3OCCA

Crystal structure of pnp with dadmeimmh from yersinia pseudotuberculosis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
237
structure length
237
Chain Sequence
TPHINAEMGDFADVVLMPGDPLRAKFIAETFLQDVREVNNVRGMLGFTGTYKGRKISVMGHGMGIPSCSIYAKELITDFGVKKIIRVGSCGAVRTDVKLRDVVIGMGACTDSKVNRMRFKDHDYAAIADFEMTRNAVDAAKAKGVNVRVGNLFSADLFYTPDPQMFDVMEKYGILGVEMEAAGIYGVAAEFGAKALTICTVSDHIRTGEQTTAAERQTTFNDMIEIALESVLLGDNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title crystal structure of PNP with DADMEimmH from Yersinia pseudotuberculosis
rcsb
source organism Yersinia pseudotuberculosis
molecule tags Transferase
molecule keywords Purine nucleoside phosphorylase deoD-type
total genus 86
structure length 237
sequence length 237
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2010-08-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3occA00
5I3CA 5CYGA 5F73A 4TTAA 3IEXA 4M7WA 1OU4A 4P54A 1SQ6A 5F7OA 2HSWA 1ZOSA 2I4TA 1C3XA 3FOWA 5EUBA 4X24A 4EB8A 1A9SA 1TGYA 3PNSA 5F77A 1ODLA 5JPCA 2QDKA 3OOEA 1PBNA 1VFNA 4L0MA 4L5YA 1YQQA 1SD1A 1NW4A 1U1CA 3P0EA 2AI1A 1G2OA 1A9TA 1RT9A 3UAZA 4DA0A 3OPVA 1JDZA 3ENZA 1Z5PA 1U1EA 3FWPA 1V4NA 1PK7A 3DJFA 3LBAA 4I2VA 4JP5A 1Y1SA 3EEIA 4RJ2A 3T94A 1ODIA 1RCTE 3INYA 3E9ZA 4YMLA 4MCHA 1A69A 4WKNA 4DANA 4TXHA 5F7XA 1V45E 3F8WA 1Y6QA 2RJ3A 1U1FA 3FUCA 3D1VA 2A0WA 4D9HA 1JE0A 1A9RA 3ONVA 4TS9A 4YNBA 1RXCA 3MB8A 3KVYA 3TL6A 1OTXA 4QATA 3PHCA 4NS1A 4OGKA 2HN9A 4FFSA 3E0QA 1RXUA 2HWUA 5F7ZA 4MCIA 5B7PA 1K3FA 1OTYA 2AI3A 4LKRA 4BN0A 1RR6A 1V2HE 3OF3A 4L6IA 3BSFA 3C74A 5B7NA 2QTGA 1V48A 3UAWA 4ECEA 2AC7A 3DDOA 3UAXA 1YQUA 3QPBA 4F2WA 1V41E 1PKEA 2A0XA 2PGAA 4PR3A 4KN5A 4JOSA 1U1DA 4R2XA 3IOMA 4BMYA 3PHBE 1SD2A 2A0YA 2QTTA 4OF4A 1A9PA 1RYZA 1JDUA 4BMXA 4JWTA 1Y1QA 1RXSA 3LA8A 4R31A 5C80A 3UAVA 5ETJA 5CYFA 4QARA 1V3QE 3OZBA 4U2KA 1M73E 4EARA 1PWYE 1Z34A 1PR5A 4LNAA 2BSXA 1Z33A 2OXFA 3OZCA 3OOHA 4H1TA 4TXMA 1Q1GA 4M3NA 1NC3A 5EPUA 4LDNA 2OC4A 1TGVA 3SCZA 3UAYA 1A9QA 4WKPA 1XE3A 4DA8A 1T0UA 1PW7A 1ODKA 1Z5OA 2ON6A 3GB9A 4IP0A 3FNQA 1B8NA 1Z5NA 5B7GA 3FB1A 5CXQA 2IQ5A 1TCVA 4WKOA 2OC9A 4G8JA 4E1VA 1ZL2A 3MMSA 1PR4A 1I80A 4K6OA 4PNPA 1T8RA 3LGSA 1OV6A 2ISCA 1Y6RA 2QPLA 4OJTA 1RXYA 1NC1A 3DF9A 4D8YA 1B8OA 5CCDA 1JDTA 3OCCA 3U40A 3ODGA 4OY3A 1YRYE 3FAZA 1ECPA 1PR0A 1PR1A 3KHSA 1LVUA 1RSZA 2Q7OE 3K8OE 1YR3A 1PF7E 2HRDA 2XRFA 1JYSA 4DARA 1Z36A 1VMKA 4F3KA 4DA7A 4TXLA 3KU4A 4QAQA 5F78A 1T8YA 1Z38A 3EMVA 1QE5A 1PR6A 2H8GA 4WKCA 1VHWA 3KUKA 1TD1A 2QSUA 1WTAA 5EFOA 4UC0A 3NM6B 2B94A 3NBQA 4F1WA 1Z39A 1JDSA 4OGLA 4GMHA 5IFKA 1Y1TA 3NM5A 5F76A 1T8WA 1TCUA 4L5AA 3EUFA 4F3CA 4LNHA 3O6VA 1OUMA 3EUEA 1Z37A 1CG6A 2AI2A 4MARA 4BMZA 4DAOA 1LV8A 3DPSA 3BL6A 4TXNA 1Z35A 4QEZA 1ULBA 3KVRA 1YBFA 2I8AA 4TXJA 1A9OA 1JPVA 4YO8A 4D8VA 1Y1RA 4QFBA 5KB3A 1JE1A 2P4SA 3OZDA 1PR2A 3KVVA 1RFGE 4TYMA 4TS3A 3O4VA 3E9RA 2GUWA 3PNPA 4DA6A 4G41A 5CCEA 5F7JA 4QASA 2OECA 5DK6A 4WKBA 2A8YA 1LX7A 4LZWA 4D8XA 4F2PA 4D98A 3P0FA 1VHJA 4DABA 3UT6A 4M1EA 5B7QA 4DAEA 1JP7A 1FXUA 1ULAA 4R2WA 1U1GA 4TTIA 1N3IA 1SJ9A 4OEHA 5FAKA 4L5CA 3NM4A 5IU6A 3OZEA 1CB0A 3BJEA 4TTJA 1PK9A 4G89A 1K27A 1ODJA 1T8SA 1JDVA 4GLFA 3DP9A 3K8QA 1K9SA 3BGSA 1OVGA 4YJKA 4GLJA 4GKAA 4NSNA 3GGSA 5CXSA 5K1ZA 4NY1A
chains in the Genus database with same CATH superfamily
4ZIRA 1QYIA 2B3TA 3DTVD 4TTRA 3T3HA 1BHO1 2NSYA 3O4JA 3LP8A 3WI7A 4LY0A 2OCLA 3LGAA 4ZTBA 1Z8DA 4RQAA 5JWHA 1GAQA 1PEKE 4MMZB 1O0BA 1N25A 4BLRA 2OCYC 3Q6MA 5JD6A 2AYYA 2IEYA 2MINB 2PO7A 3NBAA 4UARA 3PX3A 4O02B 3P52A 3M82A 1K97A 1N2IA 1H65A 4O4LA 4O2AA 1Y89A 1VL8A 1XVUA 2P30A 4RIEA 4R84A 4X20B 5AM0A 4AJLA 4CVNA 3I83A 1C3XA 1EM6A 1OZGA 1UEXC 3P0RA 4F6RB 5I4BA 1YU9A 2D5LA 3DMTA 3CISA 1PR3A 5H9WA 1KBZA 2AXEA 3A9RA 4KN8A 4CMKA 3LKBA 4W5HA 4ZDJA 1V7CA 2EQ5A 1MRNA 1I7PA 3ZU6A 1NUQA 4GH5A 3QOFA 4R0NA 1KI8A 2JGAA 4LC9A 4EYGA 1TAGA 5LSAA 1N9KA 221PA 2Z2JA 4BATA 3ON5A 1K7EB 1Q0TA 5EWLA 2FEXA 5YASA 3VHXB 3MCAA 1QP8A 2Q5LA 2DU8A 2PNJA 3NORA 1SXJE 1CZOA 3M5CA 2Q4BA 3ZX5A 5F1KA 1NMXA 3RYCB 4RZSA 4CV3A 4LOKA 2WFAA 5F5LA 2OB2A 4G09A 1CQWA 3AUFA 1A2OA 1DADA 3A3KA 5TR9A 5BQ5A 1ACMA 4G9BA 1Q11A 3G1UA 4PZ0A 3LRTA 4C7BA 5TF0A 1WUKS 3EAGA 3Q2OA 2Q9AA 1THGA 1Q6YA 3B7WA 3X2SA 1EXMA 4Y6SA 1ECCA 2AMYA 2E9SA 1K63A 2FVXA 2DBZA 1WXGA 3AB7A 3AHIA 3K15A 3T9EA 4A2QA 1ORTA 2NZ2A 2WHQA 4K9SA 5FOSA 3RVRA 3ZCSA 2R2GA 3B89A 3WV5A 3IB3A 3HDGA 2D1RA 3QNUA 4JU9A 4RXTA 5A0FA 1PLLA 2ZB8A 4NF2A 3D0QA 3D6TB 1ECFA 4O4IB 2PUBA 2FRXA 1GL3A 4BBAA 2OHGA 1WZEA 3THOA 4BV8A 4RMIA 2L0XA 3V1UA 1EDEA 4WXMA 2RAVA 5IAAA 4RESA 1PZFA 3GFTA 3QF4B 1QDUA 2BJWA 3Q9LA 1W0JD 2BEVA 4FGZA 2J6CA 2OBFA 3SMVA 3DNPA 1HY3A 3F3KA 2WYVA 5ERGB 3TECE 4S05A 5IPFA 4AURA 1OLXB 1N36B 3NANA 1SKUA 4OLBA 3MLAA 3RR2A 4D9CA 2FEOA 1XXHE 3F6YA 5G02A 3SVTA 3HB7A 5AI5A 5C4IA 3M33A 1H8EA 2J67A 3GP3A 3U3XA 5C53B 3VR6D 1OAOC 1Y0BA 2V9ZA 4PAQA 3U7EB 4A92A 1XF1A 1VI5A 2AQ8A 2WNSA 4Z0HO 1BRTA 1JR4A 4LZJA 1KSJA 2J9FA 5FFNA 3CV3A 4P3KA 3VR4D 4HZUB 2ZQYA 1RHUA 2FPKA 2RHLA 4PXAA 4X92A 2ODTX 3HCAA 4LTMA 4LRTB 2GK6A 4TUYB 5BQOA 3BXPA 3JVDA 4MUBA 5CLFA 5TIIA 1FYEA 