3OC1A

Conformational plasticity of p38 map kinase dfg motif mutants in response to inhibitor binding
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
348
structure length
330
Chain Sequence
RPTFYRQELNKTIWEVPERYQNLSPVGGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDGATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Conformational plasticity of p38 MAP kinase DFG motif mutants in response to inhibitor binding
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 101
structure length 330
sequence length 348
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3oc1A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3oc1A01
5EK7A 1ZYLA 4RX9A 1J1BA 4YUQA 2PSQA 3DPKA 3U6JA 1YOLA 3QQHA 4FL1A 2R5TA 4MAOA 3B2WA 5JT2A 4C2WA 4DGLC 4I23A 3UNZA 4QTEA 4IE9A 3D7TA 3F6XA 4FGRA 4H05A 1YXXA 4D9TA 3QTRA 3FWQA 4M67A 3E7VA 4PTEA 2J0KA 2XYUA 3OBGA 5ETIA 2F57A 3FEGA 4BICA 4YNEA 3UG1A 4QMQA 1XKKA 3QKMA 2P4IA 4BIBA 1ZOHA 4AOJA 3CXWA 4F63A 3QC4A 4CKJA 2W9FB 2UW8A 4L3LA 3O51A 4NH1A 3V5WA 5J9LA 2XNGA 4D0WA 5FDPA 4F9YA 4USDA 3EHAA 4QRCA 4LM5A 4JJRA 4CFFA 1G3NA 4KA3A 3ODYX 3MVMA 4GFMA 4DFLA 4WG4A 3RPYA 1VYWA 4EZ7A 2J0JA 2RKUA 3U51A 4BTKA 1J7IA 2OKRA 5E91A 3L9NA 4PMTA 4YSMA 1YRPA 4RIYA 4RVKA 3RPOA 5CX9A 5K0XA 4RJ5A 3CE3A 4RZWA 5C9CA 4BCGA 4PDOA 4TRLA 3FMNA 5ACKA 3EYHA 4AS0A 3DQXA 3I7CA 3MPAA 1Q8YA 3PIXA 3PJCA 4XG6A 4AZVA 5EOBA 1PYXA 2ETRA 2E9NA 2QQ7A 3OUKA 4Y73A 1H8FA 4YJVA 3LMGA 4BDEA 2W9ZB 1YHWA 4JLCA 2JKOA 3FMDA 3O71A 4IVAA 1XH6A 3HRBA 4I0RA 3TI1A 5BUEA 4TYHB 1WVYA 3QCQA 4UALA 5AP5A 4EWHA 1T45A 3OD6X 3BPRA 3P79A 5FD2A 4B8MA 5JN2A 4GIHA 2Z60A 4CFNA 2X0GA 4U8ZA 3ZRLA 4FODA 3B8QA 4W4XA 5FQDC 3I5ZA 4TW9A 4TWOA 3U9NA 1DM2A 1GZKA 5AAEA 4I4FA 4JDIA 5ETFA 3MJ2A 4GW8A 5TT7A 4HVHA 5FM2A 2NRYA 1OIYA 4D2VA 4DYMA 2JKQA 4RX5A 2HZIA 2O2UA 3NW6A 4I6BA 5EHOA 4BDKA 4E4MA 3GBZA 3LCSA 1QPJA 1Q97A 4Y5QA 3KXXA 3OY1A 3QZGA 4OTDA 1ZZ2A 2ZV8A 2BPMA 2WGJA 2VX0A 3BU5A 4MD8E 3HA8A 2PPQA 2FSMX 4GL9A 4UYAA 1H0WA 1W98A 3MESA 2A27A 2QR7A 2XRUA 3MIYA 5L8JA 4M66A 3ZDIA 2B9FA 4A4XA 4GG5A 2GFSA 4LL5A 3QD4A 4BYJA 4F08A 4E6QA 4M68A 4PMMA 4XNEA 4BR3A 4FKVA 3QGWA 3HYHA 5CXZA 2OJGA 2VO3A 1Q5KA 2VV9A 3ZLSA 4EC8A 4IXPA 1ZOEA 5CAPA 3DXNA 3PWYA 5IA1A 5L6PA 2YM3A 5C4LA 2JAVA 3L8SA 3UC4A 2QOCA 5AP4A 5HTIA 2W1DA 4BCJA 5AM7A 1Q4LA 4M69A 2LGCA 2XEYA 3WOWA 4WA9A 2PK9A 1W83A 5EQPA 5LOHA 3R22A 3CEKA 4DEIA 3W2QA 1I44A 1WMKA 3V6RA 2BIKB 2NRUA 2CKOA 2WQOA 2BFYA 2JDOA 4CTCA 2WMWA 3V8SA 4G34A 2WTDA 3QQLA 5CVGA 3TZ9A 4C4JA 5JRQA 4IAKA 4KKEA 4MXCA 1Y8YA 4OAUC 4IWOA 3H9OA 4FIGA 3MV5A 3FHIA 3ZH8A 4D2SA 5AUZA 2XIYA 5GIOE 5HD4A 3ET7A 4ALWA 2GNGA 4N4SA 2R9SA 5AA9A 1UU8A 4NFMA 5GIPE 4PTGA 2BILB 1RW8A 2ZMDA 4ZTSA 5LMKC 2BKZA 4GJ3A 2J6MA 4UXLA 4RC2A 3AC4A 4Y72A 5I9XA 2HW6A 3EQIA 5CSPA 4KRDA 5F4NA 3SXRA 2ZB1A 4GU9A 4U3YA 3HMMA 3NWWA 3I5NA 4FNYA 3TCPA 2HCKA 4DLJA 3K54A 4ZLOA 2XJ0A 3H9FA 4ZZNA 3P08A 2CNUA 4ANQA 3QGYA 5AJQA 5HG5A 4AT5A 2QOQA 4FG8A 2JIUA 3MTFA 4RC3A 3RI1A 5LMBA 4JR3A 2ITVA 4FIHA 3F3VA 2YDJA 2W06A 3LAUA 5E1SA 3KB7A 3QD2B 2W4JA 1VEBA 3R21A 4ZY4A 4YBKA 2AUHA 4DTBA 4EHGA 2XMYA 5DNRA 5B7VA 4FK6A 4D5HA 4QD6A 2YWVA 4DGGA 4DEBA 4B9DA 2JC6A 3GOPA 3QBNA 3LFAA 3ROCA 2IW8A 4GV1A 4UBAA 1LP4A 1OL2A 4QPAA 2B52A 3AMAA 3S4QA 2Y6OA 4JIAA 1H1PA 3FZOA 3RALA 3P86A 2OFUA 4G2FA 1OIRA 3ZLYA 3Q96A 2YHVA 4UXQA 5ANIA 4S32A 5AWMA 3UZTA 5A6OA 1OI9A 1M2RA 2OFVA 2QOBA 4V01A 4AF3A 2XCHA 4AGWA 4HVIA 5GJGA 1Z9XA 2RIOA 1EH4A 3MVHA 4NTSA 3D83A 5CAQA 3ZEWA 1FQ1B 2PTKA 5AR3A 4PNIA 4C4FA 4CG9A 1PKGA 2IZRA 4WSQA 2OXXA 4C02A 4FNXA 2VWVA 3UTOA 5CSXA 5E8ZA 5FUTA 1YDTE 4MXYA 3UYSA 4N6YA 5K3YA 4B99A 3DXQA 4YC3A 5KX8A 3HMIA 1TQIA 2WTKB 4G17A 1RQQA 2WPAA 3E87A 3OG7A 4FI1A 3SOCA 4FV3A 4D2RA 4FKSA 3VF8A 4KD1A 3OXTA 2G1TA 2UZTA 4ZZOA 3QRJA 2B4SB 3PUPA 5FXQA 3A8XA 2H34A 1OB3A 3MFTA 3P9JA 5HG7A 2QR8A 2PZYA 2X9FA 2RSVA 2W0JA 3E8NA 3EN7A 3Q9XA 2QOLA 4OBQA 4ALUA 4M15A 3EYGA 1MQBA 4GSBA 4W8DA 1MUOA 3FXXA 4BGQA 5AR2A 3R8PA 1Q61A 2HK5A 2ZM1A 3LM0A 2XIRA 4WSYA 4ARKA 4QP8A 3IO7A 5I9UA 3VS6A 5DA3A 4ERWA 5IF1A 3VS3A 3DT1A 3R02A 4XEYA 3WYYA 3OP5A 3OT3A 4MD9E 3R04A 4FMQA 3WZKA 3P0MA 4CNHA 3PE1A 3DA6A 3SVVA 3DLSA 4O84A 3WIGA 2EXEA 4RGJA 3NMUF 1XH4A 2OJIA 5FBOA 3WZEA 2PVYA 3QD0A 3OY3A 1JKSA 4ZEGA 5IUGA 5FWKK 3BGZA 3VNTA 1Y91A 3HV6A 2YJSA 4UV0A 4V04A 5J87A 3ETAA 5ETCA 2PUIA 2A2AA 1R78A 3UODA 4O7VA 2JEDA 4D2WA 4X2NA 3QTQA 5LMAA 1OZ1A 2YIYA 2ITUA 4BFMA 5J1VA 2XNEA 3KVXA 3F69A 1CDKA 4TKSA 4PP7A 5C8KA 4AZEA 1Q8UA 1YXTA 3GC9A 5ANKA 3R1QA 2Z7RA 3ATTA 3UNJA 2Z2WA 3Q53A 4HPUE 3IGGA 4PPAA 4O7SA 1WBSA 2X8EA 2XK6A 2XRWA 4R3RA 2BRMA 4IB3A 4PY1A 1YVJA 3P78A 4A9UA 1XQZA 3UQFA 3ZFMA 3EFWA 3POZA 4OTQA 3LJ1A 4JG7A 3PJ1A 4CTBA 4QMYA 3FLSA 2UZUE 3FQHA 5CZHA 4E6DA 2BR1A 3ZDUA 5IQEA 3ORMA 3VQUA 3NW5A 3PG1A 4RLLA 2HWOA 4IACA 4XBUA 4QQTA 4B7TA 4USEA 2CGWA 4BTJA 3ZSIA 3W16A 2YABA 3BWJA 2V55A 4A9YA 4CRLA 3OXIA 2RG5A 4JRVA 4XP2A 2KULA 3LVPA 2NNWB 2HXLA 3JVRA 5M53A 1J7UA 5JMSA 4MYGA 3WZUA 3BGPA 3PSCA 1G5SA 4RQKA 2JDTA 3AQVA 4OBPA 5HO6A 3RCDA 4MNEB 3RCJA 2PVNA 4W4VA 1DAYA 4ACGA 4YLKA 2E9PA 4FKLA 