3OCDA

Diheme soxax - c236m mutant
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
229
structure length
229
Chain Sequence
ANPGFLNVDRGEVLWSEPRGTRNVSLETCDLGEGPGKLEGAYAHLPRYFADTGKVMDLEQRLLWCMETIQGRDTKPLVAKPFSGPGRTSDMEDLVAFIANKSDGVKIKVALATPQEKEMYAIGEALFFRRSSINDFSCSTCHGAAGKRIRLQALPQLDVPGKDAQLTMATWPTYRVSQSALRTMQHRMWDMYRQMRMPAPDYASEAVTALTLYLTKQAEGGELKVPSIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SoxA
publication title Diheme SoxAX proteins - insights into structure and function of the active site
rcsb
source organism Starkeya novella
molecule tags Heme-binding protein
total genus 62
structure length 229
sequence length 229
chains with identical sequence C
ec nomenclature ec 2.8.5.2: L-cysteine S-thiosulfotransferase.
pdb deposition date 2010-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3ocdA01
1.10.760.10 Mainly Alpha Orthogonal Bundle Cytochrome Bc1 Complex; Chain D, domain 2 Cytochrome c-like domain 3ocdA02
1NNOA 3A0BV 1J3SA 2ZOOA 3X39A 4J20A 1KYOD 3ZCFA 1JDLA 1SQVD 2CXBA 1DW3A 1H9YA 2QJYB 2FRCA 5H2FV 1A8CA 5C9MA 5GTHV 4PW9B 1RZ5A 3CU4A 2QJPB 1PPJD 1SQXD 2C9XB 1FI9A 4FANA 1HZVA 2B11B 1H32B 2YK3A 3RN1A 1WEJF 4NFGB 1OAEA 1H33A 2LIRA 1SQQD 1AYGA 1I6EA 1NIRA 3WC8A 4D6TD 2BCCD 3L74D 5IY51 3O1YA 1GU2A 1S5LV 4JCGA 2CE0A 1KB9D 1CCHA 3BCCD 1L9JC 5KAIV 1I6DA 1GKSA 3PH2B 4H0JA 1CYJA 3CXHW 5B5EV 4K3IA 1AKKA 2XTSB 1M70A 3A0HV 2CA4B 3ZIYA 1C6SA 1DVVA 2N9JA 1YCCA 2BPBB 3L71D 1CYIA 3HQ7A 2L4DA 2C8SA 4EICA 1BCCD 5DJQB 3L72D 5C0ZA 1N15A 3L4OA 1H1OA 1CHHA 1HJ3A 2CA3B 3DR0A 1FJ0A 2DGEA 3CX5D 1M6ZA 2BLFB 1I55A 5EXQA 5KLVD 4WQAA 3WFEC 2GB8B 3VNWA 1HRCA 1I8OA 1QN2A 3TYIA 1C6OA 4PD4D 3A9FA 2AIUA 1GDVA 2C2CA 3H1HD 1KV9A 3ZOOA 1U74B 4WQ9A 2QJKB 1E8EA 2LITA 1CXCA 1IRWA 2GC4D 1FHBA 3OA8B 2D0WA 1DIIC 4RSZA 3ZOYA 1GQ1A 1B7VA 2FYUD 4U3FD 1FI3A 2YCCA 1CCRA 1C7MA 2PCBB 2B0ZB 3M97X 1E2RA 1AOQA 5KAFV 2N18B 4V2KA 1CC5A 1L0ND 5CIDB 1DW1A 351CA 1N90A 3DP5A 1COTA 2V07A 3RN0A 3RMZA 2V08A 3MK7B 1LMSA 3SWSA 3CWBD 1FOCA 2C1UA 1P84D 5DF5A 2C1DA 1KB0A 1CEDA 1ETPA 1CTYA 1H31A 4O1QA 2GC7D 5KLIB 3O20A 3OCDA 4H0KA 1DW2A 4AALA 1KYOW 1NU1D 3CXHD 1IRVA 3NWVA 1CHIA 1BGYD 1W5CT 1DT1A 2D0SA 1HCMA 3HQ8A 4L3GA 1CIHA 5B6QA 3H1LD 3OA8A 3O5CA 2VHDA 3SVWA 1MG2D 2YIUB 5AURA 2MHMA 1E29A 1YEBA 5CIFB 1RAQA 1HH7A 1C75A 1K3HA 1GJQA 2ZZS1 1RZ6A 4DY9A 3C2CA 3ZBMA 4WQEA 4YE1A 4L1QA 4WQ7A 1QL4A 3NBTA 4FA1A 1F1FA 1L9BC 3L73D 1IO3A 1OCDA 2A06D 1NMLA 5CYTR 1H32A 5CIHB 3HQ6A 3WFDC 5CICB 4WQCA 4L3HA 5CIGB 4FA4A 2I8FA 1KX2A 5DJQC 1S6VB 4N0KA 1VYDA 2DVHA 4FB1A 2FWLA 2N3YA 1YTCA 3CYTI 1U75B 2B12B 4WQ8A 5B66V 4XYDB 1EZVD 3PXSA 3L70D 1LC2A 5DFSA 155CA 1HZUA 3L4MA 1HROA 1PP9D 1RAPA 4MU8A 1CRHA 3ORVA 4EIEA 1AOFA 1CHJA 1KX7A 4LJIA 1CRYA 2B10B 2PACA 2IBZD 1YIQA 2BH5X 2PCCB 3WU2V 1CIGA 