3OCGA

P38 alpha kinase complexed with a 5-amino-pyrazole based inhibitor
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
349
structure length
336
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLTRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title 5-Amino-pyrazoles as potent and selective p38α inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 99
structure length 336
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3ocgA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3ocgA01
5ANKA 3I6UA 4DHFA 2J50A 4IAYA 3RPRA 2ERZE 2V7OA 4AA0A 4RZWA 4O7ZA 4GK2A 4A9SA 1URWA 3PXKA 4BCIA 1BX6A 1OVEA 1PYEA 5FBNC 2EB2A 4FTMA 4M0YA 4RWLA 3C4ZA 3BE9A 3VRYA 4J8NA 4JDKA 5HORA 3RK7A 2W17A 2W1ZA 2YIRA 2QI8A 3F88A 2XNGA 3GT8A 3OEZA 3RAHA 4CKJA 4M8TA 5AR7A 2IVTA 3NVKI 3NUAA 3BV2A 4RBLA 2J9MA 1YXVA 3FYJX 4QYYA 4G6NA 3UP2A 4B6LA 3S1HA 3F9NA 3CD3A 5AV2A 4J95A 4FNWA 4ZMFA 3P4KA 2NO3A 1V1KA 3FBVA 5KKRB 4MF1A 1SNUA 1ZRZA 2W1FA 3C13A 4KKEA 4UWBA 3TNIA 3W8LA 3NYNA 4AA4A 4LRMA 5EYMA 4FEQA 5KNJA 3DQWA 4F70A 2ZV7A 5K0KA 4BWPA 4BY9E 3A7GA 4II5A 2YJRA 4O0XA 4PP9A 4FKIA 4YLKA 4E73A 4UMUA 2XIKA 4TW9A 4PP7A 2QU5A 2XK9A 4NL0A 3TDWA 3CEKA 5DHJA 4ACMA 3DXNA 4FSUA 3TUBA 3VC4A 4NK9A 3Q4UA 4FOCA 3QQGA 4FV5A 3VBTA 2O8YA 5K0XA 4UXQA 2PVLA 4Z16A 3WZEA 2JFLA 4NW5A 4AUAA 5ANIA 3UQFA 2UW3A 3HAVA 3ZDUA 2PZRA 4HZSA 2P0CA 4KIQA 3R7EA 3TKUA 2JAVA 4EHVA 3EQFA 2OG8A 3FZTA 3ORKA 5E8ZA 4NM3A 2I0EA 3EQHA 4JR3A 4C4HA 2YM7A 5L8KA 2W4OA 5BMSA 3VAPA 1KOBA 4JT3A 3TKIA 5I9WA 3ANRA 4X7QA 5A14A 2ZM3A 1H0WA 4QMSA 4TYHB 4ZZMA 2X9FA 4O7LA 3UIUA 3NAYA 4EK5A 3LFEA 3II5A 4QMZA 3JYAA 4IVDA 2RG5A 3OUNB 3ZUUA 4XG8A 4XOZA 4UXLA 5IH6A 2ITPA 3FPQA 3ZHPC 2WMWA 1OI9A 4O38A 5AX3A 3MA3A 4EH2A 4ZMEA 2J6MA 3PPZA 4DCAA 4FTRA 2VD5A 2P2HA 5D1JA 3A8WA 4ZAUA 2XK6A 4C2VA 2C6IA 4XV9A 4D5KA 1ZMVA 2QKWB 4AE9A 4CFXA 5EM8A 4H36A 4NFNA 3TZMA 3PXZA 2OF2A 3PA5A 2X4FA 4XV1A 3KEXA 1Q8YA 1UNLA 4AZSA 4BIBA 1U59A 1Z5MA 5DR6A 2O3PA 2WOTA 3HRCA 3F5PA 3PE1A 4BICA 4DGNA 5KMIA 5ETFA 2R3PA 3O23A 5ITAA 3ATTA 4AWIA 3PXRA 2RSVA 1PMUA 2PYWA 3EKKA 2B7AA 4IHPA 2XEYA 4EOIA 5BYLA 5JRQA 1U5RA 2VTMA 3HLLA 1YDSE 2GMXA 3IW7A 3LJ1A 3P86A 4C61A 3O0GA 5CSVA 4YHJA 1FVVA 3AT3A 3RTPA 1W8CA 3D2IA 4I24A 3PLSA 2GFCA 3EJ1A 3KK9A 3BHTA 4JQEA 4I41A 4XV2A 3GENA 1YW2A 3OS3A 5BVKA 5LCKA 3LOKA 4GFGA 5CENA 2V7AA 1OITA 4OTRA 4ANOA 5AADA 3QKLA 2X9EA 5J5TA 3FZ1A 2HZIA 2WIHA 5FM3A 4LMUA 3FJQE 1B38A 2XF0A 3CXWA 2UVXA 3E7OA 3PRFA 4ALUA 2BCJA 4IDVA 4X3JA 4BCNA 3O7LD 4YTIA 2E2BA 4FKLA 2B1PA 5M4IA 1DS5A 5E1SA 2HAKA 4KWPA 4L53A 4EBVA 2VTTA 4D9TA 1KOAA 4M68A 4CFVA 2OK1A 1DI9A 4QMUA 4U44A 3I81A 3KN5A 3QCXA 4P2KA 3ZDIA 4MD9E 4F63A 5C8KA 4RIXA 3BYOA 3FZSA 3MH3A 3QLGA 1XBAA 2YM6A 2HW6A 5HBEA 1JNKA 3BEAA 4HZRA 4MBLA 5HEZA 2XKFA 2B52A 3KY2A 4FIGA 3R8VA 1PYXA 4EZ5A 5BYYA 3T3VA 3W1FA 5EH0A 1GZOA 2XIXA 2WFYA 2VRXA 4MQ1A 3LCKA 4RX8A 2XKCA 4Z55A 2BRHA 2OICA 3QTQA 4YHFA 1K9AA 3F3TA 2OKRA 4IZ7A 2BIKB 2JBOA 4QPMA 5CI6A 4IVBA 4FYNA 2ETKA 1G5SA 2QOFA 4APCA 4KABA 4CEGA 4PNKA 3C4WA 3G2FA 3WE8A 3CR0A 3OWLA 5EI8A 4ZY5A 5E9EA 2Y7JA 4FI1A 3MWUA 3UOJA 3QTRA 4Y72A 2UV2A 5FRIA 3TACA 4FV6A 4WG4A 4A9TA 1KV1A 2QOBA 3C4XA 4MF0A 5AV4A 5A54A 1A06A 3DJ5A 5IQBA 3C9WA 4E8AA 5C26A 4R7IA 4QTAA 5A6OA 3R8UA 3FWQA 2E9PA 1Q8ZA 3LQ5A 4FKRA 4WG5A 5HBJA 4LM5A 5IISA 3WOWA 5T6KA 4GG7A 3WILA 3O8UA 1F3MC 2OGVA 2V22A 3OWJA 4GH2A 5FWKK 3V5TA 4FL2A 4OTIA 4F9CA 4EOMA 3QU0A 3COHA 4L3JA 4NZWB 4TYJA 5IZFA 1H0VA 2V0DA 3S4QA 4BZNA 1JKKA 3DFAA 3QWKA 2OJGA 2YM3A 2C0TA 3D14A 2JKOA 4FIIA 4J53A 5AIRA 2UZBA 2GS6A 4AW0A 1GAGA 2VTQA 5B2LA 2PMNX 3GEQA 4BYJA 5H8BA 4WSYA 2WMXA 4HYIA 2BHHA 1ZLTA 4HPUE 3AD6A 2UW6A 4FV4A 4DE4A 5GJFA 4I6BA 4YGAA 4AZTA 2VO6A 2X39A 1NVQA 4BL1A 5L6PA 4ZSEA 2AC3A 4B7TA 3CTJA 3ULZA 4LRKA 3NRMA 1SVGA 4DLIA 3AT4A 1BYGA 3MA6A 4NUSA 3B2TA 3F2NA 3P08A 2QD9A 2WQMA 3CJFA 5IEYA 2GNHA 4JBQA 4RGJA 2YAKA 3MS9A 4PQNA 4W8DA 4YZ9A 4CMOA 5HU3A 1JAMA 4KSPA 3DBEA 3KULA 3KMWA 3F61A 3R28A 3QD3A 4H39A 2CGVA 2GCDA 3HMMA 2F7EE 3LE6A 4OTDA 5K3YA 4YJOA 3V8WA 5JK3A 3BU5A 4I1ZA 4U40A 4UB7A 5BVEA 1WVWA 4ONAA 2XIZA 4EONA 3PPJA 4O22A 4C0TA 4S34A 4IM2A 3A62A 4EEVA 5AJQA 4IADA 3ENMA 3L9NA 3K54A 3RHKA 3VULA 4JQ7A 3RWQA 4B99A 4JIAA 5EQYA 4ASEA 3KXGA 5JEBA 3QBNA 3WF6A 5EYKA 5IEXA 5JGBA 2WO6A 4NU1A 3DQXA 4HW7A 1S9IA 3TZ7A 3MFUA 4FK3A 4AGDA 3FMMA 3H0ZA 3VS5A 2BZKB 2C5VA 2EXMA 2V62A 5HHWA 2GS2A 3ZZEA 