3OCGA

P38 alpha kinase complexed with a 5-amino-pyrazole based inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
349
structure length
336
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title 5-Amino-pyrazoles as potent and selective p38α inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 336
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ocgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ocgA01
4YTIA 4FVRA 3RPYA 5KKRB 3CGOA 2XVDA 3OUKA 4G9CA 4LL0A 2OH0E 3DK6A 4XNEA 3FI3A 3M11A 4QPAA 2A0CX 3DAKA 2CHLA 4NT4A 3RJCA 4BICA 2PU8A 4FUYA 3FYJX 1WBWA 4D55A 4ENYA 2W1FA 3EJ1A 2HOGA 4L8MA 4WNPA 4USFA 3V5PA 3D0EA 5IU2A 2CGUA 2AUHA 5TE0A 2CDZA 4F9WA 3QTQA 4I4EA 3PJCA 5AAGA 1XH7A 2WD1A 2X6EA 4MBLA 4E5WA 5HTIA 2RGPA 5I9YA 1YRPA 1WAKA 3TXOA 2FH9A 3DBCA 4FSNA 3RAKA 4ERKA 1PXKA 4FT7A 3BYUA 3SDJA 4I5CA 3FMLA 2X1NA 2XP2A 3RAIA 4CFWA 4FKQA 3FXXA 4G3CA 4TTHB 4YPSA 3S2PA 4JG7A 4D4YA 2DQ7X 3Q52A 3R6XA 4PP9A 5HG8A 2P55A 5L2SA 4BDFA 5CAPA 2WGJA 3A99A 4EH4A 5EQPA 4I5HA 3FV8A 1FOTA 5HOAA 5LXMA 3RALA 4YZDA 1IA8A 4XLVA 1PJKA 5CEQA 5GNKA 4QNYA 2BDJA 2P2IA 4RIYA 4BHNA 5IKWA 3BCEA 3PXZA 3SQQA 4D58A 4ZLZA 2G9XA 2ETRA 5DT3A 3VBWA 4XV1A 2PMOX 4HNIA 5K5NA 4FKSA 4BWXA 5EI2A 4G6NA 4EOOA 2I40A 2OSCA 3QD3A 4X2NA 3JY9A 1E1XA 3QD4A 3VBYA 2JFLA 4RMZA 3FMJA 5LVPA 3R21A 5KO1A 1JAMA 3ZDUA 4BKYA 3NCGA 4S32A 5LCKA 2VTLA 2G2HA 3DS6A 2XBJA 5I9VA 3LQ3A 2Q0BA 5DGZA 4YJNA 4YURA 3VBXA 1WBVA 4F0IA 2F7XE 2JBOA 3CCNA 5EM7A 2WTKB 5TOZA 5EDPA 4DEHA 5H8BA 5L6PA 2RFDA 3DBQA 1YDRE 1URCA 5CEPA 1P2AA 4QYEA 5HVJA 2UW9A 2XRUA 3W2PA 3W10A 4UB7A 3MWUA 1YOMA 2WIHA 4M84A 4DN5A 2PMLX 5C4LA 4XYFA 3OBJA 4QPMA 3EQGA 3EFWA 3PSDA 4LV8A 3LLAA 2WMVA 2ZV2A 5BVDA 3QFVA 4WBBB 1QPDA 5CU3A 4ANQA 1UNGA 4APCA 1H8FA 3T9TA 4BBEA 2IVUA 4ZTQA 3OZ6A 4IDVA 3R8LA 4FKLA 1SVGA 2QLUA 3HRFA 4M15A 4UX9A 3A7JA 4JBVA 5EDQA 2O0UA 3HMOA 3KMUA 4W9WA 2OXXA 4CMOA 1YOLA 4C4HA 5KMJA 2PMIA 3RHKA 5BQ0A 2IVSA 3COKA 3KA0A 2PE1A 2QNJA 3QZIA 5GHVA 2YM4A 5EYMA 4FT5A 2VGPA 4BCHA 5C27A 4EUTA 4DITA 3EB0A 4JDHA 3ZONA 4GYGA 4HYHA 4RVKA 2C0OA 3Q9WA 4GRBA 4C7TA 5F9EA 1H1PA 4O22A 3WARA 5CZHA 2O65A 3I4BA 2VWXA 1S9IA 4QYHA 1CMKE 5I0BA 1H4LA 3R8VA 4DGLC 1TQMA 3V8WA 3C0GA 2QHMA 2RG5A 4IC8A 3DQXA 3I7CA 4B8LA 2CKPA 3LMIA 2XJ1A 4IAIA 4WUAA 2ITYA 2ITZA 3S4QA 4NM0A 2YABA 3QLGA 2WQMA 3IW8A 4QQ5A 4QMQA 4DFZE 4C4FA 4YC6A 5AIRA 4D2TA 4FSYA 4BCNA 3NVKI 3QCYA 4TKSA 3HMIA 4II5A 3EIDA 4PMPA 3FXWA 4FTCA 2YCQA 3NIEA 3TKIA 2RL5A 3F82A 3ENHA 3WZDA 1YKRA 4IMYA 2BFXA 1Y91A 2EU9A 4QO9A 2ZV9A 3LFAA 2OGVA 4BDAA 2X9EA 5HEZA 2WU7A 4AFEA 2VX0A 4X2GA 2FB8A 2HZIA 4O38A 2ZV7A 3FMDA 3BIZA 4KKGA 3G33A 4C57A 4DH3A 3WF5A 4EHVA 3IW7A 5M51A 3DXPA 5DRBA 5CXHA 3ZLSA 3LE6A 2QO2A 4X6QC 2Y0AA 4ZJIA 3OTVA 3V3VA 3E62A 2EXMA 3LCTA 4NEUA 4DH5A 2Z7SA 3IS5A 4ANOA 3DJ5A 4PQNA 3KULA 4R7HA 5HG5A 5GZAA 3GFWA 1XH8A 2UVXA 4XOZA 5D10A 3FPQA 2F49A 3NUUA 4DEDA 4EH6A 1GY3A 4USEA 5IISA 5M4IA 2E9OA 4RVMA 3NW6A 2W1IA 4X2JA 3SW7A 1G5SA 3QC9A 2XUUA 4PDPA 5FLFA 5CVHA 4U79A 5CX9A 4GMYA 3NSZA 4W4WA 4JQ8A 2J7TA 1J91A 3DNDA 4DFXE 2R3JA 1XKKA 2ERKA 3EOCA 2QLQA 4S33A 4IWOA 3BU3A 4BI2A 3D7TB 2PK9A 3MFUA 4MF0A 4X2FA 5AV3A 5FD2A 4BDEA 3Q5ZA 3QHRA 3MH0A 1GIJA 2C5OA 1M7NA 4L68A 4M0ZA 3MJ2A 1YW2A 5CEKA 2HWOA 3EYGA 4M0YA 3K5VA 4JX7A 4FE2A 3G0FA 3P9JA 4R7BA 1URWA 2VTTA 3QAME 3WIGA 4ANBA 4BI0A 3P79A 4QQCA 3F3TA 2QOKA 4JRNA 4BTMA 4GK3A 4ZAUA 4GVJA 2YERA 4M68A 4WNKA 5IQEA 4GT4A 2BTSA 4MXZA 4NJ3A 3O23A 2IPXA 4ACHA 2CJMA 3ZHPC 3LOKA 1NW1A 2PHKA 5H9BA 4GEOA 4WSQA 4RQVA 2JKMA 2XK3A 4XG9A 1P14A 4L52A 4FGBA 4UYNA 5DG5A 3NNXA 3L8XA 2OKRA 1YOJA 3CY3A 4RLKA 1OPLA 1ZLTA 2XRWA 4CSVA 1R1WA 3C4XA 2VU3A 2QR7A 1LR4A 5CAQA 4K77A 3EHAA 1VYWA 2R3GA 2KULA 2XK8A 4O0RA 4QP4A 3RAHA 5FM2A 4EK5A 3AC8A 4D2RA 2UW3A 2CKOA 5E92A 5JEBA 1XH5A 2XK7A 5EM8A 3VRZA 1IAHA 4OTFA 2ACXA 3EQBA 4O7TA 4AUAA 5B2MA 3LJ2A 1SVHA 1YXSA 2VO7A 3E88A 3QKKA 3Q04A 3OC1A 4UMRA 2X4FA 3Q6WA 4L45A 4O2ZA 5AV1A 2WNTA 4B6LA 3ATSA 4HNFA 5EM6A 4E26A 5AM6A 2PYWA 1GOLA 3I0QA 4C33A 5JFSA 4MXCA 2A4LA 2PVHA 1UU7A 5CYIA 4O84A 4FR4A 2R3HA 3SG8A 5CS6A 4FK3A 1V0OA 1T45A 3REPA 5EOLA 2WMTA 5L6OA 4YBJA 4DAWA 3IDBA 2YDJA 2QG5A 4UMQA 4ITIA 4CRSA 1H26A 2ITVA 3S3IA 3TCPA 4KIKA 1K3AA 2Z2WA 3PPJA 3FY0A 3LXLA 4TRLA 4FV4A 3TNWA 4O0TA 4XH6A 5JZNA 2UW7A 5HVKA 4HVGA 5DMZA 2HAKA 3P5KA 4FI1A 4YJPA 3MTFA 1OIYA 4J53A 3CQWA 4O6LA 1YXTA 1G8SA 2I6LA 4YLJA 2YA9A 2RSVA 2WIPA 4K0YA 3MA6A 5HE0A 4KSPA 3N51A 1Y8YA 4L42A 2VTMA 1M2RA 3G2FA 4F0GA 3DAEA 3TI1A 1OBDA 4LGGA 4EZ3A 3ORIA 3DFCB 3H30A 3E5AA 4M8TA 4P4CA 4YO4A 3CE3A 2HXQA 2R5TA 5M44A 4UALA 2R0IA 3NZ0A 1SNXA 4XV2A 4TYHA 4BKJA 3V51A 4IADA 3A7GA 4AGCA 3R02A 2VZ6A 3DY7A 3S0OA 2C1AA 2C47A 5CF5A 1GIIA 4J97A 3V5QA 4BZNA 4P2KA 3D5XA 2ZDTA 3FEGA 2YACA 4ITJA 3UQGA 3TV6A 3JVRA 2CMWA 4H3PA 4D0XA 1CKJA 3H9RA 2X2LA 3DB8A 5J7HA 5JGDA 2UW5A 1CTPE 2YWPA 3OOGA 5JQ8A 4CTCA 2QOOA 5IPJA 5BPYA 2WTWA 4FV3A 4F64A 4LRKA 3C4ZA 4GH2A 1KOAA 3VIDA 5CSVA 1XR1A 4PUZA 3VUGA 4W8DA 4QTDA 2W4JA 4PY1A 4Z16A 2R64A 1YDSE 2R3FA 4OT6A 5HTBA 4IEBA 3V5JA 4JQEA 3FLNC 