1KIBA 1NTMD 5CIBB 1EB7A 3SXTA 1CRGA 1CSWA 2OZ1B 2YQBA 4PWAA 4QAOA 4WQDA 1F1CA 1CTJA 2C1VA 4UB6V 4KMGA 4AAOA 4GEDB 3TGUD 1CIFA 3L75D 4XXLA 3ZOWA 1HJ5A 1DIQC 4EIDA 5E79V 1C6RA 3WFCC 4AANA 4Q5PA 3ZOXA 1HJ4A 1YEAA 2N18C 1DW0A 2BCNB 1YFCA 3O0RC 1FCDC 4O1WA 2MTAC 1SQPD 4FA5A 3MK7C 1BE3D 1A56A 1CXAA 1IQCA 3DMIA 2GIWA 2AI5A 2N9IA 1I5TA 3HQ9A 3NBSA 4AAMA 3WFBC 1CTZA 1A2SA 1N9CA 2BH4X 2N3BA 1CSXA 1C52A 1CRJA 3PXTA 1SQBD 4PJ0V 5GTIV 2JTIB 1NTZD 3VRDA 1CSVA 1FI7A 1CRCA 2ZBOA 1N50A 1H9XA 2ZXYA 1GIWA 1LS9A 4FAVA 3H1KD 2OZ1A 1YNRA 4UB8V 1MZ4A 2ORLA 1R0QA 1I8PA 4IL6V 5TISV 1CYCA 1ZRTD 1L0LD 3RLMA 4FA9A 3JBTB 1DVHA 3SJLA 4GYDA 3VYMA 3WUIA 1CIEA 1NMIA 1H33B 4AX3A 2C1DB 3CP5A 1K3GA 1H31B 2JQRA 1QYZA 1LFMA 3OCDB 3H1ID 1MG3D 3KZIV 1IZL0 2HV4A 1LC1A 3PXWA 3CX5W 1CO6A 4P4QB 2EXVA 1CORA 1C2RA 5KKZB 3SLEA 3H1JD 1CRIA 1QKSA 1QL3A 1W2LA 2CE1A 1CSUA 4Y5RA 2FYNB 4EIFA 4WQBA 2ZONG 1C2NA 2B4ZA 2BGVX 1WVEC 2AXTV 1YICA 1NTKD 1CNOA 5CIEB 1M60A 1BL9A 1I54A 1ZZHA 451CA
chains in the Genus database with same CATH superfamily
1NNOA 3A0BV 1J3SA 2ZOOA 3X39A 4J20A 1KYOD 3ZCFA 1JDLA 1SQVD 2CXBA 1DW3A 1H9YA 2QJYB 2FRCA 5H2FV 1A8CA 5C9MA 5GTHV 4PW9B 1RZ5A 3CU4A 2QJPB 1PPJD 1SQXD 2C9XB 1FI9A 4FANA 1HZVA 2B11B 1H32B 2YK3A 3RN1A 1WEJF 4NFGB 1OAEA 1H33A 2LIRA 1SQQD 1AYGA 1I6EA 1NIRA 3WC8A 4D6TD 2BCCD 3D0WA 3L74D 5IY51 3O1YA 1GU2A 1S5LV 4JCGA 2CE0A 1KB9D 1CCHA 3BCCD 1L9JC 5KAIV 1I6DA 1GKSA 3PH2B 4H0JA 1CYJA 3CXHW 5B5EV 4K3IA 1AKKA 2XTSB 1M70A 3A0HV 2CA4B 3ZIYA 1C6SA 1DVVA 2N9JA 1YCCA 2BPBB 3L71D 1CYIA 3HQ7A 2L4DA 2C8SA 4EICA 1BCCD 5DJQB 3L72D 5C0ZA 1N15A 3L4OA 1H1OA 1CHHA 1HJ3A 2CA3B 3DR0A 1FJ0A 2DGEA 3CX5D 1M6ZA 2BLFB 1I55A 5EXQA 5KLVD 4WQAA 3WFEC 2GB8B 3VNWA 1HRCA 1I8OA 1QN2A 3TYIA 1C6OA 4PD4D 3A9FA 2AIUA 1GDVA 2C2CA 3H1HD 1KV9A 3ZOOA 1U74B 4WQ9A 2QJKB 1E8EA 2LITA 1CXCA 1IRWA 2GC4D 1FHBA 3OA8B 2D0WA 1DIIC 4RSZA 3ZOYA 1GQ1A 1B7VA 2FYUD 4U3FD 1FI3A 2YCCA 1CCRA 1C7MA 2PCBB 2B0ZB 3M97X 1E2RA 1AOQA 5KAFV 2N18B 4V2KA 1CC5A 1L0ND 5CIDB 1DW1A 351CA 1N90A 3DP5A 1COTA 2V07A 3RN0A 3RMZA 2V08A 3MK7B 1LMSA 3SWSA 3CWBD 1FOCA 2C1UA 1P84D 5DF5A 2C1DA 1KB0A 1CEDA 1ETPA 1CTYA 1H31A 4O1QA 2GC7D 5KLIB 3O20A 3OCDA 4H0KA 1DW2A 4AALA 1KYOW 1NU1D 3CXHD 1IRVA 3NWVA 1CHIA 1BGYD 1W5CT 1DT1A 2D0SA 1HCMA 3HQ8A 4L3GA 1CIHA 5B6QA 3H1LD 3OA8A 3O5CA 2VHDA 3SVWA 1MG2D 2YIUB 5AURA 2MHMA 1E29A 1YEBA 5CIFB 1RAQA 1HH7A 1C75A 1K3HA 1GJQA 2ZZS1 1RZ6A 4DY9A 3C2CA 3ZBMA 4WQEA 4YE1A 4L1QA 4WQ7A 1QL4A 3NBTA 4FA1A 1F1FA 1L9BC 3L73D 1IO3A 1OCDA 2A06D 1NMLA 5CYTR 1H32A 5CIHB 3HQ6A 3WFDC 5CICB 4WQCA 4L3HA 5CIGB 4FA4A 2I8FA 1KX2A 5DJQC 1S6VB 4N0KA 1VYDA 2DVHA 4FB1A 2FWLA 2N3YA 1YTCA 3CYTI 1U75B 2B12B 4WQ8A 5B66V 4XYDB 1EZVD 3PXSA 3L70D 1LC2A 5DFSA 155CA 1HZUA 3L4MA 1HROA 1PP9D 1RAPA 4MU8A 1CRHA 3ORVA 4EIEA 1AOFA 