2VTSA 4JRVA 3DAJA 5E92A 3NW5A 2JDRA 5DT4A 3VW8A 4RIYA 1ZYCA 3U9NA 4B9DA 4IXPA 4C37A 4HVDA 2XUUA 3CS9A 5GZ9A 3TKHA 4BCFA 2FSLX 4TWOA 3CSVA 3KRLA 3SW7A 4EC9A 3BLHA 3FLZA 4I4FA 1OPJA 4Y8DA 4MD8E 5AR8A 5IG1A 4MVFA 4HVIA 2VTJA 2OJFE 5M44A 3HNGA 3MV5A 4FK6A 5I5ZA 2UW5A 5IUGA 2IZRA 1KE9A 3F3WA 2RFNA 2XJ0A 3EQGA 2FUMA 2X0GA 4YR8A 4WG3A 5BX0A 3MPTA 5EI2A 4RJ6A 3IW8A 3TV7A 2WB8A 3E7VA 2WTCA 4LFIA 5E8YA 4AOJA 2PSQA 2A27A 3BBTB 4DLJA 1IRKA 5KKRC 5JMSA 2P4IA 4ZY6A 5HLPA 4MXAA 1G8SA 1H4LA 5BVDA 5IQEA 1MRYA 3NZ0A 4OBPA 4E6DA 3G33A 3C7QA 2JIIA 3OBJA 3Q4ZA 3LCSA 1UKHA 2OXXA 3KMUA 2JITA 4C36A 3PWYA 3UNKA 3QCQA 4TNBA 3V51A 3ZUTA 3IGGA 5IQGA 2QG5A 3WF7A 3E62A 3JY0A 3MYGA 2IVUA 5EHOA 1IAHA 5LARA 3QZGA 3UZPA 4D0XA 3T3UA 4QMVA 3GBZA 1O6YA 4HNFA 5IMEA 3ZRKA 3QA0A 2YABA 4OBQA 3EYGA 4CRLA 3R30A 2ZVAA 5CQUA 4FTLA 4CT1A 3BKBA 2XKEA 4MK0A 2R3KA 3S95A 1ZY5A 4O7SA 2EU9A 5DA3A 3Q52A 3WF5A 3UIBA 4DC2A 5TKDA 2VWBA 5CAVA 3IW4A 4FSQA 4GS6A 5HG8A 3PUPA 3U51A 2YN8A 3EKNA 1YQJA 4BIDA 4GYIA 4AT3A 4CD0A 3R2YA 3FQEA 4PTGA 3MFTA 4QMXA 4P4CA 3UO4A 3PVWA 3R7OA 5EK7A 1YXSA 5CNNA 4FZFB 2UZVA 2VWZA 4C3PA 2J0MB 3F3UA 2HZ4A 3HX4A 4QMYA 5BMMA 3NW6A 3DZOA 3I4BA 3RINA 3VS1A 4ANBA 3R9HA 3ANQA 2IW9A 3R00A 4LI5A 2VTRA 3Q2JA 3CBLA 4USDA 3TTIA 4L52A 5CEMA 3VJNA 3LFAA 3HRBA 1MUOA 3BYSA 3QGYA 3AC2A 3QTZA 3RWPA 3IK3A 5KUPA 3NGAA 4RIXB 4RLKA 4RVLA 1V0BA 2GNGA 2XRUA 4QYFA 3SDJA 4F65A 4TPTA 3UGCA 4RVKA 4QP7A 2R3HA 2C6MA 3CTQA 1XHAA 2GU8A 4QT1A 2XM8A 3MJ1A 4E6QA 2RFDA 3BLQA 2RKUA 4O1OA 4EC8A 5AAGA 5IA1A 3PVBA 1MQ4A 3NUYA 5LQFA 3ELJA 3B8RA 4WNOA 1Y57A 4XG3A 4AF3A 3OT3A 3Q53A 4FV0A 3WIGA 5JN2A 1IEPA 3VBWA 3U6IA 4X6QC 4DH5A 3VS7A 5KMLA 5FXSA 3HP2A 1J1CA 4RA4A 1H1RA 2QOHA 4FKWA 4CV8A 3LM0A 2IPXA 3IPHA 5CVHA 4L8MA 4QP9A 5AP2A 4F7SA 3VHEA 4N70A 4CCUA 4CYJA 4USFA 1UNHA 3GC8A 4JG6A 4NJ3A 4RWJA 3KA0A 3LM5A 2PZYA 3IDPA 2XRWA 4X3FC 4ANSA 4DINA 5IA0A 1XH9A 3RI1A 1U5QA 2ITYA 4KNBA 2E9UA 2BPMA 2XYUA 3CQWA 2GNLA 2I0VA 1V0PA 2OF4A 4V04A 1YXTA 4UX9A 1K3AA 5AP1A 2J0JA 2PE2A 3H4JA 4RJ4A 3WBLA 2BTSA 4QP4A 1NA7A 2QKRA 2JLDA 5FXRA 2WTWA 4IB1A 5K9IA 5HBHA 5J79A 3OHTA 3D5WA 4ANNA 4U80A 3VBQA 4WD5A 4JIKA 3BE2A 5HZNA 4A07A 3FXXA 4ZTHA 3UBDA 4O0TA 4RSSA 5CU0A 2VU3A 3LCTA 4DH1A 4CSVA 4JL9A 4FEVA 4I6HA 4BWXA 3TWJA 2VNWA 3IDBA 4DEDA 4O6LA 2I0HA 5FLFA 1QPCA 3MI9A 3OXZA 2QR8A 4I20A 4L67A 3PIYA 4EK3A 4C57A 3ZMMA 3QALE 4OUCA 2WHBA 5CEKA 3FI2A 4YTFA 4YLLA 3QF9A 4R8QA 4FTOA 1KWPA 4HNIA 3DXPA 2YIQA 2VUWA 4KB8A 2VTAA 2XMYA 4QTEA 2XNBA 3G0FA 1NY3A 4M66A 4N6YA 4ACDA 4DCEA 3G90X 3OZ6A 4C8BA 3DK7A 2PVKA 2PU8A 3GC0A 2LAVA 1PMEA 2VX3A 5M09A 5JQ8A 4KD1A 4M0ZA 1REJA 2VX1A 3EOCA 2V55A 4DFBA 3EQDA 3FV8A 5FTOA 1BLXA 4AN3A 4WO5A 1FMKA 2BRGA 3ZFXA 2HXLA 2JKMA 4F9AA 1PXOA 5F95A 5TR6A 5HNBA 5TOZA 2C5OA 2A19B 3KXMA 3OD6X 1XH4A 3EQBA 2BILB 2WMBA 3Q5IA 1VR2A 2ZOQA 3MVHA 4JXFA 4MX9A 4AGCA 1U4DA 1OMWA 4BHNA 3DCVA 4EOPA 2VWWA 1XBCA 4E4MA 2W4KA 4J99A 1SNXA 3O7LB 1A48A 4ZIMA 3W2CA 4MTAA 3AC4A 4TN6A 4F6SA 4AW2A 3D4QA 2UW8A 3CP9A 3QRUA 3E93A 4PRJA 4IWQA 1H08A 2WTVA 4ITHA 3GGFA 3EQPA 2UUEA 3OEFX 4WHZA 4ZLOA 2LGCA 2XCKA 3ORPA 3I0OA 3HAMA 4MD7E 3DV3A 5F94A 3BBWA 3OG7A 4ZS4A 2Y6MA 5DRBA 3A7HA 4JR7A 3GOKA 3U8WA 3Q6WA 5HIDA 5BQ0A 3QQFA 2NRUA 3BHVA 3P9JA 2IWIA 3MSSA 4FV2A 4QQCA 2QODA 3PRIA 3CTHA 2PVRA 1CTPE 1Y8YA 2W05A 2ITTA 1BI8A 3JPVA 5C27A 4A4XA 1S9JA 2XK3A 2C69A 2XP2A 1NW1A 4XP0A 3IOKA 3LMHA 4BTMA 5HG5A 5KMOA 4DT9A 2YDKA 1M7QA 5GIOE 4EQUA 3H9OA 3RZFA 1M17A 3TNQB 3TV6A 4FR4A 5E8UA 3FMHA 3UG1A 3PJ2A 5L3AA 3PZHA 3UZTA 2G15A 5AR3A 3THBA 3V8TA 3I7BA 4O1PA 1JOWB 4BI1A 2VGPA 1YDRE 2GHMA 2GNJA 3MN3A 3OWPA 4M67A 4ACHA 1SVHA 3S3IA 3PDTA 4ZSAA 1JSTA 1GOLA 5CF8A 1ND4A 3FMEA 4OTGA 3KXNA 3LXLA 3Q04A 4RMZA 3ACKA 5HE3A 5KCVA 3QZHA 4O7WA 2ACXA 4R3PA 2PMIA 4A9RA 4H58A 4JLCA 4TYEA 4WIHA 1MRUA 2IZUA 4GT3A 4M13A 4Q9SA 1KUTA 3FI8A 2OLCA 3LAUA 4ZTLA 1RDQE 3PJ3A 1OKYA 3VS3A 3DJ6A 2JDVA 4AZVA 3RM7A 3PPKA 4M7IA 4BHZA 2GDOA 2Y0AA 3T9IA 2ZDUA 4XCUA 5J9LA 4JRNA 1DM2A 2BAQA 2BFXA 3DK3A 1M2RA 4GUEA 4Y83A 3FKLA 2F9GA 4GT5A 4QMNA 3FXWA 5DN3A 5E8SA 5AUXA 4BN1A 4YSJA 4ASXA 3D83A 4YC8A 5DEWA 3DBQA 3QRTA 3W16A 4BDAA 5AAEA 1OM1A 2BMCA 2QOCA 2WGJA 3AG9A 3E3BX 3E88A 3EN4A 3OBGA 4KIOA 3VRZA 5ANDA 5ACKA 4BZOA 5AA8A 4YZBA 4QNAA 4U5JA 1YKRA 4KRDA 1OL7A 3NVMB 4U43A 1GZNA 4FZ6A 4O83A 3L9PA 4KIPA 3DGKA 5AUWA 4EZ3A 2XBJA 4D9UA 3FLSA 4QTBA 2NP8A 5G1XA 2I0YA 4AN2A 5HU9A 4O0YA 1W82A 