4IX3A 4QP9A 4DH8A 4HPUE 3WIKA 3FSKA 5AM7A 3DZOA 3QWJA 5F95A 3CSVA 3NWWA 3ZBXA 3OWPA 4KA3A 3MJ1A 4YJQA 2OZOA 4AA5A 4YJSA 2OBJA 3AXWA 1YXXA 2QQ7A 4OGRA 4GS6A 4MWHA 3RK7A 4BGHA 4EH3A 4RFYA 5JFVA 5FTGA 2WKMA 4L43A 4ZSJA 1ZOGA 3POZA 5I9ZA 4NKAA 4C4GA 4FSRA 4M7IA 4UMTA 5JN2A 4F4PA 3NLBA 5FXQA 5AR3A 3W32A 1BYGA 3N4UA 5FP6A 1H25A 3D9VA 2ITOA 3MBLA 1XHAA 3RMFA 3Q32A 3BWFA 2YIRA 2WHBA 4PMTA 4UXLA 2YAAA 5FEDA 3SAYA 3R22A 3GU7A 2C5NA 1MUOA 2PVMA 1VEBA 2F2CB 3FMMA 3P0MA 1Q99A 4X6RA 5E8YA 5AV0A 4D2VA 4WO5A 3HP5A 5LVOA 3FI8A 3DAJA 4Y83A 5AP4A 3NYVA 5HIBA 2YAKA 3RVGA 4FTOA 1PRYA 4QP3A 5ETFA 4APPA 2XNPA 2X2KA 2XNOA 5E8VA 4CKIA 4XP3A 4ITHA 3P7BA 2GTMA 4JBOA 4M69B 4X2KA 3LZBA 3ZXZA 5LMAA 4U44A 3ACKA 5EHLA 2JAVA 2XM9A 1QPJA 3BELA 4XV3A 4HOKA 3HAVA 3D7ZA 4RSSA 4QMVA 3PP0A 2HZ4A 3BHTA 3OUNB 2QOCA 2WMUA 3PA4A 3UJGA 2BHEA 3HDNA 4WHZA 3RPVA 4CFFA 2JKQA 3UMXA 4L7FA 5TKDA 3SXSA 5DEYA 2X6DA 3TKHA 4HVHA 2W96B 4EJ7A 2X8DA 4DEIA 5J5TA 4XG6A 4EUUA 1I09A 1W98A 3LW0A 3W8LA 4G31A 4M67A 3V01A 5E8WA 3OXTA 3RTPA 3G0EA 3U87A 4X3FA 1ZOEA 2WZJA 3FLWA 5ICPA 3QXPA 4ASZA 3QTRA 3ZRLA 4XG4A 2Y6MA 3BLRA 3OBGA 4K18A 2NP8A 4W4YA 4BZDA 1SVEA 5EW3A 2C69A 3AC4A 3IG7A 1NVQA 4Y73A 4IAYA 3UPXA 3SW4A 3ANQA 2X81A 3B2WA 3W2CA 2ZMDA 3U9NA 4BB4A 4ERWA 4JR3A 5IA1A 2QO9A 3EMGA 3P78A 5K5XA 3PA3A 5AX3A 3WILA 3VF9A 4CT2A 5M57A 3BYSA 3QALE 5AV4A 2VWVA 4I24A 4G1WA 4DTAA 2VTJA 5ACBC 3DBDA 4BIBA 1RDQE 5A14A 5GIPE 1QPCA 4P5ZA 5AAFA 2VTPA 2XNNA 4L44A 5KMLA 3N4VA 3IW4A 4G34A 3NCZA 5DH3A 3SLSA 4DHFA 2ZOQA 4IHPA 5DR9A 2IW8A 3G9NA 3Q4TA 3W2OA 1STCE 2YM8A 5J8IA 5EKNA 2OLCA 1Q8ZA 3E92A 4YLKA 4RVTA 4DH1A 4EYMA 3AD4A 4HCUA 3F5GA 2BRGA 2PVYA 5LJJA 2PE0A 4IAZA 3DK7A 4YJRA 5HIEA 4G6OA 2C6LA 3LAUA 4QTBA 4BL1A 3LFQA 4JIAA 4EORA 4XG7A 2XK6A 2VO0A 3EQRA 3R7EA 4CT1A 3TDWA 3Q53A 3VWAA 3IOKA 3EN7A 3V5LA 2C3LA 5KHXA 4K8AA 4Q9ZA 3EH9A 2HY0A 2GNJA 4EQMA 3HV7A 4NK9A 3ZEWA 4A4LA 3KRWA 2YHVA 5ANOA 4YR8A 5I3RA 5BYLA 4JS8A 2J0LA 3QQLA 1Q24A 2GSFA 3ZXTA 2XEYA 4LOPA 2ONLA 3D2IA 5CU6A 3CPBA 5HD7A 1OIRA 3DA6A 1OKVA 5HBHA 4UY9A 2V0DA 2R3PA 3HYHA 1Q97A 4S2ZA 4BDIA 2X4ZA 3DKCA 1B39A 1H28A 5IA4A 3FPMA 1M2QA 4A06A 4JAJA 2KTYA 4GK2A 4AU8A 1XBAA 3BU5A 5E7RA 5ACKA 3U9CA 3MW1A 2R7IA 3FBVA 3ULIA 2F9GA 4EH9A 5HU9A 4O2PA 4A4OA 1RQQA 5AUWA 2JIVA 4E4MA 1M7QA 4YC8A 4H3BA 3PSCA 1FMOE 1CDKA 1NY3A 2XBAA 3UBDA 4AT5A 1SYKA 1W84A 2YM7A 4KS7A 1XH4A 3V04A 4AE9A 2BAKA 3IONA 3SD0A 4TN6A 1B38A 3KB7A 1KE5A 5IH6A 3D5VA 3RNYA 4BI1A 3TNPC 3QCXA 4RZVA 1WCCA 2HWPA 2GFSA 5A6NA 2W4KA 4YHTA 3D2KA 4EK6A 3KXHA 4ZJVA 2GQRA 3KC3A 3HV6A 4GFGA 4ZS0A 1A48A 4NYEA 4I6QA 4FSTA 2PVNA 4E8AA 5KMNA 3LCOA 4KUJA 4J7BA 3PZEA 5J7BA 4AT4A 3D5WA 1PYXA 3GNIB 2YZLA 2J4ZA 3NS9A 2I1MA 4NW6A 2R3NA 4XCUA 4IFGA 5DE2A 1PKGA 2O8YA 5E8ZA 3ZSIA 5BUJA 2A19B 2HXLA 3KRXA 5AP3A 4N6YA 4X21A 1Q8TA 3GXLA 1DI8A 4UV0A 4ACCA 4DFBA 2GFCA 2UVZA 3QQGA 3O0GA 3K54A 5LOHA 1BL7A 4QP6A 3I6WA 2X9FA 3DXQA 5L8JA 1LEZA 2BRNA 1OVEA 4Q5EA 2ZDUA 5JMSA 4IXPA 3WBLA 4MF1A 1TKIA 4ZSGA 4F0FA 4A4XA 2GMXA 2Y8OA 3GCSA 4YSMA 3ZM4A 1ND4A 1KE9A 3BHUA 3BKBA 3FUPA 2RFSA 4JG8A 1YWVA 3EFJA 4RJ4A 3HUCA 2JAMA 3UO5A 3LFBA 1HOWA 2YLFA 4FV0A 3UQFA 3PDTA 4NIFB 5FEEA 3GGFA 3JS2A 3TT0A 2VTIA 2VTRA 4YNOA 4OTDA 4DFNA 4H1JA 5HG9A 4UN0C 3A7HA 4L67A 4YPDA 3PA5A 4E5AX 4QPSA 4ALVA 3BV2A 2JLDA 4GFMA 2ONLC 2W17A 3MIYA 2BROA 2QHNA 4MNEA 2B7AA 2P4IA 4GK4A 3FMEA 3OG7A 4JXFA 3LFEA 5J9YA 5AV2A 3UIBA 2JDSA 4HCVA 3VC4A 4IZ7A 4JAIA 4U45A 1T46A 4C35A 5I5ZA 2DUVA 3ORTA 5IH4A 2YDIA 3UOKA 3VS0A 1Q5KA 5HQ0A 4GKIA 3TG1A 4FSZA 2Z8CA 1FVRA 3ZMMA 4XG8A 4PTEA 3NNUA 4QMYA 1TVOA 3OWLA 5D11A 4QMNA 4KS8A 4K2RA 2RFNA 3KK8A 4IVCA 4ANNA 5L4QA 1OI9A 3F3VA 3GU8A 4H3QA 5HGIA 1UU8A 3IK3A 4AA4A 2UZDA 3TTIA 3R0TA 2YDKA 4FX3A 4DCAA 2YM3A 2B55A 4O96A 4P7EA 2OJJA 1OB3A 4J52A 3VN9A 3F3UA 4IZAA 2PTKA 4AG8A 3MI9A 5H2UA 5K4JA 2J0IA 2GPHA 4OTRA 4PDOA 2IW9A 3MN3A 4D2WA 3ORMA 3DLSA 4G3FA 3QF9A 4IIRA 3PPKA 5JFWA 4F99A 2UZLA 3GU6A 3AG9A 4PX6A 3E7OA 4C59A 3UOLA 3QZHA 3DXNA 4OTWA 3KXNA 1PXNA 5ANGA 4RA5A 4O27B 4O0YA 4R6VA 5T3QA 4PV0A 3IOPA 3R2YA 3R9OA 4CZTA 2WFYA 4JG6A 5IDPA 1UNHA 2ESMA 3IW6A 3CXWA 3KRLA 2XA4A 2YIXA 2VUWA 3FZSA 5LMBA 4JNWA 5DR2A 5IEVA 1GAGA 3HZTA 3O51A 4EOPA 1E9HA 3SHEA 4XLIA 4RZWA 3GUBA 4XRJA 3O2MA 5AR4A 2V7OA 3QX2A 1H00A 3FLSA 4NZWB 5HKMA 4KIPA 2QOHA 1F5QA 4YZBA 2W4OA 4GJ2A 5FTOA 4JDIA 3AMYA 3W55A 4R8QA 5CSWA 3CKWA 5GZ8A 2OJGA 3FQHA 4GU6A 3QTSA 3RZBA 4IAKA 5M08A 1YQJA 4CRLA 2B9HA 2XKDA 1WBOA 1OKYA 4D5HA 5HIDA 4AWIA 4O7YA 3R71A 5K3YA 3LVPA 3O8UA 4E7WA 4EKKA 4GUBA 3DZQA 3OFMA 3LM5A 4GVAA 3K5UA 4K9YA 4ZEGA 4KINA 4D9UA 4HCTA 3TZ7A 3UOHA 3QTWA 5HNBA 2PY3A 4CMUA 2XNEA 3CJGA 3R1NA 3C50A 3DOGA 3C4WA 3SVVA 1ZYDA 1SM2A 3MDYA 2YJSA 3SXRA 1LUFA 1H1WA 1I44A 3DKGA 3FY2A 4ZTMA 4DYMA 3ORLA 4FL3A 3QQKA 4MHAA 2XKFA 2BKZA 3BV3A 3JPVA 4LMNA 4X3JA 1XH9A 1MRVA 4HPTE 4CLIA 1IR3A 3C9WA 3CIKA 3NUXA 1UV5A 3EL8A 2WMWA 3ULZA 4DA5A 3LHJA 2BZIB 3ORKA 1REKA 3FI2A 4Y85A 5GJFA 3UE4A 1OPJA 3EZRA 3NIZA 2VTOA 2QU5A 1ZXEA 3ETAA 5AUVA 2NRYA 5L2QA 3KRJA 5AMNA 2UZUE 3NDMA 5FEQA 4FT3A 2J51A 3GVUA 