1CHJA 1KX7A 4LJIA 1CRYA 2B10B 2PACA 2IBZD 1YIQA 2BH5X 2PCCB 3WU2V 1CIGA 1KIBA 1NTMD 5CIBB 1EB7A 3SXTA 1CRGA 1CSWA 2OZ1B 2YQBA 4PWAA 4QAOA 4WQDA 1F1CA 1CTJA 2C1VA 4UB6V 4KMGA 4AAOA 4GEDB 3TGUD 1CIFA 3L75D 4XXLA 3ZOWA 1HJ5A 1DIQC 4EIDA 5E79V 1C6RA 3WFCC 4AANA 4Q5PA 3ZOXA 1HJ4A 1YEAA 2N18C 1DW0A 2BCNB 1YFCA 3O0RC 1FCDC 4O1WA 2MTAC 1SQPD 4FA5A 3MK7C 1BE3D 1A56A 1CXAA 1IQCA 3DMIA 2GIWA 2AI5A 2N9IA 1I5TA 3HQ9A 3NBSA 4AAMA 3WFBC 1CTZA 1A2SA 1N9CA 2BH4X 2N3BA 1CSXA 1C52A 1CRJA 3PXTA 1SQBD 4PJ0V 5GTIV 2JTIB 1NTZD 3VRDA 1CSVA 1FI7A 1CRCA 2ZBOA 1N50A 1H9XA 2ZXYA 1GIWA 1LS9A 4FAVA 3H1KD 2OZ1A 1YNRA 4UB8V 1MZ4A 2ORLA 1R0QA 1I8PA 4IL6V 5TISV 1CYCA 1ZRTD 1L0LD 3RLMA 4FA9A 3JBTB 1DVHA 3SJLA 4GYDA 3VYMA 3WUIA 1CIEA 1NMIA 1H33B 4AX3A 2C1DB 3CP5A 1K3GA 1H31B 2JQRA 1QYZA 1LFMA 3OCDB 3H1ID 1MG3D 3KZIV 1IZL0 2HV4A 1LC1A 3PXWA 3CX5W 1CO6A 4P4QB 2EXVA 1CORA 1C2RA 5KKZB 3SLEA 3H1JD 1CRIA 1QKSA 1QL3A 1W2LA 2CE1A 1CSUA 4Y5RA 2FYNB 4EIFA 4WQBA 2ZONG 1C2NA 2B4ZA 2BGVX 1WVEC 2AXTV 1YICA 1NTKD 1CNOA 5CIEB 1M60A 1BL9A 1I54A 1ZZHA 451CA
chains in the Genus database with same CATH topology
1NNOA 3A0BV 1J3SA 2ZOOA 3X39A 4J20A 1KYOD 3ZCFA 1JDLA 1SQVD 2CXBA 1DW3A 1H9YA 2QJYB 2FRCA 5H2FV 1A8CA 5C9MA 5GTHV 4PW9B 1RZ5A 3CU4A 2QJPB 1PPJD 1SQXD 2C9XB 1FI9A 4FANA 1HZVA 2B11B 1H32B 2YK3A 3RN1A 1WEJF 4NFGB 1OAEA 1H33A 2LIRA 1SQQD 1AYGA 1I6EA 1NIRA 3WC8A 4D6TD 2BCCD 3L74D 5IY51 3O1YA 1GU2A 1S5LV 4JCGA 2CE0A 1KB9D 1CCHA 3BCCD 1L9JC 5KAIV 1I6DA 1GKSA 3PH2B 4H0JA 1CYJA 3CXHW 5B5EV 4K3IA 1AKKA 2XTSB 1M70A 3A0HV 2CA4B 3ZIYA 1C6SA 1DVVA 2N9JA 1YCCA 2BPBB 3L71D 1CYIA 3HQ7A 2L4DA 2C8SA 4EICA 1BCCD 5DJQB 3L72D 5C0ZA 1N15A 3L4OA 1H1OA 1CHHA 1HJ3A 2CA3B 3DR0A 1FJ0A 2DGEA 3CX5D 1M6ZA 2BLFB 1I55A 5EXQA 5KLVD 4WQAA 3WFEC 2GB8B 3VNWA 1HRCA 1I8OA 1QN2A 3TYIA 1C6OA 4PD4D 3A9FA 2AIUA 1GDVA 2C2CA 3H1HD 1KV9A 3ZOOA 1U74B 4WQ9A 2QJKB 1E8EA 2LITA 1CXCA 1IRWA 2GC4D 1FHBA 3OA8B 2D0WA 1DIIC 4RSZA 3ZOYA 1GQ1A 1B7VA 2FYUD 4U3FD 1FI3A 2YCCA 1CCRA 1C7MA 2PCBB 2B0ZB 3M97X 1E2RA 1AOQA 5KAFV 2N18B 4V2KA 1CC5A 1L0ND 5CIDB 1DW1A 351CA 1N90A 3DP5A 1COTA 2V07A 3RN0A 3RMZA 2V08A 3MK7B 1LMSA 3SWSA 3CWBD 1FOCA 2C1UA 1P84D 5DF5A 2C1DA 1KB0A 1CEDA 1ETPA 1CTYA 1H31A 4O1QA 2GC7D 5KLIB 3O20A 3OCDA 4H0KA 1DW2A 4AALA 1KYOW 1NU1D 3CXHD 1IRVA 3NWVA 1CHIA 1BGYD 1W5CT 1DT1A 2D0SA 1HCMA 3HQ8A 4L3GA 1CIHA 5B6QA 3H1LD 3OA8A 3O5CA 2VHDA 3SVWA 1MG2D 2YIUB 5AURA 2MHMA 1E29A 1YEBA 5CIFB 1RAQA 1HH7A 1C75A 1K3HA 1GJQA 2ZZS1 1RZ6A 4DY9A 3C2CA 3ZBMA 4WQEA 4YE1A 4L1QA 4WQ7A 1QL4A 3NBTA 4FA1A 1F1FA 1L9BC 3L73D 1IO3A 1OCDA 2A06D 1NMLA 5CYTR 1H32A 5CIHB 3HQ6A 3WFDC 5CICB 4WQCA 4L3HA 5CIGB 4FA4A 2I8FA 1KX2A 5DJQC 1S6VB 4N0KA 1VYDA 2DVHA 4FB1A 2FWLA 2N3YA 1YTCA 3CYTI 1U75B 2B12B 4WQ8A 5B66V 4XYDB 1EZVD 3PXSA 3L70D 1LC2A 5DFSA 155CA 