5TRTA 3KUUA 1QJ4A 3SQNA 1BE1A 3RTBA 3OOYA 5JPIA 4GI2A 1J8VA 2PRSA 4MOWA 4U9IS 2COEA 1L8AA 1VL6A 3GJ7A 3IDAA 3T5DA 1NJ2A 4PAWA 1ZOLA 4XJTA 2O3UA 4HMPA 4YQZA 2DUWA 4OA5A 3IR5A 2KI5A 2FSFA 5JXJA 3ZZ1A 2XCSB 3K5HA 2CXPA 4JWKA 3ZU4A 3C8HA 4ENUA 1F1BA 1ISIA 2ZYUX 2KPOA 4FMCF 1VJCA 2GYUA 1ZUWA 2P9GA 2W5UA 2PZJA 3CRZA 1BIFA 1SB9A 2PX6A 3IQIX 3K2QA 4PO8A 5EQJB 3TPZA 3IJPA 3AXTA 3EIQA 4UFPA 1NOIA 1A27A 3R5FA 4PC2A 2WF7A 2FSSA 2HSJA 4S1WA 4MW4A 1IN8A 5I7AA 4MI1A 3ZGYA 2I2XB 4B3TB 1YZFA 2RGDA 2B4RO 2VUTA 1STOA 5AQ1A 4PCVA 2GJ8A 1JIKA 3TZCA 2GAFA 3N0WA 3UYKA 4YONB 1YF3A 4YUZA 1E3EA 2WILA 4EH1A 1XXHB 2BJHA 2VTBA 3O8DA 3L7AA 4D74A 4HNGA 1WKCA 2P9QA 4GOKA 3E7WA 4GX2A 1M2FA 4CCAA 1YB1A 1IY2A 3F46A 4CF5A 1LQ2A 4JZKA 1BEUB 5F51A 1WZNA 1P4HA 4OYHA 4IDAA 3H16A 1E3IA 4TSFA 4JQCA 1JIIA 4ZZIA 2ZZNA 3HVIA 5KHLB 4BE4A 3T1VA 3HMKA 2HHJA 3I6QA 4YA6A 2CEKA 3UMSA 3DJYA 5IDXA 2HXYA 4F2DA 1L6IA 2XPCA 4M0DA 1ZCJA 4NU5A 1BH6A 3DHEA 3N2KA 1KXZA 3LZDA 3SBXA 1YR8A 4M98A 3CEMA 4IJWA 3PC8C 2F9LA 1TYAE 3DAPA 4PYMA 1DTWA 1WXDA 4A36A 4PYQA 3S27A 4CT5A 3V4RA 2EZ4A 3OPYB 1JHDA 3WLRA 3C7AA 3WP1B 4QTXA 1EFHA 4E33A 2G4VA 1GZ3A 5CCBA 1Y3AA 4UMDA 5KJFA 5J2TB 4HY3A 1TFRA 3Q8WA 3ITEA 2PVPA 5HM8A 1EUYA 2OORA 2BT4A 2QXUA 1V6SA 1GYRA 2QTLA 4IIBA 4XSVA 5FBZA 4F9TA 3JQGA 2E6KA 4ZIRB 3QVWA 4QWMA 3RODA 5IH7A 3LAWA 1R00A 2V7XA 3EDMA 3S2SA 1P1FA 4MP3A 4PTYA 2A4KA 3RS9A 4FOPA 1KZ6A 1TFUA 4ZAWA 4D4LA 1CUVA 1KAOA 1PJSA 1I32A 2JFXA 4OV6B 1NVTA 3GNLA 4WGFA 1Z33A 4RETA 5EZSA 4R4JA 3QHPA 3G13A 4DLLA 4N76A 4CG1A 2QL9A 1C80A 3CUTA 2AN5A 3B6KA 1LEHA 3DAOA 1FNCA 3FTPA 4UNQA 5J47A 2XGGA 2R44A 2CXRA 1XTQA 4L4SA 4RZIA 3C4VA 3SXPA 1PV4A 4M8NE 3ZD7A 3JYHA 2XRZA 2GBLA 3OETA 4UU8A 2VDNB 5ULLA 4ESEA 1J0XO 2CE7A 1H2BA 2GPWA 1MPXA 4B3FX 4LC0A 1I4TD 3DV9A 2ONZA 3NP7A 2YYAA 4H7KA 1W94A 1ZJJA 4D4JA 2LGJA 4K3UA 3O8QA 4U1RA 5HNKA 1KETA 5JNTA 5ALQA 3NOXA 1MT3A 2BGKA 1GFZA 1F0PA 1GNPA 1Y4SA 2VNJA 1NU6A 3O1IC 1FVOA 4LZNA 3RKSA 1OGJA 1UF9A 2FSUA 2NZWA 5LD2C 4AG5A 4K6KA 3IESA 4X00A 4KVZA 3HFSA 2IYXA 3MPUA 2XQJA 2WFLB 4KOEC 3LW7A 4X1OA 2CUTA 3UZUA 3M81A 2O48X 4HWTA 2IBTA 1EVEA 4NV0A 4MV1A 4OM8A 1TEVA 4P5DA 1B8NA 4AS2A 2D5IA 2J07A 1O3YA 3U19A 4MO2A 1JT2A 4YDHB 4JLJA 3QE0A 5F3DA 1MB3A 1U0BB 2ZUUA 1ZL0A 3L7MA 3MNFA 2AL7A 1XU4A 3KOYA 3HB5X 3LBNA 5CT6A 4C0AC 2ZIGA 1P5FA 4MTLA 4LPKA 1OFTA 2GZ1A 3MMSA 1KJQA 1XP8A 1E1LA 2VRNA 1SBNE 2C2XA 4LWPA 5DASA 4W6ZA 4K6OA 3BMOA 3W3AD 1XB2A 1HRDA 2YIMA 4JLWA 2JEYA 2VZEA 4CIAA 3B1WA 1XZPA 1R4ZA 3LX6A 3M6UA 3NALA 4KMRA 3RRXA 4LSMA 1RXYA 1WSAA 1MQ9A 3IHLA 3DE2X 5FADA 1YA6A 3D5QA 5K4GA 5K3DA 4BB6A 3ZJVA 2EBUA 1UDRA 1IBMB 3IOYA 3GT0A 4RH1A 2F7SA 4TWRA 2QTNA 4JR2A 3E05A 4IV0A 4UXHA 3K16A 4DV4B 2VAMA 3AZQA 4YT5A 1ECPA 3RVLA 1DRJA 1E7QA 1QOZA 1DPFA 1FDOA 4G26A 5JAIA 2OUIA 1OI3A 1SEPA 3CR7A 3IUEA 1YZNA 2XODA 2PVSA 4JB0A 3K8OE 1PX2A 2HZBA 3AY0A 4GPBA 5ALTA 5F2EA 3T38A 5LBUA 3BHIA 1NVXQ 4PHCA 4RIGA 3VSCA 1H2HA 4QNRA 2RAPA 5DIZA 2H08A 4HDRA 1NWHA 4O4LF 2W2MA 1M6EX 4TXLA 2DLCX 3HSYA 1CJKC 2R5WA 4PGFA 1VA5A 1JHRA 5LLSA 1BJRE 1JJ7A 1Y8CA 3CUVA 4D3YA 2XZLA 4NZPA 3D6NB 4RSMA 3PVZA 1T9GS 2DWPA 2F9FA 3BCHA 4QO7A 4C3UA 4QT4A 2BTEA 1EIZA 3CH5A 4BCDA 3CLTC 1VG8A 2XBLA 3CUUA 2GM9A 5G3ZA 3R0VA 5LZ2A 1GVHA 2G0AA 3CB4A 3S81A 4PFJA 1ZR4A 4M0PA 1ZXXA 4QLOA 2BCJQ 2KJQA 2PSEA 3X1XA 3PITA 1RTTA 1O94D 4F5ZA 1U7UA 2IYAA 4C78A 1DCTA 2ZBUA 1Y9ZA 5CJPA 3LFUA 1J7JA 2D3TA 3T7IA 5J4KA 2XRYA 2IIPA 4UU1A 4XB2A 3HDHA 1MVNA 4BFCA 1F0YA 4J4BA 1PL8A 4YUYA 2XD9A 3LQYA 4G1VA 4I5FA 1PVDA 2R6AA 1VSVA 4TMTA 3BF8A 5T4HA 2R96A 2AG5A 4Q5IA 3M6MD 1ISJA 4JSYA 4ZCSA 3JTMA 1L8QA 1WBBA 4NIMA 1BW9B 2J8ZA 4U2EA 1NMEA 3A9TA 1P5JA 2X23A 2ZRCA 3OJ0A 3KK0A 1CS4C 2YIDA 4FFVA 3T5AA 1MCZA 2DH5A 1NYRA 3MERA 4LNHA 2BI4A 4OG2A 4AG6A 3LDFA 5EKUA 4YJFA 2OUKA 4KBYA 3PUXA 1U3GA 3TGPA 3X1YA 1U81A 1X8KA 4PQYA 2RHOA 3PGKA 4MARA 1KXJA 1EBUA 3FH0A 2PX4A 2ZSHA 1PDWA 3A1CA 5F9MA 5EPEA 1IQRA 3OD1A 5BYJA 2HBRA 3A36A 3VJLA 3EHEA 3D4NA 3ZHYA 1DAHA 1X7WA 2PLWA 3PRYA 4KPUA 3AL3A 3L5OA 1Z88A 1E2FA 5B3AA 2NSJA 1B26A 4OLJA 3RQIA 3U13A 4ITVA 4B71A 3WIOA 4J9UE 2HREA 5BSVA 5JMTA 1JKJB 3DDSA 2YC2C 1U5CA 3K70C 1CD5A 2IHYA 3KG2A 5F7XA 5G1NA 3PFWO 5IAJA 3TE7A 1O97D 2ENUA 2WIKA 3K2BA 1W19A 2CYAA 4ZGGA 5C18A 1P7VA 3LCMA 2QMQA 4RAQA 2CZGA 5FI1B 3AUKA 1E3MA 1MABB 1W52X 1EAMA 1W8IA 3UJ9A 4ALIA 4BV2A 3QYAA 3IVMA 1VC2A 2YQ5A 1CJSA 2VTDA 2CNDA 1E9CA 3GAAA 4WZAE 4JLBA 4Z0NA 3JTEA 1N6RA 4KO4S 2H29A 4FEEA 2EIHA 4AS3A 1G18A 2VWGA 2CMHA 4LFAB 4U00A 1A8UA 5T64A 1YONA 2WHEA 1P3Y1 5CEFA 4H4DA 3DBOB 3V6MA 1N2CA 1VSUA 2XT6A 1BEZA 1VBFA 3KKPA 4Q82A 4TYMA 3TIFA 2DPHA 3E9RA 1NMQA 1L5GB 3RJTA 4N01A 1EVLA 4IDDA 3TSWA 2JF0A 2WUDA 4CFYA 1UZAA 1WKVA 3MJTA 5KVSA 3M9WA 3QMWA 4JFAA 1MAWA 2C8KA 1N6NA 4YPFA 2Q1WA 1TLTA 2REQB 1VA4A 3SE7A 3V33A 3FNFA 4TN5A 4DXAA 1Y6JA 1E2JA 3N6VA 1VHJA 4TTVA 5EP3A 3FVTA 2UYCA 3FFTA 1JG2A 3NHUA 1SIUA 3OZXA 4I4NA 3D8HA 4YP0A 4QGSA 1TPZA 2L42A 4X20A 4C0HA 1QTRA 1X13A 2G71A 4LOHA 4TQ9A 1UBKS 1PWEA 1GNSA 2XCLA 3UMYA 3PKIA 4IL5A 1RKUA 1U99A 2ORWA 2OV8A 3EQ6A 3OM0A 1UMDA 2AC4A 2XNJA 1NHGA 4FJ2A 4I46A 4EQ6A 5CD1A 4EEZA 1YRQA 