5CF5A 3LFQA 2QONA 3LFBA 4IWPA 3VS4A 3AQVA 4MBJA 1ZXEA 4NW6A 2C6LA 1ZYJA 2ITQA 5H8GA 3FPMA 3RAWA 3W18A 5CSPA 1OKZA 5ANOA 2O64A 4U7ZA 1DAYA 4F1OA 3GCSA 5EQPA 5JKGA 5HQ0A 5M07A 4XLVA 3Q2MA 3AXWA 1IASA 3POOA 4HGEA 3V6SA 4C34A 1OB3A 4DEHA 4TL0A 3ATSA 4I4EA 2WMRA 2X8DA 4BCKA 2GFSA 2HY81 3W10A 5L6OA 4V05A 2BKZA 1ZMUA 4ZY4A 1OUKA 3HL7A 3V04A 5DLSA 4S33A 2XBAA 3OCSA 4J52A 3P78A 4KBKA 4PDOA 4FL1A 3GOPA 5L2SA 3N4TA 3OP5A 3FYKX 4LUDA 5HLWA 3RGFA 1ZYSA 4CKRA 5M4CA 4MWIA 5JFXA 5I9XA 3IKAA 4BF2A 3E87A 5CT0A 2GS7A 5BVWA 4LUEA 5LMKC 3O71A 4ASZA 5ANJA 3BYMA 3KKVA 4HCTA 2YDIA 3R01A 2WMVA 4Y95A 5HGIA 4YURA 5LXMA 4O81A 4R5SA 3UIMA 4F6WA 3UJGA 4TWPA 3KGAA 4RVTA 1X8BA 3BYUA 4GJ2A 5E8VA 3ZRMA 2QOOA 3DNEA 2PULA 5DGZA 5CVFA 3FKOA 1E1VA 2A2AA 1Q62A 3EN6A 4FOBA 3R83A 1TQMA 4ZEGA 2OBJA 1Y6AA 4R1VA 3WIKA 4EOKA 5IU2A 2W9ZB 1U54B 3EFWA 3COKA 3PE2A 3E8CA 4IZ5A 2WMSA 4JBPA 4G34A 5BNJA 3H3CA 3B2WA 5D41A 4D4YA 3HEGA 5LMBA 3OCBA 2EWAA 3OCGA 4OAUC 4ORKA 4M84A 2H8HA 4FZDB 4M12A 3FLNC 5G6VA 4FIJA 3TZ9A 4B4LA 4DH8A 4FF8A 4AACA 3DKCA 4D1XA 3KQ7A 1R78A 2R3NA 4FEXA 5AEPA 4NCTA 3O96A 4JQ8A 5EYDA 3C51A 3FZRA 5H9BA 2RIOA 1Q41A 4IEBA 3UQCA 1VJYA 4MBIA 4AS0A 4U9AA 3ODZX 2QVSE 3RNIA 2YA9A 2WQNA 3OY1A 4Y5QA 2ZV8A 3C50A 3DA6A 4BCHA 4AAAA 4FNZA 2G2HA 2P33A 5GJDA 4U0IA 4V0GA 4OBOA 4FGBA 5IA4A 3U6HA 3OY3A 2PVJA 1TVOA 3PIZA 4ZK5A 3VUGA 2RGPA 4AW5A 4QP1A 4F9WA 2UW9A 4M69A 3O51A 3UQGA 2B9FA 2DYLA 4MXYA 4F0FA 1ZY4A 3DBFA 3N51A 1P14A 4IX3A 1O6LA 1R0PA 2ONLA 2J5FA 2QLUA 3SXFA 4CYIA 4YZMA 4B0GA 5HX8A 3DBCA 4XG7A 1LUFA 2C3IB 2YIWA 5IA2A 3V5QA 1H26A 3TDVA 1YWNA 3DKFA 4G9RA 2PZIA 2OH0E 2OZAB 3D7TB 1RQQA 3R71A 3OF0A 1OZ1A 4MEDA 4BBEA 4DFUA 1IA9A 1GJOA 3UVQA 2Z60A 1FVTA 2HELA 2KULA 3QRKA 3R1NA 3LCOA 4FTAA 4IBMA 4K9YA 4N4SA 1FINA 4H3BA 4BBFA 5A6NA 2EXEA 3T8OA 4QYEA 2ETMA 1O6KA 5HOAA 3SKCA 5HTIA 4Y5HA 5IA5A 4GKHA 4I0TA 4L7FA 5AP0A 3KMMA 3A4PA 4LV5A 2YWVA 4RX9A 1GZKA 4FSNA 2WTJA 3PTGA 3PY1A 3R8LA 3ZXTA 4UMQA 3AC1A 5E1EA 3O2MA 3PXFA 4YPSA 4D4RA 3IQ7A 3NEWA 4ZOGA 3FKNA 5HIEA 1KSWA 5A4CA 4CKIA 4XJ0A 1UA2A 4R3CA 4CRSA 4AE6A 5DMZA 4NWMA 2F4JA 2YJSA 2AC5A 4PMMA 3DKOA 3GUBA 3U4UA 3DLSA 3GC7A 2Z2WA 2W5HA 3HRFA 3POZA 3VQHA 2XNOA 4FSRA 4I5CA 3EQRA 3VUIA 1H8FA 3W2SA 1F0QA 2W9FB 3QD4A 4BYIA 5CAUA 3I5ZA 4XH6A 2O65A 1T46A 2A0CX 2HYYA 3QD2B 1ZYLA 2WMAA 2QHMA 5J9YA 4RQKA 2ERKA 4D2SA 5CX9A 3QRJA 5JFWA 4OR5A 4O84A 3SG9A 4LG4A 3CKXA 3NNVA 5DIAA 1BMKA 4BDEA 3UZRA 4MWHA 4MXCA 1JWHA 5DYJA 1E9HA 3IS5A 4PV0A 1MRVA 4XOYA 2X8IA 3PY0A 5E91A 2VWVA 4NM0A 5K5NA 3S00A 1UWHA 3MVMA 5FBOA 1PXNA 4OTHA 4Q2AA 4L45A 4DGOA 2XA4A 4EUTA 3H9RA 3ORLA 3ZZWA 3AT2A 2WOUA 3MDYA 5E8TA 4PNIA 3U87A 4UMPA 3NAXA 3FY2A 3QQLA 5L2WA 2FA2A 2GNIA 4X2KA 4GT4A 2R3FA 3I60A 3SG8A 4BKZA 3ZEWA 2O0UA 2I1MA 4DITA 2ESMA 3UTOA 4JNWA 1FOTA 3ZO1A 1YWRA 4JX3A 4AGWA 5IQFA 2WEIA 3PSCA 4QMQA 3CLYA 2W1IA 5HD7A 4FTTA 1XQZA 3R7GA 3ZLYA 4J97A 4S32A 4PUZA 3VWAA 4KUJA 4DFXE 5IEVA 2A1AB 5HICA 4HOKA 5BUEA 5HX6A 3TUDA 5IUHA 4R7BA 1IR3A 3G5DA 4A06A 4C4JA 3DFCB 4V01A 2W1GA 3OC1A 2PE1A 4I93A 3GCQA 3UMWA 4CMUA 2XNMA 3NUPA 4HPTE 1GZ8A 2R3LA 5KX8A 2J2IB 5FP5A 4BVUA 4UEUA 4E4LA 3HV4A 3BCEA 5HE1A 5LVOA 1GY3A 4IVCA 2R3RA 1J91A 2ZAZA 1Q3DA 4HYHA 3W2PA 4AA5A 4YP8A 2RFSA 4NYEA 4F7NA 2R0UA 1OIUA 4D2PA 1YXXA 4WRGA 4RX5A 3EQCA 3AD4A 2VWIA 2J90A 4G31A 4FTNA 5C01A 1M7NA 3A7IA 1UU9A 3G0EA 4X2FA 3QZFA 1W98A 2ZB1A 3P79A 3DXQA 3FEGA 4R1YA 3LCDA 1GIIA 1G3NA 5TF9A 3E63A 4BDDA 4BIEA 2PMLX 4A4LA 4O91A 4N57A 4ZP5A 3A99A 3A8XA 3PP0A 1H25A 4FV1A 3UNZA 5KMJA 5GINE 3R1QA 4NKAA 1ZARA 5FD2A 3NCZA 3F2RA 2QURA 4YZNA 4CQGA 2OJ9A 4KS8A 3F5UA 2W1CA 3UYSA 2X2KA 3KC3A 3DK6A 2GHLA 4E7WA 2QR7A 3ORNA 1TQPA 4GL9A 1CDKA 3R9OA 4KINA 3V5LA 5HTBA 4UZDA 5IQIA 4G3FA 2X7OA 4L00A 4C2WA 3PJ1A 1YHWA 4YZDA 4F7LA 3IO7A 2UZUE 2WTKB 4DBNA 4YPDA 3LFDA 3DPKA 2Z7QA 2GSFA 1NXKA 1JKSA 2Y4IB 3GQIA 2C6OA 2CSNA 3Q4TA 3FMDA 4YJSA 4ZXTA 5CU3A 4YTCA 3EQIA 3RVGA 4BR3A 2B54A 3EHAA 4ZSJA 3GQLA 5HESA 3V01A 4ENXA 3D7ZA 3FSFA 3GU7A 4KKHA 2I40A 2BDJA 3ALNA 1MQBA 4G17A 3COIA 4IH8A 5C9CA 4WNKA 4BKYA 1AD5A 4U3ZA 5GNKA 3BV3A 4JDIA 4ASDA 4OT5A 5K4IA 4XLIA 2G01A 4BGGA 2PWLA 2XS0A 3HV7A 3MB6A 1SM2A 3PY3A 4RC3A 3OWKA 4GK3A 4LOOA 1ZAOA 2YCQA 4UZHA 5EDPA 2Z7RA 4KAOA 3WARA 4YJTA 1H00A 4G3EA 4FTJA 2FO0A 4U41A 4C62A 1Q8UA 3QLFA 3F5GA 3GCUA 4CG8A 2XCHA 2RFEA 3LJ2A 3PVGA 4JBOA 3OT8A 4D4SA 2ITUA 2PVMA 3NUNA 5CSXA 3LJ0A 4J71A 2BALA 3CD8A 1JSUA 