4ZTHA 4ZTSA 4ALWA 2PULA 3LKMA 5DRDA 4ANLA 1J1CA 1BUHA 3LFSA 3UVRA 2PWLA 5IA5A 3R01A 3WF8A 3WE8A 2R3KA 2QO7A 1M17A 4EOIA 4YLLA 2UUEA 5LVMA 4GKHA 4IX4A 2B9FA 3ODZX 4MCVA 3SRVB 5L2WA 4JRVA 4EK4A 3MA3A 3GQLA 2ZYBA 4IFCA 5GJGA 3NAXA 4JX3A 1B6CB 3QTXA 5DHJA 5DVRA 2WTDA 3HRCA 4B9DA 3ELJA 2Z7QA 4TY1A 4RIWB 1VYZA 4FL1A 3LJ1A 2H96A 4FG8A 4F1OA 3KY2A 4O1PA 1OUKA 4IWDA 4K33A 4F7SA 4L46A 2UZNA 3EQHA 4DGOA 3QQUA 5J5SA 1OPKA 2E9NA 4BIEA 5BMSA 1R0PA 3ZS5A 4FTTA 2Q83A 3AC1A 3TZ9A 3MY0A 3QTUA 3DLZA 1UKIA 3CD3A 3DK3A 4C2WA 3SG9A 3O7LB 4ZY6A 2C6TA 3AMAA 3UTOA 1REJA 2PVKA 3DU8A 3UP7A 4GT3A 2UZOA 3KVWA 2OJIA 3C13A 1WFCA 4C3PA 3C5IA 4EJNA 5KCVA 1JSVA 1Y6BA 4AT3A 3K3IA 2PUNA 4QP7A 3VBQA 2ITNA 2BUJA 2W1EA 4FICA 4L3PA 2YCRA 1GNGA 3FJQE 2C6EA 4IC7A 3R7YA 3BEAA 4F6SA 2EXEA 3U6HA 5C01A 4I20A 4AAAA 3LXKA 1MQBA 3PY3A 3L9LA 4ZTRA 3K3JA 4MBIA 5HNGA 5M53A 3KKVA 4G17A 4ARKA 5IQIA 2Y9QA 5EKOA 5HG7A 1YWRA 2WQEA 3OROA 4QNAA 4A9TA 5ITAA 3TNQB 2HW7A 1OKWA 5CSXA 4BYJA 3P1AA 3PJ3A 2R3MA 2XJ2A 3ODYX 4XP0A 5LMKA 3CP9A 2E9VA 4KIQA 3PRIA 4WUNA 2XNGA 3AGMA 4KD1A 3V8SA 1AGWA 2QOQA 3BHVA 3BLQA 4MWIA 3RK9A 4AZTA 4YJOA 5E91A 3OW3A 2OJFE 2PMNX 4NU1A 3ZC5A 3A2CA 5CU2A 4XHKB 3QUEA 2FUMA 5E1SA 3CS9A 4MVFA 4I5MA 3SV0A 4AXAA 4U42A 4LGHA 4HW7A 2XF0A 2OU7A 2R9SA 3POOA 3UMWA 5DBXA 2PUPA 5HCZA 3AGLA 5LVLA 3MFRA 2C30A 2WMAA 4EK8A 2WTIA 3QD0A 4PPCA 3R83A 3KEXA 2H34A 4PNIA 4U40A 5EK7A 4O91A 1WBTA 5FQDC 5HE2A 3G51A 2BRMA 4WG4A 4F6UA 2W1CA 5E90A 4FKPA 3ZDIA 1ZRZA 3MFSA 4FIIA 1ERKA 3QGYA 5BMMA 4Y5HA 3P86A 4DC2A 5CQUA 3KCFA 4Y5QA 3GCVA 3VUIA 5CNOA 1KWPA 3F66A 1ZYJA 4FIHA 3UQCA 3AOXA 5AWMA 4QMMA 5A46A 3E7VA 4IH8A 2C6DA 2NO3A 3A8WA 3FE3A 4JL9A 4E4NA 1VZOA 3GI3A 5I3OA 3KK9A 4IM3A 3F9NA 4CFMA 4JQ7A 3TKUA 3BE2A 3KXGA 4FV2A 3FZRA 3QHWA 4R3PA 2UZEA 4D5KA 3TJCA 1JKSA 1M52A 4KSQA 4G3DA 4I21A 3D83A 3RNIA 1OIQA 3TNHA 4LOQA 3ZYAA 3MH1A 3QU0A 2JDVA 2YFXA 4FTMA 3NX8A 4JIKA 4L3JA 2V22A 5HLPA 4OBOA 2XMYA 1H08A 1RJBA 3E3PA 3NGAA 3K2LA 4OTHA 4BCQA 4CCBA 3VQUA 5L8KA 4FZ6A 3UC3A 3A4PA 3OT8A 4FK6A 2GDOA 2WXVA 2RF9A 1Z9XA 5BUEA 4H58A 4ZSEA 3PE1A 3FLZA 3GC8A 1YI6A 4MBJA 4G9RA 4YHFA 3MB7A 3RGFA 5GZ9A 2QOLA 1H24A 2BZHB 4BZOA 2CPKE 1YDTE 2OI4X 3DBFA 2ZM4A 4RQKA 5CSHA 3E64A 4CEGA 4EH2A 4FV7A 5CEIA 3T3UA 4AP7A 4CNHA 1H07A 5HVYA 3EQFA 4XX9A 3Q3BA 4IM2A 3WF7A 4RJ5A 2ITUA 3GBZA 1OL6A 3OCSA 2J9MA 1H01A 5L3AA 1K2PA 1WVYA 4A9RA 4J95A 2BVAA 3SA0A 3W2RA 3PP1A 3LLTA 2W1DA 4BYIA 5AP0A 2ITQA 2DWBA 3ZLXA 2JKKA 3L8SA 4RFMA 2GNFA 2ZV8A 3VBVA 4C2VA 3BGPA 5IUGA 1IAJA 4NM3A 4O7RA 3N9XA 2RFEA 1V1KA 3HNGA 3ZC6A 1PXLA 4PL5A 2C3IB 3TJDA 1JKLA 5J1WA 3RZFA 5AUTA 4PL3A 2HY81 2YWVA 4RT7A 3TIYA 4XBRA 3UDBA 4BDGA 4IACA 4ZMFA 4IZYA 2X8EA 3II5A 3LXNA 3R1SA 3R8UA 2VNWA 5DEWA 3RHXA 5IA2A 3B8RA 4UEUA 1OL7A 4KRCA 4GIIA 1JPAA 4DT8A 1U54B 2I0VA 5HI2A 5LWNA 3PJ2A 3V8TA 1PXIA 4I0RA 3MVMA 2PZYA 3T3VA 4FNYA 3DDPA 3PSBA 3PYYA 3ATTA 2V55A 3FKOA 2VD5A 2FA2A 5CVFA 1BI7A 3GT8A 4B4LA 1LPUA 1SMHA 2OZAB 4N70A 4H1MA 4CZYB 4AACA 1DAYA 3VUHA 4UYAA 3AT3A 4FSQA 4F9AA 2B52A 3L8VA 3F88A 3QQFA 3G90X 4E4LA 3R04A 4N0SA 4E3CA 3BLHA 4JBQA 4EYJA 3ERKA 1NVSA 3AC2A 4EEVA 1U5RA 2BDWA 3P08A 4LRJA 5J95A 5AUUA 2IG7A 4ZS4A 5AR7A 3IDCA 2I0YA 5HLNA 1ATPE 4RC3A 2HIWA 3ZZWA 4JLCA 3PLSA 2BAJA 4WD5A 1H0WA 1X8BA 3TUDA 3ENMA 4G5PA 1FINA 3F5XA 1OGUA 3NR9A 4IZ5A 4OTQA 3ZH8A 4MQ1A 3IGGA 2C0TA 5AP2A 4BDBA 4MD7E 4BDCA 4FKUA 3I1AA 3KN5A 1J7IA 2VTSA 3DT1A 1IEPA 5KHWA 4NKSA 2UW8A 4M14A 3F7WA 2PZRA 4UWCA 4AOJA 3S00A 2CNVA 2RG6A 3ZO4A 3OY1A 5C8KA 5IQGA 2Y4IC 3D94A 4YC3A 3RM7A 4TWPA 3QTIA 2HW6A 2JC6A 5AR5A 3LFCA 4TWCA 2P33A 4EH8A 3M42A 3H10A 4I6HA 2XEZA 2IO6A 3NYXA 2DYLA 3EL7A 5AUYA 3W2QA 3WOWA 4D1ZA 3FC1X 4WG3A 4YU2A 5BVKA 2WPAA 3NAYA 3ROYA 3VS2A 3PWYA 4GU9A 4D4SA 1DI9A 5BVOA 3TV7A 1XBBA 3BU6A 2YIQA 4V0GA 3QX4A 5AP1A 1V0PA 3NRMA 4BWKA 4OT5A 2YITA 4QMTA 5T6KA 3PWDA 2JIIA 5C26A 2PZIA 2FSTX 3KCKA 3C4FA 4G6LA 2ETKA 4DCEA 3R2BA 4QMOA 3RPRA 2AC5A 3OVVA 4FSMA 4NCTA 4FTLA 4YP8A 3ZUTA 2ZB1A 3CD8A 4NW5A 4OR5A 1XJDA 2B0QA 4MNFA 4QMZA 4JBPA 4BIDA 1YI3A 3PXKA 1MP8A 1PY5A 3MPMA 4R7IA 4KABA 5E8SA 2C0IA 3CPCA 2O3PA 3HGKA 4S31A 2YCSA 4AW2A 5J9ZA 4FEUA 4CCUA 4BY9E 2E9UA 3H3CA 5F94A 2C6OA 2QC6A 3VUTA 5HO7A 2XKCA 1QL6A 4DLIA 3LQ5A 5KMOA 4YZ9A 1OIUA 4QRCA 1JSUA 2CCHA 4NM5A 5HNIX 2X8IA 3LXPA 4BTJA 3I5ZA 4AOIA 3RCJA 3VS6A 3R7IA 4LFIA 4LOOA 3DBEA 3NYOA 4FIJA 3RAWA 4J96A 4EQCA 4C38A 2VWYA 1Y8GA 5JK3A 2IZTA 2VV9A 5TR6A 5I9WA 3U55A 3BI6A 4ZZMA 4FUXA 3WYXA 2VTNA 2XIZA 3GC9A 1LP4A 5CXZA 4UWBA 2FGIA 2PVFA 5BVWA 4ZZNA 2UW6A 3PVBA 3H0YA 1KE7A 3COHA 4ZZOA 3O96A 4FV1A 4XS2A 2WMBA 2GCDA 3VUMA 5BUIA 1BI8A 5CZIA 5EW9A 4IW0A 2ETMA 2R3QA 3G5DA 4FG9A 4PTGA 3ZFXA 2FYSA 1QPEA 3R73A 4E5BA 2W0JA 4FMQA 3V5TA 1U46A 4HYIA 4DBNA 1KOBA 4CGAA 1KE8A 3SKCA 4M69A 3KF4A 4FEVA 4AOTA 4QTAA 4FZAB 4E20A 3D15A 3MH3A 2VTQA 2BPMA 4F63A 4EONA 5JGBA 2OFVA 3VULA 4H05A 2IWIA 4HYSA 3UNJA 2BR1A 4DFUA 2BRHA 4FV6A 2A27A 3F2NA 3MTLA 3QRJA 4B8MA 4FV8A 3VS1A 3ROCA 4E4XA 4EC8A 2PPQA 4ZP5A 3PXRA 3U51A 4AF3A 4BTFA 5JQ5A 3ID6C 3FYKX 4M13A 3PVWA 4O81A 3TUBA 3OCBA 