3OC1A

Conformational plasticity of p38 map kinase dfg motif mutants in response to inhibitor binding
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
330
Chain Sequence
b'RPTFYRQELNKTIWEVPERYQNLSPVGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oc1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oc1A01
2QO9A 4RG0A 3GENA 3HX4A 2W1HA 5CANA 3KXNA 2BZKB 3V3VA 1WBVA 4MWHA 1ZY5A 2W1EA 1OIQA 4PDSA 4CLJA 1WBNA 3HAVA 4HZSA 4LUDA 3FI2A 3OTUA 4CD0A 5M44A 3OW3A 5EQEA 1QPEA 3I7BA 3F61A 2WAJA 3GP0A 4W4XA 4IANA 4D9TA 4FT7A 4FSMA 5TE0A 3BU6A 4UWBA 4UMRA 2HZ4A 3PVWA 1RQQA 4DTAA 4CGAA 2OH4A 5LWNA 4EBVA 1H1PA 3L9PA 2UVXA 5E8SA 5IA3A 4U3YA 3TZMA 1JPAA 4NU1A 3EN7A 2OIQA 3DQXA 3RK9A 1SNUA 4EK8A 4EH3A 4AOJA 3Q9WA 3KFAA 4DGGA 5CSPA 4GT5A 4YO6A 5HCYA 3EQIA 3DFAA 4G5PA 4IB5A 3ZSGA 2WQBA 2CN5A 4R1YA 4JQEA 4X3JA 5BYZA 3RNYA 3OEFX 2P2HA 4JOAA 2OBJA 5E7RA 3ANQA 4FYOA 4APCA 2F49A 4XRJA 3TZ8A 3E63A 3PWYA 4IX3A 4YJPA 4BDDA 4O7SA 4G16A 2OICA 4ZZNA 3BV2A 4U43A 5JGAA 3QLFA 5AJQA 2QOQA 4I0SA 4FBXA 3CJGA 4GSBA 1OPJA 3PG1A 4DCAA 5FBNC 3I6WA 2CNUA 4EK6A 3IW5A 3GEQA 3TDVA 4Y72A 2WB8A 4MNEA 4FV7A 3R7YA 4HVSA 2QOLA 1OM1A 3ORIA 5EM6A 5JZNA 4DFYA 3R9NA 2BHHA 3G9LX 4TWOA 2V7OA 5HIEA 4HJOA 4DFLA 4FZFB 4MD9E 4KUJA 3FKNA 4EOLA 5A4TA 4FSZA 5FTGA 5HX6A 3M11A 5AP5A 3KMUA 3D4QA 1PJKA 4FZAB 4I0RA 2QOOA 1ZRZA 2GHGA 3NVMB 4EH5A 1MRVA 2XNOA 4L52A 2WGJA 4TY1A 5EOLA 5A9UA 3Q3BA 3S0OA 2QOHA 3BLRA 3A7GA 2XKDA 4JDIA 4XV3A 4W8DA 2QO7A 1QCFA 2W96B 3OZ6A 4DG2E 4DH8A 4PMTA 2UW8A 4MNEB 2C3KA 4BN1A 3HDNA 3PTGA 2HZIA 3GCQA 2UV2A 3R83A 3VWAA 4YURA 4WRGA 1GOLA 5KBQA 4RQVA 3FZ1A 4TPTA 3TM0A 2CGWA 3IOPA 4WNOA 4YC8A 4E5WA 4ASEA 5LQFA 3H0YA 4LV5A 2CN8A 5A6NA 3SLSA 1P2AA 4RJ5A 4IQ6A 3WARA 3H4JA 2QHMA 4FTLA 5K5XA 5CSWA 3RPVA 2YDKA 4RX9A 3R7VA 4J98A 3ZO3A 5CF4A 2XBAA 5ITAA 2JC6A 2GFCA 4ASXA 2WMRA 2PZPA 4KKEA 3IOKA 4CG9A 4JRNA 4LOQA 3VBVA 4XOZA 2XJ2A 3TTIA 3QL8A 4CKRA 3OP5A 3COKA 4GRBA 4IVCA 2YITA 3QHWA 4Z7GA 3IECA 3VUGA 3EZRA 4BDIA 2W0JA 5DR9A 3NLBA 5D12A 2UW7A 2YABA 3VN9A 1MUOA 3O7LD 3VC4A 4GFMA 4W4VA 2XKCA 5LVLA 3CE3A 2YERA 2UVYA 4A7CA 3QTSA 5C8MA 4ENXA 4F99A 1PMVA 1OIRA 3BI6A 3KY2A 3FXWA 3ZBFA 3HZTA 5IEVA 4R8QA 4FK6A 2P55A 3VIDA 3NSZA 3DKGA 3PXRA 3VBTA 2W5AA 4BWXA 2YA9A 1NT2A 3AMAA 3ENMA 1GNGA 3PP0A 3SD0A 2VGPA 1ZYLA 4ONAA 1XH9A 2G2IA 2VTAA 4RVTA 5IG1A 2I6LA 4YHJA 1JKTA 2Z7SA 3ITZA 5AUWA 4IX6A 1H0VA 3DA6A 3FPMA 3FZPA 4N0SA 4QMLA 3ZU7A 2QD9A 3A7JA 2OJJA 1IRKA 3F3WA 4IADA 3UG2A 2Z7LA 4G9CA 1FMKA 4O7YA 5D7VA 4CEGA 3LCDA 3G6GA 4FK3A 4ACCA 2GHLA 4FEUA 3QA8A 4JXFA 3NX8A 3GCSA 4PWNA 1MP8A 3R22A 4RJ8A 4RMZA 2UW5A 4FIGA 4S30A 4S34A 2XEYA 3P0MA 4V05A 3UIBA 3EQBA 3OT8A 2Y6MA 4EQCA 4ITJA 3O23A 3QYZA 3ZUVA 4ANNA 4E26A 5IQCA 4BTFA 5DFPA 3CBLA 3FMLA 2VZ6A 2UZVA 3PXFA 4HNFA 3LLTA 4QPMA 3FUPA 5KMJA 4DEEA 3D7TA 3UC4A 3RPYA 3A4OX 5DOSA 4XLIA 4QP7A 5CY3A 4KSPA 4F0GA 4YR8A 3BYUA 2YHVA 4CTCA 2BTRA 2WQNA 4AACA 4IH8A 1JQHA 3CD8A 2OZAA 3NNVA 4E6CA 2YM5A 5LXMA 1WMKA 3AC2A 3HEGA 4M15A 5E8YA 2HW6A 2ZB1A 4RC2A 3WF9A 3EQPA 3QQKA 5DG5A 3DLZA 2Z60A 4YJVA 4WA9A 3SAYA 4PDYA 4DTBA 3PJ3A 3ZXZA 2IVSA 5EI6A 3GQLA 1H1WA 5ICPA 5CVHA 5E1EA 4TYHA 4YJRA 2IW6A 1OUKA 3TNIA 4BDCA 4K0YA 4EJ7A 4FV6A 3PY1A 4FVQA 3LAUA 5IEXA 3C4XA 2XRWA 2F9GA 5A14A 1SVGA 3RZBA 5EH0A 5HI2A 4F1OA 4WSYA 2PMOX 2XH5A 3RI1A 5L2TA 2OZAB 5E9EA 3GOKA 4J7BA 2O5KA 2XYUA 3QCQA 5M07A 5HVKA 2PZIA 5BVKA 4UALA 3ATSA 3UODA 3QUDA 5IMXA 5EHYA 5JFSA 4RIYB 1OL1A 3QRIA 3ZYAA 4D0WA 5I3RA 4O7VA 1XQZA 2EWAA 2WHBA 4WNMA 4AGUA 4AGWA 3LM0A 5GIPE 1Q3DA 4BDEA 3UZRA 3DB8A 1OBGA 4K33A 3KK8A 2W1ZA 3AT2A 3ZXTA 2JD5A 4X3FA 3UE4A 4F0IA 3BBWA 5L6PA 4FKLA 2YM3A 3RP9A 3VUIA 2QC6A 4FUYA 4DT9A 4N70A 1QL6A 3UDBA 3GT8A 4I6QA 3PLSA 2ZYBA 4EHGA 1W84A 3P78A 3DZQA 4BFMA 4FF8A 3CS9A 1XBAA 1RE8A 4NKAA 5FP5A 3TV4A 3BYOA 5JRQA 4LM5A 5CAOA 1YOJA 3FZTA 4BDHA 4IZYA 4KIQA 2A4LA 3QA0A 4M3QA 4XV9A 5H3QA 4B9DA 1NVRA 3BCEA 2R9SA 4EC8A 4ZY5A 3SA0A 4DE4A 4IZAA 3OD6X 3M42A 2R3HA 2WFYA 5HLPA 1PXOA 3KREA 2OW3A 3RINA 5EQPA 4YJQA 2ITXA 2ZDTA 1WBTA 3ZCLA 1FBNA 1JBPE 3CQUA 3MS9A 1YWNA 2IJMA 3AC5A 2UW4A 3DNEA 3CKWA 4OR5A 3ZHPC 4TYGA 3MB7A 2GDOA 4C37A 4RFYA 4CFUA 3NIEA 2ONLC 4J8NA 5CNOA 4YLJA 4C36A 3P5KA 4JG8A 4EHVA 4BCMA 5F95A 4FTIA 2Y4IB 5KMKA 3QQUA 3U6IA 4L53A 5DEYA 4OBQA 4BCGA 3DJ6A 4M14A 5B0XA 4D2VA 4JDKA 2G9XA 5D7AA 3W2RA 5TOZA 2XNBA 2OFUA 3KCKA 4J99A 4RLLA 5K0KA 5T68A 3QAME 3IGGA 4PPCA 2A1AB 2V5QA 2J51A 4NW6A 4XP3A 5HD7A 2C30A 2HZNA 4QMVA 5DHJA 4A9SA 4CSVA 1DI8A 3IW7A 3SRVA 2JFLA 3DQWA 2ITTA 2YIXA 1UU7A 4QPSA 2J0KA 2YZLA 2GSFA 3FLYA 4DLIA 3FMHA 3GCUA 3ZFMA 4PP7A 5L6OA 2CJMA 4BDBA 1AQ1A 3R8PA 1BMKA 4X6RA 5CSHA 2PVMA 2Z8CA 4YLKA 2VU3A 1PMUA 2GS7A 5L2QA 5CF5A 5IH4A 4QT1A 5HTIA 1STCE 2UZBA 4H3PA 5LCKA 1Z57A 3V01A 5L2IA 3CIKA 3AT4A 3RHXA 3V5WA 1PW2A 3V5PA 2W4JA 4DEAA 1OIUA 3EZVA 4G9RA 3S95A 1JSUA 5D1JA 4DC2A 4EJNA 3R9OA 1PYXA 4KRDA 3BIZA 3B8QA 2JIIA 3RAWA 3GU5A 1ZY4A 5DT0A 5J1WA 3ANRA 1H1SA 4G6OA 4FV2A 4C2WA 2JITA 2GNLA 4P5QA 3W32A 3D9VA 3I5NA 3NDMA 2J7TA 4K2RA 3TV7A 1ZOHA 2QOCA 4DTKA 5DT4A 