA 2QLUA 3F2AA 4JG8A 4EBWA 5JZJA 5EDQA 2UZBA 2R3NA 4BKYA 3JY9A 3KGAA 1NW1A 3AC3A 3KFAA 3W2QA 2IZRA 4UMPA 3JR1A 4O7RA 2OIQA 3QXPA 2W5AA 3GC0A 4RX7A 4IM0A 3BWFA 3KRJA 2BFYA 3EH9A 2C5VA 4L67A 4CZYB 1S9IA 4HVSA 3Q53A 5EM5A 3FZOA 3P7AA 3QYZA 3R8LA 3V5JA 4IADA 2Q83A 2P3GX 5JFWA 3EJ1A 4FC0A 4BWXA 5AR8A 1MRYA 5ETIA 3DT1A 3ORKA 3MJ1A 4QMQA 3DV3A 3BKBA 4FTQA 2R3HA 3F66A 4ERWA 3QHRA 5AUTA 3ROCA 4PMSA 4G6LA 4QP8A 5K5XA 4XG6A 5KKRC 1UU3A 2WMXA 3FLZA 2WMWA 3MW1A 4HCTA 4QTDA 4C35A 3P86A 4M0YA 4AW5A 3H0YA 4ERKA 3PA4A 3MPMA 4JIKA 5D12A 4CZTA 3FY2A 4PL3A 3GUBA 3GBZA 3GCQA 4HVIA 3B8RA 2JBOA 3BZ3A 4MD7E 4HYSA 4DLIA 4K33A 4MD9E 4FYOA 2VTMA 4EH2A 2WTJA 3H0ZA 3QLFA 3DGKA 3DS6A 3JS2A 4FVQA 1R39A 5M4IA 5CI6A 2Z7QA 2C6EA 2R64A 4L01A 4GUBA 5HG8A 4QP3A 2X4FA 4LOPA 5K0KA 3SD0A 4NUSA 5IEXA 2JLDA 4UWCA 1H4LA 3BQRA 3BELA 4F7SA 5CI7A 3ZFXA 2GQGA 1G5SA 3TEIA 4FKPA 1PMVA 4FSWA 1RQQA 4O21A 5D9HA 2VWYA 1SNUA 2VWUA 4CG9A 3CS9A 4IWOA 3UQFA 3DPKA 3TZ7A 5IH6A 3F5PA 4U7ZA 1PXPA 3IGOA 4Y85A 5CYIA 4DG0E 5DYJA 3FQHA 4ZMEA 5J1WA 3KQ7A 4F0GA 4UZDA 3VS1A 3GQLA 4B0GA 5LCKA 3REPA 3MVLA 3UG2A 3ACKA 1VYZA 3PFQA 4M69B 4PNIA 4JVGA 4IZ5A 5LARA 1UNLA 4FTKA 4PPBA 4QQTA 5HESA 5K4IA 5GJDA 2ZDTA 1VYWA 5C8NA 3SV0A 2HWOA 3FI4A 4BF2A 1Q8YA 4A07A 2FH9A 5HE0A 1FBNA 3VBVA 3FMLA 5IA3A 3PIXA 2JAVA 3R04A 4GS6A 2ZV2A 4PPCA 4XG3A 2Y8OA 4FF8A 2C3IB 2XCKA 4IAKA 4ENYA 4V0GA 3DY7A 4L00A 2A0CX 3MPTA 4X6QC 2VGOA 2CSNA 2KULA 3LXPA 4RC3A 3I7BA 5JZNA 4CKRA 3G5DA 3WF7A 2UZOA 2XEYA 1BL6A 3EFJA 3UC4A 4QMWA 1W7HA 3TM0A 4DBNA 4TXCA 1ZOHA 2QKWB 1PXJA 1M52A 3NR9A 4FKWA 3BHVA 4J71A 5HU3A 4AGCA 2WMVA 4EK6A 5FM3A 4Z7GA 4M13A 1Q62A 2QLQA 5FP5A 4ACGA 4E6QA 3GFWA 4EH9A 3V8WA 5DT3A 5CY3A 4BDBA 5G6VA 5AV0A 2J0MB 3QZGA 3ZO1A 5IZFA 1ZY4A 3KU2A 3RJCA 5EOBA 4UZHA 4PMMA 4DH3A 3CEKA 2EVAA 1A06A 3B2TA 4QMVA 1PHKA 4F0FA 3Q04A 4IWDA 4BCNA 4TYEA 5BPYA 3UQGA 3KMMA 2V7OA 4BY9E 2W5HA 3PVUA 1WCCA 4DFYA 5JQ5A 3AD6A 3MFTA 3PXZA 3FHRA 4JR7A 3U9NA 3O51A 5CNNA 4C2VA 4IX5A 3AG9A 1IR3A 1SVGA 2R3PA 4Z9LA 2RG5A 4MD8E 2H34A 1OVEA 3MFUA 2GNIA 4AP7A 3L9NA 4MNEA 2QOKA 4ZY4A 2CCIA 4ENXA 5L2IA 2QQ7A 4XS2A 2HW6A 5E7RA 3ZC5A 2X8DA 3FXWA 4ACDA 4FIHA 4CRSA 2WGJA 4RIXA 3QTIA 3OZ6A 1J7UA 5DR2A 3MBLA 3IDCA 5M51A 3H9FA 5EM7A 4OUCA 2PYWA 2WTIA 4GYGA 3NDMA 2PZIA 2Y6OA 4TW9A 4XLVA 2I0EA 3P08A 4AS0A 5LMKC 3QQJA 4YBJA 5AP1A 2C4GA 2NRYA 3RALA 2KTYA 3QAME 3TT0A 3NUNA 4C4HA 1XR1A 1Q3DA 3AMBA 3WZUA 2YCQA 3F2RA 1CKPA 5KHWA 3WARA 3R71A 2JDOA 3A2CA 4LMUA 3BI6A 2JFMA 2PE1A 4OR5A 1JKLA 3BGZA 3RWPA 2YIXA 3SA0A 3ULIA 3OEZA 5FG8A 3IW8A 3TI1A 2Z7LA 3ZM4A 1O6KA 3PSDA 3NVMB 3DB8A 4MKCA 5J9YA 5CNOA 3PXYA 4HYHA 3LQ5A 3HKOA 1JVPP 3A7JA 2IPXA 4Y72A 4YSJA 3P78A 3CP9A 3I4BA 2C5OA 2I0HA 1OPKA 3JVSA 1OB3A 2FGIA 4N6YA 4TNBA 1K2PA 2ZDUA 3ID6C 3F61A 3EZVA 4L42A 3W8QA 3ZRMA 1RJBA 3A8WA 2H96A 5DPVA 3UJGA 1S9JA 4DAWA 4RA5A 3VIDA 2CKPA 3R9RA 3P7BA 3NNVA 5JK3A 3UQCA 2BR1A 5LMBA 3E5AA 4LG4A 4FTJA 4D9TA 4F7NA 3LMIA 4Y83A 3DBCA 2PMLX 5DBXA 4E26A 3CCNA 3RKBA 5EFQA 4JX7A 4LM5A 4QQCA 4QTAA 3PZHA 2JKMA 4EL9A 5EW8A 4E4LA 4PDPA 5ANKA 3WIGA 3BGPA 3EYHA 3MH3A 1OBDA 3A7GA 4AQCA 2YIQA 2BTSA 4Z16A 3VVHA 5IQAA 1PXLA 2CGWA 5JFXA 4AAAA 2BHHA 5TO8A 3D9VA 4OTQA 2IVVA 4J7BA 1UV5A 3LCSA 3DA6A 1XJDA 3LCTA 2C47A 4RQKA 1OL5A 4F09A 1H00A 4MVFA 2X7OA 2PVRA 4GUEA 3NGAA 4IZ7A 4G34A 5CU3A 3UIUA 2QKRA 1ERKA 3PSBA 2CPKE 3QALE 1OBGA 4B8MA 5CQWA 4G31A 4JG6A 4G5JA 3T3VA 4CT2A 1PXNA 4GRBA 5I4NA 1Q8UA 3DJ5A 3E88A 1UA2A 3MVHA 4FZ6A 4IM2A 1Q5KA 1SMHA 3G6GA 3U51A 4QP6A 2E9VA 3R8UA 5DN3A 2HXQA 3IW5A 3S3IA 5LCJA 3D5UA 4E4NA 5AM7A 3F5UA 2G1TA 4XEYA 2R0UA 2ONLA 2ONLC 3QTSA 4FUYA 4PL4A 2C5XA 5DRDA 4RWKA 3KCKA 3CGFA 5HG7A 4CQGA 5T68A 4ASDA 4NWMA 2NNWB 4WBBB 3FLQA 3I79A 2OXXA 3QQFA 4X2FA 4EK8A 4U8ZA 4KB8A 5IMEA 4FGBA 5IA2A 3OBJA 5AX3A 3QA0A 1TVOA 4KS8A 2RFDA 3UNKA 3VUGA 4FV7A 2OWBA 4GVJA 4NW5A 4AFEA 5JKGA 5J8IA 3KREA 4U79A 4W4YA 4K0YA 4IFGA 4BWPA 3DK7A 4YC3A 2OH4A 3QRTA 4PUZA 3VUIA 2BPMA 3PJ3A 1IAJA 2PE2A 3A4OX 3FMKA 3IDBA 1OL1A 2YIWA 3NIEA 2OZOA 4QMPA 4DTBA 4LV5A 1A48A 1NY3A 3R22A 5IH4A 3OCTA 4LUEA 4W4WA 4ZTRA 1ATPE 4NM0A 4TPTA 5T3QA 3ORXA 2ERKA 4JQ8A 3OXZA 3G2FA 5M4CA 3W18A 3S2PA 4YJOA 1Q3WA 5KE0A 4F0IA 3RAHA 2HOGA 5DG5A 5D11A 3OVVA 4RVLA 3VS4A 5I9YA 5JH6A 4R7BA 4XHKB 5AA9A 1HCLA 5EW3A 5TKDA 3FYKX 5A46A 2VTQA 2W1ZA 2VWVA 3DQXA 2Y6MA 3OBGA 2WQBA 4QPSA 3DQWA 4FG9A 3GFEA 4CMOA 3KK9A 4UX9A 3TUDA 2X6DA 3EQCA 4KNBA 1W98A 4G3DA 4DH1A 4FOBA 2BZJA 3TACA 4NJDA 4D1SA 3KN5A 2OZAA 5LMAA 1OGUA 3NCZA 4HPUE 5DT4A 3UVPA 1NT2A 2IG7A 4UXLA 3NUSA 