2IZSA 1DS5A 3FXZA 3VF8A 2GQGA 2PZPA 2B9IA 5KZIA 4FTUA 5JSMA 5A3XA 3DKFA 3WZKA 3MESA 4FNWA 1BMKA 3FC2A 2PVJA 4EOLA 3ZZEA 5J9LA 5DYJA 2VX1A 2WQBA 5CEOA 1Z5MA 3TV4A 4YO6A 2XIYA 2EXCX 3O50A 4O0XA 4N4SA 4FNZA 4FEXA 3GCPA 2CLXA 3FZOA 5HX8A 4O7SA 4I6BA 4WT6A 2B9JA 3JXWA 5CNNA 5KMIA 4AQCA 4EZ7A 2UW0A 4L7SA 4BGQA 3FQSA 3VO3A 1PXMA 3FDNA 1VJYA 3H9OA 4RVLA 1R0EA 3V6SA 1GZKA 2GNLA 3ET7A 5D9HA 2W9FB 1GZOA 3GP0A 5FBNC 4EHEA 4FV5A 4U41A 4FL2A 1JOWB 2XJ0A 2J0KA 4D4VA 2WOTA 3FZPA 4IB5A 4LG4A 3C51A 2XCKA 5EDRA 4C61A 3PRFA 2X2MA 4G3GA 1LEWA 4BFMA 4DFYA 3OEFX 3ITZA 4BDKA 4DGNA 3UIUA 3G6HA 3Q60A 5TO8A 2BHHA 3ZM9A 2PVRA 3F5UA 4MH7A 3OXIA 4EWQA 3QCQA 3WZEA 4J99A 4MAOA 5AFVA 2ZJWA 2JBPA 3DQWA 4E93A 4WRSA 4JJRA 1GJOA 4R1YA 2C5VA 2PL0A 1TQIA 2GHLA 4NM7A 1Q8YA 3R28A 3LFFA 5AJQA 4A7CA 2EUFB 5I9XA 4FIGA 5CT7A 5BVFA 1H1QA 1HCKA 3EQDA 3QRUA 1S9JA 3H9FA 4AZEA 4ACMA 4ACGA 2C5XA 4F09A 4FOCA 4QQJA 5FRIA 4RIXB 4B7TA 1Q8UA 4X3FC 2YJRA 3W1FA 4BVUA 3I6UA 3ZOSA 4FTNA 3O71A 4GG5A 5HHWA 4EHGA 3BPRA 4FEWA 4UXQA 3NEWA 4YJVA 4BWPA 4WNOA 3QRIA 3GB2A 3GU4A 3IECA 3EKKA 2BRBA 4JT3A 5ANDA 5EOBA 2WMRA 2OWBA 1SZMA 2O64A 3LPBA 4TWOA 3VW8A 3PJ8A 4J71A 1WVWA 4Z3VA 5EHYA 4XEYA 4FSWA 4H39A 4BCIA 3OOMA 4ZLOA 2F2UA 5A4QA 3JR1A 5IQAA 2AYPA 2VWWA 4ZJJA 4F9BA 4FA2A 4Z7HA 4NL0A 1FPUA 5CQWA 4A9SA 3O8PA 4OTGA 5EI8A 3O8TA 4TYIA 2F7ZE 4DG3E 1O9UA 4CYIA 4D1XA 4CFNA 5TF9A 3NPCA 3F3WA 4F65A 4F9YA 5CALA 4F7NA 3ZLWA 3FMKA 3QL8A 4GT5A 4HGSA 5A54A 2VAGA 3IPHA 3L1SA 4BKZA 2GNGA 4FKTA 3V5WA 3BYMA 3ZO3A 1SNUA 3VS7A 1WMKA 3MV5A 4C34A 5B7VA 4U3YA 2EVAA 2PUIA 5AP5A 4FSUA 4C02A 1PYEA 4KBKA 4CD0A 4L9IA 2SRCA 2E9PA 5H8GA 2VN9A 4CVAA 4RJ6A 3QKMA 3ZCLA 1JWHA 3GC0A 4FOBA 4IAFA 3DDQA 3COMA 4FTIA 4ASXA 4Z55A 3BZ3A 1BKXA 4JVGA 4FEQA 3QCSA 2ZVAA 2H6DA 5A4CA 5CT0A 3QUDA 4R5SA 4UZDA 4AZSA 5HE1A 3FHRA 3QQJA 4XMOA 5JRQA 3AMBA 3DFAA 2XK9A 4MNEB 5D12A 4X7QA 1KV2A 1JLUE 3QLFA 3GEQA 1YHWA 4QT1A 2QONA 4WKQA 3R7UA 2GNIA 5B0XA 4DLJA 1KSWA 3E8CA 3RI1A 4CQGA 2XIKA 4QTEA 5HD4A 4XV9A 1P5EA 4ZLYA 2O2UA 4FTAA 3ZRMA 4CKJA 2JKOA 4BCFA 5CU4A 1OL1A 2QCSA 3BBTB 2EB3A 3MVLA 3W2SA 3MGYA 4QMUA 4TYEA 4RWJA 3AC3A 4BR3A 4YNEA 3UNKA 4IAAA 4G16A 2CKQA 4FZFB 4O0UA 4OUCA 4DE4A 4WA9A 1PW2A 1QCFA 3Q9ZA 2QURA 4MXAA 4R78A 2W06A 5M06A 3PY0A 3TUCA 2X7FA 4RX5A 1AQ1A 4GIHA 1G3NA 3A7FA 1PXOA 4PDSA 4TW9A 4QYYA 4AZWA 3QYWA 4AS0A 3A4OX 5AIKA 5D7AA 1L8TA 5EHOA 2QKWB 3CTQA 4GFOA 2OIDA 4I5PA 1FGKA 4GSBA 2LAVA 2IJMA 2J2IB 3OTUA 3AD6A 3DCVA 2FVDA 2EWAA 2R2PA 3R7OA 2GU8A 3A8XA 5KMKA 3UOJA 4YJUA 4FKIA 4B0GA 1FVTA 4U81A 1WZYA 3Q4ZA 5ETIA 5TT7A 3R9HA 5JFXA 4MD9E 3OD6X 3R8MA 4YMJA 3R00A 4FKGA 4WOVA 3QA8A 2VGOA 1W83A 2UVYA 3JY0A 2FSOX 1OZ1A 2VO6A 4S30A 2WOUA 1OKZA 2E2BA 4WRGA 2XIRA 2EB2A 5AUXA 3UG1A 4I41A 4FF8A 2XNMA 3VJNA 2YM5A 4YGAA 4PF4A 3TTJA 3W18A 5E8UA 4EKLA 4EQUA 4DBXA 4BCMA 3IW5A 1AD5A 2ITTA 3KVXA 2B1PA 2A2AA 2WO6A 3H4JA 4BCPA 3MS9A 3OWKA 5CENA 4C36A 4Q5HA 4F6WA 5A9UA 3SGCA 3U54A 3FAAA 2R0UA 4RA4A 1F3MC 4TWNA 2W5HA 4F70A 4MEDA 2OO8X 4XJ0A 5EYCA 5GIOE 1WVXA 5D41A 5ANJA 5BVEA 1IRKA 3U4UA 4D2PA 3KMWA 3UYTA 1ZOHA 5BYZA 3ZFYA 4D9TA 1Q3DA 4BCOA 4I23A 4FIFA 1WBSA 2C6MA 3TM0A 3MSSA 5LARA 4FIEA 5KZ0A 1FGIA 1ZY4A 2IZUA 3QA0A 4U80A 5AUZA 5FGKA 2HCKA 2VTHA 3HRBA 4FG7A 4IB0A 3RWQA 3F69A 4E6QA 5J79A 3WYYA 1R3CA 3QRKA 4IANA 4NTTA 4QMSA 4QP2A 5F1ZA 3C4EA 4HVIA 1ZMVA 2OW3A 4RIYB 3R30A 1J1BA 2O5KA 4ZSAA 5BX0A 2R3OA 3OW4A 1PKDA 4DEGA 1JNKA 2GS7A 5HTCA 2I0EA 5DIAA 5M09A 4XG2A 2CGXA 4LMUA 3Q96A 2BILB 3CBLA 4MX9A 1BX6A 5KBRA 3EN9A 5DNRA 4FTKA 2IW6A 5E4HA 1U5QA 1YHSA 5KX8A 4RPVA 3UNZA 5IUHA 4V01A 2I0HA 4CV9A 2WB8A 4I0TA 2BAQA 3CTJA 3Q4CA 5CAOA 3BBWA 2QOBA 5CTPA 5ETAA 2C3KA 4HZSA 3VAPA 2C68A 2WMQA 3KMMA 4HJOA 4ACDA 4BBFA 5EYKA 3VJOA 5IA3A 2CN5A 4GYIA 2CKEA 1ZZLA 2VO3A 4LI5A 4FTRA 3U8WA 4RJ8A 4DINA 3HAMA 2C4GA 3JYAA 4HGLA 1JKKA 1TQPA 4KIOA 5JZJA 5J1VA 4E6CA 2WQNA 4HYUA 4UMPA 2WTCA 3S95A 2HENA 2GHGA 1OL5A 1H1RA 5HCXA 4O7WA 2BTRA 3U4WA 4BF2A 4O21A 5CAVA 4PP7A 4ENXA 2XNBA 4K6ZA 4FKRA 1XQZA 3PTGA 2YIWA 4FYNA 3FZ1A 3P4KA 3P7CA 4L3LA 4PL4A 3RBWA 1NA7A 3RPOA 4WIHA 3QRTA 3G15A 1OBGA 1H0VA 3PIXA 2J90A 2R3RA 4YTFA 5IA0A 1FQ1B 1YVJA 2W9ZB 3ORNA 4PPAA 4QP1A 5FDPA 1HCLA 5BNJA 1ZARA 5E8XA 2NNWB 2JFMA 3LCDA 3QC4A 4MXXA 3L9PA 4AW5A 2R4BA 4HVDA 1Q3WA 4AGDA 1YXVA 2X7OA 4V05A 3R63A 3OWJA 4LUEA 5AADA 2X39A 2V7AA 4XBUA 2NPQA 5FG8A 3MIAA 4O6EA 5DN3A 3D5UA 4RJ7A 3MY1A 5L6WL 2XYUA 3PUPA 1NT2A 3AT4A 5F20A 4QMLA 4MD8E 5HLWA 2CGVA 5DI1A 5DLSA 4CFUA 3C5UA 3PPZA 2QOIA 4JR7A 4XP2A 5KKRC 2OIQA 3ORXA 3SRVA 3ZO2A 2VRXA 4RX9A 1JBPE 5AA9A 4PPBA 5FXRA 4RC4A 3F61A 2B53A 3LCSA 2W7XA 3PE2A 4MTAA 5B2LA 5IH5A 2V62A 3ZSHA 4D4RA 2W99B 3IQ7A 1Q41A 4ONAA 4ZTLA 4C4EA 3SX9A 4NWMA 4RIWA 4CFVA 3HVCA 2CNQA 4ZXTA 2YISA 4ZSLA 3R9RA 2P2HA 4C37A 2V5QA 1CKPA 1Q62A 4IB1A 4MK0A 3A7IA 3QWKA 2JDOA 3ZSGA 5ANKA 3VHEA 5AP6A 4E1ZA 3BX5A 3JVSA 1Q8WA 1PMUA 4BCJA 5DPVA 5AR8A 3W8QA 5CF6A 3T9IA 3OY3A 5C8MA 5C03A 4C62A 4I6FA 4KAOA 3R7VA 4RWKA 3NW7A 5DT0A 1OUYA 2XB7A 4LGDA 4RWIA 2HZNA 4PNKA 4V04A 1KV1A 4HGTA 3R8ZA 2VWIA 4TPTA 3SXFA 2FSMX 