5B2LA 5CF6A 1Q8WA 3PSDA 1GZNA 4RIWA 3FLQA 4FUXA 4ZTNA 4FEQA 4AFEA 2EWAA 2UVZA 3CBLA 3HAVA 4BDIA 4FEXA 1UKIA 1Q24A 3UIUA 3SW7A 4WUAA 5DBXA 2IZTA 4FT3A 3N4TA 3VS4A 3R0TA 3ULZA 4EH6A 4KSPA 5DEWA 4RPVA 4MBJA 4CEGA 2YIWA 3EKKA 3EQBA 1MQ4A 5IPJA 1XH9A 4XCUA 4P5QA 5AP2A 4O7NA 4YJPA 2BRGA 2C6DA 5CENA 5I4NA 5H8GA 4NCTA 1PXLA 5AUTA 1BKXA 3I1AA 3AGMA 2CDZA 2UW3A 4ZY5A 5L8KA 2R3KA 3UOLA 5HNBA 2XKCA 3TN8A 2I0VA 1YHVA 4D28A 4J1RA 4YTCA 5E4HA 4AN9A 4FNZA 3DB6A 4NU1A 1JNKA 4FV6A 2X1NA 4G9CA 2VNYA 3AD4A 3ZSGA 3PJ2A 3NYVA 2PZRA 3LW0A 3OS3A 4XV1A 3RAHA 3U6HA 2B54A 4EONA 5D9HA 4F6WA 5LVLA 2PVKA 4YZCA 2R3QA 1PMVA 4O1OA 4V0GA 4TWPA 4GYIA 3IOPA 4FYNA 4IFCA 4QP2A 5FDXA 2UZOA 2WQEA 2CKQA 5BUJA 1QPCA 3G9NA 3KN5A 3IK3A 2VX1A 3FZPA 3QKKA 4PP9A 5K0KA 5IQIA 2XNMA 1L3RE 4BCIA 5AR4A 3FMEA 4FBXA 2AC5A 4FKIA 2XM9A 4OGRA 4AW5A 1YXUA 2J4ZA 2YCSA 3RM6A 1TQPA 3LOKA 3UOKA 2ZB0A 5A4CA 1OM1A 2QNJA 4J96A 4IM2A 4JDHA 5DI1A 1HCKA 4ZIMA 4BB4A 5A54A 1YW2A 3QTIA 2CNVA 5ANEA 2YIXA 2E9OA 4NW6A 4BCMA 5HX8A 3F88A 3OHTA 4L46A 3MW1A 4PWNA 4BI2A 5CS6A 1Y8GA 4AE6A 4UMRA 2WU7A 4DEAA 1UU9A 1YWNA 1KE8A 3R9OA 3TNQB 3ZRMA 5FGKA 3Q2JA 3G9LX 4X21A 2YEXA 1CKIA 2P3GX 3M2WA 3A62A 3ACJA 3JY9A 4FKQA 1IA9A 1ZMVA 4QYHA 2X7OA 4Y8DA 5GZ8A 5JH6A 5ANJA 5IQBA 3EQDA 3NSZA 2CN8A 4IB0A 3LCOA 1OL7A 4JR7A 3I0OA 4U43A 3O8TA 3MH0A 4YU2A 2J51A 4QO9A 3QTZA 3ZLXA 3FMHA 4MWIA 3IGOA 3EN5A 1FVRA 2KTYA 1YOMA 3A7FA 3PDTA 5AUWA 4CV8A 3VS0A 3BYSA 1H07A 3M1SA 4K33A 5FM3A 4EOQA 1H1SA 5CALA 1W8CA 4W9WA 2J2IB 5ACBC 3HNGA 4C57A 1R0EA 3QZIA 5CYIA 2ZM4A 4IWDA 5A14A 3H0YA 5EQEA 4FKPA 5ANGA 3UQGA 5K5XA 4NT4A 3LLAA 1A9UA 2C68A 2YCQA 4BDJA 2H6DA 3NCGA 2BUJA 3NYOA 3NUNA 2R3GA 4G3FA 2QOKA 2WMUA 4AXAA 2EVAA 1ERKA 2GNJA 1JKTA 3CPBA 2IVTA 2GHLA 3QXOA 4X2JA 4WNMA 3UP2A 3U55A 2JGZA 4ASEA 5GHVA 4F7JA 3VJNA 4F70A 3DOGA 4RJ4A 4PDSA 4C58A 4EK6A 2XA4A 3QUDA 5JZNA 1LR4A 1M7NA 3SGCA 3ZO4A 4JQ7A 5I9VA 1OBDA 3E3BX 3RKBA 1W84A 5KCVA 3UJGA 3LXPA 2JDVA 3Q4CA 5E7RA 5DMZA 2NP8A 2VTAA 3I0QA 3ANQA 4ZK5A 4EL9A 2O0UA 4GK3A 4R5SA 2XCKA 4MBIA 5I3OA 2QLUA 3IONA 3U8WA 4D0XA 3I7BA 3CGFA 4LG4A 4IH8A 2QKWB 4XP3A 3ELJA 5LXMA 1OL6A 2C1BA 3NUAA 4ANBA 2W05A 2Z8CA 4LOPA 4UWBA 3MFUA 1WBOA 2UZLA 4RFYA 2QOFA 3FLZA 3QA8A 4O7WA 1ZY5A 3LCTA 4YPDA 5FBNC 3BQRA 5BVWA 3Q5IA 4K6ZA 5AV0A 3VJOA 2PVFA 4E8AA 4G3EA 2CSNA 3PVUA 4U97A 1BMKA 2V62A 4CFWA 5JGDA 4Y46A 2X7FA 3DAKA 3D2IA 4DEGA 3SRVA 3MPTA 5IU2A 4JAIA 4HGEA 2XNPA 3CS9A 3GT8A 3D94A 2A4LA 4L8MA 5E1EA 4F1OA 5L2WA 5CU3A 3C1XA 3LLTA 3RAIA 5JGAA 2PZIA 5EKOA 5J79A 1GAGA 4A4OA 5BUIA 3HVCA 4M0YA 2YDKA 2FB8A 2WMAA 1REKA 4NM3A 4I93A 2PUNA 3VHKA 5A4TA 3HDMA 1FMKA 3QD3A 4E3CA 2XBJA 2WQBA 3TZ8A 4RFMA 4RWJA 3HGKA 4C61A 2G2IA 3QZHA 5K9IA 2WB8A 2WOTA 4EC9A 1J91A 2Q0BA 2WIHA 2QG7A 3MS9A 1ZXEA 4DN5A 2ZDTA 3HUBA 4FT5A 3TTJA 4BF2A 1JQHA 4X3FC 2C4GA 3D7ZA 3OWKA 4DGNA 2PULA 1WBWA 4UZDA 4D4RA 4EH7A 4HCVA 5H2UA 3WARA 4MQ1A 2BHHA 4BZOA 3C5IA 5L2SA 3L9LA 4DF3A 3S95A 2W5BA 4R1YA 1E1VA 3LMIA 4RX8A 3ZUVA 2EXMA 1LEWA 1NY3A 3DKFA 4L7FA 1FMOE 1U54B 2PVLA 5CU4A 4U44A 2J7TA 4IC8A 4QTDA 4CFUA 4Q9ZA 2VX3A 4NJ3A 3VUGA 4NKSA 4WRSA 5EW9A 2RFSA 4BGGA 3BWFA 3ZLWA 5M55A 4A9TA 2F2CB 4GG7A 3DZQA 3BE9A 4UY9A 2DS1A 2P33A 3VF9A 2WELA 2IJMA 5EI2A 3IW8A 5CTPA 4F6SA 2IVUA 2ITPA 2O63A 2YDIA 3P1AA 2VNWA 5HOAA 5KMJA 4L6QA 5AAFA 4R78A 5HI2A 4ZLZA 4IHPA 3UNKA 3O2MA 2F7EE 3MFSA 1JLUE 4M84A 4QPSA 1LPUA 3V6SA 3NEWA 4L44A 4NUSA 4A4LA 5HICA 3FMKA 4R7BA 4DTAA 4O91A 4BRXA 1MRYA 5IA0A 4AT3A 5EQYA 3ZRKA 4CGAA 2JDSA 2BZHB 3C7QA 2WTKC 4Q9SA 4RJ6A 3FUPA 3ORZA 2WMSA 3NCZA 4I6QA 4YNOA 5D10A 3QTXA 1H24A 3ORIA 4ZSGA 1ZYCA 2VWYA 5TE0A 4CSVA 2BZIB 2BDJA 2PVHA 2Y4IC 5M4UA 2FA2A 1VYZA 2J0IA 4O2PA 2H8HA 3G6HA 5AUYA 3BIZA 2QD9A 4D1SA 4Y85A 3PY0A 2Y7JA 3HX4A 3Q04A 4YO4A 1X8BA 2GNLA 4H39A 1RE8A 2W17A 2UVXA 4FV7A 4RFZA 3PTGA 4AE9A 3K3IA 3F3ZA 3P4KA 5HD7A 1MRVA 5KZIA 5IH4A 4AGDA 3QHWA 4ZTLA 1UNGA 2GDOA 3R1SA 3UDBA 4HVDA 5F94A 4DH5A 4FOBA 3ORXA 5ICPA 4NZWB 3QLFA 1BYGA 4MXXA 3H10A 3QF9A 1WBPA 3S00A 4PPCA 4R5YA 5E8YA 3QA0A 5CEQA 3TJCA 4DHFA 4E4NA 4DCAA 1XBAA 2W4KA 4YO6A 3UPZA 3HV7A 4W8EA 5E8VA 2CLXA 1H1RA 2FUMA 4MXOA 1H1WA 2V7AA 4XX9A 2PE0A 4QNYA 4C0TA 2IZUA 2W5HA 2P55A 3TNIA 3FAAA 3HMNA 4ITHA 1SNUA 4I5HA 4R3CA 2QOIA 4ZJVA 2VUWA 4HGLA 4EQMA 2JKMA 2WQNA 3GUBA 4EOMA 4OTIA 2CGVA 1Z5MA 4UMTA 5IA5A 5IG1A 5FG8A 4KIKA 1Y57A 5IEVA 4GUBA 4AQCA 4ENXA 4XG2A 4AWIA 2WU6A 4PF4A 5I3RA 4GH2A 4LRJA 4XV9A 5CQWA 2BRHA 2FYSA 3FE3A 5F1ZA 5GZAA 4G3CA 4EBWA 3PWDA 4FKGA 3RPVA 4MXAA 4GK4A 2XKEA 3L1SA 4FUYA 3G0FA 5M07A 1GIHA 5E8TA 5D7VA 3W18A 3OUNB 5JGBA 4FSRA 3FSFA 3UZRA 3F61A 3EQPA 4IIRA 3TXOA 4B8LA 5JK3A 5EI8A 1XH7A 2BMCA 3MA6A 2W99B 4FVRA 3E92A 2P2HA 1OITA 1ND4A 4GU6A 3GI3A 3ORLA 4ANSA 4EH9A 4MBLA 3UOJA 3GCSA 2IG7A 4UEUA 3WIKA 1ZAOA 4F1MA 2R3IA 2Y6MA 5IA2A 3LKMA 4PL4A 4BWKA 4DFYA 5AEPA 4FKRA 4O6EA 3OOGA 4F9WA 4RRVA 3DFAA 4JBOA 2R3LA 2WMVA 3TIZA 2ZOQA 4QMOA 1OL5A 2RG6A 3F82A 3O23A 5ANDA 3CP9A 4O22A 4QMZA 5HBHA 3RJCA 4ASXA 2CHLA 4IMYA 4GT5A 2B9JA 2QHNA 4NK9A 1V0BA 5M4IA 4FKJA 5FXRA 5JFXA 3VHEA 5JFWA 1XBBA 4U42A 4DBXA 4BCOA 4OT5A 4NIFB 4BCNA 