1HZUA 3L4MA 1HROA 1PP9D 1RAPA 4MU8A 1CRHA 3ORVA 4EIEA 1AOFA 1CHJA 1KX7A 4LJIA 1CRYA 2B10B 2PACA 2IBZD 1YIQA 2BH5X 2PCCB 3WU2V 1CIGA 1KIBA 1NTMD 5CIBB 1EB7A 3SXTA 1CRGA 1CSWA 2OZ1B 2YQBA 4PWAA 4QAOA 4WQDA 1F1CA 1CTJA 2C1VA 4UB6V 4KMGA 4AAOA 4GEDB 3TGUD 1CIFA 3L75D 4XXLA 3ZOWA 1HJ5A 1DIQC 4EIDA 5E79V 1C6RA 3WFCC 4AANA 4Q5PA 3ZOXA 1HJ4A 1YEAA 2N18C 1DW0A 2BCNB 1YFCA 3O0RC 1FCDC 4O1WA 2MTAC 1SQPD 4FA5A 3MK7C 1BE3D 1A56A 1CXAA 1IQCA 3DMIA 2GIWA 2AI5A 2N9IA 1I5TA 3HQ9A 3NBSA 4AAMA 3WFBC 1CTZA 1A2SA 1N9CA 2BH4X 2N3BA 1CSXA 1C52A 1CRJA 3PXTA 1SQBD 4PJ0V 5GTIV 2JTIB 1NTZD 3VRDA 1CSVA 1FI7A 1CRCA 2ZBOA 1N50A 1H9XA 2ZXYA 1GIWA 1LS9A 4FAVA 3H1KD 2OZ1A 1YNRA 4UB8V 1MZ4A 2ORLA 1R0QA 1I8PA 4IL6V 5TISV 1CYCA 1ZRTD 1L0LD 3RLMA 4FA9A 3JBTB 1DVHA 3SJLA 4GYDA 3VYMA 3WUIA 1CIEA 1NMIA 1H33B 4AX3A 2C1DB 3CP5A 1K3GA 1H31B 2JQRA 1QYZA 1LFMA 3OCDB 3H1ID 1MG3D 3KZIV 1IZL0 2HV4A 1LC1A 3PXWA 3CX5W 1CO6A 4P4QB 2EXVA 1CORA 1C2RA 5KKZB 3SLEA 3H1JD 1CRIA 1QKSA 1QL3A 1W2LA 2CE1A 1CSUA 4Y5RA 2FYNB 4EIFA 4WQBA 2ZONG 1C2NA 2B4ZA 2BGVX 1WVEC 2AXTV 1YICA 1NTKD 1CNOA 5CIEB 1M60A 1BL9A 1I54A 1ZZHA 451CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NNO A;  3A0B V;  1J3S A;  2ZOO A;  3X39 A;  4J20 A;  1KYO D;  3ZCF A;  1JDL A;  1SQV D;  2CXB A;  1DW3 A;  1H9Y A;  2QJY B;  2FRC A;  5H2F V;  1A8C A;  5C9M A;  5GTH V;  4PW9 B;  1RZ5 A;  3CU4 A;  2QJP B;  1PPJ D;  1SQX D;  2C9X B;  1FI9 A;  4FAN A;  1HZV A;  2B11 B;  1H32 B;  2YK3 A;  3RN1 A;  1WEJ F;  4NFG B;  1OAE A;  1H33 A;  2LIR A;  1SQQ D;  1AYG A;  1I6E A;  1NIR A;  3WC8 A;  4D6T D;  2BCC D;  3L74 D;  5IY5 1;  3O1Y A;  1GU2 A;  1S5L V;  4JCG A;  2CE0 A;  1KB9 D;  1CCH A;  3BCC D;  1L9J C;  5KAI V;  1I6D A;  1GKS A;  3PH2 B;  4H0J A;  1CYJ A;  3CXH W;  5B5E V;  4K3I A;  1AKK A;  2XTS B;  1M70 A;  3A0H V;  2CA4 B;  3ZIY A;  1C6S A;  1DVV A;  2N9J A;  1YCC A;  2BPB B;  3L71 D;  1CYI A;  3HQ7 A;  2L4D A;  2C8S A;  4EIC A;  1BCC D;  5DJQ B;  3L72 D;  5C0Z A;  1N15 A;  3L4O A;  1H1O A;  1CHH A;  1HJ3 A;  2CA3 B;  3DR0 A;  1FJ0 A;  2DGE A;  3CX5 D;  1M6Z A;  2BLF B;  1I55 A;  5EXQ A;  5KLV D;  4WQA A;  3WFE C;  2GB8 B;  3VNW A;  1HRC A;  1I8O A;  1QN2 A;  3TYI A;  1C6O A;  4PD4 D;  3A9F A;  2AIU A;  1GDV A;  2C2C A;  3H1H D;  1KV9 A;  3ZOO A;  1U74 B;  4WQ9 A;  2QJK B;  1E8E A;  2LIT A;  1CXC A;  1IRW A;  2GC4 D;  1FHB A;  3OA8 B;  2D0W A;  1DII C;  4RSZ A;  3ZOY A;  1GQ1 A;  1B7V A;  2FYU D;  4U3F D;  1FI3 A;  2YCC A;  1CCR A;  1C7M A;  2PCB B;  2B0Z B;  3M97 X;  1E2R A;  1AOQ A;  5KAF V;  2N18 B;  4V2K A;  1CC5 A;  1L0N D;  5CID B;  1DW1 A;  351C A;  1N90 A;  3DP5 A;  1COT A;  2V07 A;  3RN0 A;  3RMZ A;  2V08 A;  3MK7 B;  1LMS A;  3SWS A;  3CWB D;  1FOC A;  2C1U A;  1P84 D;  5DF5 A;  2C1D A;  1KB0 A;  1CED A;  