2PVNA 1Z5MA 4YZDA 1UKIA 3TJDA 4BDIA 2XRUA 2WD1A 4FE2A 3L1SA 4JAJA 2IN6A 3TUBA 3Q9XA 4AOTA 3PWYA 2ZM4A 3NWWA 4K77A 5FWKK 4FKVA 4FV4A 3VBXA 2W9FB 3ZHPC 4L9IA 2OJ9A 3KMUA 5H8BA 4FL1A 2V62A 4AT3A 5LOHA 3PE2A 5BVDA 1JAMA 3QF9A 5F20A 4C8BA 4PX6A 4HGEA 4I5HA 3G15A 3HV4A 3FMEA 5CS6A 2ITOA 4RFMA 1U59A 2VAGA 2VD5A 4S2ZA 2DWBA 4I6BA 2C6IA 3UDBA 3UVRA 4FIJA 3CY2A 3O17A 2O64A 2ITXA 5ITAA 3ET7A 5J7HA 3DBDA 1PMUA 2O3PA 3OY1A 3TG1A 3VNTA 4EC8A 1KUTA 2JDTA 1B6CB 3KF7A 3FKOA 4FTOA 2NRUA 4J99A 3EQDA 3ATTA 3OD6X 3WZDA 3NIZA 4BGGA 1GOLA 3FKLA 5EYMA 5G1XA 3HMNA 4ZTNA 3KXHA 4IANA 1VZOA 3AC1A 4E6DA 2JFLA 5JRSA 5JN2A 2UUEA 4QMXA 1ZZLA 2ESMA 2J0LA 1F3MC 3MY0A 4ZS4A 3FC1X 3SW4A 4MWHA 2ZV9A 3LVPA 4TWOA 3NAYA 3GT8A 3RGFA 3Q4CA 4WNPA 4R5YA 3ORMA 4NT4A 5CAVA 1ZYLA 4RQVA 4FTRA 2YIRA 4N70A 2UW7A 3I0OA 1UWJA 1YRPA 4FTLA 1PXOA 4EYJA 3LFCA 5CZIA 2WU7A 3AC4A 4BVUA 4R3RA 3F3UA 1H8FA 2B4SB 2VTHA 4GIHA 2WTKB 4H58A 4M68A 2OLCA 4YZCA 5FM2A 4D5KA 3DCVA 3QD3A 3QD0A 4ZSEA 4GU6A 2WMUA 2NP8A 4PDOA 4NM7A 1NVRA 1XBBA 4DFZE 4F64A 5IA1A 1PMNA 5ANGA 5KNJA 3NNXA 4GL9A 5KMMA 2HYYA 1JSTA 2HELA 2LGCA 3QHWA 3VJNA 4D1XA 1F5QA 3SAYA 3G9NA 4GW8A 3GU4A 4QYHA 4HCVA 4D2WA 1FMOE 4KBKA 4IC7A 1YI4A 4JR3A 4NSTA 4X7QA 3KVXA 5A4TA 4DEAA 3FV8A 4LOOA 4O0YA 1JSVA 1IA9A 5IG1A 1W84A 3HUCA 2PVHA 4DEBA 5LVPA 1R0PA 2HIWA 3F3TA 3FSFA 5CT0A 2Z8CA 3IW7A 1OECA 3ZU7A 4BCHA 5LVNA 3NZ0A 5CEMA 2JBPA 2J2IB 2WHBA 3P0MA 4FTIA 4G3FA 4IVCA 4KIKB 4UB7A 4YJVA 2CJMA 4J8NA 4RLLA 5DA3A 5A4LA 5EK7A 3BWJA 5HO6A 4XH6A 1SVHA 2OBJA 4IJPA 4JDIA 3KXXA 2R0IA 3QZHA 4CV9A 3RK7A 4PP9A 4BTJA 4MF0A 4FV9A 3R28A 4BTMA 1KE8A 4AG8A 2P2IA 4FUXA 1YXUA 3LCKA 2GS7A 4MXAA 4EQCA 4GMYA 4UV0A 3DBEA 2XEZA 3JXWA 4QMYA 4RJ7A 2CNVA 5DEWA 1M2PA 3LQ3A 4B8LA 4C3FA 1PW2A 3H30A 5LJJA 4I5MA 2W4JA 3W2CA 4CKIA 4MAOA 3ZLSA 4EJ7A 4L43A 3SG8A 1BLXA 4H3QA 1B39A 4QYGA 2VWBA 2UW3A 2XNBA 2C6MA 3OHTA 4M69A 3QTZA 4KKEA 4O22A 5DGZA 1U46A 2QC6A 4OTPA 4XV9A 5KO1A 4FV6A 1GNGA 1YWVA 2RKUA 3C50A 3ALNA 3OROA 3QTWA 4I92A 2VWXA 2W1CA 3EL7A 4X0MA 5H8GA 3RBWA 5BVFA 1CKIA 5CXHA 4A9UA 4EORA 3EFWA 2F9GA 3C13A 2WIHA 1BX6A 3OP5A 3SRVB 4XRLA 4IB1A 4F9WA 3UYSA 4GVAA 2IZTA 4C02A 4EUUA 3E92A 1OPLA 2PPQA 3TDVA 4AGDA 5F94A 3LHJA 5IMXA 2AUHA 3R1NA 2I7QA 4CVAA 2J90A 4QT1A 3E63A 3LZBA 3QFVA 4IHPA 5D1JA 3ZCLA 3HNGA 2H8HA 2VX3A 4EH8A 3QUDA 3PJCA 3EL8A 2UVZA 5BMMA 3LE6A 4IBMA 3AT3A 5AV1A 1XH6A 4O7VA 5HKMA 4M84A 4TTHB 2OIDA 4JRNA 2BZKB 2YERA 4DFUA 5ACBC 2XJ0A 5E1EA 4FSQA 4YHFA 5HD7A 1Q99A 4ASXA 2GCDA 4C33A 5J5TA 1IAHA 4O0VA 1DI8A 4FZDB 5EQYA 4E8AA 3P7CA 4YLKA 5AIKA 3VUKA 4AW1A 2JDSA 5CVHA 3BU5A 2R3KA 2I1MA 4ACMA 2XM8A 3ZZEA 2PL0A 2XK8A 4AN9A 4CNHA 3VC4A 1REJA 2QCSA 3UG1A 5HE3A 5E90A 1PXMA 5JGBA 3H4JA 4P7EA 2W0JA 5A54A 1ZZ2A 5KX8A 3UZPA 4A4XA 3MH2A 5L8LA 4PDYA 3LFBA 3PE1A 3Q3BA 4RIOA 4WT6A 2YN8A 4NU1A 1G8AA 2QO7A 5GZ8A 2Y7JA 3CQEA 5IDPA 5FTGA 3TDWA 3L8SA 4EHVA 2ITNA 3LFAA 5CF8A 4F6WA 5GNKA 4QMSA 4GK4A 4O0XA 3ZH8A 4UYNA 4Z7HA 4RVMA 4YJPA 3WI6A 5DI1A 3UOKA 2QO2A 2W4KA 4IVAA 2G01A 5EHOA 5M4FA 1NVSA 3W55A 3LCDA 2BFXA 2XH5A 1OUYA 2BRBA 4FX3A 4D58A 4P2KA 3PSCA 3OT3A 2XYUA 2CLXA 4JBPA 4WG4A 4YJTA 5C01A 4F1TA 1H27A 3LW0A 3AC8A 3FEGA 2PK9A 1W83A 3R9HA 3Q60A 4LI5A 5HBJA 4LQMA 3RCJA 4GYIA 1F0QA 1U5RA 3U6IA 3ALOA 2RG6A 2CKEA 3DK6A 3D2IA 3ZLYA 2VUWA 3FLYA 4YJSA 4L3PA 2O2UA 3FWQA 5I9ZA 4D2PA 2FSMX 2YEXA 3UO5A 3QGWA 2VTPA 1MP8A 4W8EA 4O81A 5FBNC 4IX6A 2RFSA 4G17A 3SDJA 2WTCA 3TNQB 2YWVA 2QO9A 3QQKA 5DE2A 4USFA 4MXCA 2QR8A 4RJ3A 2GS6A 3WOWA 3CQWA 3IGGA 2BIYA 3DKGA 4EWQA 3EQBA 1YQJA 4CZUA 3QQHA 4QP7A 3KY2A 4XG2A 4WUAA 4YTHA 5IQCA 5BX0A 2WEIA 4DGLC 4RSSA 1H07A 3ZO2A 4O6LA 5J9LA 4GK3A 1OIYA 4I6HA 3SOAA 3UO6A 4R7HA 2CNQA 2VRXA 1PKGA 4ID7A 2OW3A 3ZDUA 2DS1A 3LXKA 4KIQA 3A62A 1AQ1A 3BX5A 4JBVA 3Q2MA 3E64A 4BZDA 2GDOA 2GHMA 5ANIA 2BZIB 5IQIA 4K8AA 5BVEA 3KB7A 4FTUA 5DR9A 2C3LA 4FKTA 2RL5A 3FDNA 4FSTA 1Q41A 1U54A 4CT1A 4FVRA 4AZSA 3CBLA 4TWNA 5GIOE 5T6KA 3EIDA 3VF8A 3W1FA 4CQEA 5JSMA 4F08A 3BIZA 2F7XE 4XV2A 4ALWA 2ITWA 4FR4A 5HLPA 4EHGA 1Q8TA 2V5QA 4CV8A 5CZHA 4OAVB 2GNGA 4EOQA 2IW6A 1LEZA 2GMXA 4U97A 3T9IA 3FYJX 3G9LX 4S30A 2QNJA 3SKCA 4EUTA 3KCFA 2ZOQA 4XNEA 5HVKA 2UZEA 4HGTA 1YVJA 4WOVA 4WSYA 5J1VA 3A7HA 5BVKA 4C57A 2PUPA 3QTRA 2OJGA 4JJRA 2CGUA 2YM4A 1XWSA 5A3XA 5M4UA 3ROYA 2YDKA 2YCFA 2XIXA 5HD4A 3PXRA 2VWZA 2FA2A 4ZTHA 1DS5A 2V55A 3V8TA 5CVGA 3ZMMA 4RWJA 4ANBA 3R6XA 3L9MA 5IEVA 5ETAA 3FAAA 3WF9A 4M0ZA 1VEBA 3KXMA 4OBPA 2ZV7A 4DGNA 3BE2A 5LQFA 3FL4A 4D4YA 3ZO3A 2VV9A 3EMGA 5ANEA 2WELA 5CAQA 3FLNC 5A6NA 2WMSA 