5KMLA 3OROA 3COMA 3IDPA 4IC7A 3I81A 1WBNA 4MVFA 3LFQA 4FIEA 1O6LA 3L9PA 3R1YA 4OTHA 3P7BA 1BUHA 5J5TA 1V0PA 4JBQA 4RMZA 2UZBA 3M42A 2I6LA 4BDGA 1QCFA 5DR6A 4M8TA 2R3HA 4G5PA 4LV5A 2RFDA 3AC1A 2X39A 3ALNA 3BX5A 3II5A 2JBOA 5LARA 3QYWA 1SYKA 3FI2A 4ZTQA 4H3QA 4CRSA 1OECA 2Y8OA 4JX7A 1P4FA 2WMXA 3FKNA 4JXFA 4JDJA 5CI7A 2AC3A 5GZ9A 3TKIA 2XKDA 3OT8A 4AACA 2DUVA 2VRXA 3R1NA 5DT3A 4O6LA 4D4VA 5IQFA 1KV2A 4Z55A 4J98A 1ZY4A 3Q9YA 5EKNA 3U54A 4DLIA 2XIZA 5AP3A 3FBVA 2OZOA 3F7ZA 4TWCA 3CQWA 4ZMEA 4ZXTA 1OKYA 2OIBA 3WILA 3DJ7A 3IQ7A 1H1QA 5F95A 2UW0A 3E5AA 5CAVA 3D4QA 2PE1A 5CXHA 4U79A 3AOXA 3G6GA 2X81A 4APPA 2VN9A 3EKNA 2I0YA 4WOVA 5AV2A 1U4DA 3UIMA 1YI3A 3N51A 2JFMA 3K5UA 3EZVA 1G8SA 3TZ7A 3BLQA 4XRLA 3VBVA 4ZAUA 1GJOA 2C6MA 3R8UA 4G31A 3LMHA 3NUSA 4GVAA 4UZHA 4K8AA 2J5EA 4FK3A 4FZAB 2W1FA 4YZ9A 4FICA 5IUHA 3VS2A 5KKRB 2GU8A 4TT7A 3OW4A 4RJ7A 3HMPA 3OC1A 4KB8A 4JBVA 2H96A 5AUUA 4QTCA 5FEDA 3THBA 3IS5A 3B8RA 3SC1A 4WHZA 4BWPA 4EK4A 5TR6A 3AXWA 3R7VA 3OEZA 2YIQA 5M4FA 5IA3A 3KGAA 4HPTE 4MNFA 4XG8A 3WYXA 4TYHA 5D12A 1OGUA 4FE2A 3ENHA 4WNOA 4QOXA 4A9SA 3QLGA 3UYTA 4CMUA 4MCVA 3WF7A 5DH3A 4DTKA 3PJ3A 3CKWA 5B2MA 2X9EA 5DGZA 1OL1A 4I5CA 4D55A 1FINA 2OSCA 2BALA 1GZOA 5HORA 3R01A 5HE0A 3SAYA 3TIYA 2ONLA 3DDPA 4TYJA 2ZV9A 3GQLA 4YJSA 4E26A 3N4VA 3IDCA 4EHEA 3A8WA 2YWPA 4F09A 2WTVA 2H9VA 3CTQA 2BFXA 4EOOA 4EWQA 2EUFB 3NUPA 3RWPA 4NEUA 4KUJA 2GHMA 4YZBA 1OPKA 3T3UA 3QL8A 4RWIA 1YKRA 3AT4A 3VBTA 4AX8A 4FV8A 4EH3A 5AX3A 5C26A 3QTSA 5IEXA 2GPHA 4KKHA 4BDAA 3BYMA 3SD0A 1F5QA 4PMPA 3D14A 2C3LA 4W4WA 3W33A 3BHUA 3KRLA 4XYFA 3R8LA 1FOTA 4BI1A 4CFXA 2HW7A 2XK7A 2YZAA 2GTMA 3A2CA 2WFYA 2O64A 3QCYA 1IAJA 2G2HA 4FSYA 3QCXA 4IWQA 3BYOA 5GNKA 4EK8A 4FC0A 4X3FB 2WNTA 5FP5A 5IH5A 3KKVA 4K2RA 4R7IA 3VULA 4JIKA 4FSWA 4U41A 5IUIA 1VJYA 4QMXA 3IECA 3LJ0A 4IAZA 1PXKA 3EQCA 4GFGA 4OW8A 3UP7A 4MD7E 3ZTXA 4MQ2A 3KRWA 4K0YA 2YM7A 1KOAA 4I24A 3IW7A 1OMWA 1SVEA 5EW3A 5J7BA 1O6YA 3M11A 5E90A 4ZSAA 2C6LA 1NW1A 4AZSA 5DHJA 3OXZA 3KF7A 4FYOA 3PXQA 2CJMA 5DR2A 4O38A 3C0HA 4JVGA 4CMOA 3KRXA 3R6XA 3QUPA 4OTFA 3IOKA 4ZSLA 3WF8A 2Q83A 3MVJA 4IFGA 5C03A 3ODZX 4YJNA 3ZOSA 5CAOA 5J9YA 5CVHA 4O27B 2P2IA 4ITIA 5AIKA 2YLEA 3RHXA 3V51A 3DXPA 1DS5A 3GENA 4PL5A 3LXLA 3LM5A 4BCQA 4AW1A 1H08A 3AGLA 3QHRA 3W2PA 2JKKA 3CLYA 3S2PA 2CGUA 4LRKA 5CU0A 3DK6A 4HCTA 5IKWA 4IVCA 3E8CA 2VTJA 4Z7GA 3CIKA 4QMPA 4RJ3A 1OIUA 3TZMA 1GOLA 2UZNA 3FI8A 3FPMA 3SG9A 2Y4IB 3VIDA 4CG8A 2BAQA 4TN6A 4FTQA 2C6IA 4ZS4A 5LQFA 4J71A 4U3ZA 1SVHA 4RA4A 3CTHA 5H8BA 2UVYA 5CY3A 3AMYA 3BEGA 1SM2A 5CF5A 5HKMA 4PMSA 4BY9E 2BRNA 4QPMA 4S33A 3HV3A 3D5VA 4U7ZA 2VWBA 4QMNA 5E8SA 5J1WA 3U9CA 3HUCA 2G9XA 4MH7A 4O0WA 3GOKA 3LXNA 3E7OA 1SVGA 3O96A 3FZRA 3QFVA 4HZRA 2R3FA 4KAOA 2QO2A 5AV1A 1UU3A 1QPDA 1JBPE 2C1AA 4GEOA 4FTRA 4J52A 4BDDA 3LFDA 2XKFA 3MN3A 4YJQA 1TQMA 1ZLTA 2JITA 4FSNA 5D7AA 3VUKA 3KY2A 1R3CA 2BVAA 4FOCA 4IB1A 3F5XA 1PHKA 4QP4A 2Z7QA 4C3PA 4S30A 3Q60A 5M44A 4L7SA 1PXMA 3DKGA 3I79A 4M12A 5DRDA 2F7XE 1YXVA 3ZMMA 4LMUA 4HVGA 1J7LA 1BL6A 2YM8A 4HCUA 4XUFA 4EH5A 4TZRA 5D11A 5BVOA 3PRIA 2J9MA 3ALOA 3RZFA 3V01A 4FEUA 2WTJA 4F9AA 2QURA 3SOAA 4O82A 3FYKX 3ORNA 2WMRA 5HIBA 4RZVA 3R2YA 4KABA 4CQEA 5HU3A 4I41A 4FSUA 4KIQA 3V5TA 3TACA 3S1HA 1URCA 1YOJA 3FC2A 3BLHA 4LFIA 3LFBA 4Q2AA 1KWPA 4FV9A 3RMFA 3WF9A 3E63A 4IDTA 2C3IB 4UMPA 5BVFA 2B7AA 4BBFA 1REJA 4F1TA 3QU0A 3FLYA 3IKAA 2QODA 4FTUA 2QI8A 1KSWA 3PXFA 3QX4A 1IEPA 4NKAA 4O0TA 5KMIA 4Q5EA 3R8ZA 4IVBA 2XUUA 4U0IA 4A07A 4A06A 2G2FA 5G6VA 4NTTA 2OH0E 5BVEA 1UWHA 4YR8A 3P5KA 4MKCA 5BNJA 4RT7A 5KMNA 3QWJA 4JOAA 1TKIA 3GP0A 4IX4A 4WBOA 5FEEA 5H3QA 2C47A 5KBQA 4GK2A 2NPQA 3QQJA 5F20A 3R8MA 4BDCA 4CLJA 2ERZE 3D2KA 5A3XA 2B9HA 1A06A 3UC3A 4EOJA 4YJTA 2CN5A 5HEZA 4G6LA 3LQ5A 2QU5A 3QQFA 4DE4A 3HEGA 3BZ3A 2OBJA 2QONA 4I5MA 3MY1A 5HO7A 4CT1A 3UBDA 4NFNA 2UV2A 1WBVA 1WCCA 3R7UA 2XEZA 3ZHPC 4O83A 3NPCA 4RLKA 4X2KA 5J7HA 4ZP5A 2F7ZE 4KRCA 4RIXA 4WIHA 3G15A 5AV3A 3HLLA 3QCSA 3KREA 1BI7A 1M17A 2HIWA 3EQGA 3MTLA 3DK7A 4JNWA 4ZTMA 5AP7A 5LVPA 2PZPA 2VO7A 1I09A 1BL7A 4AW0A 1Q8ZA 3KMMA 3ORKA 3EL8A 5CF8A 4CZYB 2R3OA 5I9YA 4DT8A 2PU8A 4FKTA 4RVLA 2C5YA 3U4UA 4FTNA 4FSTA 5CEPA 5HLNA 4FEWA 3DJ5A 3LZBA 3EMGA 5JFSA 3PXKA 4U9AA 3BYVA 3SW4A 5J95A 2OJ9A 3KCKA 4C3RA 1W0XC 3CTJA 5LWMA 2HAKA 2XK8A 3FHRA 2VU3A 3BRBA 4ITJA 2W7XA 4LQMA 4IAIA 2UW4A 2ITQA 2ZVAA 3K5VA 2OIQA 4MEDA 4Z3VA 5CT7A 4XP0A 2WEVA 5K4IA 3ZO1A 4C35A 2JIIA 3FSKA 3D5UA 4EUUA 4K1BA 4FIFA 4FV4A 4IM3A 2YACA 4JX3A 2Y9QA 3BELA 3LFEA 2XIKA 3R2BA 2OU7A 2C5VA 5C8MA 3V8WA 3ANRA 3TT0A 5AR8A 2G01A 2ESMA 3D5WA 4IQ6A 4FZ7A 1UA2A 3PJ8A 2CPKE 4MNEA 3FQSA 4LGDA 2ETMA 3ID6C 4O81A 3DKOA 3FXWA 3PLAE 1H27A 2UW5A 2ACXA 2VO6A 3MY5A 3LQ3A 2VTSA 4BTFA 4I94A 2QO9A 3CC6A 3KN6A 4C4GA 5T6KA 4IAAA 4XLIA 2X8IA 3G0EA 4YPSA 4P5ZA 5IA4A 2PMNX 1GIIA 2CLQA 3LCDA 2O8YA 5HNGA 2HYYA 4C34A 1YWRA 4DFXE 2C6OA 2A19B 2XF0A 2JDRA 4G1WA 4R6VA 3VS1A 4O7ZA 2C5NA 3SXSA 3T9IA 4OTPA 3F5UA 4L68A 1E1XA 4IJ9A 1FGIA 3LJ2A 4O0RA 3SDJA 3NAYA 5CNNA 5M57A 1BLXA 3FI4A 4H36A 4G3DA 4X0MA 4TNBA 2R4BA 2IVVA 5EDPA 2UZDA 3RK9A 