5CTAA 4PBSA 3OTWA 2IP2A 2HV8A 1MEEA 4RPGA 3VH3A 4DIOA 4DVJA 5BMVB 3O74A 4NHEA 1XZCA 3UANA 1W9HA 2J33A 1UBNA 2XE8A 3BERA 4IDHA 4IYJA 5K3AA 2W58A 3G68A 2VJCA 2ZSUA 4MUKA 5BR8B 1PK8A 5FPPA 4HTFB 3A3PA 3FUUA 2XF8A 2W70A 2F1KA 3AR6A 4ZVOA 4J1NA 3JQ8B 5LBTA 1R5NA 4HVAA 2XTNA 2ROQA 1NJ1A 2XVAA 3DB1A 4H17A 5IH3A 5L4LA 1KBOA 4GOOD 2Q3FA 5LVAA 2NVWA 2GKGA 1EX9A 1JDVA 3LM8A 1C0KA 1XHLA 1UMBB 2W4IA 2ZSAA 3W5CA 1NG1A 1GPMA 1WZCA 2LKCA 5KDLA 2PT6A 4KE8A 3T3OA 4LY9A 3T3IA 4J0EA 3RFFA 1L5KA 1Z5VA 5LMZA 1FVHA 2D54A 2JHGA 1G8KA 1TADA 3O21A 2JD1A 1Q0HA 3DMFA 4GU5A 5FORA 2IIVA 3HABA 3UHAA 2NX2A 3GEGA 3HUEA 5TX7A 1GSOA 1H1LB 4ROTA 3ZJ5A 4I4CA 5F12A 1TECE 5IULC 4Q24A 5IUNC 1W30A 5IVHA 4RTSA 1EFAA 3ZGZA 3V4OA 4QFCA 3KXPA 2Z2KA 2VKQA 1EFRA 2BELA 3QKRB 1HFKA 5E8RA 3UIEA 2FPRA 1FTQA 1VPLA 1W85A 1V9SA 2VG8A 4BP3A 4YK7A 4A6PA 1ISHA 1Q3HA 1VXOA 1YVRA 2GN8A 4HGYA 2GEKA 2ZB3A 1ICIA 2C2YA 4YJGB 1OU0A 3OM1A 9GPBA 2AMVA 2NPIA 2XE4A 5CVUA 2JK1A 3T1NA 1WD5A 4LYYA 5TMPA 4TOIA 2JJ2D 4B3XA 5HJEA 4JSRA 5IN5A 4RVOA 1PGQA 1D4ZA 3G2QA 1S7GA 4CDRA 4GSLA 3B6ZA 4UBJA 1CERA 4YUVA 5CA1F 1TKCA 2AG0A 3WRYA 3IVGA 2VZLA 4AKEA 2O05A 3PPYA 4LGVA 3EPHA 5JJIA 1KJYA 1BQ4A 1DBPA 4X24A 2ZBVA 2RD2A 5G0VA 2WUGA 2X5NA 4IZIA 5JCZA 5JQGB 4M9QA 2E4WA 2VP0A 2V5VA 3CE9A 3ZDYB 5D2CA 2G6TA 3MIZA 1NURA 1NBMA 3PIRA 3K6SB 2RG7A 2QRPA 1UEIA 2QG4A 5CLLA 3RI3A 3A3YA 1AJEA 4RK7A 2PZAA 4MLZA 1OFUA 1GYQA 1N2CB 4JUDX 1C7EA 2IXTA 3PQCA 2H2IA 3GCGA 3SF0A 2BBTA 4MKXA 4DCUA 2J5QA 3B9PA 6ADHA 3E48A 1SULA 1YIOA 1ZO8A 2C59A 2WKQA 3E7DA 1CK4A 2NUTB 3GUCA 4KE9A 3R7DA 1NP6A 3FWHA 2ADMA 3FI9A 2H5LA 2PMDA 5HE9A 2EX1A 1TZ2A 4W7IA 1UBMS 1ZM9A 1YJ8A 1G55A 2R3SA 5SZJA 5CAEA 1ETHA 5DNCA 1YFKA 3BXGA 3FWPA 8ATCA 3CUEF 4BAGA 2CYBA 3BL5A 1UZMA 3QW4B 4GQBA 3VISA 3DJFA 1IJBA 3L1VA 3RKUA 4HYQA 3E4CA 3PQ5A 3SOZA 1DXHA 3GFPA 3EE6A 2PJUA 4Y0VA 3RW9A 3C39A 4PLWA 3CVXA 4CG0A 1FTGA 3ZK8A 3QFTA 5E9WA 1O7JA 3QF4A 3HSSA 1K8RA 4BN4A 1W6UA 1AGXA 3BWEA 4MS1A 4FN4A 3D2BA 3DTNA 3NWOA 1BA2A 3ORQA 3LWDA 2XNDA 4E0BA 5L7WA 3IDFA 4Z9FA 1F51E 5E7IA 1NX6A 1D04A 2CXNA 4JNCA 2XXAA 1J9GA 1TM2A 3GQVA 4YVFA 1GNQA 4BLUA 1SHUX 1V3UA 3VUEA 4IICA 2QIPA 3O9MA 4DY4A 5AK4A 5JBQA 3MTIA 4ESVA 2NSHA 3R9IA 2G25A 2OD9A 3CX8A 4HQLA 3QXHA 4RE5A 3B20A 3IOBA 1L5HB 2H2HA 5T4BA 2JI7A 3FMIA 1BE6A 1SMKA 2H1RA 3E1KA 3QEJA 2FETA 1JLMA 4DREA 3OICA 1R0SA 3QQPA 4Q3CA 4KAAA 5H16A 3RFVA 2AC2A 2PKQO 1KYWA 3WSVA 2VPIA 2Q28A 3EF3A 4D9HA 2JAHA 3VR2D 1DC8A 4MV5A 1XZEA 4XYEA 4D6PA 3PGXA 1RRPA 3I9NA 4MQ6A 2O7NA 2R68A 1UJBA 4A26A 3IAS1 4OD0A 1EMDA 2WE7A 4ZI7B 3I5XA 2C7GA 3ZNOA 2AIRA 2ZR8A 2D2EA 1EJBA 4O2LA 4DLYA 5CFNA 6YASA 3UV3A 1M8FA 5GM1A 2I2FA 4L3WA 3TL6A 3VR3A 5F9HA 1PTJA 2R4UA 4U0KA 1GRQA 1FU8A 1PWHA 2FSVA 3KOXA 4BEBA 1NKSA 3DEJA 2CDNA 2D8AA 3L7LA 4D4IA 5T7BA 4UBIA 1W87A 3MGKA 3EGOA 3P71T 1BVUA 2Z6UA 4FGKA 4ZQFA 2EKPA 5L9AA 1K3FA 2ODAA 5ESRA 1KQNA 3LK7A 3EVEA 4GBGA 5LN1A 5DU2A 3WK7A 3IP5A 3Q8MA 1TKAA 4NV3A 2OQVA 1ZM3A 2JA1A 4B3BA 4EECA 4PRZA 1CR0A 1G1MA 4A73A 1Q91A 5ILQA 1ZD2P 5EINA 5LL6P 3Q6IA 2COKA 4YP6A 3QUBA 1L5RA 1E99A 4GI1A 1GSIA 5AKLA 4EBFA 3PGMA 3K0BA 3W4IA 2ORED 1WBJB 1F4PA 2F1JA 2C83A 4B4UA 2ZB4A 2ZDQA 3H2JA 4LJKA 3LLUA 4H6WA 3EFOB 2PL9A 3G17A 4RIFA 3VH2A 3ILXA 5KINB 2QXYA 1KFBB 1OI7A 1XCGB 2IEDA 2C5SA 2AUTA 2FLVA 4YIKA 2ZJ7A 3O92A 5D7BA 1DCMA 1IB0A 4JYZA 1R50A 3O7WA 1URPA 2EJTA 3D64A 3GDHA 1TZJA 1ZH4A 2XUIA 4EL0A 4KU4A 2H1FA 2O2YA 1GLVA 1KR2A 3UUWA 2R4QA 4DT1B 2Q45A 3OFJA 3UYLA 3PZBA 1YRHA 1WNFA 1A4RA 4NU8X 4FFBA 4I5DA 5HK8A 3MSCA 1ABEA 3RJZA 2P2LA 1TYEB 3WY9A 4F4DA 5A04A 5DNUA 4HVCA 2VK8A 1MFPA 1QANA 2I3ZA 3K1ZA 3S8EA 3ZQKA 2BEUB 1VJ1A 3E03A 3ELUA 4KQFA 4QYIB 1LDEA 1Y8ZA 3GJ5A 5LMCA 4BNDA 3CBQA 3G23A 1S8OA 1Y98A 3ZOZA 4IHJA 4NEQA 1LCIA 4XFDA 5C80A 1CF2O 3T12A 3L43A 4I0WB 3TB4A 3WWCA 4RPHA 3D6AA 4F21A 2X0RA 4LDJA 3AVWA 3FKSD 1PR9A 4IHAA 5JECA 4HWRA 1FFSA 2I1VB 5LQNA 1SCQA 3PBKA 5EHZA 3D1LA 3ZHRA 2I33A 1FMCA 4FYWA 4BGEA 2QP3A 3H9QA 3R1IA 1PR5A 4V2IA 3ZHXA 1R4MB 1H2XA 3QEMB 5B4UA 1DE0A 1GPUA 3W9UA 1JAHA 2R8BA 2G9NA 1LA2A 4RHYA 3GRRA 3QFFA 2VS1A 1APBA 1EIWA 3I62A 2AA3A 4R16A 5C8YA 4RTQA 2PAFA 2UYYA 2ZU0C 3FWNA 3N6RA 4BJ5A 3QM1A 4B9AA 2GZRA 3GNTA 3TQFA 1MB0A 2X5OA 3FZYA 2ZRAA 1MEOA 3LBYA 1ZK4A 3V1MA 3EODA 3QKSB 1O6BA 4LDNA 2V45A 1D1PA 4QUDA 1USKA 2PK3A 2QL5A 1QPBA 2ES4A 1ZJ4A 4WXHA 1KDVA 4TVSA 1K7CA 3CVWA 4R3WA 1SXJD 3PDJA 4KQ1A 1KDRA 5DLYA 3VH4A 4HGQA 5TV2A 3PNKA 4DADA 4LGYA 2FG7C 2OCIA 4JUCA 4JXZA 4B6OA 5DHQA 4JL6A 4X66B 2J7KA 1PNTA 2CCGA 1JJAA 3UMJA 1Z7BA 1U3CA 4BGIA 2L82A 2NXWA 5ICMA 3IOEA 3HWSA 2BGWA 1M8GA 1FLAA 1QWSA 2PYDA 1XQVA 2AX3A 2R66A 3FNQA 2M1XA 4DM3A 2Q6TA 3PC3A 4F6RA 4FGLA 1D1SA 1BZYA 4KN9S 1V11B 3DEAA 3ABZA 1BCSA 2P2GA 3RYHA 2E5WA 2E4VA 2IYFA 4EITA 4F4UA 2JAPA 2NAFA 3LBFA 4TN1A 4CFZA 2NM0A 3NKLA 4L3VA 2ZE6A 1JTEA 4D3FA 1P4RA 3CIOA 3DL2A 3ENWA 4NCHA 1TF7A 2ZS7A 2V9PA 4OQZA 4W63A 4YHBA 2GFHA 3WXBA 2VHEA 4M0FA 3PJGA 4L6AA 5J2TF 1WCIB 4AJEA 3ZDBA 3GF4A 2GM4A 3CEAA 4DV3B 1C1XA 3FSGD 2HDHA 1NC1A 3KR2A 3D3QA 3ILVA 4P7BA 1Y4DE 3KKQA 3DAFA 1BSVA 1V2GA 1CS0B 3VC3A 1ZXLA 2XNKA 2V6BA 3FAZA 1VPEA 3GLIB 3I9MA 1RXIA 