3P7AA 4V0GB 5LOHA 5C4KA 2XB7A 1XBBA 3L8SA 2XNNA 3H10A 4RWKA 3Q96A 3VBXA 4O7TA 1APME 4RLLA 1Q24A 3RZBA 5CS6A 1ERKA 4AX8A 4M69B 4EK4A 3BZ3A 5E4HA 4KIKA 3FC2A 2QU6A 4EHEA 2FB8A 3VS0A 3UIXA 4BDBA 3FZOA 2CCIA 2E9VA 2FSMX 2WD1A 3AMBA 4QYHA 5DFPA 3RK9A 2C6KA 4PF4A 4APPA 5KHXA 1Q4LA 5CF6A 2C47A 3HGKA 5EG3A 4CMTA 2B9HA 4O2ZA 3F3ZA 2XM9A 3R9DA 5CU4A 4L7SA 1OIRA 1Z9XA 1M14A 1WVXA 3VUKA 5J1VA 2RL5A 4KRCA 4XG2A 5DEYA 5GJGA 1R0EA 4DG2E 3G9NA 3C4FA 1ZMWA 4RT7A 1IAJA 4I22A 4AZWA 4F64A 5CEQA 3ORMA 1WBNA 1FGKA 3ZC5A 4FGRA 3HMIA 3MTFA 4O6EA 4ZS0A 2XK8A 2J0LA 5ICPA 3RCJA 4D58A 3NUXA 3PA4A 5F4NA 1Y6BA 1ZWSA 5EOBA 5HKMA 3HDNA 3LXPA 5B2MA 4BI0A 4JI9A 3GFWA 3VF9A 3VUTA 4A7CA 4BTJA 4FTUA 4D1SA 4EH5A 2Q0BA 5CAOA 3HV6A 3HP5A 1DI8A 3KRWA 4FSYA 2FSOX 4ITJA 4D55A 2PVYA 5JZJA 1ZOGA 1QL6A 3PA3A 4IAAA 2ZJWA 2FVDA 3EIDA 4FT9A 4OTWA 4W4WA 4XS2A 5LMAA 4YUQA 4A9UA 4CCBA 4FSZA 4MXZA 4FODA 5HIBA 3R6XA 3ZSHA 2AYPA 2W99B 4YSMA 2UZDA 3E5AA 4LOQA 3Q6UA 1G8AA 4LV8A 3ZLXA 4FTCA 3QTUA 2IVVA 4AFJA 5CAPA 3E8DA 3GVUA 5IPJA 4O0UA 1ZZ2A 4RQVA 4O7VA 3DBDA 3R7IA 2ITVA 1LP4A 3TL8A 2XNEA 4OW8A 5CEOA 3D5UA 4CGAA 3HA6A 3R22A 5E90A 1GNGA 3QKKA 3DS6A 5AR5A 4FKQA 1LEZA 4DFLA 4AW1A 5K5XA 3LMGA 4J7BA 2BUJA 4EYMA 2X81A 4ANMA 4UV0A 3FQSA 3BHUA 3PG1A 4XBRA 4O21A 4FT5A 1QMZA 5CT7A 5L2TA 4EQCA 2XK4A 3D15A 4OTPA 4C4EA 4E5BA 2F7ZE 4F9YA 3QYZA 4X2JA 5BVFA 5BVOA 2QOKA 3CIKA 5IUIA 2VWYA 5I9ZA 3CQEA 2CGXA 3ROYA 5FUTA 3SQQA 4U79A 3VIDA 3QWJA 5F20A 5LVNA 3ENHA 2C30A 2BZIB 3MGYA 1L8TA 4AN9A 3MH0A 2VTIA 4X2GA 2J4ZA 4RIOA 4L6QA 4LQMA 5H8EA 5HVYA 2R3QA 4DH7A 4E1ZA 2X6DA 4CV9A 4E5WA 2CDZA 3JXWA 4RC4A 3EN7A 3WYXA 4H05A 3TT0A 3LXKA 5IKWA 2JDOA 5EM7A 5T3QA 3SXSA 3KVWA 1KE7A 4IACA 4FT3A 2W1HA 1H01A 3Q9ZA 2C1BA 3LW0A 4L46A 5CALA 2PPQA 5TE0A 4GVAA 5CAQA 2C1AA 5HO6A 2C5NA 3DY7A 3Q3BA 3Q60A 2X7FA 1CKJA 4HYUA 4IAIA 4QQTA 4TYIA 5LVLA 3RJCA 1BL6A 3HVCA 4FV7A 4BCJA 3P7BA 3PLAE 2C5YA 2YWPA 3OUKA 4PTEA 2WQEA 3GCPA 3F5XA 3WYYA 3OOGA 5JZNA 3ZO4A 3BLRA 3BU6A 4YHTA 4DGMA 2Y6OA 3ZXZA 4RWIA 3MTLA 2GQGA 2XKDA 3RKBA 3KXXA 2ZDTA 3ZU7A 3R21A 2YM4A 4EOLA 1H1SA 1H1WA 2C0IA 3Q5ZA 3SRVA 5IA3A 1Q61A 4OGRA 5CVGA 5I4NA 4DGGA 4JS8A 3DLZA 4JX7A 4C59A 4ZJVA 3FL4A 3DTCA 3I79A 5J1WA 4XP3A 4GK4A 4NIFA 5L2QA 4FUXA 4HGSA 5FXQA 3E8NA 5AX9A 4HCUA 3BHHA 4LOPA 4TZRA 1HCLA 1KE6A 1IA8A 5L8LA 2E9NA 2OO8X 3QC9A 2B55A 2QNJA 4C33A 3ZO2A 4IZAA 4G3CA 4EZ7A 4Z7GA 3ZRLA 4F99A 4TXCA 3KULB 3OCTA 3ACJA 1YHVA 5C1QB 3A61A 1WZYA 3KRRA 3Q32A 2P2IA 4QMTA 5AUZA 4EKLA 4PL3A 1REKA 3FUPA 3QHRA 4F4PA 4C3FA 5D9HA 4EKKA 5KMKA 4U3YA 3NYXA 4UALA 3UP7A 1CSNA 3BPRA 4D2VA 4GV1A 3W32A 4PDPA 4MHAA 3P7CA 3UOKA 5CXZA 2PZPA 2WPAA 2YLFA 5KO1A 2CHLA 3PYYA 1P4FA 4O0WA 3MY0A 4G6LA 5CASA 1J3HA 1GIHA 2FH9A 2XEZA 4DEGA 4W9WA 2HWOA 5KMMA 3K5UA 4XX9A 1XH6A 5I3OA 3FI3A 4ARKA 3BHYA 3FE3A 5AP4A 3TG1A 4FL3A 4ZTRA 2PUUA 2OWBA 3LLTA 3Q9YA 5FM2A 3ZBFA 3ZLSA 3R9RA 4IAKA 3UVRA 5FDPA 3R7YA 3K3JA 4RIYB 4CNHA 4RJ7A 2CPKE 2G1TA 2XZSA 1YOMA 4UMTA 5DH3A 5M08A 4GMYA 4FSWA 4I94A 2GTMA 1XR1A 2BDWA 5M4UA 3R7VA 5LCJA 3R8ZA 3QUEA 4Z7HA 2WTKC 1LR4A 4BCMA 1ZZLA 4DBXA 2JDTA 3RAKA 5TT7A 5EHYA 5I3RA 5FTQA 2QO7A 1WMKA 2BRNA 4TYHA 4BCPA 5CEPA 2PK9A 3TJDA 4YJQA 4EUUA 4F0IA 5EW9A 4K77A 3QX2A 4DG0E 3TNPC 4J8MA 5J87A 3LFFA 4XHKB 5LVPA 2ZM1A 4AG8A 3FXZA 5HO8A 5B0XA 3TEIA 4K1BA 2VO0A 4A9YA 2DQ7X 4XRJA 5DI1A 2QQ7A 5AP6A 3NCGA 3QL8A 2WMUA 2JKQA 4I0SA 4AFEA 4ZTNA 4O7YA 2CKQA 2XIRA 1YOLA 2YIXA 4R3RA 3CCNA 4DAWA 2W1EA 5JRSA 4IW0A 4PY1A 5M06A 4XMOA 2EUFB 5A9UA 5A4TA 2OSCA 3V3VA 5DT0A 2WKMA 2JGZA 3G6GA 4R77A 5A46A 2H6DA 3VO3A 5AAFA 3PFQA 3F6XA 3Q9WA 4BKJA 3QXOA 4YU2A 4KSQA 3KCFA 3DZQA 4FZAB 4GVJA 4IM3A 4QQJA 5CU2A 1Y8GA 2Y4PA 2JBPA 4G3GA 4RJ3A 4KA3A 1JBPE 3BELA 4U97A 4DFNA 4H1MA 3F82A 3TCPA 4B8MA 3C5IA 2WQBA 4HGTA 3H30A 5M57A 3GI3A 3KU2A 3L9MA 4IDTA 3UPZA 3QYWA 4E6CA 3MPAA 3SLSA 3QTXA 3VF8A 3O8TA 2C3LA 4EJ7A 1ZOHA 5BVNA 4FKOA 2C3KA 3IGOA 3A60A 1Q97A 5C8MA 4X3FA 1MP8A 2PVNA 3ORIA 4ALVA 5FEDA 3HUBA 4G6OA 1P5EA 4AGUA 4LL5A 3QQHA 3V5JA 1SYKA 3BWJA 1UU3A 3OROA 4EHGA 2YCRA 4UBAA 4E3CA 3OOMA 4P7EA 2A4LA 2OXDA 2R3MA 4JDHA 5B2KA 3EFLA 2H96A 3PSBA 5J9ZA 2QC6A 4M15A 1VZOA 3ALOA 2OH4A 4QQ5A 4AU8A 3C1XA 1OL5A 2UW7A 4C4IA 5EKNA 4W4VA 3MH1A 3KK8A 3TV4A 1YI6A 5IQDA 1OL6A 2CNQA 2WU7A 4CT2A 5J7HA 2W06A 4I3ZA 4NKSA 5AR4A 4X21A 4KKGA 2W7XA 4RX7A 4YZCA 3R8MA 3H9FA 3PJCA 5IH4A 2ITNA 4ZTSA 2QOQA 1JSVA 2CLXA 4HVSA 5CSWA 4QP8A 3RCDA 