4JI9A 2HELA 2IVSA 2Q0NA 3FQEA 4LUDA 5IQCA 3F5PA 2HXQA 2HZ4A 5C1QB 2V0DA 3EQRA 5I5ZA 4FX3A 3W2RA 3HAMA 3MA3A 4QTBA 2G15A 4GKHA 1GY3A 4RQVA 3SHEA 3S0OA 1P5EA 3LHJA 4DEEA 3N4UA 5D41A 2XK4A 1FVTA 3TUCA 2YITA 2IZSA 1STCE 3V5PA 4DC2A 4DITA 3WF5A 3ZUUA 4AN3A 5HTCA 3KRRA 3W2CA 2PYWA 4FTKA 2XNNA 4LMNA 3GFWA 3A61A 3MB7A 5DFPA 4AG8A 5BQ0A 4QP9A 2F4JA 2XK9A 4L67A 2VZ6A 3GEQA 3KXHA 3A4OX 3ACKA 3KC3A 2YJRA 3OOMA 4YBJA 5HNIX 5HX6A 5KKRC 3DY7A 2O65A 3NUYA 2GQGA 3EFJA 4FZFB 4S2ZA 5EDRA 3QXPA 2WZJA 5IDPA 3UMXA 4DH3A 3O17A 1F0QA 5FEQA 4C8BA 4AA4A 3BV2A 5EW8A 4YJRA 2PMLX 5BX0A 3TKHA 4C4EA 2XYNA 3OVVA 1B38A 4IX3A 2YAAA 5FXSA 3FY2A 3Q5ZA 2FSLX 4DGOA 5IH6A 3MJ1A 3EWHA 5KUPA 3FY0A 4IZYA 2OJJA 1UVRA 2REIA 3QWKA 4EQCA 2YM6A 4FVPA 4FIIA 4K18A 2VWZA 4IAFA 3PA5A 4WT6A 2J5FA 4FNWA 3TNPC 3CGOA 3QAME 1QMZA 3ZM9A 3QQGA 4HNFA 4FTJA 2IW6A 5T3QA 3UE4A 3C4WA 3Q2MA 5LWNA 2PVJA 4CMTA 2GMXA 4JQ8A 5HBJA 1U59A 1NVRA 3GU7A 3IPHA 2X2MA 3Q4ZA 5TO8A 1XHAA 3RWQA 3UIXA 4I5PA 5CANA 1G8AA 1DI9A 1MP8A 4IZAA 3S3IA 2FH9A 2ITOA 3PLSA 4N0SA 3MY0A 4RG0A 3TEIA 1SMHA 2O3PA 3VN9A 3RHKA 1YXSA 5IMXA 4KIOA 4AGCA 3HDNA 4I1ZA 5DT0A 3SQQA 3U87A 4DG0E 1OKZA 5LMKA 3BHYA 2HZ0A 5AR5A 3ZS5A 4MTAA 4D2PA 4EH8A 4ORKA 4MWHA 2WOUA 4O21A 4XV3A 1AQ1A 3RGFA 3W2OA 4CQGA 3VVHA 2XP2A 3C51A 2BDWA 3KF4A 4IEBA 3DB8A 5EM5A 1W82A 4XG4A 3DDQA 5HE3A 4DA5A 2OWBA 3ATSA 1KOBA 2VWIA 2VAGA 5EDQA 4QQ5A 3TTIA 3TKUA 4E6CA 4NSTA 5M51A 2JAMA 4FR4A 3JVSA 4F65A 2R3PA 2PVMA 5AP1A 4QQJA 4XS2A 2XB7A 5CNOA 4QQCA 4P4CA 4I0TA 4FTAA 2ZYBA 3PY1A 1YDRE 2RF9A 4B0GA 3FKLA 5H9BA 5KBRA 1SNXA 4CZTA 4BVUA 3FLNC 4U5JA 5IQGA 3MDYA 3QKLA 2PY3A 5A4EA 2J0MB 2YISA 1ZYDA 3GGFA 5HU9A 3TUDA 3KMUA 3PIYA 3HRCA 3NR9A 1P2AA 5BVDA 1YHSA 4ZLYA 5L2QA 2VWXA 3AC3A 4JG8A 2YLFA 3QRTA 3DK3A 4WNKA 3FC1X 1GIJA 4GFOA 3KULB 3UVQA 2V5QA 4N6ZA 3K2LA 2UUEA 5DEYA 4ANMA 4QP3A 4FTCA 2CCIA 4RJ8A 3PZHA 4JS8A 4ZY6A 2RFNA 4PDYA 5E92A 1PMEA 4CCUA 3NX8A 4X2GA 3CY2A 1R39A 3B2TA 2QCSA 2C3JA 3DAEA 2OO8X 3EN4A 3QQUA 4JRNA 4H3PA 3UOHA 3IW5A 4FA2A 1UU7A 2ITNA 4UWYA 4WRGA 2OLCA 4OR5A 3ZBFA 4BBEA 4E5AX 4BHZA 5LVMA 3GVUA 1Y6AA 3D7TB 1NVQA 3D0EA 4GYGA 5CEOA 2OZAA 3BKBA 4BZNA 4YP8A 2CNQA 1JOWB 4PL3A 3O7LB 4CVAA 5TF9A 3MH3A 4NM0A 5KMKA 2PHKA 2GQSA 3F3WA 5I0BA 3V5LA 2EXCX 4GCJA 4RX7A 3L9MA 4RWLA 4AFJA 4BDHA 4O86A 3KFAA 3VQHA 5AR7A 4BCKA 3I60A 3VUDA 3ZC5A 2YIRA 4BCHA 4BCPA 5HZNA 5I9ZA 2ZM3A 4IW0A 4O0SA 1M2QA 4MHAA 2VGPA 4RIYB 5L6OA 1BI8A 3DLZA 5CWZA 4FV1A 4LGGA 3E8EA 1U54A 3NNWA 4KBKA 4NM5A 3PRFA 3F3TA 3VS5A 3Q9ZA 3QRIA 3Q6WA 3R28A 5DOSA 4CZUA 1LEZA 1PF8A 5JZJA 4D2TA 4X2FA 2C6EA 4PV0A 4AT4A 4TYEA 3E64A 4EZ5A 2W1ZA 4ZSEA 4AOTA 3TL8A 3LPBA 2FSTX 5HG9A 3FXZA 2GCDA 3UVPA 4BC6A 4YGAA 5A9UA 2IW9A 1CKJA 2GS2A 4WBBB 1JKLA 1OPLA 4OAVB 5EI6A 4Y95A 1UKHA 1ZMWA 2R7IA 5A4LA 1Y6BA 5JEBA 3Q3BA 4M7IA 4CV9A 4QP6A 4S34A 4EH4A 2YCRA 2FO0A 4CKRA 2X2KA 3CSVA 4NCTC 3C5UA 4Y83A 2BZKB 1H25A 3BCEA 4U45A 3RTPA 4UX9A 4BKYA 4ANOA 4O2ZA 4IADA 5BMMA 5LVNA 3FMJA 3H4JA 3IG7A 3PY3A 4UWCA 3RAWA 3DAJA 3IDBA 2YZLA 1PW2A 2C30A 3ITZA 3LXKA 3ZSHA 3COIA 4FG9A 4YC8A 3VWAA 3G33A 2C5OA 3JS2A 3R73A 4RVMA 3UZPA 4AN2A 2X4ZA 4L00A 5CSVA 1K2PA 3CQUA 2VWWA 3DU8A 2ITYA 3EFLA 3PXYA 2X8DA 3R8VA 3ZUTA 5IDNA 3MYGA 1FBNA 3D9VA 3HRFA 5CU6A 1KE9A 5AUVA 4B6LA 4ACDA 2QOHA 5M09A 3IW4A 3MWUA 1PXPA 4FV5A 4DGMA 3W8QA 1ZZLA 4NWMA 5HHWA 3G51A 2F2UA 5HVYA 1NVSA 3FKOA 5HE2A 4BIEA 4EKKA 4UMUA 2F49A 4I92A 4EJ7A 2QVSE 2A1AB 1ZYJA 5DR9A 4C2VA 4CFMA 2CKPA 2CMWA 3Q32A 5DN3A 2PMIA 1WFCA 1IRKA 3GU6A 3R7GA 3RK7A 5JSMA 1LUFA 5AIRA 3A7IA 4E4XA 4N70A 1YQJA 4RSSA 4C59A 3PG3A 2RGPA 4M69B 1TVOA 4DFBA 4B4LA 4F6UA 3OFMA 3RK5A 3OF0A 3EN6A 3RM7A 4EOPA 2B9IA 4D1ZA 4KBCA 3RVGA 5FTGA 2RL5A 1CM8A 4LOQA 2EU9A 2R2PA 2BZJA 5ANOA 5LCKA 3VRZA 2UW9A 4ANLA 5AM6A 3OTUA 2GQRA 4OTWA 2V22A 2WXVA 4MK0A 5CVFA 2PUPA 5IZFA 3C4ZA 4A9RA 3AC8A 4P90A 2BKKA 4XG3A 4ASZA 4AUAA 3RAKA 4GUEA 5HCZA 3AD6A 4GJ2A 4BN1A 3R30A 4QT1A 3R9NA 4F7SA 4O7YA 5GINE 1B6CB 3DNDA 4NJDA 1KE6A 2B1PA 3KL8A 5C4KA 3EOCA 4F99A 4PNKA 3N9XA 2HOGA 4FZDB 3TUBA 3DZOA 3HKOA 4C37A 3A99A 4FV0A 4DH7A 2JIVA 3KQ7A 5IQDA 4M0ZA 4NM7A 3MB6A 4R7HA 2GNIA 4BL1A 2YM5A 3OTVA 4H58A 3CD8A 3SLSA 4I4EA 5B2KA 2F9GA 4F4PA 4F0GA 5G1XA 4L42A 2OICA 2WO6A 4YHFA 2XJ1A 2QG5A 2X2LA 4M3QA 1IR3A 2GHGA 5AP6A 4D9UA 5ITAA 5BVNA 4ACHA 4O0XA 1WZYA 4ENYA 1R0PA 3CJGA 4EOSA 4TXCA 4J53A 4HYIA 2QC6A 1JWHA 3CKXA 3JUHA 2PUUA 4NIFA 4YLLA 3TG1A 3GCUA 3QC9A 4F9BA 3DS6A 4YMJA 2VTTA 3DBFA 4IVDA 3LQ8A 4XLVA 1XBCA 5CEIA 3RPRA 1PRYA 3FI3A 1PXJA 2IWIA 2JD5A 5CU2A 5KNJA 2ERKA 4QMSA 4RA5A 3UGCA 2XM8A 5IISA 3C4XA 1MRUA 3VC4A 4BKJA 4I21A 2OF2A 2R3RA 3RZBA 4DH8A 5L2TA 5IEYA 4I3ZA 1JPAA 1M52A 4L45A 1FGKA 4E73A 4EZ3A 3DQWA 3VW8A 3QYZA 2ZAZA 3ERKA 4MXZA 5EH0A 4CYIA 4XOZA 4IAYA 4YJOA 2LAVA 4UB7A 3EH9A 1A48A 4ONAA 3C13A 4ERKA 2WEIA 3CQEA 1Q62A 3QZFA 3E8DA 3NRMA 3NYXA 4L01A 2EB2A 3OBJA 2ITZA 3QALE 3BQCA 3R9HA 2FGIA 2YM4A 4APCA 4C62A 4EQUA 3C9WA 4I0SA 3KVWA 2QLQA 3U6IA 1XH8A 3DGKA 1Q3WA 4U81A 5DT4A 2GFCA 4CKIA 4N57A 3GQIA 3ZFXA 4XH6A 1O9UA 1CSNA 4AW2A 2I40A 2R0UA 3NYNA 3EB0A 1U46A 2Y4PA 4YHJA 4OLIA 2X7GA 