7REQB 3QWIA 3R3YA 1NNEA 2M1ZA 2RKWA 1JT9A 2NG1A 2FPIB 2Y1DA 1B2RA 1K3TA 2HL6A 2ZYWX 4ES6A 2QD3A 4Z5XA 5CLJA 4PS0A 3EG9B 3HJUA 2Q7OE 4GF5A 4AO6A 1A4XA 4F5EA 4KC0A 5KOIA 1XFAA 3Q1LA 3TSYA 4MUMA 4DIMA 2KM1A 1JI0A 1PSZA 3OCVA 4MYTA 3DAGA 4U2BA 4TLLB 5LP6B 3OZRA 1S3GA 2WT4A 4UXJA 3BXEA 1IJFA 4O3MA 1RMYA 4J0IA 4E3ZA 4QAQA 4X65B 4KBFA 4ZVRA 1RRKA 4XQEA 1T8YA 4IJMA 4JT8A 1Q7GA 4WADA 1KK2A 3WHPA 1P3DA 2H8GA 1H5QA 1XPJA 2HXSA 4M1ZA 4XCXA 1A5BB 3JAWA 1J8QA 3QEMA 3CRMA 4Q9HA 2AR9A 1ZSYA 2UYGA 1K6EA 4LX8A 2PYIA 3RG2A 1PJTA 1U8YA 3CRW1 4BTLA 4CFSA 3EQZA 2W42A 3F7OA 4AZSA 1UBJS 1W93A 1YQDA 2WKSA 4QE3A 5BT9A 1U2GA 3T41A 1XCMA 4E94A 4LHYA 2FPXA 2A84A 2J1LA 2Z6VA 3FKSA 3HNRA 3K9NA 5EMHA 3RO7A 2YXDA 3W8DA 1OA0A 1PD1A 2RKOA 1HE8B 1KAEA 2EFGA 4RORA 3IXLA 2VDJA 3RJ5A 1RADA 3BA1A 4ZQCB 4DG9A 3B2QA 2EW2A 3SE0A 2VXBA 1KKLA 5KWSA 2P35A 3QZUA 3VPFA 3GLSA 3H11A 2QZ9A 1XVAA 1W9MA 2E37A 3A25A 3BDVA 5FNZA 2OGSA 3NNSA 4JC0A 1M0EA 1EFKA 2XXBA 3KZCA 2C42A 5CFQA 1SVKA 1Y1TA 3LWNA 1EJ2A 1DKLA 2OHJA 2FUG1 4WSOA 5IDWA 2BKEA 2NO0A 4B09A 3O8NA 1PQWA 4N40A 4M9CA 2PX0A 2V9CA 4YJFB 4E5MA 3QVUA 3RWOA 1DUVG 4IDOA 2GZSA 4L0CA 5C31A 5LOVB 3E2IA 4TYNA 1ZINA 2FKNA 1U4SA 2NAPA 4MHSA 1LBSA 4BVJA 4JVLA 2J7PA 1QCCA 1EK6A 2AE2A 5CURA 5FR2A 4FEYA 3G89A 4YRDA 4EVIA 4M2LA 2PMWB 2GETA 2BGGA 2IF2A 1I3MA 1UBCA 4TKUA 3SKXA 3U4QB 2HK6A 3IMEA 3BHNA 3V6LA 1AUOA 1RJEA 1X1QA 2A35A 2FR1A 3G9UA 2EZ8A 5AUPB 2HW8A 4QODA 3H13A 4CCWA 4XSHA 1AY0A 5HCNA 2PQ2A 4JJ8A 3BRWD 3EOBI 4YI3A 3QVMA 3AHJA 1KDTA 1R12A 2JGNA 1H6CA 4I9NA 2X9NA 1YBFA 2HU5A 2J0UB 3R7SA 2O1EA 1L8XA 2PX5A 2GHQA 3KQPA 1E4VA 1ZHHA 4PEVA 1F8UA 3CEJA 2GSWA 3ABSB 3FWYA 4FUQA 4EBBA 1BX1A 2EFYA 3AKYA 2WAXA 3F2IA 4PYLA 3RVMA 1H66A 1WNTA 1U7ZA 5A0VA 1JILA 1Q0RA 3A7DA 1VBKA 3PR1A 1F20A 2ZRHA 4D8VA 4RFLA 4DCGA 5J4YA 4E5NA 1SKQA 4RM3A 3AO0B 1MR3F 3WGNA 4QFBA 5IXYA 1PUIA 1G16A 5CNIA 5IWCA 3ZYCA 3M6LA 4P5PA 4RZ2A 3PLNA 5FBLB 2ZCJA 4OTZA 1OSNA 3B1ZA 3ZDRA 4B3SB 4UM7A 1G4HA 4OMCA 1D5CA 4MQUA 1G21A 3HA7A 3H5AA 3KKZA 1CDEA 4S0ZA 1XROA 3EFOA 1EDZA 4LQDA 4XD7A 2AKAB 3A14A 3MS4A 1S2DA 2GEBA 2P68A 5BWNA 2VFAA 3KSMA 3G2HA 4JX8A 2I55A 2BGNA 3R6DA 1LX7A 3FOBA 2EATA 1YZHA 2XEXA 2IW3A 3ONFA 3SF8A 4D98A 1QQBA 4PSDA 3PNLA 5IZCA 5KTMA 2HYIC 2GEVA 2UDPA 1TU0A 3AKDA 4L1KA 2AW3A 3I42A 5EQDA 4UNRA 1REQA 2FWNA 2WNIA 3JQBA 1MMFB 3FFXA 2FFQA 1UKVY 3FYDA 3N8HA 4X54A 1NUUA 4XJXA 2BEUA 2OV3A 4PX2A 1HDIA 1MHTA 1PS9A 2C97A 3P2EA 4XVQA 4DMMA 4W9MC 1CV2A 1GR0A 1WEHA 2HPZA 2J46A 3GNQA 3HADA 3IODA 1X7YA 3W6OA 1EFUA 3SIPA 1WXHA 2OXEA 4FX2A 1EK1A 4G0YA 1PGNA 1IN5A 4Q4JA 3ZE0B 4KRGA 3AR9A 1DU4A 1EFRD 1H9AA 2YFYA 3CZ4A 3D3JA 3H5VA 4R69A 5CHEA 4IF6A 4L2IB 2DQYA 4TTJA 4HX2A 3CLRC 4PTLA 1CC1S 3NEAA 1UPAA 1MQ8B 1KKMA 4UM5A 5E95A 3M6XA 3QFHA 1J21A 2C3OA 3NDPA 1CETA 1T9BA 3Q0IA 4GXQA 3WMXA 4JOCA 4AO7A 4C5AA 1KZ4A 3WFZA 4EG6A 4LGMA 3GMIA 1V5IA 3UA3A 1HM5A 1TE2A 3OPXA 4NXNB 1E7RA 5L3QA 4YJDA 3K2EA 3GIDA 1VYHA 5ED0A 1BVRA 3H18A 4J16C 4O4HA 4XA8A 5KJ6A 4ZMBA 1GA1A 3ZVKA 4JBXA 2IYQA 5FTWA 4G5RA 2NACA 3WGZA 4CT0A 4D3SA 4DCCA 4JEHA 4ER3A 1Z6XA 2EZUA 4NFYA 2NLOA 4I3FA 4BYGA 1FZQA 3G8AA 1FRFS 5FFMA 5CYGA 1DOZA 3LBIA 1N6KA 4G1EB 3TM5A 2X7JA 1E1DA 2G9VA 2XGMA 3VTFA 1JX6A 3KSBC 4OA8A 3X1MA 3DSRA 3EGDB 4KREA 1M34A 4WA8A 1OH7A 1DAOA 3LP6A 4MS3A 4WLVA 3UAGA 5A9SA 1GU7A 4E88A 1SCKA 4J0KA 3I4CA 2AJBA 3RHTA 4NARA 2ONCA 4HAXA 4XQCA 5DGXA 2R6JA 3T1OA 2D4AA 2ETXA 3NNDA 1MIOB 1Z2OX 4UEQA 5BO5A 1GPAA 4DWVA 4OQYA 1FMJA 2YINC 2QUHA 3DDHA 1YA4A 4G2NA 5AI0A 2OB1A 4H60A 4DDUA 1NW8A 4KO3S 2EVWX 3ONEA 4KQ6A 1QH1B 2QS9A 1BMQA 4M0LA 1ZUD1 3EJWA 3G8DA 1P1IA 5D86A 5DLDA 5BR7A 3P2MA 4BU0A 4J1TC 2QDKA 1WHTA 2DZDA 1ORDA 4Q48A 2BKAA 2Z4SA 4MGYR 3VU0A 1U31A 4LZLA 4U3JA 3GPDG 3M6AA 4IJ5A 1CX9B 1HBJA 1HEIA 1VKOA 1BC5A 5EMLA 5IVIA 2A59A 1WO8A 1Y8RA 4W8HA 4BIMA 4C0LA 4NQRA 1HGXA 1O87A 5C34B 1GSAA 2XMGA 1I9CA 4HB3A 5B1SA 1C1HA 1YJ5A 5E7QA 3PQDA 1BKDR 4G67A 3IQFA 3OOWA 2QHXA 3WNVA 2HAEA 3P9NA 2CXOA 2FHPA 3U4GA 1WPRA 2ZIZA 2A88A 4OXKA 3R24A 4QBIA 4RY0A 4G56A 1G5HA 4EIWA 2Z1DA 3UAZA 3WLOA 5FAXA 3EFBA 1GQRA 2XV1A 2RGGA 3WRVA 3ZE1B 1ZD5A 3JQ9A 3H8JA 4P7JA 5DTIA 1YH3A 5EHIA 2OK7A 1VLHA 3I6IA 4GMKA 3UW3A 2CXXA 3FNIA 3OI7A 1N9ZA 2Y9MB 2IXFA 3B7PA 4P4SA 1T5DX 1UP7A 5NULA 2H17A 3IT3A 1RPAA 1IY8A 5K09A 5L7TA 2PFGA 1BXKA 2JCBA 4TTTS 3QXGA 1NVVR 4I9GA 4WA7A 3ZHOA 1WLYA 3HJTA 1RYHA 2UZ4A 4FDLA 2PQMA 2MSCB 4OMFG 1A72A 1DFGA 1VTKA 5IAEA 1RMTA 3PI7A 2Y76A 4AD8A 2RHBA 3TVYA 4MW2A 3TD2A 2OGWA 2QN1A 4F3YA 4CMCA 3RUEA 4BLWA 3BMXA 4RZHA 3W1VA 1Q0UA 1V8DA 5CIWA 2MYPA 2PL5A 1D5WA 2VHQA 3F6SA 4Z54A 4DHEA 2Q2NA 1LBHA 1JI3A 1QV9A 2GQ0A 2WLSA 3G0DA 3I45A 3JY6A 3L79A 3MWFA 3P4XA 4YRQA 2FR0A 3LKDA 3KQHA 2DFPA 1FX1A 2IU3A 2V8OA 2Y0PA 3E22B 4H7JA 5EPOA 1QPZA 3CH4B 1CDOA 4NJMB 3D1VA 2OYRA 4CN8A 1IULA 4K40A 4ARVA 4DUZB 1O2DA 3IO5A 4LHZA 1PHRA 3KPWA 2VYVA 5LQKA 3RD5A 1OB2A 4EFLA 2K5UA 3S2FA 3TINA 3TLAA 2BMVA 2GLUA 2PU5A 3I52A 4LXXA 2UKDA 3CNOA 3AT1A 4QQKA 3E3AA 4JLUA 5FBRB 1NNI1 4QJBA 3ZZUA 3O38A 4NULA 3OE1A 5DHRA 3U3ZA 5TE9A 5C46F 4TS9A 2GD6A 3ZLUA 4QVIA 4YV0A 3EIUA 3I76A 4KN6A 3AF0A 4MVJG 5AW7A 4A23A 3ZWXA 