3FZPA 2VTNA 4EK6A 2WMQA 3COMA 2C6TA 2WQOA 4JAIA 3G9LX 2VO7A 2VTOA 4PDSA 3W2RA 3RPVA 4F1TA 4DF3A 4HJOA 1FMOE 2VTLA 2Z7LA 1CM8A 3CGFA 3NWWA 4TKSA 3IG7A 1YWVA 3ZCLA 4EQMA 2PTKA 2VV9A 3UDBA 4FEWA 3NR9A 3BEGA 4D2WA 4IAFA 3T9TA 4IE9A 1WBPA 4AOTA 3CKWA 5AP5A 2XVDA 3W33A 5FEQA 5M56A 3C0IA 3MPMA 1OUYA 4FIHA 2R3JA 4PMTA 4RZVA 4AT4A 3S0OA 4P5QA 2QHNA 1QPDA 3RPSA 3QX4A 3UODA 4XUFA 4ALWA 5HD4A 4Q5HA 3LPBA 1XH5A 2IZTA 2CKEA 4N6ZA 5ANGA 4GU6A 1OL1A 3NYOA 5FDXA 5F9EA 3LXNA 3UOHA 2Q0NA 4XBUA 4I5MA 2PZ5A 4K2RA 3QTSA 5HLNA 3NW7A 1H1QA 5AM6A 1Q5KA 4ACGA 3MESA 3EB0A 4W4YA 3A2CA 4K11A 3I0QA 4DT8A 3P1AA 2FGIA 1PXKA 2UZTA 3NNXA 3BGQA 2HWPA 4C3RA 1H28A 3QQJA 1T45A 4HGLA 3KVXA 3JVSA 3Q4CA 4J96A 4YBJA 4CZYB 4CZUA 4MNEA 2B4SB 5AM7A 3I7CA 3FHRA 3BYVA 4N0SA 3FSKA 4D0WA 4MYGA 3A7JA 3QXPA 3R73A 4PTCA 5ACBC 3UO6A 4E26A 3UVPA 1RW8A 3VNTA 3N4VA 4H3PA 4E6AA 1W0XC 5IDPA 4NIFB 1PXPA 4R6VA 5AV3A 3QUPA 1OKWA 3K3IA 5AP7A 3IECA 3DOGA 3L1SA 3OTVA 2IW8A 4XP2A 3VQUA 4CFFA 1OPLA 3S2PA 4EH3A 2YISA 5BUJA 3U55A 2O2UA 3VBVA 4TNDA 3DAEA 4QYGA 3DDQA 2EXCX 4FG9A 2VAGA 3GU8A 3EMGA 4DFYA 5H3QA 3LKMA 3G51A 1OKVA 1GIJA 3R63A 4W4XA 2H34A 5C03A 4Y46A 4CFWA 5JFSA 5LVMA 1WBSA 4UY9A 2YHVA 3ZSGA 3M2WA 3KXHA 3GU6A 3D94A 3TJCA 4HVHA 4UN0C 4C02A 2YM5A 5JGDA 2BKKA 1A9UA 3QCYA 4W8EA 4ZZOA 4U8ZA 4ERWA 2I7QA 2WXVA 4Y73A 3ORZA 4IQ6A 2QO9A 3LQ8A 5AMNA 3H0YA 3QFVA 5HTCA 3W55A 3UC4A 3AMYA 5ETCA 3OVVA 4YTHA 5J8IA 4I92A 5JT2A 2WIPA 2I6LA 3R7UA 4IJPA 4EWQA 4FTKA 2OXYA 3RAIA 4RJ5A 3F3VA 5C4LA 3SV0A 2R7IA 4BDJA 4QPSA 3JS2A 5F1ZA 4D28A 2BRBA 4JG7A 4O0VA 4QD6A 5D11A 4OLIA 2HZ0A 4EH4A 2XYNA 1XH7A 5I9VA 4FIFA 1NT2A 1SVEA 3HMOA 5IQAA 4FUYA 2HOGA 3R8PA 4GSBA 5DRDA 4O96A 2R4BA 3ZTXA 3FC1X 3KL8A 3RPOA 3BI6A 3DB8A 5AA9A 3TUCA 1VYZA 2JAMA 2IW6A 2HXQA 2R7BA 4G2FA 1PJKA 2HZNA 4QRCA 3E3PA 5H2UA 3ZOSA 2UVZA 3TTJA 4EH7A 4O82A 2ETRA 3E64A 3BQCA 4JJRA 2X1NA 4M3QA 1YDTE 5AWMA 5EHLA 4F6UA 4IM0A 1FGIA 4WKQA 5ETAA 4OAVB 2BAKA 5DT3A 4BDHA 4TRLA 1BUHA 3KXZA 4MXXA 1YOJA 4KBAA 4F1MA 3FLYA 5J7BA 5EYCA 2VWUA 2W96B 4IB5A 1UNGA 1OL2A 3R02A 4X2NA 5DR9A 2C0OA 5DG5A 5CU6A 4NT4A 3W2QA 4AQCA 5A4LA 3FMKA 3BX5A 5CWZA 4F08A 1R1WA 2YITA 3KRXA 4FNXA 4FMQA 4I0RA 5HCXA 2IVSA 4GCJA 1XKKA 4KS7A 2JIUA 4CZTA 2GTNA 3V5PA 5EQEA 3NMUF 5FEEA 2ITOA 3E92A 4JDJA 3EFKA 3ZYAA 4L3PA 4PX6A 5EFQA 4XNEA 3NPCA 4D2RA 2IJMA 4L44A 2O5KA 2XNPA 3B8QA 1ZYDA 3VUHA 4I23A 2KTYA 3QZIA 4FVPA 1K2PA 5EM6A 3UG2A 4C4GA 4EOJA 3BGZA 5CZIA 1P4OA 2ITZA 4EWHA 3F2AA 3LHJA 4TTHB 5CY3A 3LMIA 4GU9A 2SRCA 3JVRA 4EHZA 2CNVA 1WFCA 3TNWA 2UW0A 5LMKA 2Z8CA 2R3GA 4WBOA 4PPAA 3SHEA 3C4CA 4DTKA 4X3FB 3O50A 3GNIB 5DOSA 4WT6A 4BDCA 3CY3A 4DA5A 1M2PA 4GYGA 2VO3A 1Q3WA 3AGMA 4FV3A 1WAKA 5HG7A 3JR1A 2WU6A 2PE0A 3MVJA 4WNMA 4AP7A 2PMOX 3LVPA 5CF4A 4XRLA 4AZFA 4DTBA 3QUDA 4PPBA 4RG0A 2YLEA 3RMFA 1J7LA 2YEXA 4OTFA 3ZM4A 4D4VA 2CN5A 3G6HA 5M53A 2R0IA 3IONA 5ETIA 5JGAA 3CPBA 3I5NA 2C6EA 5AUTA 5AIKA 4RFZA 3NYVA 2OU7A 3VBYA 4A4OA 2RF9A 1AGWA 2CGWA 2ZB0A 4LGDA 4QP6A 4EH6A 4ZTMA 1OBDA 4FSMA 3NNUA 5BPYA 3PZEA 2NNWB 4ENYA 3HMPA 2YZLA 5JQ5A 4FX3A 3QCSA 3L9LA 4USEA 4FV9A 3MBLA 4EOSA 1UU8A 1WBOA 4BDFA 2CMWA 1TQIA 2BDFA 1CMKE 1M52A 2HENA 3KRJA 3ZUVA 4DEIA 5AFVA 4BC6A 4I6QA 1BL7A 2DS1A 2XIYA 2CKPA 4FKJA 4S30A 3RPYA 4K33A 4YO6A 4PMPA 5CANA 5HVJA 2YCSA 4EL9A 3CGOA 3EZVA 2C6DA 3M42A 3P5KA 2OJJA 3KN6A 2OIBA 4RA5A 4BGHA 4KBCA 3ZFYA 4FEUA 4IAZA 5J5SA 2O63A 2VX0A 3AD5A 2FYSA 3AMAA 3R1YA 4WRSA 4FG8A 2B0QA 4YJPA 2UZNA 3ORXA 3NUUA 5FP6A 2EB3A 3IW5A 4BDGA 3ETAA 3KFAA 3NIZA 2CNUA 2WELA 3D9VA 2GHGA 3PSDA 4OT6A 4B8LA 1UU7A 3NLBA 2GQRA 4BCQA 3BQRA 3TXOA 3O17A 4QMWA 1BKXA 4L68A 2PL0A 4DN5A 4PWNA 1CKPA 3BRBA 4MNEB 1QCFA 3DKGA 4ANQA 2YFXA 2ZMDA 3JUHA 1SZMA 4QP3A 1HCKA 3MY1A 3ZEPA 3RBWA 2ZV2A 3E8EA 2WMTA 3ZH8A 3UMXA 4C38A 4CQEA 4C35A 2JIVA 3A4OX 4QP2A 4FVRA 1JKLA 2XK7A 5CTPA 3TM0A 2AUHA 4FKGA 4PL4A 2YERA 4TYGA 2X2MA 4FNYA 2UW4A 2UZWE 4FIEA 4RC2A 3REPA 2RG6A 1UVRA 3ZC6A 4XEYA 4O2PA 1WBVA 4WBBB 4IWDA 3VJOA 3KREA 3L8PA 3BWFA 2Z7SA 4ZLZA 4FKVA 2VNYA 4L01A 3OXIA 1Q99A 1KE5A 2JC6A 3EH9A 5EDQA 2WTIA 3LIJA 2X8EA 2B53A 2VGOA 2ITXA 2B9JA 3EN5A 4E20A 5IF1A 2WAJA 3EZRA 1JLUE 3M1SA 3WZJA 5HCZA 4K6ZA 4DGLC 2X7GA 3NUSA 1FQ1B 4XYFA 2OW3A 4QMOA 2OIDA 4ZZNA 1WCCA 2B9IA 2J5EA 1HOWA 4GIIA 3VHKA 1PF8A 3D5XA 4MH7A 5HCYA 4HYSA 3FMNA 3RP9A 3FAAA 3ITZA 1BI7A 1Q8WA 2F57A 4D1ZA 4FV8A 3Q9XA 2XJ2A 3MFSA 2BFYA 5M55A 3OTUA 1PXMA 2IN6A 1UKIA 