5CF8A 4RC3A 3WF7A 4YMJA 4A07A 4JIKA 5FTQA 5ANKA 4ZLZA 3RWPA 4E1ZA 4E6QA 3QYWA 4IDTA 4UWCA 3BWFA 2R3LA 1UV5A 3NIZA 3ATTA 3DKFA 4I21A 4AUAA 4D2PA 4W8EA 4F7LA 4UN0C 4AZSA 3DB6A 3QZHA 4UBAA 2BZJA 3FY0A 3N9XA 4CFWA 4DFNA 2XS0A 1XH7A 3GU7A 4EH8A 4FNYA 4RRVA 5C03A 4NK9A 4NM0A 4JBVA 2B55A 2CLXA 1JLUE 2HWOA 3OUKA 4KBCA 3RALA 1LUFA 4ZXTA 2XMYA 3FC2A 2WTDA 1VZOA 4WUNA 4FEXA 1NVQA 3U54A 5LVNA 4JRVA 3A7IA 4FTNA 5E90A 3OCGA 4PPBA 4EK4A 5BMMA 2VTNA 3SDJA 2VTJA 4Z3VA 3TUCA 1ZZ2A 4O1PA 3BEGA 5KMNA 3MV5A 4FSYA 1H07A 1Y6AA 4FNZA 4I24A 4O38A 4QP3A 5J87A 2J90A 3VULA 2IG7A 1H26A 2W5HA 3GUBA 1IAJA 4K9YA 4JL9A 3COMA 1KV2A 4FGBA 5CS6A 3ZEWA 5AV2A 4ZSAA 3BE9A 4A9TA 3ZOSA 3MVLA 5EK7A 4PDOA 3ORMA 3EHAA 5ANEA 3LFBA 4HZRA 2G15A 3DK6A 3AC3A 1KOBA 4N4SA 4NSTA 3R7UA 5I3OA 3FY2A 4U9AA 4GG5A 4PX6A 4IM2A 4PMMA 1H27A 2VRXA 5DBXA 5B7VA 5I9WA 4USDA 3R0TA 5M57A 2J0MB 4J52A 3DBFA 3KU2A 3QX4A 4Y83A 4AE6A 4AQCA 3CSVA 1PYEA 4IXPA 3CLYA 4EOJA 3E3BX 4EC9A 4C34A 1A48A 4ZZOA 1P14A 3LCTA 3CY2A 1HCLA 3UG1A 4DCEA 2PU8A 3QUEA 2HXLA 4EOMA 3DGKA 4DH7A 2QONA 4FTUA 4HGSA 4IX5A 4RX8A 2JKOA 3Q32A 3SOAA 3O8TA 3VJNA 5BYYA 4CT2A 4PPAA 4O96A 3NUUA 4EH7A 4HVDA 4GJ2A 4JX3A 4QP4A 3KULA 1ND4A 1JKLA 4HPTE 1OGUA 2VWBA 3V5QA 4ASDA 2PK9A 3EN4A 5J1VA 2ZB0A 2YWVA 2A27A 3Q52A 3R7OA 1NXKA 2E9UA 2IZSA 2UW0A 4K6ZA 3ZZWA 4O2ZA 3PDTA 3KXMA 4MNFA 4U0IA 2FSTX 5BVOA 3KK9A 4RIXB 3FSFA 3MPTA 4B8LA 1Q99A 2UZNA 1K2PA 5GJDA 4E4XA 5HX8A 5KBRA 4FSRA 5ANJA 4G3GA 3LCOA 5AR2A 3VUTA 2WOTA 3PIZA 4FKQA 3P1AA 3BHHA 5JFXA 4EK3A 4KKGA 3F3ZA 3MH2A 4ZMFA 1OL7A 3E8DA 3EN9A 4MXZA 3S2PA 4BHZA 4ANBA 3KULB 2R0UA 4E4MA 4W9XA 4O6LA 4U7ZA 4WHZA 2XK4A 3ET7A 2F2UA 4ENYA 1Y8GA 3OFMA 4GIIA 4BI2A 2WQMA 3GU6A 4AW2A 5A54A 4WG4A 2XK7A 4IHPA 5K4IA 2W9FB 1VEBA 3D0EA 3AC8A 4QYEA 4DBNA 4R5SA 5ANIA 5D9HA 5TO8A 5IQEA 4BGGA 3KXZA 4NL0A 2Z2WA 4YJOA 3BHUA 3MJ1A 4I5PA 3QZGA 4WD5A 5HHWA 4FKGA 3KN5A 4RPVA 5ANOA 3PP1A 2VV9A 1TVOA 4B6LA 3UOHA 3RPOA 3AD5A 3V6RA 4USEA 4PTCA 1G8SA 2CLQA 5A46A 4Z16A 4L8MA 3WZDA 2XIRA 4UZHA 4XLVA 4ZJVA 3HMMA 2VUWA 2CSNA 5IA2A 1SVEA 3LKMA 3LCSA 3FLQA 1F0QA 3EFKA 2F4JA 3PIYA 4QP9A 3LMIA 3CKXA 4K8AA 5GZAA 4WSQA 1CKJA 2VTQA 4J95A 3L1SA 5I9VA 2XIXA 3W2SA 5M09A 2W1FA 3F9NA 4Y95A 2C0TA 1R0EA 3QHRA 3B2TA 3G2FA 2F57A 1V1KA 4EL9A 5CNNA 4IB0A 2PMLX 4HOKA 2IW9A 5DE2A 1OB3A 2OIBA 3LQ5A 5J9ZA 1Q8ZA 4D4SA 4B99A 2VO7A 3NNWA 4LGGA 4DEGA 1ZYDA 4H3QA 2R3OA 5AM7A 5I9UA 1A06A 2WZJA 3KL8A 2BRNA 4PL5A 5FDXA 2XEZA 3DPKA 3SXRA 1FVVA 4A9YA 3PA4A 3CTJA 4AF3A 1IA9A 1PKDA 1Q97A 3NWWA 4OTIA 2H9VA 3ORLA 4JR3A 4FI1A 4TXCA 5I9YA 5ETAA 4MCVA 1EH4A 4QO9A 4YJTA 5HBHA 4UYNA 2XM9A 3TCPA 4AA4A 4FSWA 3DBDA 5AIKA 2YISA 2CNVA 5BVWA 1B39A 4RZVA 4FKJA 3UBDA 4GT3A 4O0XA 2HCKA 4LMNA 3MFSA 3UNKA 1KE7A 4AU8A 4C4JA 1M7QA 3TG1A 5AR4A 4E4LA 3KEXA 4O7ZA 5E8TA 2OF2A 3K2LA 5HNBA 2BKKA 2QKWB 4PQNA 3SV0A 3PRIA 4RA5A 3PPKA 3CGOA 2BZIB 4CFVA 5CF6A 3W33A 4NFMA 3KKVA 3F2RA 3HAMA 3VW6A 1PY5A 3S00A 2G01A 4AN3A 5HG8A 5D11A 3ZONA 3EL8A 5DN3A 4KIOA 3WE4A 4AW0A 3D5XA 2OJGA 3N4VA 3R00A 2NRUA 3QZFA 4RWKA 5I4NA 3F3TA 3F88A 3ZRLA 3ALNA 3RGFA 4KIKB 4FZ6A 3PJ1A 2I7QA 3QRKA 3SG8A 3KVXA 1ZLTA 1S9IA 4F9YA 1ZOEA 1OMWA 2X9FA 3ORXA 3Q2MA 4CFFA 4JT3A 3WZJA 5CENA 2IPXA 4FEWA 3HMPA 4YLLA 4Z7HA 4E4NA 3Q6UA 4UMPA 2ZM1A 3P7CA 3R7EA 3TV6A 2X1NA 4E20A 5CVFA 2ZV8A 3QGWA 4LMUA 3UO4A 2PUIA 3CR0A 1YXSA 3HRFA 2UZOA 2UZWE 1ZYCA 3VBXA 2I0VA 1OKVA 2YCQA 4L3PA 2OJFE 2JBPA 3L8XA 1UNLA 4HYHA 1S9JA 4I0TA 2WU6A 3PVBA 4WOVA 3W2OA 1ZWSA 4DT8A 3WZEA 2BAJA 5AP1A 4O84A 4CFNA 4BKJA 3T9IA 1M2PA 1UWJA 5FGKA 3W2CA 2H6DA 5IH5A 4YSMA 4A06A 5EKOA 2B1PA 2YN8A 5HU3A 2ZOQA 2VTPA 3R04A 3G0FA 5HLWA 3N4UA 3W16A 3TNQB 3IW6A 4TNBA 2QODA 3EL7A 3OWKA 5KE0A 3CGFA 5AV3A 3HV5A 2B9FA 2VWXA 4IJ9A 2HY81 4L43A 5CASA 4R7BA 4OTQA 3QRUA 4PUZA 3RPRA 3R9HA 1J91A 3GU8A 2IW8A 2WTWA 3E93A 2ERKA 3BRBA 4R3PA 2ITOA 3FZSA 3AD6A 2VX3A 4QPAA 5TR6A 3D83A 5EW3A 1XBCA 3ZLSA 5CEKA 1YHWA 2W05A 3IDCA 4DF3A 4TWNA 2GPHA 2UVZA 5M4CA 3ZRMA 4UXLA 4QP2A 4UX9A 1Q61A 3OW4A 4R1VA 3R8MA 3UO6A 5CEPA 2F7XE 3PWDA 2V7AA 3E8NA 3V5LA 4D5HA 5GIOE 4AN2A 5KKRC 4E8AA 3IGOA 1YOLA 1GJOA 2FO0A 4FTOA 4GVAA 4LQMA 4YTCA 5HE2A 5AA9A 3OY1A 3Q04A 4MD8E 4P90A 1KWPA 2GTNA 3P4KA 4QYFA 3UOLA 3MESA 4FTCA 3WZKA 2R2PA 3F5UA 4FODA 4BWKA 4GJ3A 3FPQA 3HRBA 3MWUA 3U4WA 3G15A 3R71A 4XNEA 5CEQA 1Y57A 3VS5A 4JDJA 2Z7RA 1R78A 2O2UA 1VYWA 2B54A 3TNHA 3WE8A 5HD4A 3QQLA 4KKHA 3CPCA 3L8SA 1H28A 4QMUA 5EM5A 3C5IA 4CZYB 2WTCA 2E9VA 2VNWA 1FOTA 2NRYA 3WI6A 3HA6A 3OWLA 4D55A 2EXEA 3Q4TA 3W8LA 5FXRA 3G90X 4ZTSA 4F7JA 2VTMA 4EOOA 4FIIA 4RBLA 1MRUA 4IWDA 5DPVA 3NUAA 1HOWA 1IEPA 3FI4A 3FLWA 3CTHA 4RGJA 4XV1A 2JDSA 4HGTA 4YTHA 4USFA 2F7EE 3DT1A 4AZVA 5IDPA 4F09A 1Y6BA 2PMNX 4OTPA 3FV8A 5ETCA 1FVRA 5LJJA 3GB2A 5K3YA 1YQJA 2ESMA 4I22A 2C6TA 1W83A 3F6XA 3NAYA 1XH8A 5KHXA 2IZTA 2QR8A 3LJ2A 4U81A 5HVYA 4TL0A 4RJ6A 2BIKB 2WNTA 1P4FA 3H9FA 2EVAA 3EJ1A 3GGFA 2I1MA 3ZS5A 4Z55A 2RFSA 4LGHA 2QLUA 1E9HA 3EFLA 3EH9A 3WYYA 4FV9A 2XYNA 4XV2A 2QG7A 4YSJA 4E93A 1OUYA 1PXIA 1ATPE 1PMEA 4UYAA 2Z7QA 4JS8A 3H9RA 4J97A 