2A0FA 3A4NA 1BFKA 1EQUA 1XEXB 1MABA 2VPPA 5HFAA 3JD2A 4RMJA 2ATIA 1H42A 3TW8A 3ZKAA 1PFVA 4L50A 5CLQA 4C6HA 3O03A 2RH4A 2BH9A 5ADUS 3IDZA 1RTKA 2CMGA 2YZ2A 5A9SB 3EGWA 4HS9A 3TDKA 4F4HA 3UPUA 2PMCA 3DZIA 4OUDA 1KU6A 1GZDA 3OF3A 5AM1A 4X7PA 1RAFA 3G85A 3WYBA 3OUTA 5F98A 2CNOA 3FNBA 2OWEA 2VPQA 1JFFA 3D4IA 3FG9A 3WWYA 4IIFA 4KPYA 1P6UA 2QSJA 4CKCA 4ECEA 2NTNA 1AC5A 2OFXA 3LL4A 3LCJA 3Q5DA 3UK0A 1YQUA 2I0FA 3OEEA 4NE2A 5AM5A 3WK5A 1QTQA 1PZGA 1IOWA 1Z17A 4ZJYA 3LQFA 2D7JA 3KALA 1V41E 3KQUA 4TLMB 5KNCD 3CUWA 1S3IA 4LHVA 1G3RA 2A0XA 2QP4A 4QBFA 1X7ZA 1X42A 1MZVA 2Q4TA 4PM4A 4WCFC 3TQIA 3Q72A 1I2BA 1N2HA 1PSWA 2BONA 5J9FA 5EYPB 1QF7A 3W7AA 1L4KA 4AFNA 4B3DA 4B0PA 4U3JB 4QELA 4J7AA 3TZKA 3AWDA 1A77A 2QNBA 3NG1A 5A3SA 2ZIEA 2NO1A 3ZWMA 3LCCA 4K9PA 3H3JA 1QO9A 2Z2IA 1F06A 2JARA 4BMYA 4CM9D 4X85A 1T4GA 6NULA 2A0YA 2P2DA 3W6NA 1JSCA 1Q2UA 3H65A 1WZIA 4TM7A 4ALJA 1P9OA 2I99A 5CXXA 4UD6A 1SCDA 2G76A 3VO9A 4K3VA 2YCLA 1I24A 2J30A 3FZEA 2XUOA 3K4PA 3KQYA 4JWTA 4YJ2F 3KJGA 3CW2A 4NL4H 1Y1QA 2VSYA 4DDKA 2DXIA 5JAOA 4BRZA 2OM2A 4HEQA 1QNLA 1UZNA 2VJPA 2WF9A 1A4UA 2O2GA 4FT2A 1C29B 4MIKA 5JYCA 4Q1DA 1T9ZA 2XWJI 1HDCA 5JXWA 2SNIE 1NSTA 4IH9A 1BOOA 4JGBA 4B75A 4XM2A 1POWA 4OKNA 4PWYA 1K4KA 4MVWA 4XGRA 1M2NA 2ACVA 4FYVA 1AVTA 3SJUA 3PHHA 3TSOA 3IT0A 4MI9A 1YU6A 2HO4A 2LNDA 1W5EA 3JQAA 4GBJA 4XM0A 5IF3A 4Q4LA 4QUIA 5ITZA 3MFQA 1P9WA 5LA6B 5J59A 5KSZA 3O8OB 4PAGA 1E4EB 3KCNA 4H1TA 2CLKB 4WXRA 4KGZA 2PS3A 4WI1A 4PYKA 2DETA 1Z0ZA 4WKGA 5KNLA 5ENVA 3EC7A 4FR5A 4RLSA 4OGWA 5HKKD 4NHOA 1U7WA 3D7NA 3HBJA 3JWPA 4G5SA 1ID8A 4V0ME 1ZIPA 2HT6A 2X9LA 4N7BA 2IS1A 2NU9A 4MUIA 1TLLA 5B58T 3SJAA 3F8SA 2ZXUA 3LT0A 3QBEA 4BX2A 4HB2A 5JC1A 1LRKA 3IS3A 1U9IC 2IYOA 3STWA 1G6OA 4AJHA 3M5WA 3ECCA 9ATCA 4RVHA 2WC1A 5DTMA 3WBFA 3JASA 4OPMA 1Z5GA 2IHZA 1HMYA 4B34A 2PFKA 4Z8YA 4F6CA 1XI2A 1XKTA 4MV0A 2HR1A 3C45A 4KKVA 3EFEA 1U0OC 2VRCA 3KU1A 3UAYA 4ZOQI 4TMKA 1KYXA 1OASA 3BILA 2JI4A 4LZAA 2YWXA 3ETCA 3L6CA 2PE5A 3AF5A 5K20A 1BCSB 3E7PA 3PWTA 4ZZ3A 4TKLA 4UM9D 2Y1CA 1PN3A 2GH1A 2FUCA 4HGRA 1KAMA 3IKLA 3UA4A 2CF5A 2H57A 1GCGA 4YX9A 2A7QA 3AJRA 1I13A 2FSIA 3PG5A 4AJIA 1M34B 5CR9A 2C4HA 3AF1A 1DP4A 3R44A 3SQXA 4YCDA 2IYWA 1M74A 2VPWA 2ZSDA 3RREA 4L22A 4JLSA 5JS6A 4DR6B 3AZPA 3OG9A 4GUDA 5FWXB 5LC1A 3H99A 6ABPA 1Z4OA 1E2IA 1R6VA 2EJWA 1VLJA 3C4JA 4M22A 4EYKA 4U6QA 4ARZB 3LT4A 2JIPA 1C7QA 2E0IA 2ZQ5A 4FFRA 4DDWA 3OZIA 1PGOA 2R8PA 1XTSA 5CB4B 4Q00A 1JDTA 1MC8A 3JQRA 3KTAA 1B6GA 3D6UA 3BRQA 4U4AA 1N77A 2FPIA 4WEQA 1YRYE 1LXCA 2OE2A 4XB1A 3S4YA 4IG9A 4IRXA 4PLZA 4G81A 2MSWA 2EFCB 4PG7A 5HQJA 4BLSA 3RHFA 3DBLA 4KFRA 5E3IA 2GXUA 2PZFA 1TT5A 2C96A 2NYRA 3BJZA 3MS7A 3PDHA 2W6ZA 3MN1A 2BMEA 4LBZA 2AUMA 1YR3A 1H4SA 1QS0B 2EQAA 2GTHA 1C50A 1JR3A 4DARA 3G2PA 4H1VA 2DX7A 3U7HB 3DHVA 3QLVC 1UBEA 4YUXA 1H0HA 4IGIA 5HRAA 2FP3A 1QIIA 1P2UA 1T1EA 2CXQA 2OLKA 3HZHA 1KI1A 5E4FA 3RYFB 1QOQB 4JI1B 2CNKA 3AP1A 5HF9A 3I2JA 3EWSA 5KPDA 1EUDA 1I10A 2E48A 3EBLA 3F4KA 4DBZA 3LXXA 4QNMA 4O2AF 3DYIA 3WO1A 2FGKA 2HRCA 2VT7A 1C9EA 3DUFB 1XTIA 4EK9A 3D7SA 1CT9A 1I8TA 1V16A 1NBAA 3GD5A 3BSYA 3GJSA 2UVPB 3NTRA 4KV7A 2I65A 2JHFA 2XZDA 3OZTA 5LDGA 2XYPA 3S2YA 2BMJA 2KX7A 2YJ4A 1OWOA 4O2BB 4MKHA 4UAUA 4C0JA 2FK7A 1OXMA 3CXUA 1UJ4A 3AV0B 4LV8B 5FOVA 4DCNA 2C3MA 3SQWA 3DG9A 3QEAZ 5A9RA 5BMOA 1FTSA 2IY7A 2ZRLA 2ZZKA 3PKJA 1NL3A 5JADA 1JJVA 3ET5A 1KY5A 1TF2A 4GG1A 1R88A 2PVCA 4F3RA 4IHQA 3S2EA 4DN6A 4CEIB 1D6JA 2QTMA 5D6OA 3FPSA 1Y7LA 5HILA 4Y9UA 4KAFA 3WIVA 1XJQA 4OP2A 1PFYA 3GJTA 5FPKA 3HA5A 2Y3IA 3OEHD 1QYXA 1B8UA 4I8XA 4K1XA 4L57A 4AP5A 1GPJA 2P0YA 4FHEA 4N03A 3TXYA 1RQGA 4FU0A 3OQHA 4OAPA 5ICEA 4BY9E 4YCJA 1TQ2A 4K9KA 2ACEA 1GTL1 2L18A 4RABA 4HH0A 4RBNA 4ZANA 1TCUA 2GF0A 3F1KA 4ML3A 4XWGA 4YXWA 3U80A 1MENA 2CJWB 1R64A 3K9QO 5HE8A 1O96B 1UDCA 3M0EA 4F38A 2XR1A 3T99A 1Q2XA 4RVCA 2QTHA 2VPYA 4MQFB 4P92A 4XIFA 4PW0A 4UATA 4MYRA 2I8CA 2A1TR 5KO2A 4K9LA 4PZPA 4D9JA 1LRLA 1TIKA 4HDAA 1KQPA 1W4BA 3P9PA 1G6KA 4CIVA 5HZMA 2H54A 2W00A 2F3UA 1MO4A 1MKYA 3ZLVA 1WPXA 4RLQA 3DLBA 2RHJA 4UNNA 1CUCA 4JUIA 4YQYA 4RULA 1RWNA 3D7MA 1UC9A 3S7TA 3WB2A 1Z75A 4KLNA 3H9BA 4XYLA 1XLTC 1GNTA 4GX5A 3LXUX 4YAUA 1JS1X 2F1RA 1UT6A 4MP6A 2P78A 4XGNA 4EYOA 1ADFA 4UDXX 4OCZA 1CE8A 3DP7A 4HFRA 4B40A 2FN8A 2A5FA 2RJNA 1ESCA 5EWLB 3UOWA 1M8PA 1MBZA 2RGNA 4WTOA 1FYFA 2TMDA 4LPSA 2RAFA 4WD3A 1VHQA 3U7QA 3B13B 2XITA 1TRKA 2JGLA 1H2WA 2L2QA 1P8AA 1YI0A 3F6EX 4G4JA 3I01M 1H6BA 4Z3DA 3RS8A 1G20A 1OXKB 1SBTA 3V8EA 1EB8A 4CM6A 4Q34A 2PEZA 3IBTA 3WIUA 3AVXA 4KHZA 3A4MA 4CCSA 1ZWKA 2Q46A 3OWHA 3KVVA 2CNLA 1PT8A 1RHJA 3AG6A 3CKLA 1GKLA 1V7ZA 2DMRA 4FNOA 2GNAA 3C4QA 1NBWB 1ZVQA 3BK1A 3Q4GA 3T06B 2YUIA 4R05A 1WF3A 1ZIYA 3P0HA 4EB6A 3HVHA 4AU1A 1T8TA 2VDKB 1J8DA 3TKLA 1OXXK 1WRBA 2G36A 1M1NB 1SXGA 3EDCA 4B31A 4BNTA 3NWPA 1EK0A 2O2JA 3WQSB 2WSMA 2VF4X 2C7RA 1O5IA 1QH9A 2R9VA 1W2GA 3MJRA 4NOKA 2LRHA 1SVWA 4Q0MA 5TMDA 3ZXYA 1Q19A 2WMNB 1RLUA 2NO9A 4M1EA 3ROTA 4ZYYA 1D0VA 3DO6A 3S1SA 3DWEX 3C3WA 4Q7JB 2N47A 3P9IA 2VJBA 2IEAA 1EP3B 1U8UA 4R2WA 4X1YA 2BFMA 4XTCS 5TJ9A 2GBCA 4R8VA 2YC4C 3AUJB 3UWPA 2PSFA 9ABPA 