3EYGA 2V7AA 2FSTX 3JY0A 3TL8A 3HEGA 4H3PA 3LLAA 5CSHA 3VS7A 4FG8A 2ITVA 2YM5A 2J9MA 5B2KA 3I6UA 4GT3A 1NXKA 4JBOA 4R6VA 3TN8A 3PA3A 2WMRA 3E87A 4Q9SA 4S32A 3HV3A 2QOCA 5FTOA 2ZMDA 4FK3A 3U9CA 3Q4ZA 3PG3A 4BIEA 4V04A 4BICA 4O7LA 4XUFA 3NYOA 2IWIA 4PMPA 5IQFA 1Q8ZA 5EM8A 3DTWA 4EK4A 2OF2A 4JDJA 2F57A 5HTIA 4WIHA 1YDSE 3NUPA 1H1SA 5TT7A 3UMXA 5JFVA 4DH5A 2P2HA 2XVDA 1SNXA 2CN8A 2H9VA 4NTTA 3R1YA 5F9EA 1YXXA 2P0CA 2JKKA 2XKDA 2YWPA 1STCE 2WMTA 3MA3A 3D4QA 5M57A 4U3YA 2I0VA 1SYKA 4QRCA 4CMUA 2GU8A 4E6AA 2X8IA 1E1XA 1YDRE 3QRIA 5CAPA 4G3GA 3BU6A 2JKQA 4EK3A 4RFZA 3ZS5A 3RNYA 5IA5A 3V8SA 3AT2A 4MQ2A 4XBRA 5J95A 3THBA 3KRXA 3LM0A 2IO6A 2WOTA 2UW4A 3DJ7A 3O7LD 4XG8A 4YJQA 3VULA 4ASZA 4I4FA 4YJNA 4DEIA 2QHNA 4ORKA 5CEPA 4IB5A 4IB0A 4CSVA 4L3JA 4L3LA 3GXLA 1PRYA 3KXGA 3SHEA 4EKLA 4RZVA 4CFXA 2C5NA 2GFSA 3C4WA 5M56A 4BB4A 3FMMA 5CU2A 4YU2A 4UMUA 5CSVA 2PVKA 5I9UA 3RPYA 3BCEA 4ACCA 5A4QA 3WZEA 5HX8A 4ANLA 2QODA 2GS2A 2QI8A 3GENA 1YOLA 5K3YA 2BRMA 2RGPA 1MQBA 1URWA 3IO7A 4OBQA 2E9PA 1RE8A 2PMNX 3CKXA 3OW3A 3PY0A 1J1BA 5HO8A 4DHFA 2BTRA 4XJ0A 4J95A 3VUDA 5TR6A 4DTKA 4L52A 3II5A 2R9SA 3ZLWA 3VBQA 4UN0C 5E92A 4FV5A 1J7IA 3ENHA 1JQHA 4E5BA 2XK4A 3BV3A 4BTKA 4XOZA 4F9CA 4PF4A 3VAPA 1HCKA 2R3IA 5AP3A 2WAJA 1YWNA 4AT4A 4DFXE 3QRUA 5H2UA 3HAVA 4A9TA 3GGFA 3EOCA 3RCDA 4FSUA 2HK5A 4JT3A 4AZEA 4C4FA 4I21A 2Y0AA 3TTJA 2W1GA 2ZV8A 4TKSA 1XBCA 3BYSA 2G9XA 4MWIA 5IUIA 4ZTMA 4D2RA 4U9AA 4FNWA 2SRCA 4DYMA 3GC8A 4I41A 3G51A 3GU6A 4WSQA 3D83A 2R7BA 3RVGA 5AUWA 5ICPA 4O1PA 3SQQA 4I5CA 4NFMA 5BVOA 4BTFA 5IH5A 1YHSA 2YAAA 4EI4A 4APCA 3GOKA 4FSRA 4FZFB 4KWPA 5HBHA 3UE4A 5HE1A 3IKAA 4HW7A 2R3JA 1DAWA 4KUJA 4O82A 4Y5QA 1FGKA 4G9CA 3HP2A 3RK9A 3HECA 4IAFA 1XH7A 1WFCA 3QTUA 4C4GA 2X0GA 1WVXA 5EI8A 3I1AA 4U43A 1OKZA 4CEGA 4BKJA 4JXFA 5FDPA 4BHNA 4G6NA 3U6JA 3DZQA 5EQEA 2OFUA 3WE8A 3BQCA 2OXDA 1H08A 4O7YA 3O8PA 1BKXA 4GFGA 5DLSA 3IONA 3BV2A 3QKMA 4C59A 3R2YA 4K9YA 5L8JA 1BI7A 1FINA 3MVJA 4KRDA 3ZC6A 3TTIA 5AP0A 4YBKA 5BUJA 1ZYDA 2JD5A 4G16A 1J91A 1ZWSA 4HYUA 5ETCA 2XIRA 3FUPA 2VU3A 2ITQA 3M42A 4FT9A 4X21A 3WBLA 3DK3A 4QNYA 4K18A 3N9XA 4RWIA 4BCOA 1OIRA 3L8XA 4IWPA 2UZTA 4HOKA 4YLJA 1LR4A 3DNDA 1ZLTA 4J53A 4ZJIA 1FMKA 4G3EA 1RDQE 4M12A 1BUHA 3BYOA 4Y46A 4P5QA 3R8VA 4Q2AA 2ZYBA 1H1RA 3UZTA 2YLEA 3R2BA 2F7ZE 3ERKA 4MXOA 4PTCA 4GK2A 4XBUA 4ZEGA 5AP6A 5GINE 2OO8X 4R8QA 5E8VA 4FTCA 3R73A 1P4FA 3EN6A 4RG0A 4CFVA 5A14A 2C1BA 4BDDA 4H39A 3FQEA 4LMNA 2RSVA 3C4CA 3F69A 4H05A 3RM7A 2DYLA 2GNLA 4V05A 4A9YA 3CTQA 3JYAA 4F1OA 1XBAA 1YOJA 4I23A 4FT7A 1W8CA 2OIBA 4BR3A 4ZAUA 4IAYA 1KOBA 1ZOGA 5AX9A 3PYYA 1UWHA 2XF0A 4BCJA 3D14A 4RZWA 2PU8A 2FSLX 3AXWA 3O7LB 4XCUA 5JT2A 3DFAA 4R1YA 3GP0A 4RX5A 3R30A 2BUJA 4PTEA 1XH5A 3LMGA 3MFSA 4IM3A 3QX4A 4NJ3A 4B9DA 3S1HA 2B55A 2VTIA 3NUAA 5CF4A 4F65A 4KSPA 5CSXA 3F82A 1H1PA 2IVUA 4BYJA 4OTFA 2W1FA 2I0YA 3O50A 2DUVA 4L44A 4QO9A 3PJ1A 3U4WA 5IEYA 4L45A 2WTVA 2W99B 3AMYA 5IA4A 5IU2A 4MH7A 5LWMA 3GCPA 4TYJA 1DI9A 1ZMWA 4E20A 4II5A 3EQGA 3AC5A 3DXQA 3TKHA 3UGCA 5F95A 3ORNA 3KEXA 1OZ1A 4FKUA 3DAJA 3M11A 4I6QA 4J8MA 5HTBA 3ORLA 4D5HA 1ZY5A 3SRVA 4XRJA 3ORPA 5AP4A 1TQPA 2BRHA 2O65A 4RT7A 4TT7A 2C6LA 2C1AA 1EH4A 4FZAB 3F88A 2OF4A 3HRFA 4R3CA 4LL0A 5FDXA 3QLGA 5AMNA 1QMZA 4FBXA 5KUPA 3OXIA 5C27A 1YOMA 3NS9A 5ANDA 2JEDA 3RAIA 1YDTE 3AOXA 4FKSA 4DC2A 4O27B 5CU0A 4JLCA 1WAKA 4MXZA 4DCAA 4ZY5A 3Q2JA 3ANRA 1M7NA 3GC9A 4OLIA 5FXSA 5KMJA 3VJOA 2JIIA 3MN3A 5E8WA 3SG9A 1MQ4A 5HTCA 5D10A 3CTHA 4TYHA 3OXTA 3QD2B 5EI2A 5L3AA 2X1NA 4RVTA 2JDRA 1QPJA 4TNDA 3EN7A 5FP6A 1FVTA 4Z55A 3N4VA 4R5SA 5CSWA 1OITA 5KMIA 4IEBA 4RIWB 5JQ8A 5KKRB 5J9ZA 4FNYA 2OK1A 4RC2A 4BGHA 1Q4LA 3R83A 1G8SA 1CMKE 1PMEA 3P5KA 4DCEA 3LJ1A 5HVJA 4QP1A 5HG5A 5E9EA 4RX9A 2CGXA 3T3UA 4CTBA 4YR8A 3PY1A 4LFIA 4C58A 4O1OA 3SC1A 4BGQA 4DEEA 4N4SA 2EXMA 2HWPA 4BDGA 2ZMCA 2YIYA 4PTGA 4FA2A 2VX0A 2YM3A 4I6FA 4TZRA 3PPZA 2OU7A 1KE6A 5CEQA 4GJ3A 3QX2A 4UMRA 4DA5A 3B2WA 5FLFA 4JIAA 5CTPA 3OWLA 3UIXA 2C0TA 5AAGA 3Q5ZA 2BILB 5CF6A 3GU8A 2W17A 3I0QA 3RZFA 3B8QA 3F7ZA 2AC3A 4FIEA 3TIZA 1Q24A 2LAVA 3W32A 4DG2E 3R9DA 2XIYA 1JNKA 4OTRA 3RPOA 5BNJA 3R9OA 4EK5A 2YABA 3EQHA 3F3VA 4D4VA 5A4EA 4CLJA 4YHTA 2J6MA 3GCUA 4IFCA 3MIAA 3SGCA 3CY3A 3GB2A 4ITJA 1FOTA 4I5PA 2ERZE 4JI9A 4U44A 2PZRA 3RNIA 3TIYA 4BCFA 4BIBA 4A9SA 3C5UA 3CLYA 2UW9A 3DTCA 3OY3A 5KMOA 1H1WA 3QRKA 2XIKA 3N51A 5FBOA 4USEA 3BLRA 3IDPA 4IAAA 4I4EA 4NL0A 3NLBA 4WG3A 5HO7A 2CKOA 5HG9A 5E4HA 4GG5A 3D2KA 3R8PA 2F2UA 4IE9A 2BAQA 4A06A 3HRBA 3KA0A 4ANMA 3FMJA 