1ETP A;  1CTY A;  1H31 A;  4O1Q A;  2GC7 D;  5KLI B;  3O20 A;  3OCD A;  4H0K A;  1DW2 A;  4AAL A;  1KYO W;  1NU1 D;  3CXH D;  1IRV A;  3NWV A;  1CHI A;  1BGY D;  1W5C T;  1DT1 A;  2D0S A;  1HCM A;  3HQ8 A;  4L3G A;  1CIH A;  5B6Q A;  3H1L D;  3OA8 A;  3O5C A;  2VHD A;  3SVW A;  1MG2 D;  2YIU B;  5AUR A;  2MHM A;  1E29 A;  1YEB A;  5CIF B;  1RAQ A;  1HH7 A;  1C75 A;  1K3H A;  1GJQ A;  2ZZS 1;  1RZ6 A;  4DY9 A;  3C2C A;  3ZBM A;  4WQE A;  4YE1 A;  4L1Q A;  4WQ7 A;  1QL4 A;  3NBT A;  4FA1 A;  1F1F A;  1L9B C;  3L73 D;  1IO3 A;  1OCD A;  2A06 D;  1NML A;  5CYT R;  1H32 A;  5CIH B;  3HQ6 A;  3WFD C;  5CIC B;  4WQC A;  4L3H A;  5CIG B;  4FA4 A;  2I8F A;  1KX2 A;  5DJQ C;  1S6V B;  4N0K A;  1VYD A;  2DVH A;  4FB1 A;  2FWL A;  2N3Y A;  1YTC A;  3CYT I;  1U75 B;  2B12 B;  4WQ8 A;  5B66 V;  4XYD B;  1EZV D;  3PXS A;  3L70 D;  1LC2 A;  5DFS A;  155C A;  1HZU A;  3L4M A;  1HRO A;  1PP9 D;  1RAP A;  4MU8 A;  1CRH A;  3ORV A;  4EIE A;  1AOF A;  1CHJ A;  1KX7 A;  4LJI A;  1CRY A;  2B10 B;  2PAC A;  2IBZ D;  1YIQ A;  2BH5 X;  2PCC B;  3WU2 V;  1CIG A;  1KIB A;  1NTM D;  5CIB B;  1EB7 A;  3SXT A;  1CRG A;  1CSW A;  2OZ1 B;  2YQB A;  4PWA A;  4QAO A;  4WQD A;  1F1C A;  1CTJ A;  2C1V A;  4UB6 V;  4KMG A;  4AAO A;  4GED B;  3TGU D;  1CIF A;  3L75 D;  4XXL A;  3ZOW A;  1HJ5 A;  1DIQ C;  4EID A;  5E79 V;  1C6R A;  3WFC C;  4AAN A;  4Q5P A;  3ZOX A;  1HJ4 A;  1YEA A;  2N18 C;  1DW0 A;  2BCN B;  1YFC A;  3O0R C;  1FCD C;  4O1W A;  2MTA C;  1SQP D;  4FA5 A;  3MK7 C;  1BE3 D;  1A56 A;  1CXA A;  1IQC A;  3DMI A;  2GIW A;  2AI5 A;  2N9I A;  1I5T A;  3HQ9 A;  3NBS A;  4AAM A;  3WFB C;  1CTZ A;  1A2S A;  1N9C A;  2BH4 X;  2N3B A;  1CSX A;  1C52 A;  1CRJ A;  3PXT A;  1SQB D;  4PJ0 V;  5GTI V;  2JTI B;  1NTZ D;  3VRD A;  1CSV A;  1FI7 A;  1CRC A;  2ZBO A;  1N50 A;  1H9X A;  2ZXY A;  1GIW A;  1LS9 A;  4FAV A;  3H1K D;  2OZ1 A;  1YNR A;  4UB8 V;  1MZ4 A;  2ORL A;  1R0Q A;  1I8P A;  4IL6 V;  5TIS V;  1CYC A;  1ZRT D;  1L0L D;  3RLM A;  4FA9 A;  3JBT B;  1DVH A;  3SJL A;  4GYD A;  3VYM A;  3WUI A;  1CIE A;  1NMI A;  1H33 B;  4AX3 A;  2C1D B;  3CP5 A;  1K3G A;  1H31 B;  2JQR A;  1QYZ A;  1LFM A;  3OCD B;  3H1I D;  1MG3 D;  3KZI V;  1IZL 0;  2HV4 A;  1LC1 A;  3PXW A;  3CX5 W;  1CO6 A;  4P4Q B;  2EXV A;  1COR A;  1C2R A;  5KKZ B;  3SLE A;  3H1J D;  1CRI A;  1QKS A;  1QL3 A;  1W2L A;  2CE1 A;  1CSU A;  4Y5R A;  2FYN B;  4EIF A;  4WQB A;  2ZON G;  1C2N A;  2B4Z A;  2BGV X;  1WVE C;  2AXT V;  1YIC A;  1NTK D;  1CNO A;  5CIE B;  1M60 A;  1BL9 A;  1I54 A;  1ZZH A;  451C A; 
#chains in the Genus database with same CATH topology