4PRJA 3JR1A 4FT7A 1H4LA 4RVTA 1CMKE 5HO8A 4X3JA 3HZTA 2X6DA 2PMOX 3KEXA 3H9RA 4AOIA 5M56A 3KK9A 2E9VA 4AZFA 2VTRA 4USFA 2B55A 2ITTA 4O0UA 3ZO3A 5LJJA 4F0IA 3PSBA 2QOOA 1JAMA 4LYNA 4JQEA 1JKKA 2VWUA 3BV3A 2J0LA 1O6KA 3TDVA 3NIZA 2E2BA 3DBQA 5FP6A 5AX9A 3CD3A 4IJPA 1H26A 1KV1A 3WZDA 2B0QA 4FL2A 3W10A 3DBDA 4LOOA 4NL0A 4MF0A 4E1ZA 3SA0A 2HY0A 1PXNA 2VTMA 4QMTA 3ENMA 2GS7A 4AGUA 3ZEPA 3R9RA 4M14A 2OJFE 2ETKA 3QTUA 4M13A 3AT3A 4HYSA 3BBWA 2XBAA 4JL9A 4KKGA 4KNBA 3KXZA 3KMWA 3OCSA 2ITWA 5L4QA 3FL4A 2OIDA 4PQNA 5B0XA 5KMMA 3JYAA 1H28A 4L3PA 3KCFA 4YLJA 5AAGA 3SKCA 2PE2A 3G5DA 3PVGA 1WBTA 4H1JA 4FL3A 3AG9A 3ROYA 1PYEA 1K3AA 5E8UA 2BAJA 3FMMA 3DJ6A 4HNIA 5HESA 4ASDA 4F0FA 4GT3A 4F64A 2YA9A 3UO5A 5A46A 3PFQA 4YC6A 3TV6A 4LUEA 3CY3A 3Q4UA 3T3VA 3E88A 5TKDA 4QTAA 4G3GA 4XHKB 5AFVA 2YCFA 4GS6A 4P7EA 2BTSA 5DWRA 1XR1A 5EHLA 3ZZEA 2HY81 3TDWA 3RNYA 2OH4A 3UVRA 3T8OA 1GZ8A 3BHHA 5EM8A 4LI5A 4KWPA 3PP0A 4ZJIA 1YI6A 5E8XA 4X6QC 2OXYA 4J97A 4I6FA 3A7HA 2QO7A 2JFLA 4EHZA 5KO1A 4E5WA 5C01A 2OG8A 4OTGA 4EI4A 3C4FA 4XG9A 5DG5A 4Q5HA 5JQ5A 3DBCA 4K11A 5CEMA 3KU2A 3BHVA 4IWPA 1K9AA 3L8XA 4FKOA 1IG1A 3P7CA 1DI8A 4XOYA 3HP5A 3PP1A 4QP7A 2R0IA 2GTNA 4X3FA 1OBGA 5FTOA 4FT0A 1J3HA 1UNLA 3EQHA 4TNDA 4FTOA 4TPTA 4W9XA 1XJDA 3OCTA 2R3NA 2JBPA 1URWA 4C3FA 4ID7A 2PVRA 3R00A 4EKLA 5A6NA 1R1WA 3NGAA 3Q4TA 3GU8A 1FPUA 2HZNA 2XH5A 3ZFYA 4FTMA 4R1VA 4AZWA 3AC5A 3FZTA 3NUUA 4ACMA 4NYEA 1JSTA 1B39A 2R3MA 2W1EA 3EIDA 2DWBA 4G9RA 3KXNA 2GNHA 2VO0A 4RIWB 3PVBA 5AMNA 4CT2A 1M2PA 5H8EA 2W1GA 5C8NA 3EL7A 3CCNA 2C0OA 3NS9A 3EFKA 3ZC6A 4ZZMA 3W8LA 3OMVA 1PY5A 4EBVA 3NUXA 3R7OA 1OKVA 3H30A 4FKUA 4I6HA 4ZJJA 4BKZA 4IDVA 1S9JA 1WVWA 3FV8A 4J8MA 3PYYA 4R8QA 3UO4A 4ALVA 4HVSA 5DYJA 1W7HA 4CYJA 1M14A 3AD5A 2WMTA 2XNBA 2W5AA 1PXOA 4P2KA 3R83A 4JAJA 3WF6A 1XO2B 4DEHA 4RIXB 3AMBA 3PE2A 2NO3A 2VGOA 1OIQA 3LIJA 2GSFA 3NDMA 2OXDA 1DAWA 3H0ZA 4GVJA 3CPCA 3UMWA 3BE2A 4QMUA 4E7WA 4EOIA 4Z7HA 5M08A 3E3PA 3F5GA 4C4HA 3GFEA 4IM0A 4BIDA 4EK5A 2X4FA 4HGSA 3HECA 1V1KA 3DFCB 3KK8A 3UG2A 3MIAA 4GRBA 4PX6A 2GS6A 2V7OA 5J9ZA 3LE6A 5DPVA 4IB5A 5F9EA 4EYMA 5M4CA 1IA8A 1WAKA 4D4YA 3G2FA 3OCGA 4Z16A 4CLIA 5CF4A 4F9CA 3O0GA 4V0GB 2XNOA 5HG8A 4BDFA 5HCXA 1NA7A 2W1IA 5BPYA 4EORA 4FF8A 3BEAA 4L3JA 1E9HA 2E9UA 4TYGA 5JRSA 4EUTA 2Z7SA 2XK3A 3QX2A 4YZDA 5DIAA 4WUNA 3GXLA 4KINA 4MX9A 4DCEA 1PMUA 1CTPE 1PXIA 5AV4A 5EYDA 4HW7A 4YZMA 4Y5HA 1ATPE 4DG3E 3AT2A 1L8TA 5L2IA 4WO5A 4O7TA 2WHBA 3DV3A 4KS7A 4ZS0A 4L53A 2FVDA 3LFFA 5T68A 3RBWA 4FIJA 5BYYA 4U80A 4QMMA 1T46A 4JDKA 3WE4A 4C38A 5GJFA 4FKWA 1OKWA 3GCVA 2GNFA 3OEFX 3PPJA 4R3PA 4D4SA 4XJ0A 5HE1A 3VAPA 1OUKA 4C33A 5K5NA 3FJQE 4I22A 4F7LA 1IAHA 2PWLA 3RP9A 3F3UA 3TJDA 3OWJA 1ZARA 5EM7A 3KRJA 3L8VA 2XIXA 3GU4A 2BIYA 3ORPA 5CQUA 2IO6A 3TWJA 3U4WA 5M06A 2BCJA 4CD0A 1VZOA 5A4QA 4EJNA 4TWNA 3VUIA 2QHMA 4ZMFA 3BBTB 2XVDA 1YI4A 5HGIA 4DG2E 2W4OA 2BRBA 2Y0AA 3EN9A 5DLSA 5E8WA 3TV4A 1F3MC 4XV2A 4BWXA 4J7BA 5K4JA 3BGQA 3FZ1A 3JPVA 3FMLA 3VUHA 5BYLA 2C69A 3R7IA 1Z57A 2ZV7A 4OT6A 5GJDA 2AYPA 3HP2A 5L6WL 1Q3DA 4X7QA 1VR2A 4RC4A 4ZSJA 1NT2A 3R7YA 1UV5A 3NAXA 4EYJA 4L52A 1AD5A 3VBWA 1V0OA 2P0CA 2WTCA 4FSMA 1JVPP 2VTIA 3P7AA 5C27A 3V5QA 1OVEA 4TY1A 2UW6A 3ULIA 3NVMB 3FDNA 5DRBA 3NZ0A 5CSWA 1JSVA 2W1CA 1M7QA 5CEKA 4XRJA 4M97A 2HWPA 3DKCA 3FZSA 5CT0A 3GCQA 1NXKA 3E62A 5IQHA 2VD5A 4LL0A 4NW5A 5LVOA 3ZCLA 4J8NA 3W32A 4II5A 3ZZWA 1PJKA 3GB2A 4W4YA 3VS7A 2YN8A 2CCHA 1KE7A 4YHTA 4JT3A 3NW7A 3PXZA 3WE8A 3MVLA 5TOZA 3VUTA 3V5JA 3R71A 3BYUA 1QPEA 2W1HA 3K3JA 4QP1A 4IBMA 4QMLA 5HBEA 5J8IA 4BCFA 3QRKA 3ZM4A 4UYNA 1RDQE 3F7WA 2VTHA 3VRYA 2WTIA 3VO3A 2WMBA 2C6KA 5BVKA 1IASA 1APME 1JSUA 2OF4A 3O7LD 3ZBXA 5JQ8A 4D5KA 3DNEA 1U5RA 4QMWA 3AC2A 4KBAA 3WI6A 3F9NA 5KHWA 4FT9A 5EYCA 2IPXA 4RBLA 4DFNA 3EQFA 3A60A 2ONLC 4PPBA 3C0IA 3SRVB 3VBXA 4X6RA 3ZXTA 3QTWA 4RWKA 3NNUA 4YTFA 3BLRA 1YDSE 2C0IA 2QU6A 2WAJA 3A4PA 4HYUA 4OTRA 4XBRA 3VW6A 5EM6A 1HCLA 4DAWA 3JXWA 2ZMCA 3H3CA 1YWVA 3PA4A 2C3KA 5KMOA 4O1PA 4YTHA 5BYZA 3F2NA 4G6NA 1OPJA 4J99A 2R64A 3CJFA 5CSHA 3OCBA 4E93A 1H0VA 3VBQA 4CXAA 3DBEA 4EH2A 1UWJA 4EK3A 5AA8A 5AADA 5EHYA 3NNXA 3HL7A 4F7NA 5HIEA 3UO6A 5IMEA 5JKGA 1H01A 3REPA 3PXRA 4DFUA 4R77A 3FLWA 4BYIA 4DBNA 4U40A 2EB3A 3GCPA 3LCKA 4WG3A 5FTQA 3Q9WA 4K77A 2YAKA 3FYJX 4O96A 3BU3A 1BX6A 1ZOGA 4H3BA 3PZEA 4CFVA 2VTLA 4HOKA 2BTRA 3MGYA 3L8PA 3NVKI 2ZDUA 3W1FA 1Q99A 5KE0A 5IQAA 3ZXZA 2BDFA 2VTQA 5BMSA 2IN6A 5EOLA 2HENA 3MH1A 3O50A 4GT4A 4RIOA 4AZTA 2J50A 3VBYA 3F2AA 3HMOA 1QL6A 4WD5A 4E5BA 1SZMA 3COKA 3BHTA 3HA6A 3O8UA 4FSZA 2OI4X 2UZEA 3T9TA 4DT9A 4FGBA 1ZYSA 1ZMUA 2BROA 3O8PA 2ITXA 4QNAA 4L43A 4TYIA 5JFVA 4IX6A 5HVJA 2OK1A 2PL0A 3QRUA 3QUEA 4AAAA 5HTBA 2R3JA 3COHA 3POOA 3R7EA 3SXFA 4J95A 2CKEA 3I6UA 4DFZE 3IW6A 3D5XA 3OWLA 2VTOA 2X6EA 4EOLA 3RPSA 4FEVA 2I0EA 4FG7A 1PKDA 5AP0A 3D15A 3LFCA 5HLWA 4BGHA 4A7CA 3CR0A 2UW7A 4BDBA 5EYKA 5KZ0A 4S31A 4CCBA 4WNPA 4AA5A 4XG7A 3KXMA 4FSQA 4KSQA 4WG5A 3V04A 2FSOX 5L3AA 2OZAB 3A7GA 3R63A 3FPQA 3W2SA 1WVXA 3NIEA 3BI6A 3Q6UA 5DE2A 4K9YA 1PMNA 3MH2A 3C4EA 4YTIA 1Q8TA 4XMOA 5KHXA 4EHVA 