4F63A 1V1KA 1WBTA 3HV6A 4QMNA 2B9IA 2QONA 1GAGA 3KULA 3R9NA 5LVMA 2J0KA 4PL5A 4GCJA 4XV3A 1YI6A 2OKRA 4TY1A 4DFLA 2UZLA 5L6WL 1Y6AA 4NIFB 4V0GB 3LAUA 4DGGA 4ANOA 3KC3A 4LGGA 1WBWA 3GU7A 3G0EA 3BYMA 3VBTA 4NK9A 5E8ZA 4F4PA 2ITTA 5DNRA 1JKKA 4C4JA 4DITA 1VJYA 2J7TA 4L68A 5BVNA 1H01A 3H3CA 4ZK5A 2W7XA 3QCYA 3PRFA 2DQ7X 5BYYA 3IS5A 5JFSA 4IXPA 3D7ZA 1YI3A 3ENMA 3MDYA 3LMHA 1ZXEA 5D7AA 2C5YA 2YJSA 5ETFA 4F9AA 4KKHA 2Z02A 1XQZA 1CSNA 1ZYCA 2J0JA 3E7VA 3TNPC 2JKOA 5EW9A 3ZUTA 5M53A 1BL7A 1J1CA 1H1QA 3KRLA 5M07A 3QQUA 2HY81 4Q5EA 2UZVA 3LFNA 3HDNA 3QQLA 1H0WA 5B2LA 2R3MA 3LFDA 2C69A 3I5NA 2PZYA 5L6OA 5DT0A 3P79A 5FUTA 2EB3A 5E8TA 2ZVAA 3NNUA 5JGAA 5IQBA 2UZNA 2BAKA 4I24A 3CSVA 5CSPA 4YC6A 2R3RA 2ZJWA 4PNKA 5TF9A 5K4JA 4FT5A 4GT5A 4H36A 2QU5A 3KRRA 1BYGA 2GHLA 3PPJA 3FLWA 2XK3A 3IW6A 2OJIA 4FOCA 2W1DA 4O0WA 4XYFA 5KMLA 4HZSA 4R7IA 2E9OA 4O2PA 3MTFA 3UP2A 4X6RA 4YZBA 5EYKA 5C8MA 4EHZA 2X2LA 4BZOA 3UOJA 3RZBA 2B1PA 2W1IA 2XKEA 4AWIA 4AE6A 3OOMA 4FSZA 2BDWA 4K6ZA 4FGRA 2XJ2A 3QUEA 2W96B 3U8WA 2REIA 5EI6A 4O96A 4CFUA 4WD5A 3OWJA 1JOWB 2B54A 4HPTE 2QURA 3PUPA 4UY9A 2XM9A 4KIOA 2JIUA 5AUZA 3DKCA 4I0RA 1OL7A 3PA5A 2GSFA 4BL1A 4O83A 4C36A 5I9VA 2IJMA 4FV0A 3TZMA 3D5XA 3I81A 4IX4A 3QUPA 4FNZA 4K1BA 2XNMA 4QNAA 3LCOA 1I09A 2AC5A 3FQSA 4GKIA 3RWQA 1H25A 2X6EA 4F7LA 2P55A 4DEGA 1MRVA 2J50A 4CD0A 1H26A 1NA7A 2I40A 3DZOA 4BRXA 2YITA 1O6YA 4K2RA 4U80A 1R3CA 2Z7RA 3E7OA 2BAJA 3Q4TA 4CFWA 5KMNA 4YJRA 4HNIA 2C30A 3BHUA 4GEOA 3OT8A 4ZSLA 4YTFA 2GTNA 3BLQA 4JQ7A 3CPBA 3MB6A 2YJRA 3NCGA 2YFXA 4MBJA 4MF1A 3PJ2A 4NM5A 5EOLA 3MFRA 4YSMA 3UC3A 3UIMA 4AT5A 4DT9A 3MYGA 5CENA 4FODA 4A4OA 3OCBA 3TJCA 2QOLA 5EYDA 1QPDA 3LQ8A 4QQ5A 4UEUA 5BYLA 2VTOA 4ZSJA 4BBEA 4RWLA 5DVRA 4QYFA 5HE2A 1P2AA 2BRGA 3DU8A 4ZZNA 4LRJA 1T45A 3V6SA 4BCPA 3P1AA 3KL8A 4RMZA 3BYVA 4FVPA 4PV0A 2HZNA 1V0OA 3R1SA 4RJ4A 4LRMA 3GQIA 4ZTLA 3O8UA 4ZTQA 3NUYA 2XK9A 3LKMA 2C3KA 3F2NA 4ZY6A 1GIIA 4FTTA 4HCUA 4M14A 3EKNA 5C4KA 4I94A 1GZOA 5AR3A 5JGDA 4ZLYA 3ZRLA 4I1ZA 2YCSA 4J96A 5I5ZA 3EQRA 4LV8A 3D15A 1DAYA 3HZTA 1XKKA 2WB8A 3PIZA 2HXLA 4FIIA 4XMOA 4PP7A 5IDNA 4TYIA 3UTOA 3SOCA 2CHLA 3TKIA 4BCGA 4BWKA 1YHWA 1OUKA 2PSQA 2OI4X 2PWLA 3MV5A 1J3HA 4C0TA 3EZRA 1REKA 5HEZA 4ZZOA 2ETRA 2QOIA 3E3PA 1L8TA 5AP7A 4FEWA 4AACA 2HZIA 4LRKA 4IDVA 4ZTSA 3OUKA 4YJUA 1Y91A 4RJ5A 3UODA 4L46A 4KKGA 4U45A 3UOHA 1LP4A 2W4OA 4WRGA 4WG5A 2HAKA 3BGQA 5EDPA 1MRUA 3ZFMA 4V01A 4Y8DA 3AD5A 4F7JA 5HHWA 3ULZA 4YTIA 2BZHB 3VS6A 1NVQA 3QCQA 2RIOA 2XYNA 5CXZA 5EQPA 4FIFA 5K0XA 3IQ7A 4D0XA 3IOKA 2VX1A 3BBWA 4MXXA 1Y8YA 5BVWA 4KSQA 1OI9A 2BALA 5HNGA 1K9AA 4QTCA 4BC6A 5CVFA 3W16A 2Z7SA 1R1WA 3VWAA 4BDJA 4WHZA 2GQRA 4CRLA 4I22A 2HENA 4MNFA 3HYHA 4RIYB 5KBQA 3PP1A 1LPUA 3GU5A 3OCGA 4FKGA 2R3QA 5EDRA 3F3WA 1M2QA 3OTVA 2YDIA 4BDKA 4GH2A 4YPSA 4YZMA 1CKJA 4O38A 2V0DA 3C0GA 4IJ9A 4ZLOA 3GCSA 4XG4A 2XBJA 4MQ1A 5EYCA 3HV7A 2W1EA 4NTSA 4F9BA 4MK0A 5IUGA 3K5UA 2ITYA 2X4ZA 2WO6A 5KMKA 4GSBA 4MX9A 2CMWA 2QD9A 4WRSA 4O2ZA 5A6OA 2WEVA 4UXQA 3VS5A 4DGMA 1YHVA 4IB3A 5BUEA 3A61A 1UKHA 3V01A 4NH1A 4O91A 4IH8A 3C4XA 2UW5A 3GOPA 2Y4IB 3HP5A 4AA4A 1M2RA 3OOGA 4DEDA 3W10A 3G33A 3WILA 4ZIMA 5DHJA 4JDKA 3SXSA 1M17A 3UVQA 3IG7A 3ODYX 3ELJA 3HAMA 4PDSA 2E9NA 2XA4A 3BE9A 1OL2A 4ZP5A 1QPEA 4MHAA 5I9WA 3PXKA 4NYEA 2VO6A 1H24A 2WMAA 4AA5A 1R0EA 3KXNA 3R7YA 3RPRA 2OH0E 2C6DA 4X3JA 5HIBA 4EH6A 4HJOA 2F4JA 3Q5IA 5DMZA 4TN6A 5CALA 5HCYA 4O7WA 4DBXA 2J5EA 4FV8A 4EONA 3TNIA 1HOWA 4IIRA 3COHA 3QGYA 4QTEA 3TV6A 1ZARA 3MH0A 4IZYA 2YHVA 4QYEA 1GZKA 4WBOA 3ORIA 2UV2A 3PVBA 1IA8A 5ANOA 4FKQA 3VBWA 3D7TB 4UWBA 4YHJA 2W5BA 2IZUA 3K3JA 1YXSA 1PJKA 1X8BA 4AU8A 1M7QA 4JL9A 4UWYA 5J87A 4W8DA 3NW5A 4GKHA 1GIJA 4YGAA 5E8UA 2QVSE 5AUXA 3KVWA 3VUMA 5C8KA 1JPAA 4F70A 2IW9A 4NKAA 2UW0A 3MA6A 5TE0A 2WQMA 2XUUA 4EHEA 2QOQA 5AJQA 2XNGA 3R02A 3W2SA 3KMWA 4QMOA 5AUUA 4G5PA 5DFPA 1GJOA 4NKSA 4BYIA 5IQEA 3Q96A 2FSOX 4J98A 1PYEA 2UZWE 4QP4A 1PKDA 4H1MA 4E93A 3HRCA 2X7FA 1YXVA 3CTJA 3W2OA 1BI8A 2VZ6A 2WQOA 3CQUA 4U40A 3ZONA 4E3CA 4F9YA 2W06A 3DXPA 5FXRA 4DF3A 2B9HA 1W82A 2X8EA 3QCXA 2Q0NA 3R8ZA 3E8EA 2Z2WA 2PE0A 3GNIB 3QQGA 4FSYA 3V5LA 2ZB1A 3GI3A 4ZLZA 2OJFE 1ND4A 4GJ2A 4RJ6A 5HGIA 4YNOA 1M14A 4BIDA 5M44A 4CGAA 4X2JA 4BCQA 4CYIA 3BBTB 4FT0A 4O0TA 5I9XA 1WVWA 3DXNA 2VWIA 1Y57A 3VF9A 4BBMA 1CM8A 2VTTA 3QTQA 4E6CA 1ZMUA 4JRVA 3O23A 3PLSA 1ZYJA 4ACHA 2QG7A 3Q9ZA 4AW2A 4OT5A 2ITUA 3C0HA 5KHXA 4RIWA 5CWZA 5B2MA 3K54A 4A7CA 3TUCA 3L9PA 4YNEA 4CKJA 4AX8A 3RPVA 4JNWA 4D9UA 2C3JA 5F4NA 3FL5A 3IOPA 