4GUEA 4FNXA 4OAVB 3PZHA 2QD9A 2WELA 4W9XA 1YXUA 3A60A 4CFXA 3HP2A 4ANSA 2G1TA 4LV5A 4K1BA 4EOQA 5FWKK 4BN1A 4F7JA 2WTJA 1WBNA 2REIA 3R1YA 1XWSA 3CGFA 2R7BA 3FQEA 3UVPA 2J5FA 3HV5A 3OCGA 3VS4A 3KULB 2G15A 1ZMUA 3OS3A 4L53A 4BBMA 3ZUUA 3A61A 3OCTA 4QYGA 2HELA 2XK4A 5AX9A 3PJ1A 2OXDA 4R1VA 4DG0E 2BALA 3F6XA 1JSTA 2W5AA 4R3RA 4RJ3A 4AFJA 4TYJA 1IA9A 2C3JA 3BHHA 1ZAOA 3FMNA 4UBAA 2VX3A 2XYNA 5E1EA 4TL0A 5G1XA 3EN5A 3PIZA 4XRLA 1H27A 2BZKB 4BDDA 2WTKC 2F57A 1RW8A 4LRMA 4IX5A 3TL8A 3KREA 3LMHA 4FGRA 1ZYSA 3SOAA 3DJ6A 3AC5A 4PWNA 1XBCA 3LJ0A 4LUDA 4RC2A 4QQTA 5M4UA 2YCFA 3VNTA 4ALUA 3ALNA 1UWHA 3BRBA 4DH7A 4DGGA 2G01A 4HGEA 1Z57A 1APME 3BE9A 3Q9XA 2OXYA 3C1XA 4MKCA 3VHKA 3E87A 4FTJA 3VS5A 4I4FA 5FTQA 2WQOA 5L8LA 4WSYA 5K0KA 4C8BA 1G8AA 3R1QA 3AT2A 3HA8A 1XH6A 4ASDA 5HESA 1J7UA 4YZNA 5DWRA 5EH0A 1UKHA 3FLYA 5IG1A 3MVJA 2JD5A 3EQPA 1F0QA 3KFAA 5IQBA 3I5NA 3WE4A 4U3ZA 4LQMA 5HO6A 4PTCA 3SOCA 5K9IA 4O7VA 3R9NA 4M12A 3ZUVA 2PZ5A 5AA8A 2QI8A 2A1AB 4CMTA 4RGJA 2YIYA 4TYGA 5CI7A 1CSNA 4RIOA 4BGGA 3R9DA 2XZSA 4O1OA 3D7TA 5FUTA 1OMWA 3AD5A 2UZTA 2IVTA 4ZIMA 5JRSA 2OJ9A 3EFKA 5KE0A 4CKRA 5CANA 3UZTA 1R78A 4J8NA 3UO4A 4CTBA 4Y8DA 3OT3A 3OHTA 5EG3A 4TNBA 3QYZA 5A6OA 2Y4IB 2OF4A 3M1SA 4J1RA 4XG3A 1H1SA 3TIZA 4CQEA 2F7EE 2OICA 3HECA 4EOSA 2JGZA 5L2IA 4DGMA 5HORA 3F2AA 1GZ8A 2ITWA 3KQ7A 1KUTA 1QMZA 3QXOA 2J0JA 4QMXA 5LMKC 5AAEA 5IF1A 4AW1A 4FZ7A 4O0SA 3FZTA 2XKEA 4W4VA 3EN4A 4EH5A 5IQCA 3FKLA 4GV1A 1OL2A 2UZVA 3CLYA 4FV9A 4AE6A 4E6DA 4R77A 3PIYA 5AR2A 2B4SB 5AEPA 4LM5A 3E8DA 5I9UA 2YM6A 4NJDA 2GNHA 5CEMA 4GG7A 4YSJA 3I60A 4A07A 1ZWSA 1KE6A 3C0IA 4M66A 5D1JA 3C7QA 3GENA 4O83A 4I3ZA 1J7LA 4UZHA 5M07A 1EH4A 3HL7A 3VVHA 3W16A 2DS1A 4EBWA 3JUHA 4L6QA 2JDTA 4NSTA 4KIKB 1DM2A 4ZY4A 5LQFA 3U6JA 3HMMA 3C0HA 5JKGA 4DFLA 3EQIA 4ZY5A 5IZFA 3KN6A 3PVGA 4FT9A 1ZYCA 4FYOA 3BYVA 4ZK5A 2WTVA 4AGWA 3QBNA 3GCQA 1JQHA 4IM0A 5HCYA 5GINE 2PVLA 2XS0A 1BLXA 4OAUC 5F4NA 4EC9A 5CY3A 2UZBA 4OTIA 2QR8A 2ZM1A 3B2TA 4U9AA 4XUFA 5DR6A 1OECA 5DT4A 4BCKA 3LQ8A 4HZRA 3PXQA 4OBPA 4PMMA 4U6RA 3QD2B 1Y6AA 3IGOA 5IDNA 3DGKA 2BIYA 2QVSE 4RFZA 5EI6A 3EZVA 3Q6UA 4O0WA 3GOPA 5BYYA 4KB8A 4TYHB 1PHKA 2XH5A 1ZYLA 5IQFA 3EN6A 3W33A 2VWUA 1M2PA 1ZZ2A 4CYJA 1U54A 2ZMCA 4AW0A 2ZM3A 3O7LD 3PXFA 2UV2A 2BDFA 3D14A 4O0VA 4AX8A 1W82A 2XIXA 4JOAA 3RKBA 3GU5A 2GS2A 2QOFA 2J5EA 3LMGA 3OP5A 4U97A 2OZAA 2QU6A 2RKUA 1RE8A 2C1BA 3FHIA 4YBKA 2PUUA 4MXOA 4IJ9A 2W1HA 4YUQA 2HZ0A 3PG3A 4YTHA 2XM8A 2NRUA 4OLIA 3ZBFA 2CN8A 3VQHA 1MRYA 3KRRA 4BCGA 4DEAA 1OITA 2FSLX 4N57A 3A62A 3DNEA 3EWHA 4D0WA 5KUPA 2CNUA 2CLQA 3HA6A 3Q9YA 4DT9A 4QP8A 4KBCA 3FL5A 3HDMA 1WBPA 4BDHA 5EYDA 4KKEA 4GJ3A 4I93A 4V0GB 2PE2A 5EQYA 5JH6A 4DEBA 4L01A 2Z02A 4IBMA 5LVNA 4CG9A 3PLAE 4FODA 4USDA 3NYNA 3QKLA 3KL8A 3FI4A 3HUBA 3EKNA 1OM1A 3OF0A 4KBAA 5HZNA 4FKVA 4IVAA 2G2IA 2JIUA 3PG1A 4IE9A 5FBOA 2ITXA 3UG2A 4EL9A 5IMEA 5HBJA 3E63A 3UO6A 3F3ZA 4I0SA 4IJPA 3ZO1A 3I79A 5EW8A 3E8NA 2BIKB 4G3EA 3UIMA 2GTNA 3F7ZA 3P23A 5A4TA 3OMVA 4QOXA 2R3LA 3Q5IA 5BVNA 2R3IA 2Z7RA 3TN8A 5CSPA 2UW4A 5IQHA 2WAJA 1Y57A 2HK5A 3NNVA 5K4IA 1PF8A 4IVBA 2Z60A 4QYFA 4JDKA 2VTAA 4AN2A 2YN8A 2VWZA 2X7GA 5ANEA 4U0IA 3TZMA 4B99A 4P5QA 4ORKA 2JITA 2GS6A 5FM3A 4LL5A 4OBQA 4QMWA 4FC0A 2WMXA 4D1SA 4EH7A 3N4TA 5H8EA 1O6YA 5H3QA 5HICA 5T68A 3M2WA 4C58A 1UA2A 3GOKA 2H9VA 5CU0A 1UVRA 3PFQA 4I1ZA 4RX8A 1Q4LA 3WF9A 2Q0NA 1PXJA 4E73A 1Q61A 1ZY5A 4OTPA 5EQEA 3G9LX 4W8EA 4N6ZA 2WMSA 3CY2A 2OK1A 3L8PA 4H36A 5CF8A 1J3HA 3HKOA 4X3FB 3NUAA 4AN9A 5LWMA 4A9YA 3TZ8A 3DKOA 4TT7A 4Z7GA 3Q2MA 4NUSA 4IQ6A 2P0CA 1W0XC 1P4FA 3T8OA 2Y4PA 4RRVA 3R8PA 2F4JA 5M55A 4S34A 3MY5A 4P90A 4UWYA 3TNIA 2FO0A 2IN6A 1BL6A 1U59A 1MQ4A 4EOJA 5J87A 2OG8A 3LFDA 4EHZA 3LIJA 4PRJA 3QUPA 4BDJA 3MYGA 4DTBA 3ANRA 4I92A 4FTQA 3VS3A 2J0MB 2W1ZA 2ITPA 3DTWA 5CLPA 3E8EA 4KNBA 4EI4A 4MXYA 1YHVA 3RK5A 3CQUA 1NVRA 3Q2JA 5HE3A 4KKHA 4DF3A 1P4OA 3IDPA 4U8ZA 1ZMWA 3ZRKA 3FWQA 4WNMA 4AZFA 5IEYA 1L3RE 3MB6A 5A4EA 3B8QA 3HMPA 3KU2A 2VWBA 3DTCA 3L9NA 3L9MA 4ZOGA 2QG7A 3F5PA 4D2SA 5I4NA 4NCTC 4D28A 1M14A 2YZAA 4WBOA 5ETCA 3UPZA 2X0GA 3COIA 1CKIA 3TWJA 4TXCA 3RWPA 5JGAA 2UZWE 3KXMA 4Y95A 3RCDA 3FKNA 4FZDB 1JKTA 2OIBA 2W1GA 2OFUA 3EYHA 4NH1A 4RBLA 3ACJA 5FP5A 3UP2A 3ZEPA 4CXAA 1UU9A 2JEDA 5JT2A 3QGWA 5C4KA 4JDJA 3UIXA 4O86A 4QTCA 4MQ2A 1UU3A 3VW6A 4YTCA 3CEKA 3QZFA 2ZB0A 5KMMA 2LGCA 3SC1A 5L2TA 3HMNA 4Z9LA 2BKKA 4UMUA 4M97A 3BEGA 3QQHA 4MYGA 4R3CA 3BQCA 5A4LA 2YEXA 5IEXA 4J98A 5M56A 2ERZE 5AP7A 3IO7A 3KXZA 4GCJA 4TZRA 4CZUA 4L00A 4G5JA 2YLEA 1O6LA 2Y7JA 5FDXA 1R39A 4IWQA 5ANIA 2CSNA 3RM6A 5IMXA 4YJTA 3ALOA 4RWLA 5FXSA 3VUDA 1W8CA 1PMNA 3UYSA 4G2FA 3BHYA 3R7GA 3HEGA 5GJDA 4QD6A 4R5YA 4YZMA 4WG5A 4GL9A 4JI9A 4XOYA 3MPAA 4C3RA 3MH2A 1K9AA 3GC7A 1DAWA 3MVHA 3DB6A 3EQCA 4FKWA 3EFLA 3WZUA 3PVUA 2H8HA 2QKRA 2WEVA 5DFPA 3ZTXA 3HLLA 3TACA 4ASEA 1U4DA 5CWZA 4AZVA 3RPSA 3V6RA 3CC6A 3BYOA 3E93A 1W7HA 3BGQA 5E9EA 2CCIA 4EBVA 2IZRA 2JDRA 2GQSA 1PMEA 3WZJA 1FVVA 4J8MA 4PMSA 1JVPP 3C4CA 3MPTA 2BMCA 4EOMA 1IASA 3CKXA 5D7VA 5C9CA 2PSQA 3UZPA 4RIXA 