3KCKA 3SX9A 5KZ0A 1YXUA 5A3XA 3LFCA 5M4FA 2W5AA 3AC8A 2VN9A 2P3GX 5DVRA 4E5AX 5CI7A 2PY3A 1DAWA 3D5VA 4JAJA 4K0YA 3ZFMA 2C4GA 3PG3A 3SD0A 3LLAA 4NM7A 1YI4A 4FT0A 1UV5A 4FSTA 4ANLA 2PUIA 3GP0A 4FICA 4G1WA 4WNPA 4RFYA 4BI2A 2C5XA 3UE4A 4FKUA 2REIA 4I5PA 4WOVA 5FTGA 4C58A 1WVYA 3VS6A 4EJNA 1I44A 1Y91A 2OFVA 4DTAA 1XJDA 1TKIA 4YJVA 1H24A 2GNFA 3FDNA 3PWDA 4PDYA 4E4XA 4G5JA 2QLQA 4NM5A 1PHKA 4TY1A 2JD5A 4BB4A 1J7IA 4XG6A 2HY0A 4I5HA 3BGPA 3MIYA 3QA8A 4PL5A 5AV1A 3IDCA 3CE3A 4RVMA 2J0IA 4UWYA 4GUBA 4RIWA 1LPUA 2F7XE 2YZAA 4JBVA 4YJUA 2BROA 1OIQA 3HV3A 1OIYA 4YLJA 3V5WA 4YBKA 4DH3A 3SOCA 3SW4A 1P2AA 1ZOEA 3ORTA 3NS9A 4BRXA 3VVHA 4BFMA 5EDRA 4YJNA 3HECA 5CSHA 4R7HA 1V0OA 3D0EA 4FC0A 4GIHA 3SRVB 5AUYA 4ITIA 3U4WA 4CLJA 4LGHA 5AR2A 1IG1A 2R64A 3NIEA 4H3QA 3GU4A 4GG5A 4IWOA 4RRVA 1RE8A 4NH1A 2W1DA 3HYHA 4EH9A 3OW3A 5CNOA 3EL7A 1JQHA 3CC6A 1PXLA 3ZONA 2OI4X 2PVHA 5KZIA 4ACCA 3BU3A 5KBRA 4JOAA 2UVYA 2XJ1A 3DAKA 2VZ6A 3DTWA 4TWCA 3CY2A 2NPQA 5EM5A 4FG7A 3V6RA 5L2IA 4O7NA 4EOQA 4CTBA 2UZEA 4YNOA 5K4JA 5FG8A 4DYMA 4F7JA 4CVAA 4LL0A 3ZS5A 5HG9A 5GZAA 4K8AA 5GHVA 1PRYA 2BIYA 1VYWA 3JY9A 4NJDA 2R2PA 1YHSA 4FVQA 1JKTA 1OGUA 3OXTA 3QRIA 4E93A 4MAOA 5JSMA 3TIZA 2P55A 3N4UA 4L42A 3HDMA 5EOLA 2VTPA 1PMNA 1FPUA 5GZ8A 2OZOA 1CKIA 5I0BA 4AXAA 3ZLWA 3F66A 3HMNA 5HNGA 5DBXA 3NX8A 3ZBXA 4MXOA 2W5BA 1W84A 4HCVA 4WUAA 3NNWA 1Z57A 3HZTA 5D12A 3WI6A 2QCSA 5D7AA 1U46A 4QMPA 2J7TA 4ZJJA 4ZSGA 4F0GA 4Y85A 2Q83A 3UYTA 2WEVA 3SAYA 4D5HA 5KHWA 3PXYA 3K2LA 4AZEA 2OIQA 3KF4A 3FQHA 4YC6A 4L43A 4O0SA 4BWKA 4IIRA 1OBGA 4YJRA 5HVKA 3LFSA 5JFVA 3CJGA 5HE2A 4O86A 2R5TA 4C4FA 3D2KA 3MFRA 2DUVA 4G16A 2R3OA 2HIWA 3MIAA 4IB0A 3ZSIA 4WA9A 4JG8A 1H07A 4IX4A 3W2OA 3KF7A 4ID7A 3IOPA 3PIXA 5IQCA 4MQ2A 2JFMA 1PKGA 3GFEA 4NFMA 4QMMA 4QTCA 4UWCA 2ZV9A 4L3LA 3SC1A 3UOLA 4U81A 4WUNA 1PKDA 5AUVA 5I9UA 5IMXA 3ET7A 2GQSA 5DE2A 1AQ1A 2BVAA 5DR2A 3U6JA 3C0GA 4UYAA 3VS2A 4DEBA 3UO5A 4FTIA 1OECA 1B39A 4MNFA 4ZSLA 3F69A 3EL8A 3LFNA 4BDKA 1R39A 1U54A 4J1RA 2ZYBA 5LWNA 2WNTA 1H27A 3FY0A 3ROCA 3MB7A 1FVRA 3DJ7A 3OMVA 5EW8A 3I6WA 3WF9A 2X2LA 4IC8A 3VUDA 2R3IA 3TNHA 5KBQA 3M11A 4H1JA 3UC3A 3V8SA 1W7HA 2ZMCA 4O7RA 4R78A 1H1PA 3MY5A 2G9XA 3EYHA 4Q5EA 3WE4A 3AC5A 4LGGA 2VWXA 3WZDA 2YM8A 4X0MA 5CYIA 3IW6A 4U45A 4CXAA 4MKCA 3K5VA 2XH5A 4YMJA 2HK5A 3MH2A 3PJ8A 3NDMA 2BAJA 5DPVA 4EBWA 3QHWA 3CQUA 4FZ7A 4U42A 4F9BA 3VN9A 4BDIA 3HA8A 4OTQA 5IQHA 5DNRA 4WSQA 4Q9ZA 5C8NA 2VTHA 5A4QA 3FLWA 3ID6C 4Z3VA 3QGWA 4LMNA 4FYOA 3PVUA 3DDPA 4G9CA 5HNIX 2R9SA 3R9NA 2NRYA 4EOOA 3U9CA 3WZKA 4EI4A 1YVJA 5EW3A 3OW4A 3TZ8A 2FSTX 2CJMA 1XH8A 2ZM4A 2F2CB 1R3CA 4PMSA 4YO4A 5E7RA 1PY5A 3GU5A 1KV2A 3P0MA 4PPCA 2IG7A 1XWSA 3MW1A 4QO9A 3SOAA 3RHXA 4S31A 3GC9A 4LRJA 3SVVA 3HUCA 1J7UA 1B6CB 2Y4IC 4KIKB 2DWBA 4IB3A 2BHEA 4FA2A 4M97A 3R0TA 3QD0A 4L9IA 2OZAA 3D7TA 3QAME 3LQ3A 3FL5A 1ATPE 3VUMA 3AGLA 5AUUA 5HE0A 3A7FA 1L3RE 2BZHB 4O27B 2HCKA 4CFUA 1NVSA 5AP3A 4RJ8A 4TWNA 3QQUA 3QTWA 4IVAA 3ZO3A 4NCTC 3P23A 4ZTQA 1UWJA 1WBTA 2BTRA 4C7TA 2EVAA 4P90A 3TIYA 3PP1A 3QQKA 1URCA 2CKOA 3ZM9A 5B7VA 4FT7A 4YNEA 4O0RA 3UNJA 4F09A 2E9OA 3GB2A 4EORA 4GFOA 4HVGA 2BRMA 4UYNA 4CFMA 2OFUA 2G2FA 5IH5A 2UZOA 5KMNA 3U54A 4EYJA 3ERKA 4RFMA 4BBMA 3EWHA 5IDNA 2PUPA 3OFMA 5JH6A 2HW7A 3C4EA 3GCVA 4QTDA 4IFGA 4QMLA 4IZYA 4XG9A 4YC3A 3VW6A 4BCGA 4AT5A 3C0HA 2Z02A 5J95A 2YAAA 4GKIA 2PUNA 2QOIA 4EK8A 4I6FA 4BGQA 4GFMA 5E8WA 4FE2A 3C5UA 4GRBA 4CG9A 4CLIA 2J0KA 3SA0A 2WTDA 4FBXA 4RIWB 1PXJA 2CCHA 4E4NA 4IMYA 3R04A 3EN9A 2GPHA 3TI1A 4J98A 1M2QA 2BR1A 2ONLC 1Q8TA 3FLQA 5ANEA 4EH8A 4IX6A 2WZJA 4RPVA 4U6RA 4W9XA 4QOXA 3W8QA 4BTFA 4DFZE 3AC3A 3CPCA 5LJJA 2IO6A 4CFNA 2Y8OA 3FI4A 4JVGA 2QOLA 1PW2A 2OJIA 3UPXA 5HO7A 4FKSA 5FQDC 2QO2A 4TT7A 4G5PA 3F7WA 1YI3A 1YRPA 5DWRA 5CZHA 5E8XA 3O8PA 3SXRA 4BCOA 3RM6A 4CTCA 1WBWA 2Y9QA 3AOXA 3N9XA 4K18A 5CXHA 2YDJA 1FBNA 1EH4A 1NVRA 4G3DA 5BUIA 2YCFA 2V5QA 2F49A 3R1SA 4GJ3A 4XG4A 5A4EA 2W0JA 3QKMA 5M51A 2UZLA 3WF8A 2X6EA 2CGUA 1E1XA 3DT1A 2JKKA 3G15A 1F5QA 1I09A 1VEBA 1XO2B 4M14A 4FKTA 4D2TA 2BZJA 1PMVA 2JDSA 4NTSA 4S2ZA 3MVLA 4MCVA 4I21A 2IZSA 5HI2A 5L6WL 3RNYA 2YIYA 4ZJIA 2CN8A 3LZBA 2H9VA 3FMLA 4QPAA 3I1AA 3EFJA 4AOIA 2F2UA 3L8VA 1QPEA 3DB6A 5T68A 3GXLA 4BTKA 5AV0A 3NSZA 3HV5A 4DG3E 1J1BA 4IFCA 2W4JA 2G2IA 3KB7A 4LYNA 3BIZA 5EKOA 4IJ9A 1RJBA 1SMHA 4P5ZA 3FHIA 1W83A 4GW8A 4XV3A 1JVPP 5FGKA 4QNYA 4DEAA 5D10A 1OPKA 2PVFA 3ODYX 4DEEA 5GIPE 4UMRA 5TO8A 3DU8A 2J51A 4X6RA 2ITWA 3PXQA 5BYZA 1KE8A 3SGCA 3ULIA 4ERKA 2JEDA 3RALA 3WZUA 4NEUA 2PHKA 3DNDA 5L4QA 2X4ZA 3QC4A 1JPAA 5CEIA 3L8XA 2QG7A 1LEWA 5I9YA 4IX5A 4GEOA 3F7ZA 3QTIA 4IC7A 4BZDA 3RK5A 1QPJA 4R5YA 3FMJA 3HKOA 1STCE 5LWMA 2YACA 4FKPA 5CLPA 5D7VA 4ZLYA 1PXIA 5EI6A 3R2BA 3MJ2A 4FTQA 5L8JA 1O9UA 3TN8A 4NSTA 2C68A 4IANA 4NTTA 5KE0A 4Z9LA 2CLQA 5CQWA 2C3JA