3JUHA 3HUBA 1KWPA 3D5VA 3IECA 5CQUA 4AOJA 1P5EA 1Y6BA 4CYJA 4CMTA 3NYNA 3EKKA 3DOGA 4AZWA 1VR2A 4TL0A 2BHEA 3W2PA 5BYZA 5IQGA 3RPSA 4P5ZA 2WMQA 4AA0A 2WU6A 2WPAA 4MYGA 4RBLA 4M7IA 2PULA 5K5NA 1KE5A 2CCHA 2X81A 2R4BA 4DG3E 4IDTA 2BDFA 3BHHA 4IAZA 1UNHA 3NRMA 3UMWA 2JITA 4FL2A 1JKSA 2G2FA 4IMYA 2IVTA 2J0IA 3EN5A 5HCXA 4KIPA 4GV1A 3ZEWA 3NX8A 1O9UA 2RF9A 1GIHA 1ZYSA 4R1VA 2XNEA 5DH3A 4EKKA 3PVGA 3F7WA 4YZNA 3WYXA 4UMTA 4ZZMA 3PDTA 4D4SA 2E2BA 3DDPA 4HGLA 4BCIA 3OTUA 2VTSA 3CIKA 4I93A 4QD6A 4AF3A 3DNEA 4EZ5A 2BKZA 3R7GA 5HNBA 3NVKI 3A60A 3OMVA 4K11A 3LIJA 4BCMA 1JLUE 2JGZA 2EWAA 1YXTA 2RFEA 2YCRA 3MIYA 2EU9A 2YA9A 3R0TA 3WE4A 4D1ZA 2XCHA 2H6DA 3CJGA 4WKQA 4CCUA 1PXIA 2WKMA 4JOAA 1MUOA 4M3QA 1ZRZA 2B0QA 4FEUA 2VTNA 2YACA 4KBAA 2YISA 3DBQA 3NMUF 2ETKA 2XBAA 4YPDA 2XB7A 3GCVA 1H0VA 3E62A 3MB7A 3ZXTA 4C37A 5HLWA 4QQJA 3S0OA 2XKFA 2IZSA 2XNPA 4NW6A 3ZXZA 3UNZA 2R3OA 2W9ZB 4IW0A 3ZBXA 4NIFA 3LJ0A 3FZ1A 3O0GA 3I7CA 4LGDA 4IVBA 4EBVA 3POOA 4FIGA 2WNTA 3T8OA 4AZFA 3VHEA 1WBNA 2UVYA 4X3FB 4EH3A 2VTLA 5H9BA 3S95A 4DE4A 4OTHA 3AGLA 5TOZA 1JWHA 5AUVA 2OXYA 3TWJA 3OCSA 3FSKA 4KINA 2ITZA 4D4RA 3OFMA 5HI2A 3VW8A 1UNGA 3PPKA 3Q32A 2JC6A 2RFNA 4QPMA 5CEKA 3OWPA 3S4QA 5CF5A 1OKYA 5AV2A 1QL6A 2J4ZA 4XG7A 3ZEPA 4CFNA 4RC4A 3U54A 2FUMA 4MEDA 5JRQA 1WBOA 4C2WA 3GC7A 3WIKA 3FHIA 3N4UA 5BUIA 4IWQA 2C6TA 4JG7A 5LVLA 3ZUVA 3EQPA 1JSUA 2BCJA 3MWUA 2O8YA 3H9RA 1CTPE 3PXQA 4Q9ZA 1LEWA 4TRLA 3R63A 5LMKA 4GT4A 4KABA 1FVVA 1XH8A 4KBCA 4UMQA 3BU3A 3LPBA 4WNMA 3RINA 4Z3VA 2WTKC 2JAMA 1SM2A 3VO3A 5L4QA 4EH5A 5AADA 3F3ZA 4KD1A 2P4IA 4E4MA 4QMLA 3FZPA 4X2KA 4YC8A 3C0IA 3C5IA 5FEDA 1KE9A 2UVXA 1FVRA 1Q61A 3L9LA 2YZAA 2PVLA 5BQ0A 1P14A 3ACJA 3LOKA 3SW7A 1KSWA 2R3LA 4EWHA 5J5SA 5AIRA 4JX3A 1CDKA 1OKWA 3F9NA 3FZSA 4BDAA 3VUTA 4E4XA 2PVMA 5AV4A 2PVJA 3CC6A 4CFFA 3VRZA 2WTWA 4C61A 3CE3A 3LFFA 3ATSA 4JS8A 4C3RA 1YWRA 2QOFA 4HZRA 2GNFA 5GZ9A 4W4VA 4ZMFA 1OKVA 4R78A 4EOIA 5LWNA 3DKFA 4L7FA 2JIVA 4EH7A 4F1MA 4KIKA 3CXWA 5E8XA 2Q0BA 3VQHA 3Q52A 1JKTA 4RA4A 4RGJA 2AYPA 5HVYA 3EB0A 4BBFA 3HX4A 5CU4A 1V0BA 3AC2A 4UYAA 3ZFYA 2IW8A 2R7IA 4OBOA 4JBQA 1GY3A 3MESA 1OIUA 5D41A 3NAXA 3OF0A 2XJ1A 3O2MA 3AT4A 4W4XA 4ZJJA 3VS0A 2HZ4A 4DEHA 3D0EA 5L8KA 2WFYA 3C4FA 3DAKA 4ITHA 1IEPA 4EOLA 4C4IA 4FEXA 5E91A 5J7BA 5EKNA 3FI3A 4O7SA 3R7UA 3ZUUA 3COKA 4YZ9A 3WYYA 4Q5HA 5CEIA 4IAIA 4NZWB 2R5TA 2ACXA 2EUFB 3DFCB 5DIAA 3VS2A 2EXEA 2GQSA 3U55A 2CN5A 5M06A 2HY0A 1L3RE 4XG9A 3UPXA 5IPJA 3D94A 3HA8A 4XOYA 2B52A 2B9FA 4KRCA 2A4LA 3PRIA 4D55A 1J7LA 4BZNA 1TQIA 2VWWA 4PPAA 4X2GA 1UU9A 3COIA 5F1ZA 4XP3A 3VW6A 4D0WA 5AEPA 3ZOSA 3RK5A 3C7QA 5HNIX 1B38A 1URCA 1U54B 4BDCA 3HMMA 3R7EA 2PVFA 3E8NA 3MVMA 4FTNA 1TKIA 2WXVA 4QYYA 3RAWA 3BYUA 2QR7A 3HMPA 2VTAA 1A9UA 4I0SA 5B0XA 3MI9A 3TNWA 3MY5A 5ANJA 3RHKA 3AMAA 3Q9WA 2VO0A 3HL7A 4Y73A 5E1SA 3PVWA 4LUDA 2ETMA 4N6ZA 4U0IA 3UNJA 4CCBA 4ZSGA 4E73A 3QKKA 5CEOA 4W9XA 5C9CA 5IF1A 3LM5A 2C6KA 3PIYA 3QZFA 4JAIA 4S34A 3G0FA 4G3CA 5AR4A 4RPVA 3R8MA 4XLIA 1SZMA 3HV5A 3TXOA 3V5PA 4AW0A 4NEUA 4FKIA 3PP0A 4OT6A 4U81A 5KZIA 5L6PA 5DWRA 2FB8A 3EN9A 3RTPA 3CD3A 2UW8A 2G15A 3R1QA 4YMJA 1WZYA 2VO3A 3O96A 4U6RA 5CU6A 4AFJA 4O7ZA 4UALA 5HCZA 1OMWA 4AZTA 2XK7A 3FJQE 5FXQA 3FMNA 3DB6A 4QPAA 3LXLA 4MCVA 4QMUA 5I3RA 3HA6A 4O84A 4D2VA 4BDFA 4MXYA 4EOKA 2YZLA 4QOXA 4ANSA 5GZAA 2BMCA 5CX9A 2XK6A 2B9JA 3KN6A 4I0TA 4X2NA 3SVVA 2Y9QA 5AAFA 3TV4A 3ZSGA 4L7SA 5FEEA 5A4CA 4DTAA 1U4DA 3R7OA 2OJJA 3MSSA 4DFBA 3JVRA 2YLFA 5HICA 4FEVA 3SXFA 3NUUA 2A19B 5L2TA 1Z9XA 3ORTA 4XP2A 5JMSA 3OS3A 4J1RA 2GFCA 4A9RA 1UVRA 1Z57A 4XV1A 4RJ8A 3V5QA 4FICA 3UYTA 4D2SA 2VNYA 3ZBFA 5HU9A 2GPHA 2WQEA 3NUXA 3M2WA 3MH1A 3W8LA 3MS9A 3RAKA 4CLIA 3QTXA 4G2FA 5AA8A 4AN2A 3H9OA 5HX6A 1TQMA 4U41A 5L2SA 3E8CA 4EJNA 4ZOGA 3A7FA 5CT7A 2V22A 4HGSA 4KA3A 4RLKA 4HVGA 2GNJA 4BHZA 4AXAA 4DH7A 4B6LA 4YLLA 2XRWA 2VN9A 2C6OA 3ANQA 3CGOA 4RIYA 5IKWA 1U5QA 2E9UA 2OG8A 3EWHA 4FL3A 5E8SA 3ZRKA 2WOUA 4EYMA 3FLSA 1E1VA 5CAOA 2CNUA 3KK8A 3MPAA 4BI0A 5EHYA 3W2RA 4JDHA 5M55A 4P90A 4OAUC 4D2TA 4AZVA 4FZ7A 5CAUA 5M08A 2PMOX 4CTCA 5LXMA 3LFSA 3PTGA 2I6LA 2P33A 4C38A 2F2CB 2QG5A 5HLNA 4C3PA 2G2HA 2ZAZA 4O0SA 4QP2A 5IISA 3E93A 3P23A 1YKRA 4FV3A 5KCVA 3QWJA 3N4TA 2HW7A 2C68A 2O63A 2ITPA 2WIPA 2Y4IC 2XNNA 3ZLXA 3OEFX 4WO5A 3T9TA 2OSCA 2PTKA 4FV1A 4ASEA 1QPCA 4HYIA 4TYGA 5I3OA 3A99A 4M67A 3C9WA 3L8VA 4WNOA 1SVEA 2J51A 3U4UA
chains in the Genus database with same CATH superfamily