3DTWA 2ZV2A 1KE5A 4FV2A 3SX9A 3MBLA 5FRIA 3RINA 4QYEA 1Q41A 4DINA 4IANA 2QKRA 5DVRA 1CKPA 3V3VA 5EFQA 4PTCA 4LGHA 3BU6A 3DTCA 4ANNA 5J5SA 3LFNA 4V05A 5D1JA 2YERA 3P23A 4G6OA 4ZTRA 5LCJA 2O5KA 1ZWSA 5HQ0A 4DEDA 3OWPA 1FVVA 3PA3A 3W55A 4E4LA 5CASA 4Z9LA 4FTIA 4E6AA 3KXGA 3C50A 2PZ5A 3V8TA 4YURA 3SV0A 4ACCA 2XS0A 2J90A 4TTHB 5I9WA 3C0GA 1P4OA 4YZNA 3MI9A 4E20A 3UQCA 2I0HA 4QYGA 2WD1A 2Z02A 3PIZA 3F2RA 5AUXA 1ZRZA 1AGWA 5CLPA 3JY0A 3PPZA 4KIKB 5HLPA 4C36A 3NLBA 4ZTHA 3UIBA 3OW3A 3ZU7A 2RFEA 4BTMA 5HCYA 4C4IA 3PPKA 4EEVA 5EG3A 4KIPA 4ZOGA 2C5XA 2SRCA 2VTPA 4UN0C 5HVKA 1OUYA 3LFSA 3NNVA 4IZ5A 3GU5A 4FVQA 3UPXA 4L9IA 3TV7A 1XH5A 2I1MA 3MSSA 1XWSA 2Z7LA 3FL5A 4G16A 3DCVA 2WIPA 2DYLA 4GIIA 2XZSA 5CZIA 5HIDA 3WZJA 4BBMA 3GC0A 4FZ6A 4FTLA 4PUZA 4WKQA 4GKIA 4HZSA 3QQKA 3SG8A 2WQMA 2UZVA 4G5JA 2B53A 4LV8A 4QMVA 3TNWA 3RNIA 5CI6A 1HOWA 1UNHA 2C6TA 4BHNA 2WTWA 4LRMA 2CGXA 4YSJA 2OW3A 4UMQA 3ZONA 2WKMA 4AU8A 1S9IA 2DQ7X 3MPMA 3EZRA 2YFXA 4C7TA 3EJ1A 3TM0A 3GC7A 2WMQA 3KA0A 3ZYAA 1P14A 3A7JA 4U6RA 4KS8A 4YJUA 3ZO2A 4H1MA 1KUTA 2W96B 2R7BA 2BHEA 4OUCA 3WBLA 4QYYA 2UZWE 3G90X 4D1XA 4JG6A 3GC8A 3GNIB 4IZ7A 4HYHA 4IX5A 3TNHA 2XJ2A 4O7RA 5FLFA 1U5QA 4HJOA 4JBPA 3PVWA 2ZJWA 1GNGA 5EYMA 3E93A 4MF1A 4O0VA 3I4BA 5CAUA 3MFRA 2I7QA 4FTTA 3HV5A 1RJBA 3OZ6A 3C4CA 5E9EA 4HGTA 3ORTA 4I20A 4EOKA 2C0TA 3KULA 4TL0A 4OBOA 5L8LA 4O7LA 4QYFA 4AP7A 4GMYA 2BAKA 1H00A 3HV4A 3VUMA 2VTNA 1J1CA 2OGVA 3I6WA 4DH1A 3F66A 2A0CX 4O0YA 5ETAA 3Q52A 4AA0A 3R9DA 4PDPA 4BZDA 4D58A 4BI0A 2JLDA
chains in the Genus database with same CATH superfamily
5EK7A 1ZYLA 4RX9A 1J1BA 4YUQA 2PSQA 3DPKA 3U6JA 1YOLA 3QQHA 4FL1A 2R5TA 4MAOA 3B2WA 5JT2A 4C2WA 4DGLC 4I23A 3UNZA 4QTEA 4IE9A 3D7TA 3F6XA 4FGRA 4H05A 1YXXA 4D9TA 3QTRA 3FWQA 4M67A 3E7VA 4PTEA 2J0KA 2XYUA 3OBGA 5ETIA 2F57A 3FEGA 4BICA 4YNEA 3UG1A 4QMQA 1XKKA 3QKMA 2P4IA 4BIBA 1ZOHA 4AOJA 3CXWA 4F63A 3QC4A 4CKJA 2W9FB 2UW8A 4L3LA 3O51A 4NH1A 3V5WA 5J9LA 2XNGA 4D0WA 5FDPA 3UDTA 4F9YA 4USDA 3EHAA 4QRCA 4LM5A 4JJRA 4CFFA 1G3NA 4KA3A 3ODYX 3MVMA 4GFMA 4DFLA 4WG4A 3RPYA 1VYWA 4EZ7A 2J0JA 2RKUA 3U51A 4BTKA 1J7IA 2OKRA 5E91A 3L9NA 4PMTA 4YSMA 1YRPA 4RIYA 4RVKA 3RPOA 3UDSA 5CX9A 5K0XA 4RJ5A 3CE3A 4RZWA 5C9CA 4BCGA 4PDOA 4TRLA 3FMNA 5ACKA 3BL7A 3EYHA 4AS0A 3DQXA 3I7CA 3MPAA 4LDTA 4DDIA 1Q8YA 3PIXA 3PJCA 4XG6A 4AZVA 5EOBA 1PYXA 2ETRA 2E9NA 2QQ7A 3OUKA 4Y73A 1H8FA 4YJVA 3LMGA 4BDEA 2W9ZB 1YHWA 4JLCA 2JKOA 3FMDA 3O71A 4IVAA 1XH6A 3HRBA 4I0RA 3TI1A 5BUEA 4TYHB 1WVYA 3QCQA 4UALA 5AP5A 4EWHA 1T45A 3OD6X 3BPRA 3P79A 5FD2A 4B8MA 5JN2A 4GIHA 2Z60A 4CFNA 2X0GA 4U8ZA 3ZRLA 4FODA 3B8QA 4W4XA 5FQDC 3I5ZA 4TW9A 4TWOA 3U9NA 1DM2A 1GZKA 5AAEA 4I4FA 4JDIA 5ETFA 3MJ2A 4GW8A 5TT7A 4HVHA 5FM2A 2NRYA 1OIYA 4D2VA 4DYMA 2JKQA 4RX5A 2HZIA 2O2UA 3NW6A 4I6BA 5EHOA 4BDKA 4E4MA 3GBZA 3LCSA 1QPJA 1Q97A 4Y5QA 3KXXA 3OY1A 3QZGA 4OTDA 1ZZ2A 2ZV8A 2BPMA 2WGJA 2VX0A 3BU5A 4MD8E 3HA8A 2PPQA 2FSMX 4GL9A 4UYAA 1H0WA 1W98A 3MESA 2A27A 2QR7A 2XRUA 3MIYA 5L8JA 4M66A 3ZDIA 2B9FA 4A4XA 4GG5A 2GFSA 4LL5A 3QD4A 4BYJA 4F08A 4E6QA 4M68A 4PMMA 4XNEA 4BR3A 4FKVA 3QGWA 3HYHA 5CXZA 2XALA 2OJGA 2VO3A 1Q5KA 2VV9A 3ZLSA 4EC8A 4IXPA 1ZOEA 5CAPA 3DXNA 3PWYA 5IA1A 5L6PA 2YM3A 5C4LA 2JAVA 3L8SA 3UC4A 2QOCA 5AP4A 5HTIA 2W1DA 4BCJA 5AM7A 1Q4LA 4M69A 2LGCA 2XEYA 3WOWA 4WA9A 2PK9A 1W83A 5EQPA 5LOHA 3R22A 3CEKA 4DEIA 3W2QA 1I44A 1WMKA 3V6RA 2BIKB 2NRUA 2CKOA 2WQOA 2BFYA 2JDOA 4CTCA 2WMWA 3V8SA 4G34A 2AQXA 2WTDA 3QQLA 5CVGA 3TZ9A 4C4JA 5JRQA 4IAKA 4KKEA 4MXCA 1Y8YA 4OAUC 4IWOA 3H9OA 4FIGA 3MV5A 3FHIA 3ZH8A 4D2SA 5AUZA 2XIYA 5GIOE 5HD4A 3ET7A 4ALWA 2GNGA 4N4SA 2R9SA 5AA9A 1UU8A 4NFMA 5GIPE 4PTGA 2BILB 1RW8A 2ZMDA 4ZTSA 5LMKC 2BKZA 4GJ3A 2J6MA 4UXLA 4RC2A 3AC4A 4Y72A 5I9XA 2HW6A 3EQIA 5CSPA 4KRDA 5F4NA 3SXRA 2ZB1A 4GU9A 4U3YA 3HMMA 3NWWA 3I5NA 3AKLA 4FNYA 3TCPA 2HCKA 4DLJA 3K54A 4ZLOA 2XJ0A 3H9FA 4ZZNA 3P08A 2CNUA 4ANQA 3QGYA 5AJQA 3W0MA 5HG5A 4AT5A 2QOQA 4FG8A 2JIUA 3MTFA 4RC3A 3RI1A 5LMBA 4JR3A 2ITVA 4FIHA 3F3VA 2YDJA 2W06A 3LAUA 5E1SA 3KB7A 3QD2B 2W4JA 1VEBA 3R21A 4ZY4A 4YBKA 2AUHA 4DTBA 4EHGA 2XMYA 3O5AA 5DNRA 5B7VA 4FK6A 4D5HA 4QD6A 2YWVA 4DGGA 4DEBA 4B9DA 2JC6A 3GOPA 3QBNA 3LFAA 3ROCA 2IW8A 4GV1A 4UBAA 1LP4A 1OL2A 4QPAA 2B52A 3AMAA 3S4QA 2Y6OA 4JIAA 1H1PA 3FZOA 3RALA 3P86A 2OFUA 4G2FA 1OIRA 3ZLYA 3Q96A 2YHVA 4UXQA 5ANIA 4S32A 5AWMA 3UZTA 5A6OA 1OI9A 1M2RA 2OFVA 2QOBA 4V01A 4AF3A 2XCHA 4AGWA 4HVIA 5GJGA 1Z9XA 2RIOA 1EH4A 3MVHA 3NFGB 4NTSA 3D83A 5CAQA 3ZEWA 1FQ1B 2PTKA 5AR3A 4PNIA 4C4FA 4CG9A 1PKGA 2IZRA 4WSQA 2OXXA 4C02A 4FNXA 2VWVA 3UTOA 5CSXA 5E8ZA 5FUTA 1YDTE 4MXYA 3UYSA 4N6YA 5K3YA 4B99A 3DXQA 4YC3A 5KX8A 3HMIA 1TQIA 2WTKB 4G17A 1RQQA 2WPAA 3E87A 3OG7A 4FI1A 3SOCA 4FV3A 4D2RA 4FKSA 3VF8A 4KD1A 3OXTA 2G1TA 2UZTA 4ZZOA 3QRJA 2B4SB 3PUPA 5FXQA 3A8XA 2H34A 1OB3A 3MFTA 3P9JA 5HG7A 2QR8A 2PZYA 2X9FA 2RSVA 2W0JA 3E8NA 3EN7A 3Q9XA 2QOLA 4OBQA 4ALUA 4M15A 3EYGA 1MQBA 4GSBA 4W8DA 5BV3A 1MUOA 3FXXA 4BGQA 5AR2A 3R8PA 1Q61A 2HK5A 2ZM1A 3LM0A 2XIRA 4WSYA 4ARKA 4QP8A 3IO7A 5I9UA 4O4DA 5DA3A 3VS6A 4ERWA 3VS3A 3DT1A 3R02A 4XEYA 3WYYA 