1K86A 2HB6A 4CTMA 6GPBA 1H3EA 1OYVA 2PLAA 4DC1A 2ZRMA 2J0QA 4O2BA 4H0NA 5K3CA 1SA0B 3M4XA 5I7HA 1J1IA 1E2DA 3DTVA 4HSGA 1KEEA 2OO3A 2TS1A 4EO7A 3MQ2A 2A5LA 5I4KA 5A05A 1R6DA 1JEAA 3QKSA 4CMEC 2JLWA 5AQEA 4LDZA 4TWAA 5KUTA 1CB0A 1EGAA 4Y8VA 4YJ3F 1T24A 5JDCA 3BXZA 1T5HX 1ML4A 1KOJA 2BL4A 3KL4A 2P0AA 1SOVA 2DB3A 3V4PB 1E64A 4KR7A 2W8BB 3KS9A 1J07A 3I09A 1XV5A 1GARA 3HU5A 3M4ZA 1Y33E 5C0OE 4DE5A 4KL8S 2WJYA 3IURA 3P9XA 4Y2HA 1D4AA 4HZGA 2P1RA 2LCIA 3KJHA 5HQ3B 5KVCA 4IUBS 1F0NA 4ARZA 4JBNA 1KWGA 2P4QA 3N2GA 4Q7LA 3EGVA 4GLJA 3WGYA 2VAWA 1DIHA 2PXXA 4W9NA 1SOMA 5LP1A 1M5RA 2CMKA 2QLJA 3IQWA 3KJIA 3PXAA 4L4XA 4WY2A 5IYZF 3IAEA 4GPZA 2XIQA 3UWDA 4A16A 4I5EA 5FV4A 2PT9A 1CRZA 4FFLA 4JJZA 1RE1A 3BTUA 1RD4A 4HN4B 1T3ZA 4B0OA 5IBQA 5JCOA 3T5PA 5K0CA 1EU1A 4N39A 1J2JA 2JKYA 2G9ZA 2B83A 2UVQA 4O4HF 1WUJS 3RM3A 1P9LA 5CDGA 3MJHA 1GPKA 2IZ5A 4B6RA 4WZBB 2G9RA 5JJCA 3TLGA 2F00A 3L4EA 3P32A 1GDDA 2CCJA 4GYYA 4GR9A 1EGMB 4R40A 3JVUA 1DDOA 1SUEA 2PR2A 2Z8ZA 3CNEA 1YJAA 2BUCA 3ETGA 4JR1A 2J3JA 4NCNA 2V5UA 1ZOSA 1XMXA 3MUFA 1FTYA 4YC7A 4C7VA 4M88A 5DCLA 4FD3A 5J4LA 4RZ3A 3BD9A 3P9RA 4DYVA 4B6JA 4P4UA 4QBKA 4ESHA 5G4KB 5D3MA 2X5XA 5JCOC 1E60A 1QIHA 2H4FA 4D4GA 2IIQA 3RSGA 3C5CA 3FWZA 2N9UA 3U7RA 5ESXA 1GG9A 2GWHA 4JLOA 4CI0B 5KC9A 2WB2A 4DPKA 3F47A 3TM4A 3X1DA 2JLZA 3LUGA 1BVHA 1HEUA 4RLHA 4FKMA 1MQSA 3FKQA 3KT3A 4FZ3A 4YRAA 3LFTA 4R6WA 3TDMA 1E1CB 4B7UA 3H1GA 3ZHQA 1G8JA 4P0PB 1E3TA 1UWLA 4KB5A 4MCAA 4ARAA 4YT2A 2VTEA 4XX0A 3H1FA 1FDTA 3ZU3A 5AMXA 1G41A 3CVYA 3AL0C 3I2YX 1R6AA 4A6EA 1JUDA 1U3WA 3B52X 5BVHA 1NBHA 3N2EA 5KMGA 1SXHA 4C08A 5KOHA 1QLJA 4LOJA 2C4WA 4K26A 1QCDA 4H7DA 5IKPA 1A8QA 3W90A 1I9GA 4LXYA 3L02A 1EVYA 1QVAA 2G3YA 4QYMA 2Q2QA 1HLFA 3DV0B 3FCXA 4CRWB 2JFFA 4PO9A 1I33A 4IX9A 1YBHA 3BFPA 3K9WA 5JCXA 1KZ1A 4KCGA 3NIFB 1W29A 2I7XA 5KYXB 4AI6A 2C0QA 4MWGA 2R84A 2Q1TA 4HDRB 5KDOA 3AF4A 1WW3A 4JBGA 2BVNA 3ROPA 1G0OA 3CZ9A 4V03A 1IRIA 5F2NA 1XEFA 4GOLD 4ZOEA 4HXEB 1KKUA 2PKQP 1JECA 2PANA 4J0QA 3VSDA 1LK0A 1TZMA 2ONJA 3ZWCA 3RAFC 1LI5A 1UOQA 3C1UA 3P9KA 4K2AA 3WGLA 4W99A 2YN2A 4RKFA 1OLUA 3HCBA 4FMPA 2ZRFA 1UFKA 1RLIA 2GRJA 2OZPA 2DT8A 2QI9C 3K2IA 3V1LA 4EJ0A 4EYQA 5CDFE 1NPYA 4CKZA 2HPHA 3O8CA 1A69A 1BKSB 3O8QB 5C3MA 4KP7A 2WTUA 3L6BA 1RVV1 1YRWA 4LDQA 1R0BA 2XOXA 4O6VA 3RV4A 3ZCXA 5AVUA 4PSCA 2AYZA 3PQ7A 2XDAA 4DZTA 3F8WA 4S1NA 2PTGA 4F85A 4K86A 4PZYA 2CD7A 3PC2A 2Q7XA 1SR8A 2V6IA 3KETA 2F6RA 3VI4B 1DEHA 1CUFA 2PRIA 5C8YF 3DGEC 3INTA 4J1QA 2O8FB 4XYBA 3OHPA 1TKBA 1FY2A 1SU6A 3ZH2A 3UT5B 1ZD8A 3DMTC 2OM6A 1JLKA 4D42A 4E4YA 3AY3A 5IAGA 2WWIA 2PS1A 4U2CA 1ACLA 2F2TA 3WKAA 4ZKEA 3TLYA 5EJ5A 2ZRNA 1SVSA 2JJQA 1E7WA 2J0UA 3VPXA 1CIJA 1KYYA 1N0VC 5DX1A 4YRIA 5BSFA 1T0HB 1JB1A 1OOEA 3CMMA 1TK9A 1CR1A 1CQZA 5LZ4A 3HV0A 4TYPA 3WJ1A 2AHOA 3NTOA 3A0RB 4Q1CA 1IAQA 1U04A 1AK9A 3E0QA 5DHSA 2WG1A 2WJPA 1TYBE 4P80A 4EUNA 2I22A 3NHPA 3JPYA 1DO0A 2WMOB 2AMJA 3PKZA 3STUA 4XWYA 1LY1A 4EHFA 4AZ3B 4FCCA 4KPUB 2XBMA 2QAGA 3IBFA 5BUQA 5D00A 1QCYA 3UXYA 5B7NA 1L7RA 1O5OA 4FJ0A 1INLA 2NVUA 2WIAA 4M0EA 2G4LA 3BA6A 1H93A 2EW1A 5KSWB 3GP8A 4IINA 2O3QA 3JVIA 2IH5A 2QG6A 1E2MA 2PV0A 2ZIFA 2HSZA 4CLXA 2ADOA 3FTEA 5JI2E 5KTPA 3VU8A 1SCNE 1Q0LA 2WD8A 4D9GA 3N39C 3FZQA 4Y6RA 2JFYA 5CUQA 1E96A 2VKTA 2JAOA 4GKBA 4OH1A 1VMAA 2GPYA 3JYQA 4KJXA 4L72A 4U7HA 4CMBA 4DPMA 4Z99A 4ZHQA 5CBPB 2ZI7A 1C7ZA 2Y1LA 1KTVA 3OLVA 4P36A 1GGEA 1WZUA 1IXYA 4URWR 3OLXA 4RHUA 5CH3A 4HGPA 1AKWA 1VE3A 4NBSA 4GT1A 1O1YA 4Y0NA 1QFSA 1OLSB 3CCFA 5EJ4A 3ET4A 3PHBE 1SD2A 1Z7EA 2G5CA 4HPWA 4OXQA 4QUAA 3COSA 1IATA 1QH0A 2ZTLA 4OF4A 4QQNA 1WY7A 2LUOA 1HG0A 1HKHA 1Q50A 3C7CB 4CIDA 2GCOA 5EIHA 3WMEA 1BU8A 4QRDA 5SV2A 1ULHA 3GC6A 2YWGA 3DD1A 3LY9A 2A9JA 2A94A 1BMFD 1VIAA 1TTPB 5NLLA 4NOLA 1WW2A 4DLXA 1FUEA 4FWBA 3EVFA 3BWVA 3C15C 4TMFA 1RM4A 3DCIA 1Y81A 3R6WA 3P96A 3HXKA 5B1IA 3F78A 2CDCA 1FTNA 5TT0A 4OHZA 5DHUA 3WQHA 4UBNA 1T0PA 5IJ9A 4YRLA 2F1HA 4J2TA 5EMJA 1SG9A 1WCWA 4IWYA 1Z29A 5CYOA 4CLRB 3T15A 1FSGA 2V1XA 4DCSA 2WWXA 1B8PA 4ENPA 1X87A 4HLCA 4XFKA 5J2UA 2OXFA 1GSHA 4S35A 2CY0A 3T5BA 1G5RA 4QFMA 2QNIA 1DAGA 4LECA 3IPAA 3TTTA 4LE0A 5KYUB 1HYBA 1NNUA 2AHRA 2C94A 4INAA 5C3UA 4C4OA 1DJQA 5EJ8A 3DZ8A 4IGEA 4XVCA 1HPLA 5IVKA 1R2QA 3GK3A 4KQIA 3HJFA 5JVDB 4ER0A 2BDEA 2W2KB 5IJWA 5D3MB 3J7TA 5EJ2A 5TVKA 1NV8A 3AX6A 4IHKA 2P4EA 5B1EA 4N6OA 2FPOA 5HZKA 2HMAA 4RPCA 2ZS9A 5LOVF 4YDSA 3EWNA 1BG6A 1QVRA 3E2PA 4NFSA 4AKGA 4DLRA 3VAZA 2HC9A 1JALA 4EF5A 5BWBA 2H2FA 2CNWA 2G5GX 2AOVA 2FMTA 3F9IA 4G4GA 1XQ6A 1H0SA 3TOXA 3LNTA 1IOZA 4H0FA 4WKPA 1YACA 5DNDA 2Z5LA 1JF8A 2AEFA 3NH6A 5DRYA 1KEKA 1BFUA 5EIFA 121PA 3TTSA 1QRUA 4GMXA 1UAYA 1N75A 1TEXA 1LNQA 4BNUA 4K9MA 1CNFA 4HATA 3SJBA 3K94A 5JDIC 1AMNA 4M1OA 5D5PA 4YJ2A 2IA5A 5GONB 2N1BA 4QGGA 1P5RA 4D3DA 4J43A 4WKOA 5LQMA 1ZQ1A 2IS2A 4PF1A 3DVRX 4KAXA 1J1ZA 1NPTO 3LA6A 5KAMA 5HIKA 3GLIE 2GF9A 3U3RA 3NMUF 4YI5A 3QX7A 5CBPA 1V96A 5ALIA 1N1DA 5HS4A 2AZDA 3ER6A 3JARA 4MYHA 3HDVA 5CB6A 1C81A 1E5XA 2JD2A 4PGAA 1NQAO 3E3LA 4KJZA 3PX7A 1Z28A 3C8ZA 1MJFA 4JT2A 3CR8A 4RTMA 2WLTA 5ECWA 3CRNA 4N5MA 1XZGA 2QMUA 3Q9UA 2Q27A 3DBHB 3O4GA 