2ZM3A 3NW5A 4YPDA 4X2NA 1NVSA 2B53A 2ONLA 4L7SA 4BCKA 5HKMA 1IG1A 4D9UA 5HVJA 3QTZA 2WIPA 3HKOA 3IS5A 1ZMWA 3Q4UA 3O7LB 4AW1A 4RFZA 3PSCA 5HE0A 2XF0A 3PXYA 2BFYA 1GZOA 3NNUA 3UNZA 2W4KA 3HLLA 2HZ0A 3NW6A 4GK4A 4FZ7A 2WTKC 3MIYA 3UMXA 3VBYA 3BZ3A 5EM8A 1JNKA 1XH4A 4NUSA 3QXPA 3SGCA 2VTTA 5IZFA 4N57A 4DFZE 4K18A 5HE3A 2PULA 5L2SA 3PXQA 3FI8A 5LMAA 5M55A 5L8LA 2Q0BA 3HDMA 5AP7A 2X8IA 4CZUA 4EYJA 3UPZA 2ZV2A 3UO5A 4DGMA 1VJYA 4HVIA 3TNWA 4IJPA 2C4GA 2F7ZE 4BDGA 3VRZA 5AA8A 2C3JA 4D2SA 4GKIA 1SYKA 5HGIA 1WAKA 4C7TA 3QTWA 5GHVA 3GCPA 3RCDA 3KRRA 5A4EA 3Q9XA 3L8PA 5LMKC 5DMZA 5L4QA 2VD5A 4OTHA 2R7IA 3LMHA 5JZJA 3P86A 5GJGA 5FTOA 5BPYA 5E92A 5IUIA 3GFWA 2PVLA 1ZZLA 4QMWA 5E8WA 2I0YA 2C1AA 2OI4X 4L3LA 2XM8A 4HGEA 3S3IA 4DFUA 2WMBA 4IWQA 4C3FA 2PTKA 5ETIA 3UVPA 4F08A 4FTKA 1CSNA 4J53A 1CTPE 5TT7A 4G31A 3DKCA 5EHOA 4L01A 2J0JA 3UIMA 4M68A 3RVGA 3FXXA 3ZC5A 2FSMX 4M8TA 4PL3A 3HMOA 4P4CA 4YGAA 4DINA 4LYNA 1YI3A 3QKKA 4FKTA 2XBJA 1FQ1B 2VO6A 3ERKA 4V04A 4XRLA 3N4TA 3F7ZA 4J96A 3DAKA 4IW0A 4M7IA 2C3LA 2CHLA 2BRMA 3POOA 2RFEA 5AIRA 2ITWA 4FKWA 3FE3A 2ITNA 4IB1A 2VTOA 2BUJA 4QMTA 2C5YA 4JG6A 4DG3E 3MVMA 3A60A 4YTIA 5L8KA 4HCVA 4ACMA 4BDKA 4L42A 5HTBA 2V62A 3C9WA 4FKVA 4IFCA 3JUHA 4D1SA 3RAKA 4IX4A 2X2KA 3BWJA 4QMOA 4UXQA 1Q4LA 3VS4A 2C69A 1M2QA 1NY3A 2WTVA 4G3EA 3JS2A 2PUNA 2P33A 4G6LA 3T3UA 2ZMDA 2CKEA 3TACA 4QMYA 3ZLXA 4NH1A 5H8EA 5A4QA 4O7TA 3AT3A 3L9NA 4N6ZA 4O1OA 4OTRA 3ZDUA 3O96A 1BL6A 2WELA 4TYIA 4BZNA 2QR7A 3BYVA 2HOGA 5IMEA 5C26A 2R64A 4YU2A 3MPMA 2GFSA 5LVOA 1IR3A 3ZO1A 1XO2B 3BE2A 2RKUA 3ZM9A 2OK1A 4M67A 1YHVA 4GEOA 2UW6A 2V22A 3TI1A 4BGQA 1TQPA 1WCCA 3OXTA 4KINA 2JKMA 4RIYA 4TNDA 3RBWA 3DOGA 5EDPA 3MA6A 1H8FA 4OUCA 3VO3A 4N6YA 3VQHA 4EHEA 4KD1A 4F1TA 3KMMA 2J0LA 2B4SB 3AG9A 3PY0A 3TKHA 3UZPA 5A3XA 4D1XA 3UMWA 4ANLA 3R2BA 1U54B 3R9DA 3RAIA 5JFVA 5CT0A 1DM2A 2WMUA 1DS5A 3ZO4A 3OXIA 4I93A 3MY5A 4LOOA 4YJNA 4RJ4A 2ZDUA 2HELA 3A2CA 4IZ7A 4R6VA 4D4YA 4O7RA 3HVCA 1GIJA 4BYIA 4O0RA 4I5HA 3PLAE 3VS6A 2GQRA 3EN5A 4PL4A 3UTOA 3VBWA 3BV3A 2P3GX 4PNKA 3LXPA 5BMSA 3R2YA 3VJOA 3G9NA 2QKRA 4U80A 5HO8A 3RM6A 5E8XA 1FINA 4JAIA 2VWUA 1CMKE 1JAMA 3ZC6A 2QOBA 1YDRE 3QKLA 4RSSA 5C27A 4ZSLA 4CG8A 5CLPA 5DNRA 1TQMA 4M13A 2W1IA 2ZVAA 3RZFA 4IC8A 4IAKA 3BKBA 3K5VA 2WQEA 2XNEA 5C4LA 1KE6A 3LM5A 4D2RA 5L8JA 5AAFA 4TKSA 3RJCA 1Z9XA 4D2TA 2NO3A 3OCBA 4XS2A 4BCFA 5KMOA 4RWIA 3FSKA 2E2BA 2XRUA 4OTFA 4FVRA 4LRJA 4FSQA 2FB8A 4BCQA 4P5ZA 2YEXA 3DXQA 2CGUA 1RDQE 4FV3A 3E62A 4ARKA 3PFQA 4AA0A 4GW8A 2GQGA 2VTHA 3LCKA 4KBAA 4CFXA 1B6CB 3O8PA 3IKAA 4W4YA 1Q41A 3AOXA 4AGDA 5M51A 4C8BA 5CZHA 3V8SA 4KBKA 3OF0A 3EQHA 3C4WA 3PVUA 4R3RA 3SOCA 4X0MA 2J4ZA 3DXNA 3JY0A 3LFNA 4IVAA 5AWMA 4MYGA 1LP4A 2VX1A 3ZMMA 2GNJA 4R7HA 5ETFA 3GI3A 2CGXA 2WXVA 4PV0A 2GNGA 3A61A 4OT5A 1FVTA 4TYEA 3RM7A 2SRCA 2UZLA 1PKGA 4XBUA 5FP6A 5BUJA 4EUTA 4FKRA 3P23A 5D41A 4WUAA 1Y91A 2EB3A 1Q3WA 2X0GA 3U55A 1QMZA 2J6MA 5BVDA 3WIGA 3A7HA 3O50A 3RK5A 4H1JA 1M17A 3ODYX 3VUDA 5CWZA 3GXLA 3JY9A 3UIXA 3I4BA 2QLQA 3U6HA 4F7SA 1OPLA 4O2PA 4G17A 2X4FA 4UMUA 4H36A 4M69B 5EHLA 5F4NA 4FKSA 5AX3A 3ZBXA 4AA5A 5J79A 4MQ2A 4Q9SA 3NCZA 5EYDA 3HA8A 3UQGA 1YI4A 4G3DA 3MVJA 3F7WA 4RVMA 1U59A 3TEIA 2ZV9A 2B52A 5EM7A 5AUXA 4V0GB 3R8LA 1M14A 5H9BA 4PP9A 4R3CA 5FM2A 2XIYA 2PVFA 3H10A 2YLEA 4UV0A 4ZY4A 5KNJA 3F69A 3BYMA 3C0IA 5FEDA 4YP8A 3E7VA 4G2FA 4BICA 2RG5A 3QTQA 2JIVA 3LMGA 5CU3A 4HW7A 3D14A 3FQSA 4O0UA 2I0EA 1PMNA 3DZOA 3NNXA 2WD1A 4KS8A 4GMYA 4L68A 4ZP5A 4IDVA 3HUBA 4C62A 4XP2A 5C01A 1YDTE 2X39A 1K3AA 2J50A 4TWCA 3QC4A 2XKEA 4KA3A 4X6QC 4UB7A 5EFQA 5FXQA 3KCFA 2IO6A 1LEWA 5J95A 1KE8A 4JI9A 3MH0A 4BVUA 2FYSA 4M0YA 3MI9A 2WU7A 4PMPA 1LR4A 3NVKI 3FWQA 2W1CA 3EQDA 3FQEA 4RWLA 2QO2A 4XG8A 4RA4A 3KN6A 4K11A 1YHSA 4OTWA 5IDNA 2AYPA 4I5MA 3K54A 2X7FA 3UOJA 2BR1A 4RFMA 5KO1A 5CU4A 1WFCA 3QD2B 3VVHA 4JIAA 4E6DA 3E88A 3D7ZA 2QG5A 2BALA 5IKWA 5JK3A 2O0UA 1GAGA 3GC7A 2IWIA 2YZAA 4U41A 2VO0A 3H30A 2R3RA 1M52A 3FMEA 3OT3A 4ZJIA 4ZS4A 3DK3A 4DN5A 5AADA 4XG2A 3DJ5A 2UUEA 4RT7A 4X7QA 5CI7A 5CXHA 2A19B 5DH3A 3NUXA 3MY1A 3LZBA 1NA7A 3OVVA 2J5EA 4MWIA 5AMNA 1PXNA 5GJFA 1F5QA 3T9TA 4W4WA 3QRTA 4XG3A 2ACXA 5LOHA 2QOFA 5DA3A 4FIHA 1BUHA 1URWA 2ITPA 5H8BA 4MD7E 3KXHA 3IK3A 3VS3A 3NZ0A 3UQFA 1O6YA 4ITIA 3CQWA 1OECA 4PF4A 2QVSE 3U9CA 2C5XA 2NPQA 3C4CA 4PTGA 4DGLC 4CMTA 4QTBA 2BILB 2XNPA 3MJ2A 1W98A 3RKBA 3OEZA 2OU7A 4L3JA 4D5KA 4RIOA 3ID6C 1I09A 5AX9A 2XZSA 3MA3A 3OCTA 1SM2A 1P4OA 2QOKA 5B2KA 3TJDA 3F66A 1JSTA 4RIXA 4FG9A 5E1SA 4CCBA 3KRWA 5AP3A 4JR7A 5IA4A 5EOBA 4D4VA 3SG9A 5HO7A 2UZUE 4L45A 2GS6A 5GZ8A 2YDJA 4FEQA 4AZWA 2OWBA 2PE2A 1KOAA 3BQRA 4AS0A 4KSQA 2ITZA 4PY1A 3TIZA 4XG7A 2O8YA 4MXYA 3NUNA 2JKQA 3UC3A 2VWVA 2LGCA 2BRHA 5AFVA 4QTCA 5EW9A 3TL8A 3QD3A 5EYCA 1H0WA 4IIRA 2R3JA 5J7BA 3QD0A 4IE9A 3C0HA 2O3PA 4D4RA 5IPJA 1JWHA 3NGAA 3AMBA 2A0CX 3D2KA 2RF9A 4EKLA 2IZUA 1LPUA 3DXPA 3E92A 3R1YA 4CMUA 3ZUTA 3K3JA 2VWYA 4KIPA 2DS1A 3EKNA 5C1QB 2OG8A 1REKA 3ELJA 3GC0A 4ALVA 3S1HA 4OGRA 1UKIA 5CAUA 3IW8A 2IN6A 4ZAUA 3ORZA 3HUCA 