3OP5A 3OT3A 4MD9E 3R04A 4FMQA 3WZKA 3P0MA 4CNHA 3PE1A 3DA6A 3SVVA 3DLSA 4O84A 3WIGA 2EXEA 4RGJA 3NMUF 1XH4A 2OJIA 5FBOA 3WZEA 2PVYA 3QD0A 3OY3A 1JKSA 4ZEGA 5IUGA 5FWKK 3BGZA 3VNTA 1Y91A 2XAMA 3HV6A 2YJSA 4UV0A 4V04A 5J87A 3ETAA 5ETCA 2PUIA 2A2AA 1R78A 3UODA 4O7VA 2JEDA 4D2WA 4X2NA 3QTQA 5LMAA 1OZ1A 2YIYA 2ITUA 4BFMA 4JMQA 5J1VA 2XNEA 3KVXA 3F69A 1CDKA 4TKSA 4PP7A 5C8KA 4AZEA 1Q8UA 1YXTA 3GC9A 5ANKA 3R1QA 2Z7RA 3ATTA 3UNJA 2Z2WA 3Q53A 4HPUE 3IGGA 4PPAA 4O7SA 1WBSA 2X8EA 2XK6A 2XRWA 4R3RA 2BRMA 4IB3A 4PY1A 1YVJA 3P78A 4A9UA 1XQZA 3UQFA 3ZFMA 3EFWA 3POZA 4OTQA 3LJ1A 4JG7A 3PJ1A 4CTBA 4QMYA 3FLSA 2UZUE 3FQHA 5CZHA 4E6DA 2BR1A 3ZDUA 5IQEA 3ORMA 3VQUA 3NW5A 3PG1A 4RLLA 2HWOA 4IACA 4XBUA 4QQTA 4B7TA 4USEA 2CGWA 4BTJA 3ZSIA 3W16A 2YABA 3BWJA 2V55A 4A9YA 4CRLA 3OXIA 2RG5A 4JRVA 4XP2A 2KULA 3LVPA 2NNWB 2HXLA 3JVRA 5M53A 1J7UA 5JMSA 4MYGA 3WZUA 3BGPA 3PSCA 1G5SA 4RQKA 2JDTA 3AQVA 4OBPA 5HO6A 3RCDA 4MNEB 3RCJA 2PVNA 4W4VA 1DAYA 4ACGA 4YLKA 2E9PA 4FKLA 5B2LA 5CF6A 4AQKA 1Q8WA 3PSDA 1GZNA 4RIWA 3FLQA 4FUXA 4ZTNA 4FEQA 4AFEA 2EWAA 2UVZA 3CBLA 3HAVA 4BDIA 4FEXA 1UKIA 1Q24A 3UIUA 3SW7A 4WUAA 5DBXA 2IZTA 4FT3A 2XANA 3VS4A 3N4TA 3R0TA 3ULZA 4EH6A 4KSPA 5DEWA 4RPVA 4MBJA 4CEGA 2YIWA 3EKKA 3EQBA 1MQ4A 5IPJA 1XH9A 4XCUA 4P5QA 5AP2A 4O7NA 4YJPA 2BRGA 2C6DA 5CENA 5I4NA 5H8GA 4NCTA 1PXLA 5AUTA 1BKXA 3I1AA 3AGMA 2CDZA 2UW3A 4ZY5A 5L8KA 2R3KA 3UOLA 5HNBA 2XKCA 3TN8A 2I0VA 1YHVA 4D28A 4J1RA 4YTCA 3NFFB 5E4HA 4AN9A 4FNZA 3DB6A 4NU1A 1JNKA 4FV6A 2X1NA 4G9CA 2VNYA 3AD4A 3ZSGA 3PJ2A 3NYVA 2PZRA 3LW0A 3OS3A 4XV1A 3RAHA 3U6HA 2B54A 4EONA 5D9HA 4F6WA 5LVLA 2PVKA 4YZCA 2R3QA 1PMVA 4O1OA 4V0GA 4TWPA 4GYIA 3IOPA 4FYNA 4IFCA 4QP2A 5FDXA 2UZOA 2WQEA 2CKQA 5BUJA 1QPCA 3G9NA 3KN5A 3IK3A 2VX1A 3FZPA 3QKKA 4PP9A 5K0KA 5IQIA 2XNMA 1L3RE 4BCIA 5AR4A 3FMEA 4FBXA 2AC5A 4FKIA 2XM9A 4OGRA 4AW5A 1YXUA 2J4ZA 2YCSA 3RM6A 1TQPA 3LOKA 3UOKA 2ZB0A 5A4CA 1OM1A 2QNJA 4J96A 4IM2A 4JDHA 5DI1A 1HCKA 4ZIMA 4BB4A 5A54A 1YW2A 3QTIA 2CNVA 5ANEA 2YIXA 2E9OA 4NW6A 4BCMA 5HX8A 3F88A 3OHTA 4L46A 3MW1A 4PWNA 4BI2A 5CS6A 1Y8GA 4AE6A 4UMRA 2WU7A 4DEAA 1UU9A 1YWNA 1KE8A 3R9OA 3TNQB 3ZRMA 5FGKA 3Q2JA 3G9LX 4X21A 2YEXA 1CKIA 2P3GX 3M2WA 3A62A 3ACJA 3JY9A 4FKQA 1IA9A 1ZMVA 4QYHA 2X7OA 4Y8DA 5GZ8A 5JH6A 5ANJA 5IQBA 3EQDA 3NSZA 2CN8A 4IB0A 3LCOA 1OL7A 4JR7A 3I0OA 4U43A 3O8TA 3MH0A 4YU2A 2J51A 4QO9A 3QTZA 3ZLXA 3FMHA 4MWIA 3IGOA 3EN5A 1FVRA 2KTYA 1YOMA 3A7FA 3PDTA 5AUWA 4CV8A 3VS0A 3BYSA 1H07A 3M1SA 4K33A 5FM3A 4EOQA 1H1SA 5CALA 1W8CA 4W9WA 2J2IB 5ACBC 3HNGA 4C57A 1R0EA 3QZIA 5CYIA 2ZM4A 4IWDA 5A14A 3H0YA 5EQEA 4FKPA 5ANGA 3UQGA 5K5XA 4NT4A 3LLAA 1A9UA 2C68A 2YCQA 4BDJA 2H6DA 3NCGA 2BUJA 3NYOA 3NUNA 2R3GA 4G3FA 2QOKA 2WMUA 4AXAA 2EVAA 1ERKA 2GNJA 1JKTA 3CPBA 2IVTA 2GHLA 3QXOA 4X2JA 4WNMA 3UP2A 3U55A 2JGZA 4ASEA 5GHVA 4F7JA 3VJNA 4F70A 3DOGA 4RJ4A 4PDSA 4C58A 4EK6A 2XA4A 3QUDA 5JZNA 1LR4A 1M7NA 3SGCA 3ZO4A 4JQ7A 5I9VA 1OBDA 3UDZA 3E3BX 3RKBA 1W84A 5KCVA 3UJGA 3LXPA 2JDVA 3Q4CA 5E7RA 5DMZA 2NP8A 2VTAA 3I0QA 3ANQA 4ZK5A 4EL9A 2O0UA 4GK3A 4R5SA 2XCKA 4MBIA 5I3OA 2QLUA 3IONA 3U8WA 4D0XA 3I7BA 3CGFA 4LG4A 4IH8A 2QKWB 4XP3A 3ELJA 5LXMA 1OL6A 2C1BA 3NUAA 4ANBA 2W05A 2Z8CA 4LOPA 4UWBA 3MFUA 1WBOA 2UZLA 4RFYA 2QOFA 3FLZA 3QA8A 4O7WA 1ZY5A 3LCTA 4YPDA 5FBNC 3BQRA 5BVWA 3Q5IA 4K6ZA 5AV0A 3VJOA 2PVFA 4E8AA 4G3EA 2CSNA 3PVUA 4U97A 1BMKA 2V62A 4CFWA 5JGDA 4Y46A 2X7FA 3DAKA 3D2IA 4DEGA 3SRVA 3MPTA 5IU2A 4JAIA 4HGEA 2XNPA 3CS9A 3GT8A 3D94A 2A4LA 4L8MA 5E1EA 4F1OA 5L2WA 5CU3A 3C1XA 3LLTA 3RAIA 5JGAA 2PZIA 5EKOA 5J79A 1GAGA 4A4OA 5BUIA 3HVCA 4M0YA 2YDKA 2FB8A 2WMAA 1REKA 4NM3A 4I93A 2PUNA 3VHKA 5A4TA 3HDMA 1FMKA 3QD3A 4E3CA 2XBJA 2WQBA 3TZ8A 4RFMA 4RWJA 3HGKA 4C61A 2G2IA 3QZHA 5K9IA 2WB8A 2WOTA 4EC9A 1J91A 2Q0BA 2WIHA 2QG7A 3MS9A 1ZXEA 4DN5A 2ZDTA 3HUBA 4FT5A 3TTJA 4BF2A 1JQHA 4X3FC 2C4GA 3D7ZA 3OWKA 4DGNA 2PULA 1WBWA 4UZDA 4D4RA 4EH7A 4HCVA 5H2UA 3WARA 4MQ1A 2BHHA 4BZOA 3C5IA 5L2SA 3L9LA 4DF3A 3S95A 2W5BA 4R1YA 1E1VA 3LMIA 4RX8A 3ZUVA 2EXMA 1LEWA 1NY3A 3DKFA 4L7FA 1FMOE 1U54B 2PVLA 5CU4A 4U44A 2J7TA 4IC8A 4QTDA 4CFUA 4Q9ZA 2VX3A 4NJ3A 3VUGA 4NKSA 4WRSA 5EW9A 2RFSA 4BGGA 3BWFA 3ZLWA 5M55A 4A9TA 2F2CB 4GG7A 3DZQA 3BE9A 4UY9A 2DS1A 2P33A 3VF9A 2WELA 2IJMA 5EI2A 3IW8A 5CTPA 4F6SA 2IVUA 2ITPA 2O63A 2YDIA 3P1AA 2VNWA 5HOAA 5KMJA 4L6QA 5AAFA 4R78A 5HI2A 4ZLZA 4IHPA 3UNKA 3O2MA 2F7EE 3MFSA 1JLUE 4M84A 4QPSA 1LPUA 3V6SA 3NEWA 2A98A 4L44A 4NUSA 5HICA 3FMKA 4R7BA 4DTAA 4O91A 4BRXA 1MRYA 5IA0A 4AT3A 5EQYA 3ZRKA 4CGAA 2JDSA 2BZHB 3C7QA 2WTKC 4Q9SA 4RJ6A 3FUPA 3ORZA 2WMSA 3NCZA 4I6QA 4YNOA 5D10A 3QTXA 1H24A 3ORIA 4ZSGA 1ZYCA 2VWYA 5TE0A 4CSVA 2BZIB 4F78A 2BDJA 2PVHA 2Y4IC 5M4UA 2FA2A 1VYZA 2J0IA 4O2PA 2H8HA 3G6HA 5AUYA 3BIZA 2QD9A 4D1SA 4Y85A 3PY0A 2Y7JA 3HX4A 3Q04A 4YO4A 1X8BA 2GNLA 4H39A 1RE8A 2W17A 2UVXA 4FV7A 4RFZA 3PTGA 4AE9A 3K3IA 3F3ZA 3P4KA 5HD7A 1MRVA 5KZIA 5IH4A 4AGDA 3QHWA 4ZTLA 1UNGA 2GDOA 3R1SA 3UDBA 4HVDA 5F94A 4DH5A 4FOBA 3ORXA 5ICPA 4NZWB 3QLFA 1BYGA 4MXXA 3H10A 3QF9A 1WBPA 3PFYA 3S00A 4PPCA 4R5YA 5E8YA 3QA0A 5CEQA 3TJCA 4DHFA 4E4NA 