 1NNO A;  3A0B V;  1J3S A;  2ZOO A;  3X39 A;  4J20 A;  1KYO D;  3ZCF A;  1JDL A;  1SQV D;  2CXB A;  1DW3 A;  1H9Y A;  2QJY B;  2FRC A;  5H2F V;  1A8C A;  5C9M A;  5GTH V;  4PW9 B;  1RZ5 A;  3CU4 A;  2QJP B;  1PPJ D;  1SQX D;  2C9X B;  1FI9 A;  4FAN A;  1HZV A;  2B11 B;  1H32 B;  2YK3 A;  3RN1 A;  1WEJ F;  4NFG B;  1OAE A;  1H33 A;  2LIR A;  1SQQ D;  1AYG A;  1I6E A;  1NIR A;  3WC8 A;  4D6T D;  2BCC D;  3D0W A;  3L74 D;  5IY5 1;  3O1Y A;  1GU2 A;  1S5L V;  4JCG A;  2CE0 A;  1KB9 D;  1CCH A;  3BCC D;  1L9J C;  5KAI V;  1I6D A;  1GKS A;  3PH2 B;  4H0J A;  1CYJ A;  3CXH W;  5B5E V;  4K3I A;  1AKK A;  2XTS B;  1M70 A;  3A0H V;  2CA4 B;  3ZIY A;  1C6S A;  1DVV A;  2N9J A;  1YCC A;  2BPB B;  3L71 D;  1CYI A;  3HQ7 A;  2L4D A;  2C8S A;  4EIC A;  1BCC D;  5DJQ B;  3L72 D;  5C0Z A;  1N15 A;  3L4O A;  1H1O A;  1CHH A;  1HJ3 A;  2CA3 B;  3DR0 A;  1FJ0 A;  2DGE A;  3CX5 D;  1M6Z A;  2BLF B;  1I55 A;  5EXQ A;  5KLV D;  4WQA A;  3WFE C;  2GB8 B;  3VNW A;  1HRC A;  1I8O A;  1QN2 A;  3TYI A;  1C6O A;  4PD4 D;  3A9F A;  2AIU A;  1GDV A;  2C2C A;  3H1H D;  1KV9 A;  3ZOO A;  1U74 B;  4WQ9 A;  2QJK B;  1E8E A;  2LIT A;  1CXC A;  1IRW A;  2GC4 D;  1FHB A;  3OA8 B;  2D0W A;  1DII C;  4RSZ A;  3ZOY A;  1GQ1 A;  1B7V A;  2FYU D;  4U3F D;  1FI3 A;  2YCC A;  1CCR A;  1C7M A;  2PCB B;  2B0Z B;  3M97 X;  1E2R A;  1AOQ A;  5KAF V;  2N18 B;  4V2K A;  1CC5 A;  1L0N D;  5CID B;  1DW1 A;  351C A;  1N90 A;  3DP5 A;  1COT A;  2V07 A;  3RN0 A;  3RMZ A;  2V08 A;  3MK7 B;  1LMS A;  3SWS A;  3CWB D;  1FOC A;  2C1U A;  1P84 D;  5DF5 A;  2C1D A;  1KB0 A;  1CED A;  1ETP A;  1CTY A;  1H31 A;  4O1Q A;  2GC7 D;  5KLI B;  3O20 A;  3OCD A;  4H0K A;  1DW2 A;  4AAL A;  1KYO W;  1NU1 D;  3CXH D;  1IRV A;  3NWV A;  1CHI A;  1BGY D;  1W5C T;  1DT1 A;  2D0S A;  1HCM A;  3HQ8 A;  4L3G A;  1CIH A;  5B6Q A;  3H1L D;  3OA8 A;  3O5C A;  2VHD A;  3SVW A;  1MG2 D;  2YIU B;  5AUR A;  2MHM A;  1E29 A;  1YEB A;  5CIF B;  1RAQ A;  1HH7 A;  1C75 A;  1K3H A;  1GJQ A;  2ZZS 1;  1RZ6 A;  4DY9 A;  3C2C A;  3ZBM A;  4WQE A;  4YE1 A;  4L1Q A;  4WQ7 A;  1QL4 A;  3NBT A;  4FA1 A;  1F1F A;  1L9B C;  3L73 D;  1IO3 A;  1OCD A;  2A06 D;  1NML A;  5CYT R;  1H32 A;  5CIH B;  3HQ6 A;  3WFD C;  5CIC B;  4WQC A;  4L3H A;  5CIG B;  4FA4 A;  2I8F A;  1KX2 A;  5DJQ C;  1S6V B;  4N0K A;  1VYD A;  2DVH A;  4FB1 A;  2FWL A;  2N3Y A;  1YTC A;  3CYT I;  1U75 B;  2B12 B;  4WQ8 A;  5B66 V;  4XYD B;  1EZV D;  3PXS A;  3L70 D;  1LC2 A;  5DFS A;  155C A;  1HZU A;  3L4M A;  1HRO A;  1PP9 D;  1RAP A;  4MU8 A;  1CRH A;  3ORV A;  4EIE A;  1AOF A;  1CHJ A;  1KX7 A;  4LJI A;  1CRY A;  2B10 B;  2PAC A;  2IBZ D;  1YIQ A;  2BH5 X;  2PCC B;  3WU2 V;  1CIG A;  1KIB A;  1NTM D;  5CIB B;  1EB7 A;  3SXT A;  1CRG A;  1CSW A;  2OZ1 B;  2YQB A;  4PWA A;  4QAO A;  4WQD A;  1F1C A;  1CTJ A;  2C1V A;  4UB6 V;  4KMG A;  4AAO A;  4GED B;  3TGU D;  1CIF A;  3L75 D;  4XXL A;  