3BHTA 1XH4A 4QMTA 1WBSA 3KF4A 1XMMA 2CKQA 3EHAA 3ZZWA 5DR6A 1KV2A 2IVSA 2X39A 3FZRA 5AV3A 3S00A 3RMFA 2XS0A 4BJJB 4OTDA 5L2QA 4O86A 2X9FA 4G6OA 3PG1A 3IW4A 4LOQA 5EHLA 4ZSAA 5FD2A 3C4ZA 3FPMA 1WBPA 4GIIA 1PYXA 5LVOA 3Q6UA 5KBRA 1K3AA 3BLHA 3D7TA 4PRJA 4H3BA 3W0SA 2XKCA 2PY3A 4MBLA 1YW2A 3V04A 5GJFA 5HIEA 2R3GA 3EFKA 5HOAA 3F5GA 2Z60A 4FI1A 3OC1A 3ZTXA 4IACA 1DM2A 4FKLA 5D7VA 3DAEA 4ZJVA 4LGHA 3VHKA 4E1ZA 3SLSA 2QHMA 3RHXA 4F99A 4L6QA 3SX9A 4C7TA 5JEBA 5BMSA 2BVAA 3PWDA 3VBYA 4GG7A 1UU8A 4FYNA 3LLTA 3LJ2A 4ANNA 1O6LA 4RRVA 3QU0A 4QMMA 5HZNA 3KRWA 2O5KA 4MNEB 2G2IA 1AGWA 3OWKA 4AN3A 2BKKA 5AP5A 2WZJA 4WA9A 2A2AA 3ZSIA 3QCSA 3COMA 4KAOA 2W1HA 5GHVA 1APME 5EH0A 3FMDA 5GJGA 3TZ9A 4E5AX 2BROA 5C4LA 4RIXB 2JDVA 3FBVA 3UIBA 2VGPA 3Q9YA 2FO0A 1FGIA 4F78A 5KZ0A 4FKRA 2X9EA 4Y5HA 3WZKA 2WQNA 3UBDA 4C4EA 4YO4A 3U87A 2PUIA 5AFVA 2PZPA 4O6EA 5A9UA 4CFMA 5HIDA 3RI1A 3W33A 4B99A 4RVKA 2XMYA 3F6XA 2Y4PA 4M8TA 4FG7A 3U6HA 1OIQA 4DGOA 4HVHA 2ZM1A 4DLJA 2CLQA 2X2MA 4AE9A 3POZA 4FT3A 3V3VA 3ZSHA 3HMOA 3NNWA 3OG7A 3TZ8A 3QC9A 4GFOA 3AGMA 3FI2A 3ZDIA 4EOPA 4N0SA 4BFMA 3MTLA 4MTAA 3EN4A 3BHYA 4IC8A 4OGRA 2X7GA 4TWPA 2QOBA 3A4PA 1Q8WA 3BEGA 4PQNA 5FQDC 3UOLA 3H10A 3WF8A 3TV7A 4EOSA 3FI8A 4F6UA 2NPQA 3C51A 3EFLA 3QZIA 4IVDA 2W05A 4M97A 3CR0A 2VNWA 4KS7A 3OW4A 5AM6A 3RP9A 1Y8GA 1BMKA 1T46A 3TNHA 4EQMA 1I44A 4OTIA 3NEWA 5AP2A 1WMKA 4EOMA 3O8TA 3LXNA 2BRNA 3HVCA 5K9IA 4FSMA 3MJ2A 3NYVA 1LUFA 3QRJA 2VO7A 2GNHA 4YURA 3I5ZA 4FTMA 2ZB0A 2OFVA 3E8DA 3A8XA 3EQIA 1KOAA 4EZ3A 3GVUA 3R00A 4ZS0A 3I60A 1XH9A 1PY5A 3K5VA 5H8EA 2C0OA 1IASA 4ALUA 4R77A 2NO3A 5DRBA 4E5WA 4FEQA 3PJ8A 2EXCX 4FV2A 4FSNA 2PVYA 4ONAA 2ZM3A 3O71A 3MY1A 4BI1A 5IQDA 3HDMA 4N57A 5IQHA 2VTRA 4EH4A 2B7AA 5H3QA 4HNFA 1QCFA 2YDJA 3VQUA 2XNOA 2A27A 4BDHA 3UPZA 2GHGA 1UU7A 5FRIA 4FMQA 4M66A 3SXRA 3CD8A 3TKUA 2UZUE 3V51A 1E9HA 3UO4A 3VS3A 2XZSA 4E7WA 4CXAA 3I6WA 3QKLA 4L53A 5HORA 1G3NA 5FEQA 5CASA 3PLAE 3A7IA 3GEQA 2HZ0A 5E8YA 3PXFA 4O0RA 4DINA 3QYWA 4QP9A 1FPUA 4EC9A 5AR5A 1KV1A 3V6RA 3FXXA 5GIPE 5AR7A 5HQ0A 1H28A 3NSZA 4YP8A 4IZAA 4F6SA 3LFQA 3IK3A 3R7IA 3VN9A 2R3FA 4BI2A 4W9WA 4WNKA 2EB2A 4X3FA 4OTGA 4X3FC 4O0UA 4J52A 4DFNA 2GTMA 4PWNA 1P4OA 2UZDA 2YM8A 4LL5A 4QMZA 3QC4A 3DLSA 2NYAA 2PUNA 5M09A 5DEYA 5CLPA 2WMBA 2B53A 5AUYA 5J79A 3F5XA 3PZEA 1JBPE 3E3BX 3WZJA 4BDEA 4FTAA 4TYHB 3K3IA 4P4CA 1GZNA 4Y95A 4HVDA 5IUHA 4EQUA 3TCPA 4FK6A 3CJFA 3ODZX 5EKOA 3V5TA 4XX9A 5AR2A 2CGVA 3DKOA 4YTCA 2R2PA 5AWMA 3Q6WA 4NM3A 3WF6A 2J5FA 4M15A 5FTQA 3D5WA 3R21A 3R01A 2WTDA 1ZOEA 2UW6A 2PUUA 1OM1A 1PF8A 3FXZA 2OICA 1RW8A 4TWCA 4G9RA 3JPVA 3FMHA 4NFNA 3ZYAA 3UZRA 3KXZA 3NW6A 5AAEA 1WBVA 4ITIA 4CG8A 3CKWA 1FQ1B 4EEVA 3AQVA 1IG1A 1OPJA 2VTJA 3FZTA 4PMTA 3R7VA 4XP0A 5B7VA 3DLZA 5ACKA 3MGYA 2F49A 5DOSA 4ALVA 4NCTA 4NCTC 4G1WA 3P9JA 5EM6A 3CPCA 3K2LA 4J97A 4U5JA 4FKOA 5HBEA 3VUHA 4AGWA 1ZMVA 4O7TA 3WF5A 3NW7A 3G90X 1AD5A 4IX3A 2XP2A 1OL6A 4ARKA 3FY0A 4DN5A 4B4LA 4APPA 3DDQA 2QOHA 3HGKA 3HLLA 5CANA 4FKJA 3QD4A 4LYNA 2O0UA 3VRYA 2OZAB 3BEAA 1W0XC 2BIKB 4ANQA 4BN1A 2QOOA 4MBIA 1GZ8A 2YAKA 3FE3A 1XO2B 4ZXTA 5C26A 3LFEA 3FPQA 3IPHA 3VONA 2BDJA 3C4EA 3DBFA 4GFMA 4UBAA 5FGKA 2PMIA 4OTWA 2F7EE 3AD4A 3HMIA 2CDZA 5I0BA 3DJ6A 4BCKA 4PY1A 1IRKA 3QL8A 2QU6A 3G6HA 4USDA 4U42A 3QBNA 1R78A 1WVYA 4RX8A 3KULB 2XIZA 1XHAA 2A1AB 3OUNB 4D28A 4EZ7A 3V5WA 4AUAA 4C62A 3L8PA 4B7TA 2PHKA 3BRBA 3PY3A 4DT8A 4H1JA 3QWKA 4GU9A 2FYSA 5EG3A 4BKZA 2HCKA 2YM7A 3NPCA 4JQEA 3QXOA 3NYXA 3P4KA 4EOOA 4YUQA 4I20A 3ETAA 4O7NA 3C1XA 4I3ZA 3M1SA 4YO6A 4C34A 1Q97A 4DH8A 3FC2A 4U3ZA 4AGUA 4S31A 2PZ5A 3ORZA 4EOJA 4IQ6A 5C03A 2C0IA 3ZM9A 4DDGA 4A4LA 2YM6A 4R3PA 5C1QB 5L2WA 1V0PA 4FNXA 2OGVA 5BV3A 4AOIA 1PXKA 3BPRA 3RM6A 4OW8A 3EQFA 3KKVA 4L8MA 4S33A 4WUNA 5IA0A 4RFYA 3FKNA 3Q4UA 4QTBA 1KE7A 1G8KA 3UP7A 3ITZA 3QA8A 4MUQA 3ZO4A 2X2KA 2FVDA 1ZAOA 2QLUA 3F2AA 4JG8A 4EBWA 5JZJA 5EDQA 2UZBA 2R3NA 4BKYA 3JY9A 3KGAA 1NW1A 3AC3A 3KFAA 3W2QA 2IZRA 4UMPA 3JR1A 4O7RA 2OIQA 3QXPA 2W5AA 3GC0A 4RX7A 4IM0A 3BWFA 3KRJA 2BFYA 3EH9A 2C5VA 4L67A 4CZYB 1S9IA 4HVSA 3Q53A 5EM5A 3FZOA 3P7AA 3QYZA 3R8LA 3V5JA 4IADA 2Q83A 2P3GX 5JFWA 3EJ1A 4FC0A 4BWXA 5AR8A 1MRYA 5ETIA 3DT1A 3ORKA 3MJ1A 4QMQA 3DV3A 3BKBA 4FTQA 2R3HA 3F66A 4ERWA 3QHRA 5AUTA 3ROCA 4PMSA 4G6LA 4QP8A 5K5XA 4XG6A 5KKRC 1UU3A 2WMXA 3FLZA 2WMWA 3MW1A 4HCTA 4QTDA 4C35A 3P86A 4M0YA 4AW5A 3H0YA 4ERKA 3PA4A 3MPMA 4JIKA 5D12A 4CZTA 3FY2A 4PL3A 3GUBA 3GBZA 3GCQA 4HVIA 3B8RA 2JBOA 3BZ3A 4MD7E 4HYSA 4DLIA 4K33A 4MD9E 4FYOA 2VTMA 4EH2A 2WTJA 3H0ZA 3QLFA 3DGKA 4AXFA 3DS6A 3JS2A 4FVQA 1R39A 5M4IA 5CI6A 2Z7QA 2C6EA 