4DCAA 1XBAA 2W4KA 4YO6A 3UPZA 3HV7A 3AKJA 1ST4A 4W8EA 5E8VA 2CLXA 1H1RA 2FUMA 4MXOA 1H1WA 2V7AA 4XX9A 2PE0A 4QNYA 4C0TA 2IZUA 2W5HA 2P55A 3TNIA 3FAAA 3HMNA 4ITHA 1SNUA 4I5HA 4R3CA 2QOIA 4ZJVA 2VUWA 4HGLA 4EQMA 2JKMA 2WQNA 3GUBA 4EOMA 4OTIA 2CGVA 1Z5MA 4UMTA 5IA5A 5IG1A 5FG8A 4KIKA 1Y57A 5IEVA 4GUBA 4AQCA 4ENXA 4XG2A 4AWIA 2WU6A 4PF4A 5I3RA 4GH2A 4LRJA 4XV9A 5CQWA 2BRHA 2FYSA 3FE3A 5F1ZA 5GZAA 4G3CA 4EBWA 3PWDA 4FKGA 3RPVA 4MXAA 4GK4A 2XKEA 3L1SA 4FUYA 3G0FA 5M07A 1GIHA 5E8TA 5D7VA 3W18A 3OUNB 5JGBA 4FSRA 3FSFA 3UZRA 3F61A 3EQPA 4IIRA 3TXOA 4B8LA 5JK3A 5EI8A 1XH7A 2BMCA 3MA6A 2W99B 4FVRA 3E92A 2P2HA 1OITA 1ND4A 4GU6A 3GI3A 3ORLA 4ANSA 4EH9A 3ML1A 4MBLA 3UOJA 3GCSA 2IG7A 4UEUA 3WIKA 1ZAOA 4F1MA 2R3IA 2Y6MA 5IA2A 3LKMA 4PL4A 4BWKA 4DFYA 5AEPA 4FKRA 4O6EA 3OOGA 3BL9A 4F9WA 4RRVA 3DFAA 4JBOA 2R3LA 2WMVA 3TIZA 2ZOQA 4QMOA 1OL5A 2RG6A 3F82A 3O23A 5ANDA 3CP9A 4O22A 4QMZA 5HBHA 3RJCA 4ASXA 2CHLA 4IMYA 4GT5A 2B9JA 2QHNA 4NK9A 1V0BA 5M4IA 4FKJA 5FXRA 5JFXA 3VHEA 5JFWA 1XBBA 4U42A 4DBXA 4BCOA 4OT5A 4NIFB 4BCNA 5KMLA 3OROA 3COMA 3IDPA 4IC7A 3I81A 1WBNA 4MVFA 3LFQA 4FIEA 1O6LA 3L9PA 3R1YA 4OTHA 3P7BA 1BUHA 5J5TA 1V0PA 4JBQA 4RMZA 2UZBA 3M42A 2I6LA 4BDGA 1QCFA 5DR6A 4M8TA 2R3HA 4G5PA 4LV5A 2RFDA 3AC1A 2X39A 3ALNA 3BX5A 3II5A 2JBOA 5LARA 3QYWA 1SYKA 3FI2A 4ZTQA 4H3QA 4CRSA 1OECA 2Y8OA 4JX7A 1P4FA 2WMXA 2X0OA 3FKNA 4JDJA 4JXFA 2AC3A 5CI7A 5GZ9A 3TKIA 2XKDA 3OT8A 4AACA 2DUVA 2VRXA 3R1NA 5DT3A 4O6LA 4D4VA 4MUQA 5IQFA 1KV2A 4Z55A 4J98A 1ZY4A 3TMOA 3Q9YA 5EKNA 3U54A 4DLIA 2XIZA 5AP3A 4DHZA 3FBVA 2OZOA 3F7ZA 4TWCA 3CQWA 4ZMEA 4ZXTA 1OKYA 2OIBA 3WILA 3DJ7A 3IQ7A 1H1QA 5F95A 2UW0A 3E5AA 5CAVA 3D4QA 2PE1A 5CXHA 4U79A 3AOXA 3G6GA 2X81A 4APPA 2VN9A 3EKNA 2I0YA 4WOVA 5AV2A 1U4DA 3UIMA 3W0NA 1YI3A 3N51A 2JFMA 3K5UA 3EZVA 1G8SA 3TZ7A 3BLQA 4XRLA 3VBVA 4ZAUA 1GJOA 2C6MA 3R8UA 4G31A 2XAOA 3NUSA 3LMHA 4GVAA 4UZHA 4K8AA 2J5EA 4FK3A 4FZAB 2W1FA 4YZ9A 4FICA 5IUHA 3VS2A 5KKRB 2GU8A 4TT7A 3OW4A 4RJ7A 3HMPA 3OC1A 4KB8A 4JBVA 2H96A 5AUUA 4QTCA 5FEDA 3THBA 3IS5A 3B8RA 3SC1A 4WHZA 4BWPA 4EK4A 5TR6A 3AXWA 3R7VA 3OEZA 2YIQA 5M4FA 5IA3A 3KGAA 4HPTE 4MNFA 4XG8A 3WYXA 4TYHA 5D12A 1OGUA 4FE2A 3ENHA 4WNOA 4QOXA 4A9SA 3QLGA 3UYTA 4CMUA 4MCVA 3WF7A 5DH3A 4DTKA 3PJ3A 3CKWA 5B2MA 2X9EA 5DGZA 1OL1A 4I5CA 4D55A 1FINA 2OSCA 2BALA 1GZOA 5HORA 3R01A 5HE0A 3SAYA 3TIYA 2ONLA 3DDPA 4TYJA 2ZV9A 3GQLA 4YJSA 4E26A 3N4VA 3IDCA 4EHEA 3A8WA 2YWPA 3TYKA 4F09A 2WTVA 2H9VA 3CTQA 2BFXA 4EOOA 4EWQA 2EUFB 3NUPA 3RWPA 4NEUA 4KUJA 2GHMA 4YZBA 1OPKA 3T3UA 3QL8A 4RWIA 1YKRA 3AT4A 3VBTA 4AX8A 4FV8A 4EH3A 5AX3A 5C26A 3QTSA 5IEXA 2GPHA 4KKHA 4BDAA 3BYMA 3SD0A 1F5QA 4PMPA 3D14A 2C3LA 4W4WA 3W33A 4FJVA 3BHUA 3KRLA 4XYFA 3R8LA 1FOTA 4BI1A 4CFXA 2HW7A 2XK7A 2YZAA 2GTMA 3A2CA 2WFYA 2O64A 3QCYA 1IAJA 2G2HA 4FSYA 3QCXA 4IWQA 3BYOA 5GNKA 4EK8A 4FC0A 4X3FB 2WNTA 5FP5A 2IF8A 5IH5A 3KKVA 4K2RA 4R7IA 3VULA 4JIKA 4FSWA 4U41A 5IUIA 1VJYA 4QMXA 3IECA 3LJ0A 4IAZA 1PXKA 3EQCA 4GFGA 4OW8A 3UP7A 4MD7E 3ZTXA 4MQ2A 3KRWA 4K0YA 2YM7A 1KOAA 4I24A 3IW7A 1OMWA 1SVEA 5EW3A 5J7BA 1O6YA 3M11A 5E90A 4ZSAA 2C6LA 1NW1A 4AZSA 5DHJA 3OXZA 3KF7A 4FYOA 3PXQA 2CJMA 5DR2A 4O38A 3C0HA 4JVGA 4CMOA 3KRXA 3R6XA 3QUPA 4OTFA 3IOKA 4ZSLA 3WF8A 2Q83A 3MVJA 4IFGA 5C03A 3ODZX 4YJNA 3ZOSA 5CAOA 5J9YA 5CVHA 4O27B 2P2IA 4ITIA 5AIKA 2YLEA 3RHXA 3V51A 3DXPA 1DS5A 3GENA 4PL5A 3LXLA 3LM5A 4BCQA 4AW1A 1H08A 3AGLA 3QHRA 3W2PA 2JKKA 3CLYA 3S2PA 2CGUA 4LRKA 5CU0A 3DK6A 4HCTA 5IKWA 4IVCA 3E8CA 2VTJA 4Z7GA 3CIKA 4QMPA 4RJ3A 1OIUA 3TZMA 1GOLA 2UZNA 3FI8A 3FPMA 3SG9A 2Y4IB 3VIDA 4CG8A 2BAQA 4TN6A 4FTQA 2C6IA 4ZS4A 5LQFA 4J71A 4U3ZA 1SVHA 4RA4A 3CTHA 5H8BA 3VONA 2UVYA 5CY3A 3AMYA 3BEGA 1SM2A 5CF5A 5HKMA 4PMSA 4BY9E 2BRNA 4QPMA 4S33A 3HV3A 3D5VA 4U7ZA 2VWBA 4QMNA 5E8SA 5J1WA 3U9CA 3HUCA 2G9XA 4MH7A 4O0WA 3GOKA 3LXNA 3E7OA 1SVGA 3O96A 3FZRA 3QFVA 4HZRA 2R3FA 4KAOA 2QO2A 5AV1A 1UU3A 1QPDA 1JBPE 2C1AA 4GEOA 4FTRA 4J52A 4BDDA 3LFDA 2XKFA 3MN3A 4YJQA 1TQMA 1ZLTA 2JITA 4FSNA 5D7AA 3VUKA 3KY2A 1R3CA 2BVAA 4FOCA 4IB1A 3F5XA 1PHKA 4QP4A 2Z7QA 4C3PA 4S30A 3Q60A 5M44A 4L7SA 4BJJB 1PXMA 3DKGA 3I79A 4M12A 5DRDA 2F7XE 1YXVA 3ZMMA 4LMUA 4HVGA 1J7LA 1BL6A 2YM8A 4HCUA 4XUFA 4EH5A 4TZRA 5D11A 5BVOA 3PRIA 2J9MA 3ALOA 3RZFA 3V01A 4FEUA 2WTJA 4F9AA 2QURA 3SOAA 4O82A 3FYKX 3ORNA 2WMRA 5HIBA 4RZVA 3R2YA 4KABA 4CQEA 5HU3A 4I41A 4FSUA 4KIQA 3V5TA 3TACA 3S1HA 1URCA 1ST0A 1YOJA 3FC2A 3BLHA 4LFIA 3LFBA 4Q2AA 1KWPA 4FV9A 4AXFA 3RMFA 3WF9A 3E63A 4IDTA 2C3IB 4UMPA 5BVFA 2B7AA 4BBFA 1REJA 4F1TA 3QU0A 3FLYA 3IKAA 2QODA 4FTUA 2QI8A 1KSWA 3PXFA 3QX4A 1IEPA 4NKAA 4O0TA 5KMIA 4Q5EA 3R8ZA 4IVBA 2XUUA 4U0IA 4A07A 4A06A 2G2FA 5G6VA 4NTTA 2OH0E 5BVEA 1UWHA 4YR8A 3P5KA 4MKCA 5BNJA 4RT7A 5KMNA 3QWJA 4JOAA 1TKIA 3GP0A 4IX4A 4WBOA 5FEEA 5H3QA 2IEWA 2C47A 5KBQA 4GK2A 2NPQA 3QQJA 5F20A 3R8MA 4BDCA 4CLJA 2ERZE 3D2KA 5A3XA 2B9HA 1A06A 3UC3A 4EOJA 4YJTA 2CN5A 5HEZA 4G6LA 3LQ5A 2QU5A 3QQFA 4DE4A 3HEGA 3BZ3A 2OBJA 2QONA 4I5MA 3MY1A 5HO7A 4CT1A 3UBDA 4NFNA 2UV2A 1WBVA 1WCCA 3R7UA 2XEZA 3ZHPC 4O83A 3NPCA 4RLKA 4X2KA 5J7HA 4ZP5A 2F7ZE