3ZOW A;  1HJ5 A;  1DIQ C;  4EID A;  5E79 V;  1C6R A;  3WFC C;  4AAN A;  4Q5P A;  3ZOX A;  1HJ4 A;  1YEA A;  2N18 C;  1DW0 A;  2BCN B;  1YFC A;  3O0R C;  1FCD C;  4O1W A;  2MTA C;  1SQP D;  4FA5 A;  3MK7 C;  1BE3 D;  1A56 A;  1CXA A;  1IQC A;  3DMI A;  2GIW A;  2AI5 A;  2N9I A;  1I5T A;  3HQ9 A;  3NBS A;  4AAM A;  3WFB C;  1CTZ A;  1A2S A;  1N9C A;  2BH4 X;  2N3B A;  1CSX A;  1C52 A;  1CRJ A;  3PXT A;  1SQB D;  4PJ0 V;  5GTI V;  2JTI B;  1NTZ D;  3VRD A;  1CSV A;  1FI7 A;  1CRC A;  2ZBO A;  1N50 A;  1H9X A;  2ZXY A;  1GIW A;  1LS9 A;  4FAV A;  3H1K D;  2OZ1 A;  1YNR A;  4UB8 V;  1MZ4 A;  2ORL A;  1R0Q A;  1I8P A;  4IL6 V;  5TIS V;  1CYC A;  1ZRT D;  1L0L D;  3RLM A;  4FA9 A;  3JBT B;  1DVH A;  3SJL A;  4GYD A;  3VYM A;  3WUI A;  1CIE A;  1NMI A;  1H33 B;  4AX3 A;  2C1D B;  3CP5 A;  1K3G A;  1H31 B;  2JQR A;  1QYZ A;  1LFM A;  3OCD B;  3H1I D;  1MG3 D;  3KZI V;  1IZL 0;  2HV4 A;  1LC1 A;  3PXW A;  3CX5 W;  1CO6 A;  4P4Q B;  2EXV A;  1COR A;  1C2R A;  5KKZ B;  3SLE A;  3H1J D;  1CRI A;  1QKS A;  1QL3 A;  1W2L A;  2CE1 A;  1CSU A;  4Y5R A;  2FYN B;  4EIF A;  4WQB A;  2ZON G;  1C2N A;  2B4Z A;  2BGV X;  1WVE C;  2AXT V;  1YIC A;  1NTK D;  1CNO A;  5CIE B;  1M60 A;  1BL9 A;  1I54 A;  1ZZH A;  451C A; 
#chains in the Genus database with same CATH homology
 1NNO A;  3A0B V;  1J3S A;  2ZOO A;  3X39 A;  4J20 A;  1KYO D;  3ZCF A;  1JDL A;  1SQV D;  2CXB A;  1DW3 A;  1H9Y A;  2QJY B;  2FRC A;  5H2F V;  1A8C A;  5C9M A;  5GTH V;  4PW9 B;  1RZ5 A;  3CU4 A;  2QJP B;  1PPJ D;  1SQX D;  2C9X B;  1FI9 A;  4FAN A;  1HZV A;  2B11 B;  1H32 B;  2YK3 A;  3RN1 A;  1WEJ F;  4NFG B;  1OAE A;  1H33 A;  2LIR A;  1SQQ D;  1AYG A;  1I6E A;  1NIR A;  3WC8 A;  4D6T D;  2BCC D;  3L74 D;  5IY5 1;  3O1Y A;  1GU2 A;  1S5L V;  4JCG A;  2CE0 A;  1KB9 D;  1CCH A;  3BCC D;  1L9J C;  5KAI V;  1I6D A;  1GKS A;  3PH2 B;  4H0J A;  1CYJ A;  3CXH W;  5B5E V;  4K3I A;  1AKK A;  2XTS B;  1M70 A;  3A0H V;  2CA4 B;  3ZIY A;  1C6S A;  1DVV A;  2N9J A;  1YCC A;  2BPB B;  3L71 D;  1CYI A;  3HQ7 A;  2L4D A;  2C8S A;  4EIC A;  1BCC D;  5DJQ B;  3L72 D;  5C0Z A;  1N15 A;  3L4O A;  1H1O A;  1CHH A;  1HJ3 A;  2CA3 B;  3DR0 A;  1FJ0 A;  2DGE A;  3CX5 D;  1M6Z A;  2BLF B;  1I55 A;  5EXQ A;  5KLV D;  4WQA A;  3WFE C;  2GB8 B;  3VNW A;  1HRC A;  1I8O A;  1QN2 A;  3TYI A;  1C6O A;  4PD4 D;  3A9F A;  2AIU A;  1GDV A;  2C2C A;  3H1H D;  1KV9 A;  3ZOO A;  1U74 B;  4WQ9 A;  2QJK B;  1E8E A;  2LIT A;  1CXC A;  1IRW A;  2GC4 D;  1FHB A;  3OA8 B;  2D0W A;  1DII C;  4RSZ A;  3ZOY A;  1GQ1 A;  1B7V A;  2FYU D;  4U3F D;  1FI3 A;  2YCC A;  1CCR A;  1C7M A;  2PCB B;  2B0Z B;  3M97 X;  1E2R A;  1AOQ A;  5KAF V;  2N18 B;  4V2K A;  1CC5 A;  1L0N D;  5CID B;  1DW1 A;  351C A;  1N90 A;  3DP5 A;  