4BHZA 2RIOA 5IUIA 1A9UA 4Q2AA 4NFMA 3O17A 3DJ7A 1E1VA 3QTZA 4NFNA 4IWPA 1PMVA 2G2FA 2OH4A 4ANMA 4ID7A 4KWPA 3UVQA 3LFNA 4CLJA 1YWNA 4U5JA 5E8TA 2J6MA 2W05A 3NVMB 4FVPA 2J50A 4OW8A 3NUNA 3UC4A 2P3GX 1V0BA 4CG8A 3FSFA 3H0ZA 4FKOA 4O7NA 3UGCA 3DPKA 4BRXA 1GIHA 3U6IA 3P7AA 5DOSA 4EWHA 3GQIA 4FBXA 4I22A 4RLLA 5HX6A 1VR2A 4O7LA 3VUKA 4U7ZA 3PY1A 1NXKA 1XO2B 3QZGA 4X0MA 3FL4A 3NNWA 5CVGA 3ZU7A 5C8NA 1FBNA 4LYNA 5G6VA 3RP9A 2QODA 4C0TA 4C3FA 5LCJA 3I7BA 4M3QA 4FVQA 5HU3A 3GCUA 2C6IA 5DA3A 1YI4A 5M4FA 4DEEA 5HO8A 2IVVA 5M4CA 4YZCA 4IVDA 4Y72A 1MRUA 2OF2A 3HV4A 3I81A 4IDTA 5CI6A 3TEIA 3UZRA 3CR0A 4TNDA 3ORZA 2Y6OA 2WEIA 4BTKA 2CGWA 2ZAZA 4YHJA 4EK3A 4AN3A 3KXXA 2BCJA 4ZTNA 3KGAA 2B54A 3NUYA 4RG0A 2Z7LA 3WF6A 2WU6A 4Y46A 4FKJA 3OXZA 4NIFA 4BC6A 5EFQA 3NUSA 4HVSA 1FMKA 4F1MA 5CAUA 3ZFMA 3MFTA 5KBQA 2O63A 1UNLA 1PXPA 4O7ZA 5IQDA 5CF4A 3CQEA 3WI6A 3HX4A 4K11A 3E3BX 2HYYA 4I94A 4FT0A 2BZJA 4A9UA 4EOKA 3AQVA 4DTKA 3RINA 2C6KA 4EZ5A 3UODA 4AGUA 5KNJA 4CV8A 1IG1A 3NUPA 4C4JA 2GHMA 3THBA 4PDYA 5B2KA 1UWJA 4F1TA 4RX7A 5EM5A 4Q9SA 1CM8A 4KRDA 4DG2E 4F9CA 3ORPA 4W4XA 3VRYA 4ZMEA 3PXYA 4O82A 3ZLYA 3Q4UA 1O6KA 1A06A 4AA0A 2BFYA 3FMHA 3NW5A 5C1QB 3CJFA 3NMUF 1GZNA 3FLQA 2C5YA 3VBTA 4F08A 3I0OA 4IB3A 3BQRA 4IX6A 2XCHA 3BWJA 3BGZA 4E6AA 4F7LA 3TDVA 2AC3A 4U43A 2I7QA 3CTHA 3LCKA 4GW8A 3D4QA 3HV3A 3LM0A 4C4IA 3IKAA 5HBEA 2VNYA 4NTSA 3OEZA 3DV3A 3S1HA 3G6GA 4QMPA 2W5BA 3GFEA 3KF7A 3F2RA 5K0XA 5CASA
chains in the Genus database with same CATH superfamily
4YTIA 4FVRA 3RPYA 5KKRB 3CGOA 2XVDA 3OUKA 4G9CA 4LL0A 2OH0E 3DK6A 4XNEA 3FI3A 3M11A 4QPAA 2A0CX 3DAKA 2CHLA 4NT4A 3RJCA 4BICA 2PU8A 4FUYA 3FYJX 1WBWA 4D55A 4ENYA 2W1FA 3EJ1A 2HOGA 4L8MA 4WNPA 4USFA 3V5PA 3D0EA 5IU2A 2CGUA 2AUHA 5TE0A 2CDZA 4F9WA 3QTQA 4I4EA 3PJCA 5AAGA 1XH7A 2WD1A 2X6EA 4MBLA 4E5WA 5HTIA 2RGPA 5I9YA 1YRPA 1WAKA 3TXOA 2FH9A 3DBCA 4FSNA 3RAKA 4ERKA 1PXKA 4FT7A 3BYUA 3SDJA 4I5CA 3FMLA 2X1NA 2XP2A 3RAIA 4CFWA 4FKQA 3FXXA 4G3CA 4TTHB 4YPSA 3S2PA 4JG7A 4D4YA 2DQ7X 3Q52A 3R6XA 4PP9A 5HG8A 2P55A 5L2SA 4BDFA 5CAPA 2WGJA 3A99A 4EH4A 5EQPA 4I5HA 3FV8A 1FOTA 5HOAA 5LXMA 3RALA 4YZDA 1IA8A 4XLVA 1PJKA 5CEQA 5GNKA 4QNYA 2BDJA 2P2IA 4RIYA 4BHNA 5IKWA 3BCEA 3PXZA 3SQQA 4D58A 4ZLZA 2G9XA 2ETRA 5DT3A 3VBWA 4XV1A 2PMOX 4HNIA 5K5NA 4FKSA 4BWXA 5EI2A 4G6NA 4EOOA 4QEBA 2I40A 2OSCA 3QD3A 4X2NA 3JY9A 1E1XA 3QD4A 3VBYA 2JFLA 4RMZA 3FMJA 5LVPA 3R21A 5KO1A 1JAMA 3ZDUA 4BKYA 3NCGA 4S32A 5LCKA 2VTLA 2G2HA 3DS6A 2XBJA 5I9VA 3LQ3A 2Q0BA 5DGZA 4YJNA 4YURA 3VBXA 1WBVA 4F0IA 2F7XE 2JBOA 3CCNA 5EM7A 2WTKB 5TOZA 5EDPA 4DEHA 5H8BA 5L6PA 2RFDA 3DBQA 1YDRE 1URCA 2A98A 5CEPA 1P2AA 4QYEA 5HVJA 2UW9A 2XRUA 3W2PA 3W10A 4UB7A 3MWUA 1YOMA 2WIHA 4M84A 4DN5A 2PMLX 5C4LA 4XYFA 3OBJA 4QPMA 3EQGA 3EFWA 3PSDA 4LV8A 3LLAA 2WMVA 2ZV2A 5BVDA 3QFVA 4WBBB 1QPDA 5CU3A 4ANQA 1UNGA 4APCA 1H8FA 3T9TA 4BBEA 2IVUA 4ZTQA 3OZ6A 4IDVA 3R8LA 4FKLA 1SVGA 2QLUA 3HRFA 4M15A 4UX9A 3A7JA 4JBVA 5EDQA 2O0UA 3HMOA 3KMUA 4W9WA 2OXXA 4CMOA 1YOLA 4C4HA 5KMJA 2PMIA 3RHKA 5BQ0A 2IVSA 3COKA 3KA0A 2PE1A 2QNJA 3QZIA 5GHVA 2YM4A 5EYMA 4FT5A 2VGPA 4BCHA 5C27A 4EUTA 4DITA 3EB0A 4JDHA 3ZONA 4GYGA 4HYHA 4RVKA 2C0OA 3Q9WA 4GRBA 4C7TA 5F9EA 1H1PA 4O22A 3WARA 5CZHA 2O65A 3I4BA 4LDTA 2VWXA 1S9IA 4QYHA 1CMKE 5I0BA 1H4LA 3R8VA 4DGLC 1TQMA 3V8WA 3C0GA 2QHMA 2RG5A 4IC8A 3DQXA 3I7CA 4B8LA 2CKPA 3LMIA 2XJ1A 4IAIA 4WUAA 2ITYA 2ITZA 3S4QA 4NM0A 2YABA 3QLGA 2WQMA 3IW8A 4QQ5A 4QMQA 4DFZE 4C4FA 4YC6A 5AIRA 4D2TA 4FSYA 4BCNA 3NVKI 3QCYA 4TKSA 3HMIA 4II5A 3EIDA 4PMPA 3FXWA 4FTCA 2YCQA 3NIEA 3TKIA 2RL5A 3F82A 3ENHA 3WZDA 1YKRA 4IMYA 2BFXA 1Y91A 2EU9A 4QO9A 2ZV9A 3LFAA 2OGVA 4BDAA 2X9EA 5HEZA 2WU7A 4AFEA 2VX0A 4X2GA 2FB8A 2HZIA 4O38A 4FJVA 2ZV7A 3FMDA 3BIZA 4KKGA 3G33A 4C57A 4DH3A 3WF5A 4EHVA 3IW7A 5M51A 3DXPA 5DRBA 5CXHA 3ZLSA 3LE6A 2QO2A 4X6QC 2Y0AA 4ZJIA 3OTVA 3V3VA 3E62A 2EXMA 3LCTA 4NEUA 4DH5A 2Z7SA 3IS5A 4ANOA 3DJ5A 4PQNA 3KULA 4R7HA 5HG5A 5GZAA 3GFWA 1XH8A 2UVXA 4XOZA 5D10A 3FPQA 2F49A 3NUUA 4DEDA 4EH6A 1GY3A 4USEA 5IISA 5M4IA 2E9OA 4RVMA 3NW6A 2W1IA 4X2JA 3SW7A 1G5SA 3QC9A 2XUUA 4PDPA 5FLFA 5CVHA 4U79A 5CX9A 4GMYA 3NSZA 4W4WA 3UDTA 4JQ8A 2J7TA 1J91A 3DNDA 4DFXE 2R3JA 1XKKA 2ERKA 3EOCA 2QLQA 4S33A 4IWOA 3BU3A 4BI2A 3D7TB 2PK9A 3MFUA 4MF0A 4X2FA 5AV3A 5FD2A 4BDEA 3Q5ZA 3QHRA 3MH0A 1GIJA 2C5OA 1M7NA 4L68A 4M0ZA 3MJ2A 1YW2A 5CEKA 2HWOA 3EYGA 4M0YA 3K5VA 4JX7A 4FE2A 3G0FA 3P9JA 4R7BA 1URWA 2VTTA 3QAME 3WIGA 4ANBA 4BI0A 3P79A 4QQCA 3F3TA 2QOKA 4JRNA 4BTMA 4GK3A 4ZAUA 4GVJA 2YERA 4M68A 4WNKA 5IQEA 4GT4A 2BTSA 4MXZA 4NJ3A 3O23A 2IPXA 4ACHA 2CJMA 3ZHPC 3LOKA 1NW1A 2PHKA 5H9BA 4GEOA 4WSQA 4RQVA 2JKMA 2XK3A 4XG9A 1P14A 4L52A 4FGBA 4UYNA 5DG5A 3NNXA 3L8XA 2OKRA 1YOJA 3CY3A 4RLKA 1OPLA 1ZLTA 2XRWA 4CSVA 1R1WA 3C4XA 2VU3A 2QR7A 1LR4A 5CAQA 4K77A 3EHAA 1VYWA 2R3GA 2KULA 2XK8A 4O0RA 4QP4A 3RAHA 5FM2A 4EK5A 3AC8A 4D2RA 2UW3A 2CKOA 5E92A 5JEBA 1XH5A 2XK7A 5EM8A 3VRZA 1IAHA 4OTFA 2ACXA 3EQBA 4O7TA 4AUAA 5B2MA 3LJ2A 1SVHA 1YXSA 2VO7A 3E88A 3QKKA 3Q04A 3OC1A 4UMRA 2X4FA 3Q6WA 4L45A 4O2ZA 5AV1A 