3IO7A 3UJGA 4AZFA 5CX9A 1O9UA 4WBBB 3DNDA 4O0TA 1KSWA 3AC1A 4JBQA 4OBPA 2YAAA 3C50A 3D2IA 4YHTA 5FG8A 4F6SA 5JKGA 1WBSA 4X3FC 4BKYA 3MW1A 4WNPA 3QTXA 1T46A 4RIWB 4EBWA 2WMXA 3I0OA 4LG4A 4MF1A 5IA0A 4YJUA 2BDWA 3UIUA 2B9HA 1ZYJA 4UMQA 2BCJA 3LLAA 3I60A 1Q24A 4UMTA 2C6KA 3O2MA 5T3QA 4AW5A 4F9BA 4RX5A 3EYHA 5L6WL 3Q2JA 3IG7A 5HE1A 3FC1X 2WMWA 2V0DA 2X8EA 2XK8A 4MKCA 2RFDA 2X6DA 2CCIA 4HNIA 4QP1A 3UVQA 3EQGA 4RQKA 4U45A 4X21A 3LJ0A 4CVAA 4I5CA 4BHNA 3GQIA 4GIHA 5KKRB 1H25A 4BIDA 1UVRA 2R3IA 4AGCA 4XUFA 3GCVA 4AOTA 5KCVA 4FT5A 1CDKA 2OJ9A 3ORNA 4EOIA 4G3CA 3FLSA 4FKUA 5F20A 5K5NA 4FTQA 5CAQA 4ALWA 2NNWB 2C1BA 5HBJA 2YAKA 3PVGA 2CCHA 2I40A 3KRXA 4EH4A 3MN3A 5HO6A 2RGPA 3OMVA 2Q0NA 4I4FA 2JEDA 4BB4A 4EONA 4S2ZA 3TIYA 4FTMA 4K1BA 5IA5A 5ACBC 5BVNA 2BIYA 3D94A 4NJDA 3QX2A 1BX6A 4H39A 1V0OA 4IAYA 4NFNA 3GC9A 3FYJX 3TZ9A 4OBOA 3LXNA 4UWYA 4YZMA 4FNWA 1Q8TA 3MFUA 3ZRKA 2PWLA 2XCHA 5IQDA 1R39A 3I5ZA 1XR1A 4LL5A 3AMYA 1ZARA 3DK7A 3O8UA 5EDRA 1ZAOA 3SX9A 1B38A 4BRXA 4C58A 1K9AA 2WQOA 4O6EA 1OPKA 3LPBA 3GOPA 3A62A 3DBQA 5FD2A 2GU8A 3HP2A 3LFCA 5DGZA 3EWHA 2YDIA 3QFVA 1SZMA 4MX9A 4EH6A 4QMQA 3TZ7A 4DGNA 5M53A 3FHIA 4FTRA 2ETKA 4BZDA 5IA1A 2DQ7X 1T45A 4NEUA 3TXOA 3FHRA 3MSSA 4YBJA 5IQHA 4X2KA 4ZEGA 3P08A 1HCKA 2A2AA 2C0OA 4BIEA 2OSCA 3ZM4A 1JKKA 3R9RA 4KIKA 2JDOA 1UA2A 5HQ0A 2J2IB 3RHKA 4WBOA 2HW7A 3CCNA 2ZV7A 4R7IA 5AUYA 2H8HA 2BFXA 5J8IA 2XJ0A 1UU9A 3VW8A 3I1AA 3KB7A 1IAHA 2JAMA 4NCTC 4QMPA 2PVKA 1H1RA 1WVYA 1Q8YA 3KF7A 2QOIA 2Y6OA 5EI8A 2R4BA 5M4UA 3FLZA 4GS6A 4X2GA 3BU3A 2P0CA 1M2RA 5EG3A 4H58A 4QOXA 4CZTA 3DTCA 3FZOA 1OVEA 3SVVA 4GT4A 1M7NA 2I0HA 3BGQA 4O0VA 3MGYA 5DWRA 4FIFA 3FI3A 3R8VA 5I9ZA 3EB0A 2Y7JA 3EQRA 3TT0A 4DFXE 3KRLA 1J1CA 3LXLA 3LJ1A 3M2WA 4O86A 5JN2A 5AR8A 2YJRA 3PJ2A 3FZRA 3TNPC 1XH5A 2HYYA 3ROCA 1APME 2C6DA 2JBOA 3A99A 3ZUUA 2WTKB 3T8OA 3W2QA 3OHTA 3C4FA 5LMKA 4EKKA 3M1SA 2HK5A 4I23A 3TKUA 1E1XA 4M84A 4C02A 4EK5A 3NMUF 5CAPA 2YM8A 1W82A 1GZKA 3IDBA 4O0YA 4ZSGA 2XIZA 1SMHA 5DR6A 1OKWA 5GINE 1XKKA 5A4LA 1Q62A 2X7GA 4AX8A 3TTJA 3PA5A 3RCJA 3Q60A 3G0EA 1BI7A 3OOMA 3W18A 3V51A 2W4OA 5G6VA 4FL2A 1U5QA 3CTQA 4IMYA 2O64A 3EFJA 3Q53A 1ZMUA 5K4JA 3BX5A 5EKNA 2FVDA 1YXXA 4HPUE 5DYJA 1FGIA 1UU8A 3FYKX 3H9OA 4H3BA 4YHFA 4ANSA 1J7LA 5AV0A 4O0WA 3QLGA 3NS9A 3CJFA 3FLNC 3OG7A 4FT0A 4JJRA 2R3GA 5HG5A 3OOGA 4FTAA 3PYYA 5AV1A 4BCPA 4QP6A 1OKZA 4DEBA 4ERKA 2V55A 3ODZX 4QMNA 4BDFA 2YM6A 5CYIA 3LQ3A 3FL5A 3IW4A 2F2CB 4ANMA 2ZMCA 4TZRA 2BHEA 2X81A 2CKPA 5EQYA 4GKHA 2W5BA 3PSBA 3N51A 2BRBA 2J9MA 3GU4A 3KRJA 4MK0A 1OIYA 2R3PA 3BGZA 2VNYA 5JH6A 3ZTXA 2C68A 4IC7A 3W8QA 3LVPA 1SNXA 3VF9A 5JEBA 4QYGA 5C8NA 4II5A 4ZTHA 3R1NA 4U6RA 3D5WA 3ZSIA 2BRGA 2WTJA 3ZDIA 4EOQA 4NIFA 3MTFA 4GFOA 2GMXA 4F9WA 5B2LA 3NUYA 4ACDA 4XG6A 3D5UA 3H0ZA 4L00A 2Z02A 3QQGA 2G2FA 2X2MA 4NWMA 3K3IA 3BPRA 4LFIA 5KHWA 4HYUA 2GNFA 4EHZA 3GVUA 4CLIA 1FPUA 2JLDA 4FT9A 4QTDA 4WKQA 1WBWA 3QGYA 3THBA 3OUNB 1ZOGA 3KXXA 3P79A 3AXWA 2HENA 2WPAA 2CDZA 2VN9A 4BCIA 1ZXEA 5FLFA 3HV3A 3MH3A 4FGRA 3IPHA 3V04A 4RVLA 4LOPA 5EYMA 5FDPA 1L3RE 3DBCA 3QUPA 4NIFB 1YRPA 5BNJA 3KMWA 2ZAZA 4O21A 4U42A 5EI2A 3SW4A 4QRCA 5CVGA 3HL7A 4FKIA 4JBPA 4CMOA 2UZEA 4TYJA 3ROYA 4GG7A 3TN8A 1Q8WA 4AFJA 4AP7A 3KF4A 4K77A 4C4IA 4CTBA 4CCUA 5HEZA 4DYMA 5HIDA 4FX3A 3WBLA 4DH1A 2UZTA 5M4IA 3FMMA 4JVGA 3DCVA 5K9IA 1OL5A 3PZEA 4ACGA 3B8RA 4IFGA 4CRSA 3SC1A 4C61A 5E8ZA 4CKIA 4YC3A 2FGIA 3I6UA 5JGDA 2QCSA 4ZTQA 3O0GA 4A9UA 5HESA 2BDFA 3FBVA 4H1MA 3HV7A 3FMKA 1R3CA 3LFQA 4PTEA 3FAAA 1H00A 2G2HA 3G6HA 4U40A 3PXZA 3QTIA 2PVYA 2GS2A 1WBPA 2R3KA 4OT6A 4TT7A 4XG4A 3U4UA 2O65A 1WZYA 3U8WA 5KZIA 4AWIA 4C0TA 3Q5ZA 1KV1A 1FGKA 2IZRA 3KQ7A 3PJCA 1U4DA 2ZJWA 4RWJA 2OGVA 5IUHA 1L8TA 2PSQA 3OCSA 3NYOA 2P4IA 3AQVA 3Q4ZA 3C7QA 4OTGA 3SXFA 3BELA 5I5ZA 5J5SA 2CNQA 3QQJA 2IVUA 2OFVA 1V0PA 2HXQA 4L67A 3QCXA 4BIBA 3AD4A 4FL3A 4FV1A 3ZEPA 4L44A 5IH6A 3RPSA 5IQAA 4A4OA 4Z9LA 2YCRA 4QQTA 1YW2A 1PXJA 4NW5A 1WVWA 2C6OA 4PDPA 3VS1A 4AZEA 2OZOA 3BHYA 2OKRA 4FSNA 5AP6A 4OAUC 5IEYA 5IISA 4F70A 3SW7A 4EOSA 2DYLA 5FXSA 3PG3A 5F9EA 3TUDA 4FG7A 3LFDA 4DEDA 1MQ4A 3AGMA 1LEZA 4L46A 4RLKA 4ZIMA 3I7CA 1BLXA 5LVMA 3PJ8A 4FIJA 5JSMA 4BKZA 2EB2A 4D28A 4TW9A 3R8ZA 4C57A 5JT2A 4KAOA 3FMJA 5KZ0A 3R7IA 1FMOE 3DKOA 3BEAA 3BHTA 3CY3A 2XNMA 2Y8OA 3ZLWA 1GIHA 1JSVA 3Q6WA 3VRYA 4GH2A 4IACA 3ZSHA 3OWJA 2XNNA 5CEIA 5I9XA 2R3FA 1XJDA 2XJ1A 4P2KA 4E3CA 3OROA 4BCHA 4QP8A 4X2FA 3SXSA 4MXAA 1ZYSA 4L6QA 4MAOA 4CYJA 4ZMEA 2YJSA 1YI6A 5C9CA 1XBBA 3IQ7A 1J7IA 5AR5A 5J7HA 3OXZA 2P2IA 4Y73A 4IAFA 5ANDA 4QMXA 4MHAA 1BI8A 3PE1A 2WMAA 5CQUA 5DRDA 2OO8X 2XP2A 2R3NA 5BVFA 2BKZA 3KC3A 3R1SA 1BYGA 3KGAA 5LVPA 4R78A 2JAVA 2CKOA 3HYHA 2ITQA 2W1GA 3F2NA 5BUIA 4AZTA 3NYVA 3UGCA 3ZFYA 4CV9A 5BUEA 5J9LA 4IVBA 5M4FA 3FMNA 3OBGA 3R63A 3TKIA 4EQMA 3V5JA 5ANGA 5IF1A 4LI5A 4I94A 4JLCA 5DLSA 4ZK5A 1IA8A 4FTTA 5T6KA 2IVTA 4IVDA 2VAGA 2CKQA 5CEOA 4BTMA 4XBRA 3R01A 4FOBA 2IVVA 2BROA 1OITA 3OBJA 3HGKA 3OWPA 4BF2A 4F4PA 5JMSA 4JG7A 4NM3A 4IZ5A 3MY0A 4CQEA 4HYSA 4C4EA 1XH6A 3BLHA 2E9NA 