1COT A;  2V07 A;  3RN0 A;  3RMZ A;  2V08 A;  3MK7 B;  1LMS A;  3SWS A;  3CWB D;  1FOC A;  2C1U A;  1P84 D;  5DF5 A;  2C1D A;  1KB0 A;  1CED A;  1ETP A;  1CTY A;  1H31 A;  4O1Q A;  2GC7 D;  5KLI B;  3O20 A;  3OCD A;  4H0K A;  1DW2 A;  4AAL A;  1KYO W;  1NU1 D;  3CXH D;  1IRV A;  3NWV A;  1CHI A;  1BGY D;  1W5C T;  1DT1 A;  2D0S A;  1HCM A;  3HQ8 A;  4L3G A;  1CIH A;  5B6Q A;  3H1L D;  3OA8 A;  3O5C A;  2VHD A;  3SVW A;  1MG2 D;  2YIU B;  5AUR A;  2MHM A;  1E29 A;  1YEB A;  5CIF B;  1RAQ A;  1HH7 A;  1C75 A;  1K3H A;  1GJQ A;  2ZZS 1;  1RZ6 A;  4DY9 A;  3C2C A;  3ZBM A;  4WQE A;  4YE1 A;  4L1Q A;  4WQ7 A;  1QL4 A;  3NBT A;  4FA1 A;  1F1F A;  1L9B C;  3L73 D;  1IO3 A;  1OCD A;  2A06 D;  1NML A;  5CYT R;  1H32 A;  5CIH B;  3HQ6 A;  3WFD C;  5CIC B;  4WQC A;  4L3H A;  5CIG B;  4FA4 A;  2I8F A;  1KX2 A;  5DJQ C;  1S6V B;  4N0K A;  1VYD A;  2DVH A;  4FB1 A;  2FWL A;  2N3Y A;  1YTC A;  3CYT I;  1U75 B;  2B12 B;  4WQ8 A;  5B66 V;  4XYD B;  1EZV D;  3PXS A;  3L70 D;  1LC2 A;  5DFS A;  155C A;  1HZU A;  3L4M A;  1HRO A;  1PP9 D;  1RAP A;  4MU8 A;  1CRH A;  3ORV A;  4EIE A;  1AOF A;  1CHJ A;  1KX7 A;  4LJI A;  1CRY A;  2B10 B;  2PAC A;  2IBZ D;  1YIQ A;  2BH5 X;  2PCC B;  3WU2 V;  1CIG A;  1KIB A;  1NTM D;  5CIB B;  1EB7 A;  3SXT A;  1CRG A;  1CSW A;  2OZ1 B;  2YQB A;  4PWA A;  4QAO A;  4WQD A;  1F1C A;  1CTJ A;  2C1V A;  4UB6 V;  4KMG A;  4AAO A;  4GED B;  3TGU D;  1CIF A;  3L75 D;  4XXL A;  3ZOW A;  1HJ5 A;  1DIQ C;  4EID A;  5E79 V;  1C6R A;  3WFC C;  4AAN A;  4Q5P A;  3ZOX A;  1HJ4 A;  1YEA A;  2N18 C;  1DW0 A;  2BCN B;  1YFC A;  3O0R C;  1FCD C;  4O1W A;  2MTA C;  1SQP D;  4FA5 A;  3MK7 C;  1BE3 D;  1A56 A;  1CXA A;  1IQC A;  3DMI A;  2GIW A;  2AI5 A;  2N9I A;  1I5T A;  3HQ9 A;  3NBS A;  4AAM A;  3WFB C;  1CTZ A;  1A2S A;  1N9C A;  2BH4 X;  2N3B A;  1CSX A;  1C52 A;  1CRJ A;  3PXT A;  1SQB D;  4PJ0 V;  5GTI V;  2JTI B;  1NTZ D;  3VRD A;  1CSV A;  1FI7 A;  1CRC A;  2ZBO A;  1N50 A;  1H9X A;  2ZXY A;  1GIW A;  1LS9 A;  4FAV A;  3H1K D;  2OZ1 A;  1YNR A;  4UB8 V;  1MZ4 A;  2ORL A;  1R0Q A;  1I8P A;  4IL6 V;  5TIS V;  1CYC A;  1ZRT D;  1L0L D;  3RLM A;  4FA9 A;  3JBT B;  1DVH A;  3SJL A;  4GYD A;  3VYM A;  3WUI A;  1CIE A;  1NMI A;  1H33 B;  4AX3 A;  2C1D B;  3CP5 A;  1K3G A;  1H31 B;  2JQR A;  1QYZ A;  1LFM A;  3OCD B;  3H1I D;  1MG3 D;  3KZI V;  1IZL 0;  2HV4 A;  1LC1 A;  3PXW A;  3CX5 W;  1CO6 A;  4P4Q B;  2EXV A;  1COR A;  1C2R A;  5KKZ B;  3SLE A;  3H1J D;  1CRI A;  1QKS A;  1QL3 A;  1W2L A;  2CE1 A;  1CSU A;  4Y5R A;  2FYN B;  4EIF A;  4WQB A;  2ZON G;  1C2N A;  2B4Z A;  2BGV X;  1WVE C;  2AXT V;  1YIC A;  1NTK D;  1CNO A;  5CIE B;  1M60 A;  1BL9 A;  1I54 A;  1ZZH A;  451C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...