2WNTA 4B6LA 3ATSA 4HNFA 5EM6A 4E26A 5AM6A 2PYWA 1GOLA 3I0QA 4C33A 5JFSA 4MXCA 2A4LA 2PVHA 1UU7A 5CYIA 4O84A 4FR4A 2R3HA 3SG8A 5CS6A 4FK3A 1V0OA 1T45A 3REPA 5EOLA 2WMTA 5L6OA 4YBJA 4DAWA 3IDBA 2YDJA 2QG5A 4UMQA 4ITIA 4CRSA 1H26A 2ITVA 3S3IA 3TCPA 4KIKA 1K3AA 2Z2WA 3PPJA 3FY0A 3LXLA 4TRLA 4FV4A 3TNWA 4O0TA 4XH6A 5JZNA 2UW7A 5HVKA 4HVGA 5DMZA 2HAKA 3P5KA 4FI1A 4O4EA 4YJPA 3MTFA 1OIYA 4J53A 3CQWA 4O6LA 1YXTA 1G8SA 2I6LA 4YLJA 2YA9A 2RSVA 2WIPA 4K0YA 3MA6A 5HE0A 4KSPA 3N51A 1Y8YA 4L42A 2VTMA 1M2RA 3G2FA 4F0GA 3DAEA 3TI1A 1OBDA 4LGGA 4EZ3A 3ORIA 2IF8A 3DFCB 3H30A 3E5AA 4M8TA 4P4CA 4YO4A 3CE3A 2HXQA 2R5TA 5M44A 4UALA 2R0IA 3NZ0A 1SNXA 4XV2A 4TYHA 4BKJA 3V51A 4IADA 3A7GA 4AGCA 3R02A 2VZ6A 3DY7A 3S0OA 2C1AA 2C47A 5CF5A 1GIIA 4J97A 3V5QA 4BZNA 4P2KA 3D5XA 2ZDTA 3FEGA 2YACA 4ITJA 3UQGA 3TV6A 3JVRA 2CMWA 4H3PA 4D0XA 1CKJA 3H9RA 2X2LA 3DB8A 5J7HA 5JGDA 2UW5A 1CTPE 2YWPA 3OOGA 5JQ8A 4CTCA 2QOOA 5IPJA 5BPYA 2WTWA 4FV3A 4F64A 4LRKA 3C4ZA 4GH2A 1KOAA 3VIDA 5CSVA 1XR1A 4PUZA 3VUGA 4W8DA 4QTDA 2W4JA 4PY1A 4Z16A 2R64A 1YDSE 2R3FA 4OT6A 5HTBA 4IEBA 3V5JA 4JQEA 3FLNC 4IX3A 4QP9A 4DH8A 4HPUE 3WIKA 3FSKA 5AM7A 3DZOA 3QWJA 5F95A 3CSVA 3NWWA 3ZBXA 3OWPA 4KA3A 3MJ1A 4YJQA 2OZOA 4AA5A 4YJSA 2OBJA 3AXWA 1YXXA 2QQ7A 4OGRA 4GS6A 4MWHA 3RK7A 4BGHA 4EH3A 4RFYA 5JFVA 5FTGA 2WKMA 4L43A 4ZSJA 1ZOGA 3POZA 5I9ZA 4NKAA 4C4GA 4FSRA 4M7IA 4UMTA 5JN2A 4F4PA 3NLBA 5FXQA 5AR3A 3W32A 1BYGA 3N4UA 5FP6A 1H25A 3D9VA 2ITOA 3MBLA 1XHAA 3RMFA 3Q32A 3BWFA 2YIRA 2WHBA 4PMTA 4UXLA 3TMOA 2YAAA 5FEDA 3SAYA 3R22A 3GU7A 2C5NA 1MUOA 2PVMA 1VEBA 2F2CB 3FMMA 3P0MA 1Q99A 4X6RA 5E8YA 5AV0A 4D2VA 4WO5A 3HP5A 5LVOA 3FI8A 3DAJA 4Y83A 5AP4A 3NYVA 5HIBA 2YAKA 3RVGA 4FTOA 1PRYA 4QP3A 5ETFA 4APPA 2XNPA 2X2KA 2XNOA 5E8VA 4CKIA 4XP3A 4ITHA 3P7BA 2GTMA 4JBOA 4M69B 4X2KA 3LZBA 3ZXZA 5LMAA 4U44A 3ACKA 5EHLA 2JAVA 2XM9A 1QPJA 3BELA 4XV3A 4HOKA 3HAVA 3D7ZA 4RSSA 4QMVA 3PP0A 2HZ4A 3BHTA 3OUNB 2QOCA 2WMUA 3PA4A 3UJGA 2BHEA 1ST0A 3HDNA 4WHZA 3RPVA 4CFFA 1OGYA 2JKQA 3UMXA 4L7FA 5TKDA 3SXSA 5DEYA 2X6DA 3TKHA 4HVHA 2W96B 4EJ7A 2X8DA 4DEIA 5J5TA 4XG6A 4EUUA 1I09A 1W98A 3LW0A 3W8LA 4G31A 4M67A 3V01A 5E8WA 3OXTA 3RTPA 3G0EA 3U87A 4X3FA 1ZOEA 2WZJA 3FLWA 5ICPA 3QXPA 4ASZA 3QTRA 3ZRLA 4XG4A 2Y6MA 3BLRA 3OBGA 4K18A 2NP8A 4W4YA 4BZDA 3W0MA 1SVEA 5EW3A 2C69A 3AC4A 3IG7A 1NVQA 4Y73A 4IAYA 3UPXA 3SW4A 3ANQA 2X81A 3B2WA 3W2CA 2ZMDA 3U9NA 4BB4A 4ERWA 4JR3A 5IA1A 2QO9A 3EMGA 3P78A 5K5XA 3PA3A 5AX3A 3WILA 3VF9A 4CT2A 5M57A 3BYSA 3QALE 5AV4A 2VWVA 4I24A 4G1WA 4DTAA 2VTJA 5ACBC 3DBDA 4BIBA 1RDQE 5A14A 5GIPE 1QPCA 4P5ZA 5AAFA 2VTPA 2XNNA 4L44A 5KMLA 3N4VA 3IW4A 4G34A 3NCZA 5DH3A 3SLSA 4DHFA 2ZOQA 4IHPA 5DR9A 2IW8A 3G9NA 3Q4TA 3W2OA 1STCE 2YM8A 5J8IA 5EKNA 2XAMA 2OLCA 1Q8ZA 3E92A 4YLKA 4RVTA 4DH1A 4EYMA 3AD4A 4HCUA 3F5GA 2BRGA 2PVYA 5LJJA 2PE0A 4IAZA 3DK7A 4YJRA 5HIEA 4G6OA 2C6LA 3LAUA 4QTBA 4BL1A 3LFQA 4JIAA 4EORA 4XG7A 2XK6A 2VO0A 3EQRA 3R7EA 4CT1A 3TDWA 3Q53A 3VWAA 3IOKA 3EN7A 3V5LA 2C3LA 5KHXA 4K8AA 4Q9ZA 3EH9A 2HY0A 2GNJA 4EQMA 3HV7A 4NK9A 3ZEWA 4A4LA 3KRWA 2YHVA 5ANOA 4YR8A 5I3RA 5BYLA 4JS8A 2J0LA 3QQLA 1Q24A 2GSFA 3ZXTA 2XEYA 4LOPA 2ONLA 3D2IA 5CU6A 3CPBA 5HD7A 1OIRA 3DA6A 1OKVA 5HBHA 4UY9A 2V0DA 2R3PA 3HYHA 1Q97A 4S2ZA 4BDIA 2X4ZA 3DKCA 1B39A 1H28A 5IA4A 3FPMA 1M2QA 4A06A 4JAJA 2KTYA 4GK2A 4AU8A 1XBAA 3BU5A 5E7RA 5ACKA 3U9CA 3MW1A 2R7IA 3FBVA 3ULIA 2F9GA 4EH9A 5HU9A 4O2PA 1W2CA 4A4OA 1RQQA 5AUWA 2JIVA 4E4MA 3W0OA 1M7QA 4YC8A 4H3BA 3PSCA 1FMOE 1CDKA 1NY3A 2XBAA 3UBDA 4AT5A 1SYKA 1W84A 2YM7A 4KS7A 1XH4A 3V04A 4AE9A 2BAKA 3IONA 3SD0A 4TN6A 1B38A 3KB7A 1KE5A 5IH6A 3D5VA 3RNYA 4BI1A 3TNPC 3QCXA 4RZVA 1WCCA 3NFFB 2HWPA 2GFSA 5A6NA 2W4KA 4YHTA 3D2KA 4EK6A 3KXHA 4ZJVA 2GQRA 3KC3A 3HV6A 4GFGA 4ZS0A 1A48A 4NYEA 4I6QA 4FSTA 2PVNA 4E8AA 5KMNA 3LCOA 4KUJA 4J7BA 3PZEA 5J7BA 4AT4A 3AKKA 3D5WA 1PYXA 3GNIB 2YZLA 2J4ZA 3NS9A 2I1MA 4NW6A 2R3NA 4XCUA 4IFGA 5DE2A 1PKGA 2O8YA 5E8ZA 3ZSIA 5BUJA 2A19B 2HXLA 3KRXA 5AP3A 4N6YA 4X21A 1Q8TA 3GXLA 1DI8A 4UV0A 4ACCA 4DFBA 2GFCA 2UVZA 3PUFC 3QQGA 3O0GA 3K54A 5LOHA 1BL7A 4QP6A 3I6WA 2X9FA 3DXQA 5L8JA 1LEZA 2BRNA 1OVEA 4Q5EA 2ZDUA 5JMSA 4IXPA 3WBLA 4MF1A 1TKIA 4ZSGA 4F0FA 4A4XA 2GMXA 3UDZA 2Y8OA 3GCSA 4YSMA 3ZM4A 1ND4A 1KE9A 3BHUA 3BKBA 3FUPA 2RFSA 4JG8A 1YWVA 3O5AA 3EFJA 4RJ4A 3HUCA 2JAMA 3UO5A 3LFBA 1HOWA 2YLFA 4FV0A 3UQFA 3PDTA 4NIFB 5FEEA 3GGFA 3JS2A 3TT0A 2VTIA 2VTRA 4YNOA 4OTDA 4DFNA 4H1JA 5HG9A 4UN0C 3A7HA 4L67A 4YPDA 3PA5A 4E5AX 4QPSA 4ALVA 3BV2A 2JLDA 4GFMA 2ONLC 2W17A 3MIYA 2BROA 2QHNA 4MNEA 2B7AA 2P4IA 1W2DA 4GK4A 3FMEA 3OG7A 4JXFA 3LFEA 5J9YA 5AV2A 3UIBA 2JDSA 4HCVA 3VC4A 4IZ7A 4JAIA 4U45A 1T46A 4C35A 5I5ZA 2DUVA 3ORTA 5IH4A 2YDIA 3UOKA 3VS0A 1Q5KA 5HQ0A 4GKIA 3TG1A 4FSZA 2Z8CA 1FVRA 3ZMMA 4XG8A 4PTEA 3NNUA 4QMYA 1TVOA 3OWLA 5D11A 4QMNA 4KS8A 4K2RA 2RFNA 3KK8A 3BL9A 4IVCA 4ANNA 5L4QA 1OI9A 3F3VA 3GU8A 4H3QA 5HGIA 1UU8A 3IK3A 4AA4A 2UZDA 3TTIA 3R0TA 2YDKA 4FX3A 4DCAA 2YM3A 2B55A 4O96A 4P7EA 2OJJA 1OB3A 4J52A 3VN9A 3F3UA 4IZAA 2PTKA 4AG8A 3MI9A 5H2UA 5K4JA 2J0IA 2GPHA 4OTRA 