3NUSA 1G5SA 3OTVA 5J5TA 4ANOA 5HOAA 2B0QA 3VHKA 3TDWA 2KTYA 2GHMA 4YPSA 4BGHA 4NYEA 2WMTA 1PF8A 3ACKA 4KABA 3CQEA 3QC9A 2C5VA 2H96A 4XCUA 5IQFA 4O7NA 5HORA 4B7TA 1U54A 3P7BA 5JQ8A 2WMQA 1YXVA 4CNHA 2GNIA 1WVXA 2FUMA 3MYGA 3NW7A 4HVGA 4H05A 5AUUA 4ZY6A 3ZLYA 2OJIA 5AAEA 2ETMA 3QKMA 4MBIA 5JQ5A 5HG9A 2QI8A 2QHNA 5HNGA 4WIHA 5IQGA 2W99B 1E1VA 2JFMA 4G1WA 2X9EA 2VTRA 1V0BA 3F5XA 4DG0E 2AC5A 4ASZA 2QURA 5I0BA 4YC6A 4CYIA 4S31A 4TTHB 4C38A 4E7WA 4Q9ZA 3CD3A 3VBQA 1J7UA 1PHKA 1OI9A 1PXKA 3DAEA 1H24A 4GYIA 4MXXA 2FSLX 4GK3A 5JGBA 4FV0A 3LE6A 2YCFA 5HZNA 4O83A 1UKHA 3IONA 4FV8A 4ZSJA 4ZTLA 4FOCA 5IUGA 2XK6A 3R1QA 4CT1A 2PUUA 5KX8A 3WZUA 4O22A 3W10A 4A4XA 4YZ9A 2RG6A 4M0ZA 3NYNA 4BYJA 4C3PA 3NCGA 3CXWA 3HV4A 4DH3A 2HY0A 2W1DA 2XB7A 4QTEA 4GVJA 4KNBA 4OLIA 3QRJA 3UQCA 4LGDA 2VO3A 4E5AX 1G3NA 3BU5A 4G34A 1OBDA 5DI1A 3D7TB 4RVKA 5J9YA 4RJ7A 3HMNA 3QU0A 3WF8A 5H8GA 2WTIA 3EMGA 4LRMA 5CALA 4NM5A 1YWRA 4XOYA 4UZDA 3DDPA 3E3PA 1H08A 1H4LA 2C6IA 3BBTB 1IASA 4FIEA 4DEHA 4E73A 4Q5EA 5LWMA 2JDTA 3QWJA 4YZNA 2OXDA 4XYFA 1KE5A 2FSOX 3PPZA 4AE9A 4FYNA 5IQBA 1UU3A 5AAGA 3WF5A 4FG8A 1Z5MA 4Y5HA 2ITUA 3R28A 4YNOA 2C5OA 3QXOA 3SKCA 2R3QA 3A8XA 3LFFA 5CXZA 4R77A 3VAPA 3ALOA 4TYHB 4MBJA 4GL9A 4YTFA 2YIQA 3DBEA 4F6UA 5KMIA 3R8UA 5C8KA 2EXMA 3FKLA 3UP2A 2WEIA 5HBEA 2UZDA 4IAZA 2CGVA 3LFAA 3PZHA 4M69A 4RJ3A 4MVFA 2XIKA 4YJSA 1QPCA 3FKOA 4ZS0A 2YIRA 1RW8A 4U8ZA 3C13A 4FTJA 3Q5IA 3NRMA 1G8AA 3WOWA 4KRCA 3A8WA 1YOMA 4YBKA 2BTSA 3F3VA 2EU9A 5AUVA 3ORPA 4B0GA 4V0GA 1PXMA 3PE2A 4FKPA 2PL0A 3R02A 4X3FB 2XUUA 3R6XA 5JFWA 1AD5A 4EWQA 3C5UA 3F82A 1SVHA 1YXTA 2H34A 1YXUA 2VWZA 1J1BA 5DVRA 4QMZA 1ERKA 2WMSA 3L9LA 4NTTA 3MFRA 1I44A 4TWPA 3PXKA 1OZ1A 3TUBA 2C5NA 3U87A 4ZJJA 5IU2A 4I3ZA 5HLNA 2W06A 3V8WA 3EIDA 3E87A 4KS7A 4DFBA 4FSUA 4XP0A 5AP2A 2BDJA 4FSTA 4AG8A 4ZZMA 3DAJA 4GUEA 3GBZA 4F9AA 5CU0A 3MTLA 4DH5A 2PE0A 4ALUA 1A9UA 1WBOA 2XK3A 5CQWA 2OXYA 3EKKA 1DI9A 4EZ7A 2YM4A 3QQFA 4MQ1A 3MVHA 4IBMA 4L7FA 5FM3A 4DHFA 4DA5A 2B9IA 4CV8A 3GFEA 4FVPA 5E91A 2WMVA 2R0IA 4C33A 3QALE 5DT3A 4JBOA 4I20A 5CU2A 4AXAA 3BGPA 3LFSA 4FMQA 4S33A 2QQ7A 3DS6A 5L2WA 5TF9A 4Y5QA 4YUQA 4A9RA 2YIYA 1CM8A 1Q5KA 4XH6A 4P7EA 4I1ZA 5IQIA 3G5DA 3SRVB 4MH7A 5E8UA 5HTCA 5LARA 4QNAA 3NYXA 1W8CA 4HCTA 1JVPP 4R5YA 4XHKB 3U9NA 4BBMA 3MDYA 2C6MA 3EQFA 3LXKA 4NM7A 1P5EA 1QPDA 4F7NA 4FE2A 2X7OA 4D1ZA 4EEVA 3FDNA 4NCTA 3MFTA 4D2WA 2JDRA 1MQBA 4QNYA 5FWKK 5G1XA 5HU9A 3I81A 3VUMA 2WIHA 2PVRA 4FUXA 2O63A 4F1MA 4U79A 4U44A 3OC1A 3MH1A 5BX0A 2OXXA 4Y8DA 4RZWA 2WKMA 4G6NA 4FV5A 3DLSA 3ENHA 4F65A 3E8EA 1UNGA 1PXPA 4A4LA 4W9WA 1QPJA 2WO6A 4BBEA 3FEGA 4C4FA 4BY9E 3PSDA 4ZLYA 3OY3A 3GNIB 5CTPA 4I41A 3RNIA 3ORKA 3A7FA 4GV1A 2X4ZA 3LOKA 3NUPA 4LRKA 4DAWA 2OLCA 3RK7A 3JVSA 4BI1A 2B7AA 2E9PA 5CI6A 2VWIA 3G51A 3Q4CA 4ZTRA 3QF9A 4C4HA 3QCYA 3DDQA 4FKOA 3DJ7A 4Q2AA 1KE9A 2E9OA 4QYYA 1MRYA 2BPMA 2ITVA 3PRFA 1OL2A 4D58A 3PUPA 4ZLOA 2RIOA 3LW0A 4QQ5A 4ZTMA 4O82A 2EUFB 4F6WA 5LMBA 4I6FA 3PPJA 4JQ8A 3EQCA 3UOKA 2VX0A 3SHEA 2WOUA 2R3MA 2FA2A 4QMSA 4EZ3A 4I4EA 1O6KA 3Q9ZA 5HIBA 2YCSA 4X2JA 2JIUA 3EFWA 4LL0A 2XVDA 5C4KA 2YFXA 3E8CA 3QBNA 5FUTA 4FV4A 3C51A 1Y8YA 4G3FA 2YM7A 3OS3A 3HP5A 3O17A 1F3MC 3HRCA 2DWBA 4O91A 5LCJA 3DFCB 4GU6A 4JNWA 3II5A 3VF8A 3IDPA 4IAAA 3R30A 3AGLA 4QD6A 4UEUA 3CPBA 2PZYA 4RIWA 3JPVA 3JVRA 3JYAA 3QWKA 4EZ5A 2PUPA 1PXLA 4F9CA 2ZM4A 4EQUA 5K0XA 2RFNA 4U3ZA 5HNIX 4IWOA 4CKJA 3BHVA 4AAAA 5AP0A 3VHEA 2X2LA 5FBOA 4XEYA 5FEQA 5TKDA 4GK2A 3CC6A 3F2AA 3MB6A 5GNKA 2Y9QA 1H1QA 4BBFA 5AM6A 5CT7A 5F94A 4AT5A 2JKKA 4DBXA 3PA3A 3R7GA 4QYHA 3C0GA 3WILA 4FICA 4YNEA 2GTMA 3P7AA 4G5JA 4FA2A 2QNJA 2GCDA 4GUBA 2W17A 5H2UA 2RSVA 4MTAA 2GQSA 1W0XC 5CSVA 4M97A 2FH9A 3VQUA 1URCA 2YIWA 4WT6A 4ZOGA 3ULZA 3QCSA 4IM0A 2Y4IC 3RTPA 4BCOA 4BI0A 1U46A 2NP8A 3LFEA 5FEEA 1YWVA 4C59A 2ETRA 3F5GA 3ZZEA 3UZTA 5E8VA 4PNIA 2YLFA 3ZH8A 4DITA 3B2WA 1JOWB 5M08A 1BL7A 4BDAA 4CFMA 3QTRA 3LHJA 3L8VA 4UY9A 1GZNA 3DTWA 3CEKA 2W7XA 3NPCA 4MBLA 4D0XA 2PYWA 4EUUA 3PIXA 4Y46A 3ULIA 2R5TA 5AUTA 4I92A 3FXZA 4EORA 3EN6A 1W7HA 4BCJA 5DEWA 2J5FA 5DRBA 2BZHB 4XG9A 5EW8A 4J1RA 4IAIA 4WG5A 2HWPA 4WRSA 1PRYA 1JKSA 1AGWA 3MIAA 4WNKA 3CP9A 2PE1A 2REIA 5A4CA 2HAKA 3V8TA 5KUPA 3W2PA 3MPAA 2PVJA 2BAQA 5HG7A 3WIKA 3NEWA 4NTSA 2C6LA 4C3RA 4DLJA 3ETAA 4AFEA 4NKSA 4NZWB 3UYSA 4FZDB 3RAHA 5AR7A 2Y0AA 4ACHA 4OAVB 1H01A 3QD4A 3NAXA 3C4ZA 4IEBA 4MF0A 3TJCA 4U5JA 3W1FA 4BTKA 5CSXA 4ORKA 1DAYA 5D10A 2BAKA 4ZSEA 4EWHA 3A4PA 4MXCA 5CEMA 4O7LA 4FEVA 4IM3A 1CKPA 2EXCX 4EOPA 3BLQA 3BQCA 4M12A 2BVAA 3COHA 4FL1A 4RX7A 5HCZA 3D15A 3VS0A 4M66A 3C1XA 4KWPA 3RWQA 5A6OA 2PHKA 4U97A 5FQDC 4CQGA 4E6AA 5HICA 3VUKA 3ACJA 5AEPA 4TN6A 1VR2A 3L9MA 3HECA 4PMSA 3R21A 3O71A 4YZDA 1OKYA 3DV3A 3VS2A 4IB3A 1BKXA 4AN9A 4OW8A 4E5BA 4J8MA 3LQ8A 2PPQA 2VWWA 2PVHA 4XX9A 4FNXA 2OH0E 4C4GA 4ID7A 1CKIA 5BYLA 4YO4A 3AC4A 3H3CA 1OL6A 1GIIA 1TQIA 3FQHA 5DIAA 4ZTNA 4XMOA 4AT3A 3G33A 4MXOA 4BZOA 5L3AA 2QU6A 3R73A 4HGLA 2X6EA 2AUHA 3I79A 4BTJA 2XCKA 5AV4A 1NW1A 3U6JA 3QTUA 3QQHA 3UP7A 2KULA 4O7WA 4QQCA 