2R64A 4L01A 4GUBA 5HG8A 4QP3A 2X4FA 4LOPA 5K0KA 3SD0A 4NUSA 5IEXA 2JLDA 4UWCA 1H4LA 3BQRA 3BELA 4F7SA 5CI7A 3ZFXA 2GQGA 1G5SA 3TEIA 4FKPA 1PMVA 4FSWA 1RQQA 4O21A 5D9HA 2VWYA 1SNUA 2VWUA 4CG9A 3CS9A 4IWOA 3UQFA 3DPKA 3TZ7A 5IH6A 3F5PA 4U7ZA 1PXPA 3IGOA 4Y85A 5CYIA 4DG0E 5DYJA 3FQHA 4ZMEA 5J1WA 3KQ7A 4F0GA 4UZDA 3VS1A 3GQLA 4B0GA 5LCKA 3REPA 3MVLA 3UG2A 3ACKA 1VYZA 3PFQA 4M69B 4PNIA 4JVGA 4IZ5A 5LARA 1UNLA 4FTKA 4PPBA 4QQTA 5HESA 5K4IA 5GJDA 2ZDTA 1VYWA 5C8NA 3SV0A 2HWOA 3FI4A 4BF2A 1Q8YA 4A07A 2FH9A 5HE0A 1FBNA 3VBVA 3FMLA 5IA3A 3PIXA 2JAVA 3R04A 4GS6A 2ZV2A 4PPCA 4XG3A 2Y8OA 4FF8A 2C3IB 2XCKA 4IAKA 4O4CA 4ENYA 4V0GA 3DY7A 4L00A 2A0CX 3MPTA 4X6QC 2VGOA 2CSNA 1TFFA 2KULA 3LXPA 4RC3A 3I7BA 5JZNA 4CKRA 3G5DA 3WF7A 2UZOA 2XEYA 1BL6A 3EFJA 3UC4A 4QMWA 1W7HA 3TM0A 4DBNA 4TXCA 1ZOHA 2QKWB 1PXJA 1M52A 3NR9A 4FKWA 3BHVA 4J71A 5HU3A 4AGCA 2WMVA 4EK6A 5FM3A 4Z7GA 4M13A 1Q62A 2QLQA 5FP5A 4ACGA 4E6QA 3GFWA 4EH9A 3BL9A 3V8WA 5DT3A 5CY3A 4BDBA 5G6VA 5AV0A 2J0MB 3QZGA 3ZO1A 5IZFA 1ZY4A 3KU2A 3RJCA 5EOBA 4UZHA 4PMMA 4DH3A 3CEKA 2EVAA 1A06A 3B2TA 4QMVA 1PHKA 4F0FA 3Q04A 4IWDA 4BCNA 4TYEA 5BPYA 3UQGA 3KMMA 2V7OA 4BY9E 2W5HA 3PVUA 1WCCA 4DFYA 5JQ5A 3AD6A 3MFTA 3PXZA 3FHRA 4JR7A 3U9NA 3O51A 5CNNA 4C2VA 4IX5A 3AG9A 1IR3A 1SVGA 2R3PA 4Z9LA 2RG5A 4MD8E 2H34A 1OVEA 3MFUA 2GNIA 4AP7A 3L9NA 4QDVA 4MNEA 2QOKA 4ZY4A 2CCIA 4ENXA 5L2IA 2QQ7A 4XS2A 2HW6A 5E7RA 3ZC5A 2X8DA 3FXWA 4ACDA 4FIHA 4CRSA 2WGJA 4RIXA 3QTIA 3OZ6A 1J7UA 5DR2A 3MBLA 3IDCA 5M51A 3H9FA 5EM7A 4OUCA 2PYWA 2WTIA 4GYGA 3NDMA 2PZIA 2Y6OA 4TW9A 4XLVA 2I0EA 2X0PA 3P08A 4AS0A 5LMKC 3QQJA 4YBJA 5AP1A 2C4GA 2NRYA 3RALA 2KTYA 3QAME 3TT0A 3NUNA 4C4HA 1XR1A 1Q3DA 3AMBA 3WZUA 2YCQA 3F2RA 1CKPA 5KHWA 3WARA 1W2DA 3R71A 2JDOA 3A2CA 4LMUA 3BI6A 2JFMA 2PE1A 4OR5A 1JKLA 3BGZA 3RWPA 2YIXA 3SA0A 3ULIA 3OEZA 5FG8A 3IW8A 3TYKA 3TI1A 2Z7LA 3ZM4A 1O6KA 3PSDA 3NVMB 3DB8A 4MKCA 5J9YA 5CNOA 3PXYA 4HYHA 3LQ5A 1XMLA 3HKOA 1JVPP 3A7JA 2IPXA 4Y72A 4YSJA 3P78A 3CP9A 3I4BA 2C5OA 2I0HA 1OPKA 3JVSA 1OB3A 2FGIA 4N6YA 4TNBA 1K2PA 2ZDUA 3ID6C 3F61A 3EZVA 4L42A 3W8QA 3ZRMA 1RJBA 3A8WA 2H96A 5DPVA 3UJGA 1S9JA 4DAWA 4RA5A 3VIDA 2CKPA 3R9RA 3P7BA 3NNVA 5JK3A 3UQCA 2BR1A 5LMBA 3E5AA 4LG4A 4FTJA 4D9TA 4F7NA 3LMIA 4Y83A 3DBCA 2PMLX 5DBXA 4E26A 3CCNA 3BLAA 3RKBA 5EFQA 4JX7A 4LM5A 4QQCA 4QTAA 3PZHA 2JKMA 4EL9A 5EW8A 4E4LA 4PDPA 5ANKA 3WIGA 3BGPA 3EYHA 3MH3A 1OBDA 3A7GA 4AQCA 2YIQA 2BTSA 4Z16A 3VVHA 5IQAA 1PXLA 2CGWA 5JFXA 4AAAA 2BHHA 5TO8A 3D9VA 4OTQA 2IVVA 4J7BA 1UV5A 3LCSA 3DA6A 1XJDA 3LCTA 2C47A 4RQKA 1OL5A 4F09A 1H00A 4MVFA 2X7OA 2PVRA 4GUEA 3NGAA 4IZ7A 4G34A 5CU3A 3UIUA 2QKRA 1ERKA 3PSBA 2CPKE 3QALE 1OBGA 4B8MA 5CQWA 4G31A 4JG6A 4G5JA 3T3VA 4CT2A 1PXNA 4GRBA 5I4NA 1Q8UA 3DJ5A 3E88A 1UA2A 3MVHA 4FZ6A 4IM2A 1Q5KA 1SMHA 3G6GA 3U51A 4QP6A 2E9VA 3R8UA 5DN3A 2HXQA 3IW5A 3S3IA 5LCJA 3NFFB 3D5UA 4E4NA 5AM7A 3F5UA 2G1TA 4XEYA 2R0UA 2ONLA 2ONLC 3QTSA 4FUYA 4PL4A 2C5XA 5DRDA 4RWKA 3KCKA 3CGFA 5HG7A 4CQGA 5T68A 4ASDA 4NWMA 2NNWB 4WBBB 3FLQA 3I79A 2OXXA 3QQFA 4X2FA 4EK8A 4U8ZA 4KB8A 5IMEA 4FGBA 5IA2A 3OBJA 5AX3A 3QA0A 1TVOA 4KS8A 2RFDA 3UNKA 3VUGA 4FV7A 2OWBA 4GVJA 4NW5A 4AFEA 5JKGA 5J8IA 3KREA 4U79A 4W4YA 4K0YA 4IFGA 4BWPA 3DK7A 4YC3A 2OH4A 3QRTA 4PUZA 3VUIA 2BPMA 3PJ3A 1IAJA 2PE2A 3A4OX 3FMKA 3IDBA 1OL1A 2YIWA 3NIEA 2OZOA 4QMPA 4O4EA 4DTBA 4LV5A 1A48A 1NY3A 3R22A 5IH4A 3OCTA 4LUEA 4W4WA 4ZTRA 1ATPE 4NM0A 4TPTA 5T3QA 3ORXA 2ERKA 4JQ8A 3OXZA 3G2FA 5M4CA 3W18A 3S2PA 4YJOA 1Q3WA 5KE0A 4F0IA 3RAHA 2HOGA 5DG5A 5D11A 3OVVA 4RVLA 3VS4A 5I9YA 5JH6A 4R7BA 4XHKB 5AA9A 1HCLA 4O4BB 5EW3A 5TKDA 3FYKX 5A46A 2VTQA 2W1ZA 2VWVA 3DQXA 2Y6MA 3OBGA 2WQBA 4QPSA 3DQWA 4FG9A 3GFEA 4CMOA 3KK9A 4UX9A 3TUDA 2X6DA 3EQCA 4KNBA 1W98A 4G3DA 4DH1A 4FOBA 2BZJA 3TACA 4NJDA 4D1SA 3KN5A 1ST0A 2OZAA 5LMAA 1OGUA 3NCZA 4HPUE 5DT4A 3UVPA 1NT2A 2IG7A 4UXLA 3NUSA 2PVNA 1Z5MA 4YZDA 1UKIA 3TJDA 4BDIA 2XRUA 2WD1A 4FE2A 3L1SA 4JAJA 2IN6A 3TUBA 3Q9XA 4AOTA 3PWYA 2ZM4A 3NWWA 4K77A 5FWKK 4FKVA 4FV4A 3VBXA 2W9FB 3ZHPC 4L9IA 2OJ9A 3KMUA 5H8BA 4FL1A 2V62A 4AT3A 5LOHA 3PE2A 5BVDA 1JAMA 3QF9A 5F20A 4C8BA 4PX6A 4HGEA 4I5HA 3G15A 3HV4A 4DDIA 3FMEA 5CS6A 2ITOA 4RFMA 1U59A 2VAGA 2VD5A 4S2ZA 2DWBA 4I6BA 2C6IA 3UDBA 3UVRA 4FIJA 3CY2A 3O17A 2O64A 2ITXA 5ITAA 3ET7A 5J7HA 3DBDA 1PMUA 2O3PA 3OY1A 3TG1A 3VNTA 4EC8A 1KUTA 2JDTA 1B6CB 3KF7A 3FKOA 4FTOA 2NRUA 4J99A 3EQDA 3ATTA 3OD6X 3WZDA 3NIZA 4BGGA 1GOLA 3FKLA 5EYMA 5G1XA 3HMNA 4ZTNA 3KXHA 4IANA 1VZOA 3AC1A 4E6DA 2JFLA 5JRSA 5JN2A 2UUEA 4QMXA 1ZZLA 