4YRSA 5HPYB 2ZUFA 4L5JA 1CQPA 4OI0A 3PHGA 2AMLA 2GM5A 1XEAA 2P3OA 4GLOA 3RGWS 3EH2A 4B48A 3USZA 2FZEA 1XGKA 1GQYA 4GRAA 4TTPA 4YAEA 1N1GA 1QGAA 3Q87B 4CW7A 3KZ1E 1I7NA 2QPAA 1Z0UA 5DMXA 3THWA 4OJKA 5AKGA 2PU7A 2RHCA 4I50F 5JANA 4AX4A 4QDJA 3BKWA 4YV2A 1SQFA 4F3NA 2P7HA 2Z57A 1VMKA 2YFHA 3QVSA 5B6IA 5I47A 5JH7B 4GRIA 4DA7A 3VGJA 3W4KA 4EO4A 1N8NA 2JLYA 2AJTA 2EG5A 4E03A 3AZOA 2GCIA 1E20A 3KFVA 3HB9A 3UGTA 1AA9A 5DM0A 1U8EA 2CLFB 2UVPA 1C1YA 4Q03A 5AKXA 3TNJA 4B81A 4H7EA 3U1BA 3RV3A 1QHXA 3NBZC 3UH0A 3QUTA 5HR5A 1TD1A 1A7JA 1N2ZA 2YV5A 4M37A 5J5VA 3R0ZA 5FOWA 4PBTA 5JZ9A 2WF5A 3OZVA 1BEEA 5KYXA 1KBQA 4K0KB 4P38A 3PPXA 4BDSA 4HQNA 3KIPA 2VAVA 5LP6A 3MWYW 3UB4A 3UCEA 5KNDA 4L0DA 4WUTA 4J0JA 2J31A 2G8LA 3ESDA 4J6FA 3E22A 4MVCA 2ZREA 2FF7A 3JQ7A 2AE1A 4OGFA 4B3GA 1HT2E 1IEQA 3KJEA 3Q41A 4R1QA 4YFVA 5GOTA 1Z39A 4D81A 3H2KA 3ZW7A 1SOUA 1QE0A 1AKEA 1OBVA 2Z1NA 3E9EA 1CLUA 2Q3DA 4LI0A 2BSQA 5DWQA 3FSGA 2C3YA 2VDVE 4ETNA 1QRAA 2VYFA 5FPYA 3GLHE 2HMSA 3M3PA 1P4SA 3IQZA 3OUUA 1G9TA 4W5WA 2YHIA 3BWBA 1FQWA 1ZGJA 2GBIA 2X15A 3CRRA 4L5AA 3F7NA 4GXTA 3SBDA 1IM5A 2NXEA 1V25A 4BRUA 1DBWA 4C0SA 4D1YA 4KLZA 3IDQA 1L7XA 1RNLA 1Y63A 3D5TA 3DBRB 3UOAB 1P44A 1QLHA 3K0CA 4YRTA 1PNOA 3GZNA 4BBJA 4KTTE 4DSAA 3ICQB 5HIAA 3EXEB 3C3BA 1B23P 5A6SB 3RARA 3RNOA 1HF3A 2GPAA 1G8HA 3CPEA 3VDXA 3QE4A 3DFZA 3P2KA 1KL7A 4D0SA 4EX6A 3KUXA 4BKMA 3BX1A 1YC5A 3C3KA 1CUGA 1FA9A 2FNAA 2YMLA 2DR3A 3GBVA 4LWZA 4WN9B 3PXUA 5IC6A 3ZOKA 1E66A 4PLTA 4DLBA 5TQ0B 3AVQA 3WA7A 2XOKD 1ULBA 1CF9A 3K31A 3RGGA 3ZVLA 4GX1A 1ZVMA 5FUXA 1ML3A 2WWFA 1X94A 2I7CA 2W7TA 3A6ZA 4N0MA 4EGJA 2CVQA 3LUHA 4ZO6A 3ZDQA 2I4NA 4PLCA 4CTOA 2O3JA 1ZJ6A 1RS0A 1J2EA 1YCDA 3K8YA 4GM4A 4JI8B 2WFLA 2CUZA 7MHTA 3CF0A 2TECE 4BMDA 4NDAA 3EZYA 5CX1B 5IJ0A 1BXZA 4YRNA 1BDHA 3TG2A 4YO7A 4TLBA 3B5JA 4Z4FA 3M6VA 4LVNA 1YE3A 3EF0A 4HNAA 3STTA 4ARBA 3OO0A 1P3JA 3THWB 1U0JA 4DNQA 2WY2D 2D2VA 2V6JA 2WTXA 1NNLA 1CUWA 3Q2IA 5TPZD 1PR2A 1B43A 5LU9A 4BEJA 3JQAD 1QIKA 3VPGA 1OHHD 4X97A 2Z8YM 3O8LA 4OAQA 3LQQA 1PRYA 4FYKA 3IUQA 2LW7A 2VJMB 3GPBA 5FBQB 5CCEA 3U7FB 4N8DA 4ITRC 4G0WA 3K0SA 1EA5A 2DFDA 3IP9A 4I9FA 1M2HA 1SVUA 2DLNA 4Q12A 3ENQA 2JLSA 4DIBA 1B74A 3IV7A 2JIQA 2GJAA 1ITZA 3O0TA 1HE4A 2Q3LA 2A7XA 4F2PA 2G77B 4D99A 3PXDA 2GZ3A 1N2EA 1T36B 3B7GA 1L7OA 1DXYA 3HRIA 3M1AA 4W6QA 3WADA 4BQRA 1FSPA 4AZ0A 4BTEA 1PZXA 3JYPA 1UQTA 4FDUA 2FW6A 4WNCA 1P73A 5H83A 3DMHA 3VHQA 3S99A 2QM7A 1GOTA 2ZWOA 2QY9A 3M4NA 1WMSA 2JZOA 3NAMA 3OQ6A 4B33A 3ZVNA 3T7SA 1EVIA 2KBEA 3D3NA 5KJ1A 4TRNA 3MOSA 1NVDA 4M86A 4P81A 4TTIA 3IJEB 5TY0A 1A2KC 4E4RA 2OG1A 3O3CA 3KDSE 4TTSA 2VHWA 5FF9A 3SEAA 2IEGA 3FCCA 3DZDA 1UK8A 4C9BA 2J32A 3E6AA 5EKSA 3O7MA 3D7RA 5CCXA 2IV3A 4UE6A 1T15A 1ZG3A 1XVTA 3FDZA 2Z04A 5CBKA 3ICWA 3IUMA 2H3EA 5H59A 5CM8B 5LLDA 3PSHA 3WFJA 2JA2A 3NAGA 3NX4A 3HWWA 5AK6A 5JFTA 2FXVA 4G63A 4G89A 5IDYA 1RXVA 8ABPA 3SWWA 1Z2AA 1KI2A 5H3CA 3LCVB 5I01A 1K7SN 1YS4A 2HLPA 4XIYA 1Q0PA 3A6KA 1PEYA 3NOOA 2AKEA 2PUVA 4AB1A 1JG3A 1IEVA 1O8BA 3RLIA 4B83A 2JIZA 2W2KA 4FS3A 2QG9A 2D1QA 5EHNA 2O8CB 1Z8NA 4IKOA 2RMKA 5IN4A 2R5NA 2F43A 3ZVRA 2IJGX 5CEJA 1KDOA 4IDGA 4L4UA 2FU5C 3O83A 1WE2A 3QMMA 3MIIA 5ERXA 1ILEA 3BGDA 3VGPA 1S1CA 4KVAA 1UR5A 3ZY3A 2RH8A 3Q3IA 4JFRA 4N3GA 4IXTA 5G1PA 1Z3IX 2GF2A 1ES9A 1JFLA 2JIBA 3AERB 5DNAA 5E7MA 3JAMA 1C3JA 1NDUA 1UXKA 2Q1SA 4IMJB 4WLUA 3IEXA 3S8MA 5A3RA 3IP8A 5BYKA 1E32A 2E55A 2WHPA 4PCAA 2DFVA 3HCCA 2C4NA 3BE6A 4UVDA 3IT2A 4LMRA 3KJFA 2J85A 4P54A 4X62B 1YFLA 4O3FA 3AI3A 1AXGA 1XCJA 2P9CA 4EKIA 4UPEA 3PDUA 4OLAA 2LIVA 2VTKA 3PGVA 2HSEA 4O33A 3M5PA 4H4CA 2YMPA 2C78A 3RS4A 4RV9A 1H3NA 4B2YA 3NONA 3OAAD 1KNQA 1NI5A 4JROA 3PVCA 2HA2A 2I54A 3E9MA 3GFFA 4OYRA 3JSAA 4JLMA 2E2WA 5K8VA 2AJDA 3AJAA 3R3ZA 3WNCA 3Q11A 1N7GA 1X86B 3A28A 3B1XA 5EIXA 2O0MA 1OQAA 3U9SA 1MN6A 2IYRA 3FNRA 4MWDA 4XUGB 3FJ1A 2IY8A 2X7XA 5CFPA 4PSAA 5G53C 4CL8A 3I2GA 4HDQB 2Q8QA 1WR8A 2NO4A 3JQ7B 4KACA 5FTKA 1BYIA 2JEOA 1JZSA 1OLOA 4HUQA 1GRCA 1YQQA 3R5SA 2O3SA 1UUFA 2A9QA 3JALB 5COAA 1CY2A 3E9QA 3UM9A 1X7XA 5AM3A 1VRCA 1F9EA 1SHKA 1YL6A 2HMYB 3ADDA 3DGFC 1WG8A 2GERA 2XUQA 1US8A 2A30A 2APJA 1JJBA 3G9ZA 3RSQA 3FPKA 1XDDA 2YWBA 5DP1A 2CNWD 2X42A 5H81A 1N3LA 2CGEA 4QXQA 3ND6A 4TQAA 3VR2A 1KJZA 3COJA 2VOJA 1KEPA 1PK7A 2PUWA 2W2LD 3OF5A 3WYAA 1NW9B 4OMUA 5BQXA 2QT0A 2NVUB 3IO3A 3HKDA 3LBAA 1JKXA 1IAVA 4JP5A 2XXAB 4TYQA 5I7WA 3FLAA 1JSRA 3EYWA 2H07A 3EF1A 1DLJA 5I5GA 1J8YF 2YIJA 3WL6A 3N8GA 5JYBA 1ZX1A 2HA5A 2AFIA 3KBBA 3UFXB 2EJCA 1Z74A 3EVNA 3VU3A 4ZVPA 3GLRA 3SN6A 3IUJA 1QMGA 2BFEA 4DLKA 4DT1A 3D9QX 1ZCAA 1ZGAA 3OEED 4MCHA 1H0RA 3KOZA 3QU2A 1JL3A 2RIPA 2XI4A 4D79A 1ZMBA 3R3JA 4DOMA 1SXJA 2IP4A 4ZCTA 1HNXB 1AQNA 1RCFA 3T35A 2IYLD 1WSWA 2PGXA 1B93A 1UIMA 4BXOA 5JCJD 2DHEA 3QWFA 5I7OA 2QBYA 2QB5A 3ESXA 2BEKA 4G1CA 1ZN9A 1P81A 3TQOA 3E9NA 4FI3C 5BN4A 1FBNA 5G0WA 4DNXA 4I1PA 4O1MA 4IX1A 4I1OA 2NYVA 1YHNA 2JHPA 3URKA 5CK5A 4AF6A 3R3WA 2C2HA 4MRMA 2Z0MA 2Q3CA 1CQIB 2RGUA 3H9GA 2ECQA 3W6UA 3L8DA 1EKXA 5CM9C 2AG8A 5ALYA 1MGOA 4HEJA 5ELLA 3KQTA 1P61B 5G2OA 3OE5A 1CUYA 4RM2A 1S01A 1CIPA 3RK1A 1JG4A 3UATA 4M9SA 