3KVWA 4J71A 5KMLA 5BVEA 1GZ8A 4F64A 4FR4A 4GFGA 3QZIA 2Q83A 4HVHA 1VYZA 1REJA 1ZMVA 4L9IA 4XJ0A 3W55A 4NJ3A 2C3IB 2RL5A 3REPA 2JGZA 3JXWA 3V6SA 4B4LA 2BMCA 2UW9A 4EYMA 2PVNA 3I0QA 4Y85A 3F5PA 1RJBA 3GC8A 4AT4A 4ERWA 2VTIA 3JR1A 4C35A 2XK9A 3HV6A 4ITHA 5AUZA 2G1TA 4S32A 4FT3A 4DEIA 3V5TA 3VNTA 2YACA 2XNGA 4KB8A 4BWPA 3VS7A 1XHAA 2J0IA 3E7OA 5M06A 3SQQA 2XKFA 2ITYA 4JAJA 3POZA 2W9ZB 4C2VA 2OF4A 5EYKA 5CZIA 5FRIA 3PY3A 5CAVA 1GY3A 4AOIA 1R0PA 2WEVA 3EYGA 4LUEA 5B2MA 2X8DA 4EOKA 4O81A 3LIJA 3C4EA 5E4HA 2DUVA 4MEDA 3FL4A 2PZRA 3FMDA 5ACKA 3HMIA 4LV8A 3E64A 1YDSE 2CMWA 2VGOA 4F0FA 3KXGA 4HCUA 4EH9A 3F3UA 4RC4A 4ANQA 3DY7A 5EDQA 3K5UA 3NR9A 3MBLA 1UWHA 5CU6A 5F1ZA 1R1WA 2C6EA 3KA0A 4O27B 2GNHA 2QU5A 1DAWA 4TRLA 5GZ9A 2VTSA 4BC6A 4FC0A 2XA4A 3E5AA 3HNGA 4OTDA 2JDVA 4BL1A 1XWSA 4CRLA 3EOCA 4IWPA 4DGOA 1Q8UA 4HYIA 1X8BA 3WF6A 5BQ0A 2VTLA 2C0IA 3TWJA 4EH2A 3UVRA 4QMMA 1YKRA 3P9JA 4CXAA 2YWPA 3FJQE 1UNHA 4GYGA 1U5RA 4YZCA 3VUHA 5KMMA 1YVJA 2C47A 4JQ7A 5AP4A 2CPKE 4O0SA 3UYTA 1O6LA 4B8MA 2UW3A 4I6BA 3DU8A 5DR2A 4PRJA 2PY3A 4V01A 2OIDA 5JRSA 3T3VA 4APPA 3ZFXA 4BDJA 4F63A 1J3HA 2B9JA 4WG3A 2Y4PA 5M56A 2PMIA 3COIA 2HIWA 2LAVA 4GU9A 4NT4A 4QQJA 3BYSA 4Q5HA 3WYXA 3ZO2A 5AR3A 4BCNA 3ORTA 4YZBA 4EI4A 4I6HA 2PZ5A 1KUTA 3Q9YA 3U51A 4QTAA 3D5VA 4JDHA 2ERZE 3Q96A 2R7BA 4JX7A 3RMFA 3O51A 5HCXA 3UNJA 2AC3A 4BR3A 3UPXA 3S4QA 1TKIA 4WO5A 4GCJA
chains in the Genus database with same CATH superfamily
2QO9A 4RG0A 3GENA 3HX4A 2W1HA 5CANA 3KXNA 2BZKB 3V3VA 1WBVA 4MWHA 1ZY5A 2W1EA 1OIQA 4PDSA 4CLJA 1WBNA 3HAVA 4HZSA 4LUDA 3FI2A 3OTUA 4CD0A 5M44A 3OW3A 5EQEA 1QPEA 3I7BA 3F61A 2WAJA 3GP0A 4W4XA 4IANA 4D9TA 4FT7A 4FSMA 5TE0A 3BU6A 4UWBA 4UMRA 2HZ4A 3PVWA 1RQQA 4DTAA 4CGAA 2OH4A 5LWNA 4EBVA 1H1PA 3L9PA 2UVXA 5E8SA 5IA3A 4U3YA 3TZMA 1JPAA 4NU1A 3EN7A 2OIQA 3DQXA 3RK9A 1SNUA 4EK8A 4EH3A 4AOJA 3Q9WA 4DHJA 3KFAA 4DGGA 5CSPA 4GT5A 4YO6A 5HCYA 3EQIA 3DFAA 4G5PA 4IB5A 3ZSGA 2WQBA 2CN5A 4R1YA 4JQEA 4X3JA 5BYZA 3RNYA 3OEFX 2P2HA 4JOAA 2OBJA 5E7RA 3ANQA 4FYOA 4APCA 2F49A 4XRJA 3TZ8A 3E63A 3PWYA 4IX3A 4YJPA 4BDDA 4O7SA 4G16A 2OICA 4ZZNA 3BV2A 4U43A 5JGAA 3QLFA 5AJQA 2QOQA 4I0SA 4FBXA 3CJGA 4GSBA 1OPJA 3PG1A 4DCAA 5FBNC 3I6WA 2CNUA 4EK6A 3IW5A 3GEQA 3TDVA 4Y72A 2WB8A 4MNEA 4FV7A 3R7YA 4HVSA 2QOLA 1OM1A 3ORIA 5EM6A 5JZNA 4AQKA 4DFYA 3R9NA 2BHHA 3G9LX 4TWOA 2V7OA 5HIEA 4HJOA 4DFLA 4FZFB 4MD9E 4KUJA 3FKNA 4EOLA 5A4TA 4FSZA 5FTGA 5HX6A 3M11A 5AP5A 3KMUA 3D4QA 1PJKA 4FZAB 4I0RA 2QOOA 1ZRZA 2GHGA 3NVMB 4EH5A 1MRVA 2XNOA 4L52A 2WGJA 4TY1A 5EOLA 5A9UA 3Q3BA 3S0OA 2QOHA 3BLRA 3A7GA 2XKDA 4JDIA 4XV3A 4W8DA 2QO7A 1QCFA 2W96B 3OZ6A 4DG2E 4DH8A 4PMTA 2UW8A 4MNEB 2C3KA 4BN1A 3HDNA 3PTGA 2HZIA 3GCQA 2UV2A 3R83A 3VWAA 4YURA 4WRGA 1GOLA 5KBQA 4RQVA 3FZ1A 4TPTA 3TM0A 2CGWA 3IOPA 4WNOA 4YC8A 4E5WA 4ASEA 5LQFA 3H0YA 4LV5A 2CN8A 5A6NA 3SLSA 1P2AA 4RJ5A 4IQ6A 3WARA 3H4JA 2QHMA 4FTLA 5K5XA 5CSWA 3RPVA 2YDKA 4RX9A 3R7VA 4J98A 3ZO3A 5CF4A 2XBAA 5ITAA 2JC6A 2GFCA 4ASXA 2WMRA 2PZPA 4KKEA 3IOKA 4CG9A 4JRNA 4LOQA 3VBVA 4XOZA 2XJ2A 3TTIA 3QL8A 4CKRA 3OP5A 3COKA 4GRBA 4IVCA 2YITA 3QHWA 4Z7GA 3IECA 3VUGA 3EZRA 4BDIA 2W0JA 5DR9A 3NLBA 5D12A 2UW7A 2YABA 3VN9A 1MUOA 3O7LD 3VC4A 2NYAA 4GFMA 4W4VA 2XKCA 5LVLA 3CE3A 2YERA 2UVYA 4A7CA 3QTSA 5C8MA 4ENXA 4F99A 1PMVA 1OIRA 3BI6A 3KY2A 3FXWA 3ZBFA 3HZTA 5IEVA 4R8QA 4FK6A 2P55A 3VIDA 3NSZA 3DKGA 3PXRA 3VBTA 2W5AA 4BWXA 2YA9A 1NT2A 3AMAA 3ENMA 1GNGA 3PP0A 3SD0A 2VGPA 1ZYLA 4ONAA 1XH9A 2G2IA 2VTAA 4RVTA 5IG1A 2I6LA 4YHJA 1JKTA 2Z7SA 3ITZA 5AUWA 4IX6A 1H0VA 3DA6A 3FPMA 3FZPA 4N0SA 4QMLA 3ZU7A 2QD9A 3A7JA 2OJJA 3AKJA 1IRKA 3F3WA 4IADA 3UG2A 2Z7LA 4G9CA 1FMKA 4O7YA 5D7VA 4CEGA 3LCDA 3G6GA 4FK3A 4ACCA 2GHLA 4FEUA 3QA8A 4JXFA 3NX8A 3GCSA 4PWNA 1MP8A 3R22A 4RJ8A 4RMZA 2UW5A 4FIGA 4S30A 4S34A 2XEYA 3P0MA 4V05A 3UIBA 3EQBA 3OT8A 2Y6MA 4EQCA 4ITJA 3O23A 3QYZA 3ZUVA 4ANNA 4E26A 5IQCA 4BTFA 5DFPA 3CBLA 3FMLA 2VZ6A 2UZVA 3PXFA 4HNFA 3LLTA 4QPMA 3FUPA 5KMJA 4DEEA 3D7TA 3UC4A 3RPYA 3A4OX 5DOSA 4XLIA 4QP7A 5CY3A 4KSPA 4F0GA 4YR8A 3BYUA 2YHVA 4CTCA 2BTRA 2WQNA 4AACA 4IH8A 1JQHA 3CD8A 2OZAA 3NNVA 4E6CA 2YM5A 5LXMA 1WMKA 3AC2A 3HEGA 4M15A 5E8YA 2HW6A 2ZB1A 4RC2A 3WF9A 3EQPA 3QQKA 5DG5A 3DLZA 2Z60A 4YJVA 4WA9A 3SAYA 4PDYA 4DTBA 3PJ3A 3ZXZA 2IVSA 5EI6A 3GQLA 1H1WA 5ICPA 5CVHA 5E1EA 4TYHA 4YJRA 2IW6A 1OUKA 3TNIA 4BDCA 4K0YA 3TMOA 4EJ7A 4FV6A 3PY1A 3W0OA 4FVQA 3LAUA 5IEXA 3C4XA 2XRWA 2F9GA 5A14A 1SVGA 3RZBA 5EH0A 5HI2A 4F1OA 4WSYA 2PMOX 2XH5A 3RI1A 5L2TA 2OZAB 5E9EA 3UDSA 3GOKA 4J7BA 2O5KA 2XYUA 3QCQA 5M07A 3BL7A 5HVKA 2PZIA 5BVKA 4UALA 3ATSA 3UODA 3QUDA 5IMXA 5EHYA 5JFSA 4RIYB 1OL1A 3QRIA 3ZYAA 4D0WA 3NFGB 5I3RA 4O7VA 1XQZA 2EWAA 2WHBA 4WNMA 4AGUA 4AGWA 3LM0A 5GIPE 1Q3DA 4BDEA 3UZRA 3DB8A 1OBGA 4K33A 3KK8A 2W1ZA 3AT2A 3ZXTA 2JD5A 4X3FA 3UE4A 4F0IA 3BBWA 5L6PA 4FKLA 2YM3A 3RP9A 3VUIA 2QC6A 4FUYA 4DT9A 4N70A 1QL6A 3UDBA 3GT8A 4I6QA 3PLSA 2ZYBA 4EHGA 1W84A 3P78A 3DZQA 4BFMA 4FF8A 1XBAA 3CS9A 1RE8A 4NKAA 5FP5A 3TV4A 3BYOA 5JRQA 4LM5A 5CAOA 1YOJA 3FZTA 4BDHA 4IZYA 