chains in the Genus database with same CATH superfamily
5ANKA 3I6UA 4DHFA 2J50A 4IAYA 3RPRA 2ERZE 2V7OA 4AA0A 4RZWA 4O7ZA 4GK2A 4A9SA 1URWA 3PXKA 4BCIA 1BX6A 1OVEA 1PYEA 5FBNC 2EB2A 4FTMA 4M0YA 4RWLA 3C4ZA 3BE9A 3VRYA 4J8NA 4JDKA 5HORA 3RK7A 2W17A 2W1ZA 2YIRA 2QI8A 3F88A 2XNGA 3GT8A 3OEZA 3RAHA 4CKJA 4M8TA 5AR7A 2IVTA 3NVKI 3NUAA 3BV2A 4RBLA 2J9MA 1YXVA 3FYJX 4QYYA 4G6NA 3UP2A 4B6LA 3S1HA 3F9NA 3CD3A 5AV2A 4J95A 4FNWA 4ZMFA 3P4KA 2NO3A 1V1KA 3FBVA 5KKRB 4MF1A 1SNUA 1ZRZA 2W1FA 3C13A 4KKEA 4UWBA 3TNIA 3W8LA 3NYNA 4AA4A 4LRMA 5EYMA 4FEQA 5KNJA 3DQWA 4F70A 2ZV7A 5K0KA 4BWPA 4BY9E 3A7GA 4II5A 2YJRA 4O0XA 4PP9A 4FKIA 4YLKA 4E73A 4UMUA 2XIKA 4TW9A 4PP7A 2QU5A 2XK9A 4LDTA 4NL0A 3CEKA 5DHJA 4ACMA 3DXNA 4FSUA 3TUBA 3VC4A 4NK9A 3Q4UA 4FOCA 3QQGA 4FV5A 3VBTA 2O8YA 5K0XA 4UXQA 2PVLA 4Z16A 3WZEA 2JFLA 4NW5A 4AUAA 5ANIA 3UQFA 2UW3A 3HAVA 3ZDUA 2PZRA 4HZSA 2P0CA 4KIQA 3R7EA 3TKUA 2JAVA 4EHVA 3EQFA 2OG8A 3FZTA 3ORKA 5E8ZA 4NM3A 2I0EA 3EQHA 4JR3A 4C4HA 2YM7A 5L8KA 2W4OA 5BMSA 3VAPA 1KOBA 4JT3A 3TKIA 5I9WA 3ANRA 4X7QA 5A14A 2ZM3A 1H0WA 4QMSA 4TYHB 4ZZMA 4AXCA 2X9FA 4O7LA 3UIUA 3NAYA 4EK5A 3LFEA 3II5A 4QMZA 3JYAA 4IVDA 2RG5A 3OUNB 3ZUUA 4XG8A 4XOZA 4UXLA 5IH6A 2ITPA 3FPQA 3ZHPC 2WMWA 1OI9A 4O38A 5AX3A 3MA3A 4EH2A 4ZMEA 2J6MA 3PPZA 4DCAA 4FTRA 2VD5A 2P2HA 5D1JA 3A8WA 4ZAUA 2XK6A 4C2VA 2C6IA 4XV9A 4D5KA 1ZMVA 2QKWB 4AE9A 4CFXA 5EM8A 4H36A 4NFNA 3TZMA 3PXZA 2OF2A 3PA5A 2X4FA 4XV1A 3KEXA 1Q8YA 1UNLA 4AZSA 4BIBA 1U59A 1Z5MA 5DR6A 2O3PA 2WOTA 3HRCA 3F5PA 3PE1A 4BICA 4DGNA 5KMIA 5ETFA 2R3PA 3O23A 5ITAA 3ATTA 4AWIA 3PXRA 2RSVA 1PMUA 2PYWA 3EKKA 2B7AA 4IHPA 2XEYA 4EOIA 5BYLA 5JRQA 1U5RA 2VTMA 3HLLA 1YDSE 2GMXA 3IW7A 3LJ1A 3P86A 4C61A 3O0GA 5CSVA 4YHJA 1FVVA 3AT3A 3RTPA 1W8CA 3D2IA 4I24A 3PLSA 2GFCA 3EJ1A 3KK9A 3BHTA 4JQEA 4I41A 4XV2A 3GENA 1YW2A 3OS3A 5BVKA 5LCKA 3LOKA 4GFGA 5CENA 2V7AA 1OITA 4OTRA 4ANOA 5AADA 3QKLA 2X9EA 5J5TA 3FZ1A 2HZIA 2WIHA 5FM3A 4O4FA 4LMUA 3FJQE 1B38A 2XF0A 3CXWA 4DDIA 2UVXA 3E7OA 3PRFA 4ALUA 2BCJA 4IDVA 4X3JA 4BCNA 3O7LD 4YTIA 2E2BA 4FKLA 2B1PA 5M4IA 1DS5A 5E1SA 2HAKA 4KWPA 4L53A 4EBVA 2VTTA 4D9TA 1KOAA 4M68A 4CFVA 2OK1A 1DI9A 4QMUA 4U44A 3W0NA 3I81A 3KN5A 3QCXA 4P2KA 3ZDIA 4MD9E 4F63A 5C8KA 4RIXA 3BYOA 3FZSA 3MH3A 3QLGA 1XBAA 2YM6A 2HW6A 5HBEA 1JNKA 3BEAA 4HZRA 4MBLA 5HEZA 2XKFA 2B52A 3KY2A 4FIGA 3R8VA 1PYXA 4EZ5A 5BYYA 3T3VA 3W1FA 5EH0A 1GZOA 2XIXA 2WFYA 2VRXA 4MQ1A 3LCKA 4RX8A 2XKCA 4Z55A 3AKLA 2BRHA 2OICA 3QTQA 4YHFA 1K9AA 3F3TA 2OKRA 4IZ7A 2BIKB 2JBOA 4QPMA 5CI6A 4IVBA 4FYNA 2ETKA 1G5SA 2QOFA 4APCA 4KABA 4CEGA 4PNKA 3C4WA 3G2FA 3WE8A 3CR0A 3OWLA 5EI8A 4ZY5A 5E9EA 2Y7JA 4FI1A 3MWUA 3UOJA 3QTRA 4Y72A 2UV2A 5FRIA 3TACA 4FV6A 4WG4A 4A9TA 1KV1A 2QOBA 3C4XA 4MF0A 5AV4A 5A54A 1A06A 3DJ5A 5IQBA 3C9WA 4E8AA 5C26A 4R7IA 4QTAA 5A6OA 3R8UA 3FWQA 2E9PA 1Q8ZA 3LQ5A 4FKRA 4WG5A 5HBJA 4LM5A 5IISA 3WOWA 5T6KA 4GG7A 3WILA 3O8UA 1F3MC 2OGVA 2V22A 3OWJA 4GH2A 5FWKK 3V5TA 4I6LA 4FL2A 4OTIA 4F9CA 4EOMA 3QU0A 3COHA 4L3JA 4NZWB 4TYJA 5IZFA 1H0VA 2V0DA 3S4QA 4BZNA 1JKKA 3DFAA 3QWKA 2OJGA 2YM3A 2C0TA 3D14A 2JKOA 4FIIA 4J53A 5AIRA 2UZBA 2GS6A 4AW0A 1GAGA 2VTQA 5B2LA 2PMNX 3GEQA 4BYJA 5H8BA 4WSYA 2WMXA 4HYIA 2BHHA 1ZLTA 4HPUE 3AD6A 2UW6A 4FV4A 4DE4A 5GJFA 4I6BA 4YGAA 4AZTA 2VO6A 2X39A 1NVQA 4BL1A 5L6PA 4ZSEA 2AC3A 4B7TA 3CTJA 3ULZA 4LRKA 3NRMA 1SVGA 4DLIA 3AT4A 1BYGA 3MA6A 4NUSA 3B2TA 3F2NA 3P08A 2QD9A 2WQMA 3CJFA 1XMMA 5IEYA 2GNHA 4JBQA 4RGJA 2YAKA 3MS9A 4PQNA 4W8DA 4YZ9A 4CMOA 5HU3A 1JAMA 4KSPA 3DBEA 3KULA 3KMWA 3F61A 3R28A 3QD3A 4H39A 2CGVA 2GCDA 3HMMA 2F7EE 3LE6A 4OTDA 5K3YA 4YJOA 3V8WA 5JK3A 3BU5A 4I1ZA 4U40A 4UB7A 5BVEA 1WVWA 4ONAA 2XIZA 4EONA 3PPJA 4O22A 4C0TA 4S34A 4IM2A 3A62A 4EEVA 5AJQA 2X0QA 4IADA 3ENMA 3L9NA 3K54A 3RHKA 3VULA 4JQ7A 3RWQA 4B99A 4JIAA 5EQYA 4ASEA 3KXGA 5JEBA 3QBNA 3WF6A 5EYKA 5IEXA 5JGBA 2WO6A 4NU1A 3DQXA 4HW7A 1S9IA 3TZ7A 3MFUA 4FK3A 4AGDA 3FMMA 3H0ZA 3VS5A 2BZKB 2C5VA 2EXMA 2V62A 5HHWA 2GS2A 3ZZEA 2VTSA 4JRVA 3DAJA 