3WDLA 5DHTA 2X6RA 5P21A 2Z6QA 4CEJB 2ALJA 7MDHA 1QORA 1NJ8A 2BFEB 4NZMA 4YNBA 3GU3A 1CULC 3NCTA 1SBQA 4R01A 4KIJA 5K3FB 3O3MB 1Z07A 4QATA 1R9MA 16PKA 2DHDA 5J23A 1CZRA 3U9LA 5KNDH 3GRPA 1KSHA 2IQIA 4ZODA 2ODNA 4J2OA 3A1NA 4NMXB 4KXMA 1XTVA 4XSGA 2FP4B 1BDJA 2FPGB 4NECA 4E5SA 3TOVA 4DV0B 2JAUA 2QQFA 3NVDA 3OX1A 3RAJA 4RANA 4MW0A 1NLYA 1WDWB 2YRXA 4LRSB 1JEYA 3R77A 5IKMA 4L6IA 3KBOA 3IQXA 3OZAA 4V0KA 3ITKA 5BSTA 2PJRA 3QXXA 3PEFA 3OURA 4FDAA 4M99A 1IPEA 1QU2A 4TYYA 4BU1A 3DWFA 2I3DA 4X3OA 2CHQA 3PE6A 3HA3A 4Z2YA 3EG9A 4M53A 3N2KB 3QF7A 2XNSA 2PSDA 4OOEA 1YJXA 3C0KA 1QGED 3WB9A 2R2AA 4DJEC 2Q9UA 2X40A 3F4LA 4MITA 3UC9A 1PVVA 4CF3A 2PD4A 2UYQA 2VF7A 2QM0A 3SS9X 3TBFA 3DKRA 1KQOA 2BHTA 3VR5H 3ZIUA 4HAZA 2J9YB 4Y2UA 2JFGA 1QG6A 1XYVA 4H4EA 2HF7A 2YUTA 4IJKA 1UKAA 3UXMA 3QW2A 3NHRA 4KPEC 3A32A 4XPIA 5J4HA 3JQQA 1QOPB 2H85A 1UXGA 3VV2A 4US2R 1N9GB 1O6GA 1IXKA 4QA9A 1U6IA 3DHYA 4YRZA 1RHQA 5KOYA 3U44A 5DBHX 3LJKA 2OZLA 4Y1RB 2O07A 5AFSA 1LS6A 3KFXA 4BMXA 2EWVA 3OBBA 4RWZA 3CBGA 5JV5A 1YR1A 3PC6A 5LUBA 4TZ6A 2VSXA 3BFKA 4URZR 2DWUA 3RBAA 3EPKA 1HNZB 1JQAA 1Y5IA 2XUAA 5AJHA 3OPNA 4C4TA 2HQ1A 4HPXB 4C6TB 4F5WA 2V7VA 1EXVA 3BCRA 3IX7A 4QJ4A 4XEHA 5K6TA 1Z0AA 1LLUA 2WHYA 3BFXA 3E27A 3A26A 5ALEA 4C3VA 2O0KA 3C24A 5CFMA 4RJTA 1R3DA 3DEHA 4V24A 2B7BA 3KT6A 2J3DA 1P6XA 4CHTA 3JARB 1W4AA 2AQKA 2F9MA 1HDYA 1QX4A 2XCOA 3QKWA 2EF0A 5CYFA 1XAGA 1YJCA 5KVQA 4BNLA 4QARA 1ONPA 1TUBA 4EO9A 4Q39A 1M73E 1XZMA 1E1KA 2D59A 3WXMA 621PA 1EPUA 3L49A 4TT3A 4RTOA 4UHBA 1E6UA 2E1PA 2O7QA 4HZIA 3BSWA 1TQ4A 1XLTA 4UAGA 4R2KA 4X94A 3OOHA 3WKBA 2CK3D 3ESYA 4B4WA 2EZTA 1QB8A 5IASA 1G8SA 1TQ8A 2DBYA 2N46A 3LPCA 2PS0A 2YY6A 3OVMA 1VBMA 1J25A 1XYYA 1HDRA 1TIBA 1RWVA 4X8LA 1JXQA 3U7IA 5AD1A 1HZZC 2PZEA 3BAZA 3FYTA 3LZ6A 5BUCA 1FP2A 4UXIA 5K6AC 5KOJB 4U7TB 4CDNA 2GK7A 1I3OA 3FM9A 4N12A 5BN4B 1ECJA 1JSXA 4LFCB 3RLFA 4CM3A 5B4TA 1FIUA 1XZNA 1SUWA 1UANA 2VF8A 2IVFA 3MJVA 1PGPA 5G40A 3SVLA 1QQTA 3ZW9A 2POQX 2O5VA 2R7KA 1W1WA 1ZDMA 3BRWA 4PR0A 3DDZX 3H6GA 4RMHA 4OLFA 4WK4B 1DB3A 1Y1KE 3DPUA 4BQSA 1Z45A 1T0UA 3HU3A 2AS0A 3AINA 8GPBA 4BQQA 1ODKA 4M1QA 3RJMA 4BB5A 3PICA 5HJ5A 3PXXA 2B2CA 2NMVA 3RUHA 1U80A 5AIAA 4EKYA 4D0RA 4Z9YA 1QYCA 5BSRA 1TOAA 2O4CA 2VAPA 4Q9JA 5GONA 4W5OA 4NK4A 3VBCA 5CXQA 5CIQA 4DCOA 4R3UC 4G5FA 1M1UA 1RRVA 2RH9B 1DI0A 3LT5A 3NRJA 4HGZA 3GCWA 3WISA 3IYLW 1KK1A 2PBFA 4NH0A 2V4ZA 3T4XA 2UZ3A 3RF6A 1T8RA 1UJNA 2YASA 4IEIA 1DIGA 4M36A 3QNWA 2QPLA 1XA3A 4X7MA 4BWGA 1J2UA 2QV7A 1IHYA 4BO3A 3QE9Y 1ZM4A 4AM8A 2DTXA 1D7OA 1TJ5A 2BN4A 4BNIA 3LC1O 3QUQA 4KWEA 1QVZA 1F3OA 1BXGB 2FY8A 3ODGA 5CCDA 4HS4A 3UMVA 2WF8A 4A6DA 4F71A 4CF6A 2W90A 4ISBA 1PR1A 2N42A 5ALOA 1JA9A 1O08A 2QT9A 3RTAA 1H6DA 3WIEA 1OH6A 2NZYA 2VDQB 2DPYA 4Y7CA 1EK2A 3VKWA 4Y0AA 4R8MA 1DO8A 2BR5A 1UQRA 2ANBA 3SK0A 4ENVA 3JAKA 4UOEA 4CEHB 1QBKC 4XPIB 3JD1A 3TTWA 3WNZA 4ZJUA 5GONF 1NX9A 3O4HA 1R0RE 2GCNA 3L8CA 2OCBA 4MI3A 1PNVA 1JAXA 2Z58A 5HEKA 3U81A 3V8PA 1VGQA 3IV6A 4QIHA 4JBWA 1Y7HA 2W0MA 1Y5MA 1UWVA 2WJJA 4YRFA 4AUMA 3ZXSA 3N7UA 1Q6ZA 3EAFA 1YDWA 4DCJA 1IL0A 3IXMA 3QSGA 2FQWA 2LP4Y 1VHWA 3LCRA 4MIYA 5F4ZA 4JB3A 4GL2A 1QO0A 3UN1A 5ECGC 3Q85A 4IS3A 5TQ2B 1TO6A 3HWRA 5JSZB 2ZVPX 2QSUA 3EOAI 4CTNA 1NJ6A 3B78A 2Z56A 4F0JA 2Z4RA 1RM3A 4EHJA 3SEZA 2I4LA 3Q0TA 4D6XA 4URYR 1PCXA 3WGTA 3OUZA 2ZRBA 4UVEA 3EXIB 3ANYB 4C4RA 1A9ZA 2ZI4A 2F3QA 4YMUA 3E5MA 3ESCA 3KEGA 1DTSA 1U0NA 3EPJA 1SM4A 4FMDF 2D3WA 3NVMB 5DF1A 1Z6TA 1JDSA 1OV4A 2I71A 2VNSA 4R98A 2YR0A 1TA9A 2P5SA 4FUTA 3LCUA 1BXRB 5JNRA 1ZNYA 2IHVA 4LXUA 4PE5B 1LLQA 4IGKA 4DIDA 4ONEA 2EKBA 3DE0X 3QA9A 3THXB 1XVIA 3IH5A 2YJGA 1O8CA 2WHRA 5DOVA 2IXDA 2QW1A 3EIHA 4D97A 1MB2A 1NAHA 1V47A 2JC3A 1S8AA 3DFMA 3NVAA 2C5GA 2BY4A 2IUFA 1OUMA 5IAKA 2MYNA 1Q84A 4GAEA 3U09A 1CG6A 3O8BA 1LU9A 3TZEA 3W7VA 3SZGA 2VCHA 4PHFA 5BSMA 3E81A 3K6RA 4FOTA 2MHCA 2P9HA 4HAWA 4HQ0A 5IG2A 1E7MA 1T35A 3FLEA 3VH1A 4MJ7A 4B8WA 2YV2A 6REQB 1T0BA 3IR6A 3V7YA 1PJZA 3NHSA 3JQEA 1FS6A 3DVAA 2IBMA 3C1TA 1VIVA 3FGZA 3C70A 4MWTA 2DUJA 2BF7A 2H48A 2XB8A 1YFZA 3GRFA 2PRJA 1L4GA 2G07A 5HDQA 1JMYA 2ZYTX 2PWBA 2XYQA 3I0MA 4NAVA 3FOZA 1WB9A 3FGOA 5EJ6A 5BP7A 3HBAA 2VLBA 2Y27A 3STXA 4XYGA 2F4NA 2ZETA 1YS6A 2E4YA 3PDIA 1KJNA 1KPIA 1IBSA 3TLXA 1KJWA 2D8MA 3TW8B 3A6HA 1N6HA 3SQDA 4UCXA 2ORYA 4J07A 4EW3A 3LTNC 4TX1A 3ZNNA 3MELA 3IQGX 3SQLA 5AHWA 2JW5A 1ADYA 3A9VA 4J3NA 4FIZA 3DLAA 3QPDA 1WCV1 3TQHA 1NYTA 5EQTA 4IS2A 1Z0SA 3EH1A 2W6JA 4TT8A 1NUPA 3ETDA 4DA6A 2C8VA 4MULA 3GOHA 2EWMA 1OYOA 3HNPA 2BSAA 5IM5A 5DP2A 4BGVA 4QASA 3VYSB 1P6QA 1Y7IA 2JJMA 4IEEA 2ZE5A 5E0KB 1SXJC 1ONSA 5JMOA 2HTFA 2YHBA 1FTWA 3BIWA 1ECBA 1J6UA 4XRGA 1PE0A 1XJCA 5C7IO 3ZDCA 1B00A 1GU1A 3DDWA 2O19A 2HU8A 2QI9F 2Z30A 4DUYB 4QDOA 1IBCA 1DKRA 3HPQA 3OT5A 2VBCA 4EG1A 1CEXA 4OHVA 4P6VF 4QZVA 1VYTA 3PLAE 1FP4A 4KLAA 3H7AA 3EXIA 3G0OA 5B1DA 4OH7A 2BKUA 2J45A 3CH6A 4BFXA 3GY0A 4U7DA 4LY3A 1Z83A 3NCHA 2P69A 3P2JA 3SAJA 1CVRA 5JAHA 4YV7A 4JXKA 5IEJA 3AMVA 2J0SA 4ZU3A 3AIMA 1NMYA 1LDGA 3GFBA 2O54A 1AQIA 1Y9EA 3P0JA 3BBLA 2H2WA 4WOBA 3UQYS 4RVSA 4RVDA 1DAEA 2ZPUA 1CTQA 1PTKA 3UJ6A 3MCWA 1PEDA 2V7QD