4PDOA 2IW9A 3MN3A 4DDIA 4D2WA 3ORMA 3DLSA 4G3FA 3QF9A 4IIRA 3PPKA 5JFWA 4F99A 2UZLA 3GU6A 3AG9A 4PX6A 3E7OA 4C59A 3UOLA 3QZHA 3DXNA 4OTWA 3KXNA 1PXNA 5ANGA 4RA5A 4O27B 4O0YA 4R6VA 5T3QA 4PV0A 3IOPA 3R2YA 3R9OA 4CZTA 2WFYA 4JG6A 5IDPA 4DHIB 1UNHA 2ESMA 3IW6A 3CXWA 3KRLA 2XA4A 2YIXA 2VUWA 3FZSA 5LMBA 4JNWA 5DR2A 5IEVA 1GAGA 3HZTA 3O51A 4EOPA 1E9HA 3SHEA 4XLIA 4RZWA 3GUBA 4XRJA 3O2MA 5AR4A 2V7OA 3QX2A 1H00A 3FLSA 4NZWB 5HKMA 4KIPA 2QOHA 1F5QA 4YZBA 2W4OA 4GJ2A 5FTOA 4JDIA 3AMYA 3W55A 4R8QA 5CSWA 3CKWA 5GZ8A 2X0OA 2OJGA 3FQHA 4GU6A 3QTSA 3RZBA 4IAKA 5M08A 1YQJA 4CRLA 2B9HA 2XKDA 1WBOA 3PFYA 1OKYA 4D5HA 5HIDA 4AWIA 4O7YA 3R71A 5K3YA 3LVPA 3O8UA 4E7WA 4EKKA 4GUBA 3DZQA 3OFMA 3LM5A 4GVAA 3K5UA 4K9YA 4ZEGA 4KINA 4D9UA 4HCTA 3TZ7A 3UOHA 3QTWA 5HNBA 2PY3A 4CMUA 2XNEA 3CJGA 3R1NA 3C50A 3DOGA 3C4WA 3SVVA 1ZYDA 1SM2A 3MDYA 2YJSA 3SXRA 1LUFA 1H1WA 1I44A 3DKGA 3FY2A 4ZTMA 4DYMA 3ORLA 4FL3A 3QQKA 4MHAA 2XKFA 2BKZA 3BV3A 3JPVA 4LMNA 4X3JA 1XH9A 1MRVA 4HPTE 4CLIA 1IR3A 3C9WA 3CIKA 3NUXA 1UV5A 3EL8A 2WMWA 3ULZA 4DA5A 3LHJA 2BZIB 3ORKA 1REKA 3FI2A 4Y85A 5GJFA 3UE4A 1OPJA 3EZRA 3NIZA 2VTOA 2QU5A 1ZXEA 3ETAA 5AUVA 2NRYA 5L2QA 3KRJA 5AMNA 2UZUE 3NDMA 5FEQA 4FT3A 2J51A 3GVUA 4ZTHA 4ZTSA 4ALWA 2PULA 3LKMA 5DRDA 4ANLA 2XALA 1J1CA 1BUHA 3LFSA 3UVRA 2PWLA 5IA5A 3R01A 3WF8A 3WE8A 2R3KA 2QO7A 1M17A 4EOIA 4YLLA 2UUEA 5LVMA 4GKHA 4IX4A 2B9FA 3ML1A 3ODZX 4MCVA 3SRVB 5L2WA 4JRVA 4EK4A 3MA3A 3GQLA 2ZYBA 4IFCA 5GJGA 3NAXA 4JX3A 1B6CB 3QTXA 5DHJA 5DVRA 2WTDA 3HRCA 4B9DA 3ELJA 2Z7QA 4TY1A 4RIWB 1VYZA 4FL1A 3LJ1A 2H96A 4FG8A 4F1OA 3KY2A 4O1PA 1OUKA 4IWDA 4K33A 4F7SA 4L46A 2UZNA 3EQHA 4DGOA 3QQUA 5J5SA 1OPKA 2E9NA 4BIEA 5BMSA 1R0PA 3ZS5A 4FTTA 2Q83A 3AC1A 3TZ9A 3MY0A 3QTUA 3DLZA 1UKIA 3CD3A 3DK3A 4C2WA 3SG9A 3O7LB 4ZY6A 2C6TA 3AMAA 3UTOA 1REJA 2PVKA 3DU8A 3UP7A 4GT3A 2UZOA 3KVWA 2OJIA 3C13A 1WFCA 4C3PA 3C5IA 4EJNA 5KCVA 1JSVA 1Y6BA 4AT3A 3K3IA 2PUNA 4QP7A 3VBQA 2ITNA 2BUJA 2W1EA 4FICA 4L3PA 2YCRA 1GNGA 3FJQE 2C6EA 4IC7A 3R7YA 3BEAA 4F6SA 2EXEA 3U6HA 5C01A 4I20A 4AAAA 3LXKA 1MQBA 3PY3A 3L9LA 4ZTRA 3K3JA 4MBIA 5HNGA 5M53A 3KKVA 4G17A 4ARKA 5IQIA 2Y9QA 5EKOA 5HG7A 1YWRA 2WQEA 3OROA 4QNAA 4A9TA 5ITAA 3TNQB 2HW7A 1OKWA 5CSXA 4BYJA 3P1AA 3PJ3A 2R3MA 3W0PA 2XJ2A 3ODYX 4XP0A 5LMKA 3CP9A 2E9VA 4KIQA 3PRIA 4WUNA 2XNGA 3AGMA 4KD1A 3V8SA 1AGWA 2QOQA 3BHVA 3BLQA 4MWIA 3RK9A 4AZTA 4YJOA 5E91A 3OW3A 2OJFE 2PMNX 4NU1A 3ZC5A 3A2CA 5CU2A 4XHKB 3QUEA 2FUMA 5E1SA 3CS9A 4MVFA 3BL7A 4I5MA 3SV0A 4AXAA 4U42A 4LGHA 4HW7A 2XF0A 2OU7A 2R9SA 3POOA 3UMWA 5DBXA 1VLRA 2PUPA 5HCZA 3AGLA 5LVLA 3MFRA 2C30A 2WMAA 4EK8A 2WTIA 3QD0A 4PPCA 3R83A 3KEXA 2H34A 4PNIA 4U40A 5EK7A 4O91A 1WBTA 5FQDC 5HE2A 3G51A 2BRMA 4WG4A 4F6UA 2W1CA 5E90A 4FKPA 3ZDIA 1ZRZA 3MFSA 4FIIA 1ERKA 3QGYA 5BMMA 4Y5HA 3P86A 4DC2A 5CQUA 3KCFA 4Y5QA 3BLAA 3GCVA 3VUIA 5CNOA 1KWPA 3F66A 1ZYJA 4FIHA 3UQCA 3AOXA 5AWMA 4QMMA 5A46A 3E7VA 4IH8A 2C6DA 2NO3A 3A8WA 3FE3A 4JL9A 4E4NA 1VZOA 3GI3A 5I3OA 3KK9A 4IM3A 3F9NA 4CFMA 4JQ7A 3TKUA 3BE2A 3KXGA 4FV2A 3FZRA 3QHWA 4R3PA 2UZEA 4D5KA 3TJCA 1JKSA 1M52A 4KSQA 4G3DA 4I21A 3D83A 3RNIA 1OIQA 3TNHA 4LOQA 3ZYAA 3MH1A 3QU0A 2JDVA 2YFXA 4FTMA 3NX8A 4JIKA 4L3JA 2V22A 5HLPA 4OBOA 2XMYA 1H08A 1RJBA 3E3PA 3NGAA 3K2LA 4OTHA 4BCQA 4CCBA 3VQUA 5L8KA 4FZ6A 3UC3A 3A4PA 3OT8A 4FK6A 2GDOA 2WXVA 2RF9A 1Z9XA 5BUEA 4H58A 4ZSEA 3PE1A 3FLZA 3GC8A 1YI6A 4MBJA 4G9RA 4YHFA 3MB7A 3RGFA 5GZ9A 2QOLA 1H24A 2BZHB 4BZOA 2CPKE 1YDTE 2OI4X 3DBFA 2ZM4A 4RQKA 5CSHA 3E64A 4CEGA 4EH2A 4FV7A 5CEIA 3T3UA 4AP7A 4CNHA 1H07A 4BJJA 5HVYA 3EQFA 4XX9A 3Q3BA 4IM2A 3WF7A 4RJ5A 2ITUA 3GBZA 1OL6A 3OCSA 2J9MA 1H01A 5L3AA 1K2PA 1WVYA 4A9RA 4J95A 2BVAA 3SA0A 3W2RA 3PP1A 3LLTA 2W1DA 4BYIA 5AP0A 2ITQA 2DWBA 3ZLXA 2JKKA 3L8SA 4RFMA 2GNFA 2ZV8A 3VBVA 4C2VA 3BGPA 5IUGA 1IAJA 4NM3A 4O7RA 3N9XA 2RFEA 1V1KA 3HNGA 3ZC6A 1PXLA 4PL5A 2C3IB 3TJDA 1JKLA 5J1WA 3RZFA 5AUTA 4PL3A 2HY81 2YWVA 4RT7A 3TIYA 4XBRA 3UDBA 4BDGA 4IACA 4ZMFA 4IZYA 2X8EA 3II5A 3LXNA 3R1SA 3R8UA 2VNWA 5DEWA 3RHXA 5IA2A 3B8RA 4UEUA 1OL7A 4KRCA 4GIIA 1JPAA 4DT8A 1U54B 2I0VA 5HI2A 5LWNA 3PJ2A 3V8TA 1PXIA 4I0RA 3MVMA 2PZYA 3T3VA 4FNYA 3DDPA 3PSBA 3PYYA 3ATTA 2V55A 3FKOA 2VD5A 2FA2A 5CVFA 1BI7A 3GT8A 4B4LA 1LPUA 1SMHA 2OZAB 4N70A 4H1MA 4CZYB 4AACA 1DAYA 3VUHA 4UYAA 3AT3A 4FSQA 4F9AA 2AQXA 2B52A 3L8VA 3F88A 3QQFA 3G90X 4E4LA 3R04A 4N0SA 4E3CA 3BLHA 4JBQA 4EYJA 3ERKA 1NVSA 3AC2A 4EEVA 1U5RA 2BDWA 3P08A 4LRJA 5J95A 5AUUA 2IG7A 4ZS4A 5AR7A 3IDCA 2I0YA 5HLNA 1ATPE 4RC3A 2HIWA 3ZZWA 4JLCA 3PLSA 2BAJA 4WD5A 1H0WA 1X8BA 3TUDA 3ENMA 4G5PA 1FINA 3F5XA 1OGUA 3NR9A 4IZ5A 4OTQA 3ZH8A 4MQ1A 3IGGA 2C0TA 5AP2A 4BDBA 4MD7E 4BDCA 4FKUA 3I1AA 3KN5A 1J7IA 2VTSA 3DT1A 1IEPA 5KHWA 4NKSA 2UW8A 4M14A 2NYAA 3F7WA 2PZRA 4UWCA 4AOJA 3S00A 2CNVA 2RG6A 3ZO4A 3OY1A 5C8KA 5IQGA 2Y4IC 3D94A 4YC3A 3RM7A 4TWPA 3QTIA 2HW6A 2JC6A 5AR5A 3LFCA 4TWCA 2P33A 4EH8A 3M42A 3H10A 4I6HA 2AEGA 2XEZA 2IO6A 3NYXA 2DYLA 3EL7A 5AUYA 3W2QA 3WOWA 4D1ZA 3FC1X 4WG3A 4YU2A 5BVKA 2WPAA 3NAYA 3ROYA 3VS2A 3PWYA 4GU9A 4D4SA 1DI9A 5BVOA 3TV7A