4KIQA 2A4LA 3QA0A 4M3QA 4XV9A 5H3QA 4B9DA 1NVRA 3BCEA 2R9SA 4EC8A 4ZY5A 3SA0A 4DE4A 4IZAA 3OD6X 3M42A 2R3HA 2WFYA 5HLPA 1PXOA 3KREA 2OW3A 3RINA 5EQPA 4YJQA 2ITXA 2ZDTA 1WBTA 3ZCLA 1FBNA 1JBPE 3CQUA 3MS9A 1YWNA 2IJMA 3AC5A 2UW4A 3DNEA 3CKWA 4OR5A 3ZHPC 4TYGA 3MB7A 2GDOA 4C37A 4RFYA 4CFUA 3NIEA 2ONLC 4J8NA 5CNOA 4YLJA 4C36A 3P5KA 4JG8A 4EHVA 4BCMA 5F95A 4FTIA 2Y4IB 5KMKA 3QQUA 3U6IA 4L53A 5DEYA 4OBQA 4BCGA 3DJ6A 4M14A 5B0XA 4D2VA 4JDKA 2G9XA 5D7AA 3W2RA 5TOZA 2XNBA 2OFUA 3KCKA 4J99A 4RLLA 5K0KA 5T68A 3QAME 3IGGA 4PPCA 2A1AB 2V5QA 2J51A 4NW6A 4XP3A 5HD7A 2C30A 2HZNA 4QMVA 5DHJA 4A9SA 4CSVA 1DI8A 3IW7A 3SRVA 2JFLA 3DQWA 2ITTA 2YIXA 1UU7A 4QPSA 2J0KA 2YZLA 2GSFA 3FLYA 4DLIA 3FMHA 3GCUA 3ZFMA 4PP7A 5L6OA 2CJMA 4MUQA 4BDBA 1AQ1A 3R8PA 1BMKA 4X6RA 5CSHA 2PVMA 2Z8CA 4YLKA 2VU3A 1PMUA 2GS7A 5L2QA 5CF5A 5IH4A 4QT1A 5HTIA 1STCE 2UZBA 4H3PA 5LCKA 1Z57A 3V01A 5L2IA 3CIKA 3AT4A 3RHXA 3V5WA 1PW2A 3V5PA 2W4JA 4DEAA 1OIUA 3EZVA 4G9RA 3S95A 1JSUA 5D1JA 4DC2A 4EJNA 3R9OA 1PYXA 4KRDA 3BIZA 3B8QA 2JIIA 3RAWA 3GU5A 1ZY4A 5DT0A 5J1WA 3ANRA 1H1SA 4G6OA 4FV2A 4C2WA 2JITA 2GNLA 4P5QA 3W32A 3D9VA 3I5NA 4AXCA 3NDMA 2J7TA 4K2RA 3TV7A 1ZOHA 2QOCA 4DTKA 3ML1A 5DT4A 5CF8A 4RC3A 3WF7A 4YMJA 4A07A 4JIKA 5FTQA 5ANKA 4ZLZA 3RWPA 4E1ZA 4E6QA 3QYWA 4IDTA 4UWCA 3BWFA 2R3LA 1UV5A 3NIZA 3ATTA 3DKFA 4I21A 4AUAA 4D2PA 4W8EA 4F7LA 4UN0C 4AZSA 3DB6A 3QZHA 3NFFB 4UBAA 2BZJA 3FY0A 3N9XA 4CFWA 4DFNA 2XS0A 1XH7A 3GU7A 4EH8A 4FNYA 4RRVA 5C03A 4NK9A 4NM0A 4JBVA 2B55A 2CLXA 1JLUE 2HWOA 3OUKA 4KBCA 3RALA 1LUFA 1XMLA 2XALA 4ZXTA 2XMYA 3FC2A 2WTDA 1VZOA 4WUNA 3AKLA 4FEXA 1NVQA 3U54A 5LVNA 4JRVA 3A7IA 4FTNA 5E90A 3OCGA 4PPBA 4EK4A 5BMMA 2VTNA 3SDJA 2VTJA 4Z3VA 3TUCA 1ZZ2A 4O1PA 3BEGA 5KMNA 3MV5A 4FSYA 1H07A 1Y6AA 4FNZA 4I24A 4O4CA 4O38A 4QP3A 2J90A 5J87A 3VULA 1H26A 2IG7A 2W5HA 3GUBA 1IAJA 4K9YA 1W2CA 4JL9A 3COMA 1KV2A 4FGBA 5CS6A 3ZEWA 5AV2A 4ZSAA 3BE9A 4A9TA 3ZOSA 3MVLA 5EK7A 4PDOA 3ORMA 3EHAA 5ANEA 3LFBA 4HZRA 2G15A 3DK6A 3AC3A 1KOBA 4N4SA 4NSTA 3R7UA 5I3OA 3W0NA 3FY2A 4U9AA 4GG5A 4PX6A 4IM2A 4PMMA 1H27A 2VRXA 5DBXA 5B7VA 4O4DA 5I9WA 4USDA 3R0TA 5M57A 2J0MB 4J52A 3DBFA 3KU2A 1W2FA 3QX4A 4Y83A 4AE6A 4AQCA 3CSVA 1PYEA 4IXPA 3CLYA 4EOJA 3E3BX 4EC9A 4C34A 1A48A 4ZZOA 1P14A 3LCTA 3CY2A 1HCLA 3UG1A 4DCEA 2PU8A 3QUEA 2HXLA 4EOMA 3DGKA 4DH7A 2QONA 4FTUA 4HGSA 4IX5A 4RX8A 2JKOA 3Q32A 3SOAA 3O8TA 3VJNA 5BYYA 4CT2A 4PPAA 4O96A 3NUUA 4EH7A 4HVDA 4GJ2A 4JX3A 4QP4A 3KULA 1ND4A 1JKLA 4HPTE 1OGUA 2VWBA 3V5QA 4ASDA 2PK9A 3EN4A 5J1VA 2ZB0A 2YWVA 2A27A 3Q52A 3R7OA 1NXKA 2E9UA 2IZSA 2UW0A 4K6ZA 3ZZWA 4O2ZA 3BL9A 3PDTA 3KXMA 4MNFA 4U0IA 2FSTX 5BVOA 3KK9A 4RIXB 3FSFA 3MPTA 4B8LA 1Q99A 2UZNA 1K2PA 5GJDA 4E4XA 5HX8A 5KBRA 4FSRA 5ANJA 4G3GA 3LCOA 5AR2A 3VUTA 2WOTA 3PIZA 4FKQA 3P1AA 3BHHA 5JFXA 4EK3A 4KKGA 3F3ZA 3MH2A 4ZMFA 1OL7A 3E8DA 3EN9A 4MXZA 3S2PA 4BHZA 4ANBA 3KULB 3TDWA 2R0UA 4E4MA 4W9XA 4O6LA 4U7ZA 4WHZA 2XK4A 3ET7A 2F2UA 4ENYA 1Y8GA 3OFMA 4GIIA 4BI2A 2WQMA 3GU6A 4AW2A 5A54A 4WG4A 2XK7A 4IHPA 5K4IA 2W9FB 1VEBA 3D0EA 3AC8A 4QYEA 4DBNA 4R5SA 5ANIA 5D9HA 5TO8A 5IQEA 4BGGA 3KXZA 4NL0A 2Z2WA 4YJOA 3BHUA 3MJ1A 4I5PA 3QZGA 4WD5A 5HHWA 4FKGA 3KN5A 4RPVA 5ANOA 3PP1A 2VV9A 1TVOA 2X0QA 4B6LA 3UOHA 3RPOA 3AD5A 3V6RA 4USEA 4PTCA 1G8SA 2CLQA 5A46A 4Z16A 4L8MA 3WZDA 2XIRA 4UZHA 4XLVA 4ZJVA 3HMMA 2VUWA 2CSNA 5IA2A 1SVEA 3LKMA 3LCSA 3FLQA 1F0QA 3EFKA 2F4JA 3PIYA 4QP9A 3LMIA 3CKXA 4K8AA 5GZAA 4WSQA 1CKJA 2VTQA 4J95A 3L1SA 5I9VA 2XIXA 3W2SA 5M09A 2W1FA 3F9NA 4Y95A 2C0TA 1R0EA 3QHRA 3B2TA 3G2FA 2F57A 1V1KA 4EL9A 5CNNA 4IB0A 2PMLX 4HOKA 2IW9A 5DE2A 1OB3A 2OIBA 1VLRA 3LQ5A 5J9ZA 1Q8ZA 4D4SA 4B99A 2VO7A 3NNWA 4LGGA 4DEGA 1ZYDA 4H3QA 2R3OA 5AM7A 5I9UA 1A06A 2WZJA 3KL8A 2BRNA 4PL5A 5FDXA 2XEZA 3DPKA 3SXRA 1FVVA 4A9YA 3PA4A 3CTJA 4AF3A 1IA9A 1PKDA 1Q97A 3NWWA 4OTIA 2H9VA 3ORLA 4JR3A 4FI1A 4TXCA 5I9YA 5ETAA 4MCVA 1EH4A 4QO9A 4YJTA 5HBHA 4UYNA 2XM9A 3TCPA 4AA4A 4FSWA 3DBDA 5AIKA 2YISA 2CNVA 5BVWA 1B39A 4RZVA 4FKJA 3UBDA 4GT3A 4O0XA 2HCKA 4LMNA 3MFSA 3UNKA 1KE7A 4AU8A 4C4JA 1M7QA 3TG1A 5AR4A 4E4LA 3KEXA 4O7ZA 5E8TA 2OF2A 3K2LA 5HNBA 2BKKA 2QKWB 4PQNA 3SV0A 3W0RA 3PRIA 4RA5A 3PPKA 3CGOA 2BZIB 4CFVA 5CF6A 3W33A 4NFMA 3KKVA 3F2RA 3HAMA 3VW6A 1PY5A 3S00A 2G01A 4AN3A 5HG8A 5D11A 3ZONA 3EL8A 5DN3A 4KIOA 3WE4A 4AW0A 3D5XA 2OJGA 3N4VA 3R00A 2NRUA 3QZFA 4RWKA 5I4NA 3F3TA 3F88A 3ZRLA 3ALNA 3RGFA 4KIKB 4FZ6A 3PJ1A 2I7QA 3QRKA 3SG8A 3KVXA 1ZLTA 1S9IA 4F9YA 1ZOEA 1OMWA 2X9FA 3ORXA 3Q2MA 4CFFA 4JT3A 3WZJA 5CENA 2IPXA 4FEWA 3HMPA 4YLLA 4Z7HA 4E4NA 3Q6UA 4UMPA 2ZM1A 3P7CA 3R7EA 3TV6A 2X1NA 4E20A 5CVFA 2ZV8A 3QGWA 4LMUA 3UO4A 2PUIA 3CR0A 1YXSA 1TFFA 3HRFA 4JMQA 2UZOA 2UZWE 1ZYCA 3VBXA 2I0VA 1OKVA 2YCQA 2ZFYA 4L3PA 2OJFE 3PFYA 2JBPA 3L8XA 1UNLA 4HYHA 1S9JA 4I0TA 2WU6A 3PVBA 4WOVA 3W2OA 1ZWSA 4DT8A 3WZEA 2BAJA 5AP1A 4O84A 4CFNA 4BKJA 3T9IA 1M2PA 1UWJA 5FGKA 3W2CA 2H6DA 5IH5A 4YSMA 4A06A 5EKOA 2B1PA 2YN8A 5HU3A 2ZOQA 2VTPA 3R04A 3G0FA 5HLWA 3N4UA 3W16A 3TNQB 3IW6A 4TNBA 2QODA 3EL7A 3OWKA 5KE0A 3CGFA 5AV3A 3HV5A 2B9FA 2VWXA 