2ESMA 2J0LA 1F3MC 3MY0A 4ZS4A 3FC1X 3SW4A 4MWHA 2ZV9A 3LVPA 4TWOA 3NAYA 3GT8A 3RGFA 3Q4CA 4WNPA 4R5YA 3ORMA 4NT4A 5CAVA 1ZYLA 4RQVA 4FTRA 2YIRA 4N70A 2UW7A 3I0OA 1UWJA 1YRPA 4FTLA 1PXOA 4EYJA 3LFCA 3W0MA 5CZIA 2WU7A 3AC4A 4BVUA 4R3RA 3F3UA 1H8FA 2B4SB 2VTHA 4GIHA 2WTKB 4H58A 4M68A 2OLCA 4YZCA 5FM2A 4D5KA 3DCVA 3QD3A 3QD0A 4ZSEA 4GU6A 2WMUA 2NP8A 4PDOA 4NM7A 1NVRA 1XBBA 4DFZE 4F64A 5IA1A 1PMNA 5ANGA 5KNJA 4QEBA 3NNXA 4AXCA 4GL9A 5KMMA 2HYYA 1JSTA 2HELA 2LGCA 3QHWA 3VJNA 4D1XA 1F5QA 3SAYA 3G9NA 4GW8A 3GU4A 4QYHA 4HCVA 4D2WA 1FMOE 4KBKA 4IC7A 1YI4A 4JR3A 4NSTA 4X7QA 3KVXA 5A4TA 4DEAA 3FV8A 4LOOA 4O0YA 1JSVA 1IA9A 5IG1A 1W84A 3HUCA 2PVHA 4DEBA 5LVPA 1R0PA 2HIWA 3F3TA 3FSFA 5CT0A 2Z8CA 3IW7A 1OECA 3ZU7A 4BCHA 5LVNA 3NZ0A 5CEMA 2JBPA 2J2IB 2WHBA 3P0MA 4FTIA 4G3FA 4IVCA 4KIKB 4UB7A 4YJVA 2CJMA 4J8NA 4RLLA 5DA3A 5A4LA 5EK7A 3BWJA 3AKKA 5HO6A 4XH6A 1SVHA 2OBJA 4IJPA 4JDIA 3KXXA 2R0IA 3QZHA 4CV9A 3RK7A 4PP9A 4BTJA 4MF0A 4FV9A 3R28A 3W0RA 4BTMA 1KE8A 4AG8A 3UDTA 2P2IA 4FUXA 1YXUA 3LCKA 2GS7A 4MXAA 4EQCA 4GMYA 4UV0A 3DBEA 2XEZA 3JXWA 4QMYA 4RJ7A 2CNVA 5DEWA 1M2PA 3LQ3A 4B8LA 4C3FA 1PW2A 3H30A 5LJJA 4I5MA 2W4JA 3W2CA 4AXEA 4CKIA 4MAOA 3ZLSA 4DHZA 4EJ7A 4L43A 3SG8A 1BLXA 4H3QA 1B39A 4QYGA 2VWBA 2UW3A 2XNBA 2C6MA 3OHTA 4M69A 3QTZA 4KKEA 4O22A 5DGZA 1U46A 3W0NA 2QC6A 4OTPA 4XV9A 5KO1A 4FV6A 1GNGA 1YWVA 2RKUA 3C50A 3ALNA 3OROA 3QTWA 4I92A 2VWXA 2W1CA 3EL7A 4X0MA 5H8GA 3RBWA 5BVFA 3TMOA 1CKIA 5CXHA 4A9UA 4EORA 3EFWA 2F9GA 3C13A 2WIHA 1BX6A 3OP5A 3SRVB 4XRLA 4IB1A 4F9WA 3UYSA 4GVAA 2IZTA 4C02A 4EUUA 3E92A 1OPLA 4O4DA 2PPQA 3TDVA 4AGDA 5F94A 3LHJA 5IMXA 2AUHA 3R1NA 2I7QA 4CVAA 2J90A 4QT1A 3E63A 3LZBA 3QFVA 4IHPA 5D1JA 3ZCLA 3HNGA 2H8HA 2VX3A 4EH8A 3QUDA 3PJCA 3EL8A 2UVZA 5BMMA 3LE6A 4IBMA 3AT3A 5AV1A 1XH6A 4O7VA 5HKMA 4M84A 4TTHB 2OIDA 4JRNA 2BZKB 2YERA 4DFUA 5ACBC 2XJ0A 5E1EA 4FSQA 4YHFA 5HD7A 1Q99A 4ASXA 2GCDA 4C33A 5J5TA 1IAHA 4O0VA 1DI8A 4FZDB 5EQYA 4E8AA 3P7CA 4YLKA 5AIKA 3VUKA 4AW1A 2JDSA 5CVHA 3BU5A 2R3KA 1TZDA 2I1MA 4ACMA 2XM8A 3ZZEA 2PL0A 2XK8A 4AN9A 4CNHA 3VC4A 1REJA 2QCSA 3UG1A 5HE3A 5E90A 1PXMA 5JGBA 3H4JA 4P7EA 2W0JA 5A54A 1ZZ2A 5KX8A 3UZPA 4A4XA 3MH2A 5L8LA 4PDYA 3LFBA 3PE1A 3Q3BA 4RIOA 4WT6A 2YN8A 4NU1A 1G8AA 2QO7A 5GZ8A 2Y7JA 3CQEA 5IDPA 5FTGA 3TDWA 3L8SA 4EHVA 2ITNA 3LFAA 5CF8A 4F6WA 5GNKA 4QMSA 4GK4A 4O0XA 3ZH8A 4UYNA 4Z7HA 4RVMA 4YJPA 3WI6A 5DI1A 3UOKA 2QO2A 2W4KA 4IVAA 2G01A 5EHOA 5M4FA 3UDZA 1NVSA 3W55A 3LCDA 2BFXA 2XH5A 1OUYA 2BRBA 4FX3A 4D58A 4P2KA 3PSCA 3OT3A 2XYUA 2CLXA 4JBPA 4WG4A 4YJTA 5C01A 4F1TA 1H27A 3LW0A 3AC8A 3FEGA 2PK9A 1W83A 3R9HA 3Q60A 4LI5A 5HBJA 4LQMA 3RCJA 4GYIA 1F0QA 1U5RA 3U6IA 3ALOA 2RG6A 2CKEA 3DK6A 3D2IA 3ZLYA 2VUWA 3FLYA 4YJSA 4L3PA 2O2UA 3FWQA 5I9ZA 4D2PA 2FSMX 2YEXA 3UO5A 3QGWA 2VTPA 1MP8A 4W8EA 4O81A 5FBNC 4IX6A 2RFSA 4G17A 3SDJA 2WTCA 3TNQB 2YWVA 2QO9A 3QQKA 5DE2A 4USFA 4MXCA 2QR8A 4RJ3A 2GS6A 3WOWA 3CQWA 3IGGA 2BIYA 3DKGA 4EWQA 3EQBA 1YQJA 4CZUA 3QQHA 4QP7A 3KY2A 4XG2A 4WUAA 4YTHA 5IQCA 5BX0A 2WEIA 4DGLC 4RSSA 1H07A 3ZO2A 4O6LA 5J9LA 4GK3A 1OIYA 4I6HA 3SOAA 3UO6A 4R7HA 2CNQA 2VRXA 1PKGA 4ID7A 2OW3A 3ZDUA 2DS1A 3LXKA 4KIQA 3A62A 1AQ1A 3BX5A 4JBVA 3Q2MA 3E64A 4BZDA 2GDOA 2GHMA 5ANIA 2BZIB 5IQIA 4K8AA 5BVEA 3KB7A 4FTUA 5DR9A 2C3LA 4FKTA 2RL5A 3FDNA 4FSTA 1Q41A 1U54A 4CT1A 4FVRA 4AZSA 3CBLA 4TWNA 5GIOE 5T6KA 3EIDA 3VF8A 3W1FA 4CQEA 5JSMA 4F08A 3BIZA 2F7XE 4XV2A 4ALWA 2ITWA 4FR4A 5HLPA 4EHGA 1Q8TA 2V5QA 4CV8A 5CZHA 4OAVB 2GNGA 4EOQA 2IW6A 1LEZA 1G8JA 2GMXA 4U97A 3T9IA 3FYJX 3G9LX 4S30A 2QNJA 3SKCA 4EUTA 3KCFA 2ZOQA 4XNEA 5HVKA 2UZEA 4HGTA 1YVJA 4WOVA 4WSYA 5J1VA 3A7HA 5BVKA 4C57A 2PUPA 3QTRA 2OJGA 4JJRA 2CGUA 2YM4A 1XWSA 5A3XA 5M4UA 3ROYA 2YDKA 2YCFA 2XIXA 5HD4A 3PXRA 2VWZA 2FA2A 4ZTHA 1DS5A 2V55A 3V8TA 5CVGA 3ZMMA 4RWJA 4ANBA 3R6XA 3L9MA 5IEVA 5ETAA 3FAAA 3WF9A 4M0ZA 1VEBA 3KXMA 4OBPA 2ZV7A 4DGNA 3BE2A 5LQFA 3FL4A 4D4YA 3ZO3A 2VV9A 3EMGA 5ANEA 2WELA 5CAQA 3FLNC 5A6NA 2WMSA 3EYGA 2V7AA 2FSTX 3JY0A 3TL8A 3HEGA 4H3PA 3LLAA 5CSHA 3VS7A 4FG8A 2ITVA 2YM5A 2J9MA 5B2KA 3UDSA 3I6UA 4GT3A 1NXKA 4JBOA 4R6VA 3TN8A 3PA3A 2WMRA 3E87A 4Q9SA 4S32A 3HV3A 2QOCA 5FTOA 2ZMDA 4FK3A 3U9CA 3Q4ZA 3PG3A 4BIEA 4V04A 4BICA 4O7LA 4XUFA 3NYOA 2IWIA 4PMPA 5IQFA 1Q8ZA 5EM8A 3DTWA 4EK4A 2OF2A 4QDEA 4JDJA 2F57A 5HTIA 4WIHA 1YDSE 3NUPA 1H1SA 5TT7A 3UMXA 5JFVA 4DH5A 2P2HA 2XVDA 1SNXA 2CN8A 2H9VA 4NTTA 3R1YA 5F9EA 1YXXA 2P0CA 2JKKA 2XKDA 2YWPA 1STCE 2WMTA 3MA3A 3D4QA 5M57A 4U3YA 2I0VA 1SYKA 4QRCA 4CMUA 2GU8A 4E6AA 2X8IA 1E1XA 1YDRE