4IJ9A 2HY81 4L43A 5CASA 4R7BA 4OTQA 3QRUA 4PUZA 3RPRA 3R9HA 1J91A 3GU8A 2IW8A 2WTWA 3E93A 2ERKA 3BRBA 4R3PA 2ITOA 3FZSA 3AD6A 2VX3A 4QPAA 5TR6A 3D83A 5EW3A 1XBCA 3ZLSA 5CEKA 1YHWA 2W05A 3IDCA 4DF3A 4TWNA 2GPHA 2UVZA 5M4CA 3ZRMA 4UXLA 4QP2A 4UX9A 1Q61A 3OW4A 4R1VA 3R8MA 3UO6A 5CEPA 2F7XE 3PWDA 2V7AA 3E8NA 3V5LA 4D5HA 5GIOE 4AN2A 5KKRC 4E8AA 3IGOA 1YOLA 1GJOA 2FO0A 4FTOA 4GVAA 4LQMA 4YTCA 5HE2A 5AA9A 3OY1A 3Q04A 4MD8E 4P90A 1KWPA 2GTNA 3P4KA 4QYFA 3UOLA 3MESA 4FTCA 3WZKA 2R2PA 3F5UA 4FODA 4BWKA 4GJ3A 3FPQA 3HRBA 3MWUA 3U4WA 3G15A 3R71A 4XNEA 5CEQA 1Y57A 3VS5A 4JDJA 2Z7RA 1R78A 2O2UA 1VYWA 2B54A 3TNHA 3WE8A 5HD4A 3QQLA 1XMMA 4KKHA 3CPCA 3L8SA 1H28A 4QMUA 5EM5A 3C5IA 4CZYB 2WTCA 2E9VA 2VNWA 1FOTA 2NRYA 3WI6A 3HA6A 3OWLA 4D55A 2EXEA 3Q4TA 3W8LA 5FXRA 3G90X 4ZTSA 4F7JA 2VTMA 4EOOA 4FIIA 4RBLA 1MRUA 4IWDA 5DPVA 3NUAA 1HOWA 1IEPA 3FI4A 3FLWA 3CTHA 4RGJA 4XV1A 2JDSA 4HGTA 4YTHA 4USFA 2F7EE 3DT1A 4AZVA 5IDPA 4F09A 1Y6BA 2PMNX 4OTPA 3FV8A 5ETCA 1FVRA 5LJJA 3GB2A 5K3YA 1YQJA 2ESMA 4I22A 2C6TA 1W83A 3F6XA 3NAYA 1XH8A 5KHXA 2IZTA 2QR8A 3LJ2A 4U81A 5HVYA 4TL0A 4RJ6A 2BIKB 2WNTA 1P4FA 3H9FA 2EVAA 3EJ1A 3GGFA 2I1MA 3ZS5A 4Z55A 2RFSA 4LGHA 2QLUA 1E9HA 3EFLA 3EH9A 3WYYA 4FV9A 2XYNA 4XV2A 2QG7A 4YSJA 4E93A 1OUYA 1PXIA 1ATPE 1PMEA 4UYAA 2Z7QA 4JS8A 3H9RA 4J97A 2ZM3A 3NW5A 4YPDA 4X2NA 1NVSA 2B53A 2ONLA 4L7SA 4BCKA 5HKMA 1IG1A 4D9UA 5HVJA 3QTZA 2WIPA 3HKOA 3IS5A 1ZMWA 3Q4UA 3O7LB 4AW1A 4RFZA 3PSCA 5HE0A 2XF0A 3PXYA 2BFYA 1GZOA 3NNUA 3UNZA 2W4KA 3HLLA 2HZ0A 3NW6A 4GK4A 4FZ7A 2WTKC 3MIYA 3UMXA 3VBYA 3BZ3A 5EM8A 1JNKA 1XH4A 4NUSA 3QXPA 3SGCA 2VTTA 5IZFA 4N57A 4DFZE 4K18A 5HE3A 2PULA 5L2SA 4O4EA 3PXQA 3FI8A 5LMAA 5M55A 5L8LA 2Q0BA 3HDMA 5AP7A 2X8IA 4CZUA 4EYJA 3UPZA 2ZV2A 3UO5A 3AKKA 4DGMA 1VJYA 4HVIA 3TNWA 4IJPA 2C4GA 2F7ZE 4BDGA 3VRZA 5AA8A 2C3JA 4D2SA 4GKIA 1SYKA 5HGIA 1WAKA 4C7TA 3QTWA 5GHVA 3GCPA 3RCDA 3KRRA 5A4EA 3Q9XA 3L8PA 5LMKC 5DMZA 5L4QA 2VD5A 4OTHA 2R7IA 3LMHA 5JZJA 3P86A 5GJGA 5FTOA 5BPYA 5E92A 5IUIA 3GFWA 2PVLA 1ZZLA 4QMWA 5E8WA 2I0YA 2C1AA 2OI4X 4L3LA 2XM8A 4HGEA 3S3IA 4DFUA 2WMBA 4IWQA 4C3FA 2PTKA 5ETIA 3UVPA 4F08A 4FTKA 1CSNA 4J53A 1CTPE 5TT7A 4G31A 3DKCA 5EHOA 4L01A 2J0JA 3UIMA 4M68A 3RVGA 3FXXA 3ZC5A 2FSMX 4M8TA 4PL3A 3HMOA 4P4CA 4YGAA 4DINA 4LYNA 1YI3A 3QKKA 4FKTA 2XBJA 1FQ1B 2VO6A 3ERKA 4V04A 4XRLA 3N4TA 3F7ZA 4J96A 3DAKA 4IW0A 4M7IA 2C3LA 2CHLA 2BRMA 3POOA 2RFEA 5AIRA 2ITWA 4FKWA 3FE3A 2ITNA 4IB1A 2VTOA 2BUJA 4QMTA 2C5YA 4JG6A 4DG3E 3MVMA 1TZDA 3A60A 4YTIA 5L8KA 4HCVA 4ACMA 4BDKA 4L42A 5HTBA 2V62A 3C9WA 4FKVA 4IFCA 3JUHA 4D1SA 1OGYA 3RAKA 4IX4A 2X2KA 3BWJA 4QMOA 4UXQA 1Q4LA 3VS4A 2C69A 1M2QA 1NY3A 2WTVA 4G3EA 3JS2A 2PUNA 2P33A 4G6LA 3T3UA 2ZMDA 2CKEA 3TACA 4QMYA 3ZLXA 4NH1A 5H8EA 5A4QA 4O7TA 3AT3A 3L9NA 4N6ZA 4O1OA 4OTRA 3ZDUA 3O96A 1BL6A 2WELA 4TYIA 4BZNA 2QR7A 3BYVA 2HOGA 5IMEA 5C26A 2R64A 4YU2A 3MPMA 2GFSA 5LVOA 1IR3A 3ZO1A 1XO2B 3BE2A 2RKUA 3ZM9A 2OK1A 4M67A 1YHVA 4GEOA 2UW6A 2V22A 3TI1A 4BGQA 1TQPA 1WCCA 3OXTA 4KINA 2JKMA 4RIYA 4TNDA 3RBWA 3DOGA 5EDPA 3MA6A 1H8FA 4OUCA 3VO3A 4N6YA 3VQHA 4EHEA 4KD1A 4F1TA 3KMMA 2J0LA 2B4SB 3AG9A 3PY0A 3TKHA 3UZPA 5A3XA 4D1XA 3UMWA 4ANLA 3R2BA 1U54B 3R9DA 3RAIA 5JFVA 5CT0A 1DM2A 2WMUA 1DS5A 3ZO4A 3OXIA 4I93A 3MY5A 4LOOA 4YJNA 4RJ4A 4FJVA 2ZDUA 2HELA 3A2CA 4IZ7A 4R6VA 4D4YA 4O7RA 3HVCA 1GIJA 4BYIA 4O0RA 4I5HA 3PLAE 3VS6A 2GQRA 3EN5A 4PL4A 3UTOA 3VBWA 2XAOA 3BV3A 2P3GX 4PNKA 3LXPA 5BMSA 3R2YA 3VJOA 3G9NA 2QKRA 4U80A 5HO8A 3RM6A 5E8XA 1FINA 4JAIA 2VWUA 1CMKE 1JAMA 3ZC6A 2QOBA 1YDRE 3QKLA 4RSSA 5C27A 4ZSLA 4CG8A 5CLPA 5DNRA 4O4FA 1TQMA 4M13A 2W1IA 2ZVAA 3RZFA 4IC8A 4IAKA 3BKBA 3K5VA 2WQEA 2XNEA 5C4LA 1KE6A 3LM5A 4D2RA 5L8JA 5AAFA 4TKSA 3RJCA 1Z9XA 4D2TA 2NO3A 3OCBA 4XS2A 4BCFA 5KMOA 4RWIA 3FSKA 2E2BA 2XRUA 4OTFA 4FVRA 4LRJA 4FSQA 2FB8A 4BCQA 4P5ZA 2YEXA 3DXQA 2CGUA 1RDQE 4FV3A 3E62A 4ARKA 3PFQA 4AA0A 4GW8A 2GQGA 2VTHA 3LCKA 4KBAA 4CFXA 1B6CB 3O8PA 3IKAA 4W4YA 1Q41A 3AOXA 4AGDA 5M51A 4C8BA 5CZHA 3V8SA 4KBKA 3OF0A 3EQHA 3C4WA 3PVUA 4R3RA 3SOCA 4X0MA 2J4ZA 3DXNA 4LV7A 3JY0A 3LFNA 4IVAA 5AWMA 4MYGA 1LP4A 2VX1A 3ZMMA 2GNJA 4R7HA 5ETFA 3GI3A 2CGXA 2WXVA 4PV0A 2GNGA 3A61A 4OT5A 1FVTA 4TYEA 3RM7A 2SRCA 2UZLA 1PKGA 4XBUA 5FP6A 5BUJA 4EUTA 4FKRA 3P23A 5D41A 4WUAA 1Y91A 2EB3A 1Q3WA 2X0GA 3U55A 1QMZA 2J6MA 5BVDA 3WIGA 3A7HA 3O50A 3RK5A 4H1JA 1M17A 3ODYX 3VUDA 5CWZA 3GXLA 3JY9A 3UIXA 3I4BA 2QLQA 3U6HA 4F7SA 1OPLA 3W0PA 4O2PA 4G17A 2X4FA 4UMUA 4H36A 4M69B 5EHLA 5F4NA 4FKSA 5AX3A 3ZBXA 4AA5A 3UDTA 5J79A 4MQ2A 4Q9SA 3NCZA 5EYDA 3HA8A 3UQGA 1YI4A 4G3DA 3MVJA 3F7WA 4RVMA 1U59A 3TEIA 2ZV9A 2B52A 5EM7A 5AUXA 4V0GB 3R8LA 1M14A 5H9BA 4PP9A 4R3CA 5FM2A 2XIYA 2PVFA 3H10A 2YLEA 4UV0A 4ZY4A 5KNJA 3F69A 3BYMA 3C0IA 5FEDA 4YP8A 3E7VA 4G2FA 4BICA 2RG5A 3QTQA 2JIVA 3LMGA 5CU3A 4HW7A 3D14A 3FQSA 4O0UA 2I0EA 1PMNA 3DZOA 3NNXA 2WD1A 4KS8A 4GMYA 4L68A 4ZP5A 4IDVA 3HUBA 4C62A 4XP2A 5C01A 1YDTE 2X39A 1K3AA 2J50A 4TWCA 3QC4A 2XKEA 4KA3A 4X6QC 4UB7A 5EFQA 5FXQA 3KCFA 2IO6A 1LEWA 5J95A 1KE8A 4JI9A 3MH0A 4BVUA