5E92A 3NW5A 2JDRA 5DT4A 3VW8A 4RIYA 1ZYCA 3U9NA 4B9DA 4IXPA 4C37A 4HVDA 2XUUA 3CS9A 5GZ9A 3TKHA 4BCFA 2FSLX 4TWOA 3CSVA 3KRLA 3PFYA 3SW7A 4EC9A 3BLHA 3FLZA 4I4FA 1OPJA 4Y8DA 4MD8E 5AR8A 5IG1A 4MVFA 4HVIA 2VTJA 2OJFE 5M44A 3HNGA 3MV5A 4FK6A 5I5ZA 2UW5A 5IUGA 2IZRA 1KE9A 3F3WA 2RFNA 2XJ0A 3EQGA 2FUMA 2X0GA 4YR8A 4WG3A 5BX0A 3MPTA 5EI2A 4RJ6A 3IW8A 3TV7A 2WB8A 3E7VA 2WTCA 4LFIA 5E8YA 4AOJA 2PSQA 2A27A 3BBTB 4DLJA 1IRKA 5KKRC 5JMSA 2P4IA 4ZY6A 5HLPA 4MXAA 1G8SA 1H4LA 5BVDA 5IQEA 1MRYA 3NZ0A 4OBPA 4E6DA 3G33A 3C7QA 2JIIA 3OBJA 3Q4ZA 3LCSA 1UKHA 2OXXA 3KMUA 2JITA 4C36A 3PWYA 3UNKA 3QCQA 4TNBA 2IF8A 3V51A 3ZUTA 3IGGA 5IQGA 2QG5A 3WF7A 3E62A 3JY0A 3MYGA 2IVUA 5EHOA 1IAHA 5LARA 3QZGA 3UZPA 4D0XA 3T3UA 4QMVA 3GBZA 1O6YA 4HNFA 5IMEA 3ZRKA 3QA0A 2YABA 4OBQA 3EYGA 4CRLA 3R30A 2ZVAA 5CQUA 4FTLA 4CT1A 3BKBA 2XKEA 4MK0A 2R3KA 3S95A 1ZY5A 4O7SA 2EU9A 5DA3A 3Q52A 3WF5A 3UIBA 4DC2A 5TKDA 2VWBA 5CAVA 3IW4A 4FSQA 4GS6A 5HG8A 3PUPA 3U51A 2YN8A 3EKNA 1YQJA 4BIDA 4GYIA 4AT3A 4CD0A 3R2YA 3FQEA 4PTGA 3MFTA 4QMXA 4P4CA 3UO4A 3PVWA 3R7OA 5EK7A 1YXSA 5CNNA 4FZFB 2UZVA 2VWZA 4C3PA 2J0MB 3F3UA 2HZ4A 3HX4A 4QMYA 5BMMA 3NW6A 3DZOA 3I4BA 3RINA 3VS1A 3W0OA 4ANBA 3R9HA 3ANQA 2IW9A 3R00A 4LI5A 2VTRA 3Q2JA 3CBLA 4USDA 3TTIA 4L52A 5CEMA 3VJNA 3LFAA 4AXEA 3HRBA 1MUOA 3BYSA 3QGYA 3AC2A 3QTZA 3RWPA 3IK3A 5KUPA 3NGAA 4RIXB 4RLKA 4RVLA 1V0BA 2GNGA 2XRUA 4QYFA 3SDJA 4F65A 4TPTA 3UGCA 4RVKA 4QP7A 2R3HA 2C6MA 3CTQA 1XHAA 2GU8A 4QT1A 3BL7A 2XM8A 3MJ1A 4E6QA 2RFDA 3BLQA 2RKUA 4O1OA 4EC8A 5AAGA 5IA1A 3PVBA 1MQ4A 3NUYA 5LQFA 3ELJA 3B8RA 4WNOA 1Y57A 4XG3A 4AF3A 3OT3A 3Q53A 4FV0A 3WIGA 5JN2A 1IEPA 3VBWA 3U6IA 4X6QC 4DH5A 3VS7A 5KMLA 5FXSA 3HP2A 1J1CA 4RA4A 1H1RA 2QOHA 4FKWA 4CV8A 3LM0A 2IPXA 3IPHA 5CVHA 4L8MA 4QP9A 5AP2A 4F7SA 3VHEA 4N70A 4CCUA 4CYJA 4USFA 1UNHA 3GC8A 4JG6A 4NJ3A 4RWJA 3KA0A 3LM5A 2PZYA 3IDPA 2XRWA 4X3FC 4ANSA 4DINA 5IA0A 1XH9A 3RI1A 1U5QA 2ITYA 4KNBA 2E9UA 2BPMA 2XYUA 3CQWA 2GNLA 2I0VA 1V0PA 2OF4A 4V04A 1YXTA 4UX9A 1K3AA 5AP1A 2J0JA 2PE2A 3H4JA 4RJ4A 3WBLA 2BTSA 4QP4A 1NA7A 2QKRA 2JLDA 5FXRA 2WTWA 4IB1A 5K9IA 5HBHA 5J79A 3OHTA 3D5WA 4ANNA 4U80A 3VBQA 4WD5A 4JIKA 3BE2A 5HZNA 4A07A 3FXXA 4ZTHA 3UBDA 4O0TA 4RSSA 5CU0A 2VU3A 3LCTA 4DH1A 4CSVA 4JL9A 4FEVA 4I6HA 4BWXA 3TWJA 2VNWA 3IDBA 4DEDA 3W0MA 4O6LA 2I0HA 5FLFA 1QPCA 3MI9A 3OXZA 2QR8A 4I20A 4L67A 3PIYA 4EK3A 4C57A 3ZMMA 3QALE 4OUCA 2WHBA 5CEKA 3FI2A 4YTFA 4YLLA 3QF9A 4R8QA 4FTOA 1KWPA 4HNIA 3DXPA 2YIQA 2VUWA 4KB8A 2VTAA 2XMYA 4QTEA 2XNBA 3G0FA 1NY3A 4M66A 4N6YA 4ACDA 4DCEA 3G90X 3OZ6A 4C8BA 3DK7A 2PVKA 2PU8A 3GC0A 2LAVA 1PMEA 2VX3A 5M09A 5JQ8A 4KD1A 4M0ZA 1REJA 2VX1A 3EOCA 2V55A 4DFBA 3EQDA 3FV8A 5FTOA 1BLXA 4AN3A 4WO5A 1FMKA 2BRGA 3ZFXA 2HXLA 2JKMA 4F9AA 1PXOA 5F95A 5TR6A 5HNBA 5TOZA 2C5OA 2A19B 3KXMA 3OD6X 1XH4A 3EQBA 2BILB 2WMBA 3Q5IA 1VR2A 2ZOQA 3MVHA 4JXFA 4MX9A 4AGCA 1U4DA 1OMWA 4BHNA 3DCVA 4EOPA 2VWWA 1XBCA 4E4MA 2W4KA 4J99A 1SNXA 3O7LB 1A48A 4ZIMA 3W2CA 4MTAA 3AC4A 4TN6A 4F6SA 4AW2A 3D4QA 2UW8A 3CP9A 3QRUA 3E93A 4PRJA 4IWQA 1H08A 2WTVA 4ITHA 3TMOA 3GGFA 3EQPA 2UUEA 3OEFX 4WHZA 4ZLOA 2LGCA 2XCKA 3ORPA 3I0OA 3HAMA 4MD7E 3DV3A 5F94A 3BBWA 3OG7A 4ZS4A 2Y6MA 5DRBA 3A7HA 4JR7A 3GOKA 3U8WA 3Q6WA 5HIDA 5BQ0A 3QQFA 2NRUA 3BHVA 3P9JA 2IWIA 3MSSA 4FV2A 4QQCA 2QODA 3PRIA 3CTHA 2PVRA 1CTPE 1Y8YA 2W05A 2ITTA 1BI8A 3JPVA 5C27A 4A4XA 1S9JA 2XK3A 2C69A 2XP2A 1NW1A 4XP0A 3IOKA 3LMHA 4DHJA 4BTMA 5HG5A 5KMOA 4DT9A 2YDKA 1M7QA 5GIOE 4EQUA 3H9OA 3RZFA 1M17A 2X0PA 3TNQB 4FR4A 5E8UA 3FMHA 3TV6A 3PJ2A 3UG1A 5L3AA 3PZHA 3UZTA 2G15A 5AR3A 3THBA 3V8TA 3I7BA 4O1PA 1JOWB 4BI1A 2VGPA 1YDRE 2GHMA 2GNJA 3MN3A 3OWPA 4M67A 4ACHA 1SVHA 3S3IA 3PDTA 4ZSAA 1JSTA 1GOLA 5CF8A 1ND4A 3FMEA 4OTGA 3KXNA 3LXLA 3Q04A 4RMZA 3ACKA 5HE3A 5KCVA 3QZHA 4O7WA 2ACXA 2A98A 4AXDA 4R3PA 2PMIA 4A9RA 4H58A 4JLCA 4TYEA 4WIHA 1MRUA 2IZUA 4GT3A 4M13A 4Q9SA 1KUTA 3FI8A 2OLCA 3LAUA 4ZTLA 1RDQE 3PJ3A 1OKYA 3VS3A 3DJ6A 2JDVA 4AZVA 3RM7A 3PPKA 4M7IA 4BHZA 2GDOA 2Y0AA 3T9IA 2ZDUA 4XCUA 5J9LA 4JRNA 1DM2A 2BAQA 2BFXA 3DK3A 1M2RA 4GUEA 4Y83A 3FKLA 2F9GA 4GT5A 4QMNA 3FXWA 5DN3A 5E8SA 5AUXA 4BN1A 4YSJA 4AQKA 4ASXA 3D83A 4YC8A 5DEWA 3DBQA 3QRTA 3W16A 4BDAA 5AAEA 1OM1A 2BMCA 2QOCA 2WGJA 3AG9A 3E3BX 3E88A 3EN4A 3OBGA 4KIOA 3VRZA 5ANDA 1G8KA 5ACKA 4BZOA 5AA8A 4YZBA 4QNAA 4U5JA 1YKRA 4KRDA 1OL7A 3NVMB 4U43A 1GZNA 4FZ6A 4O83A 3L9PA 4KIPA 3DGKA 5AUWA 4EZ3A 2XBJA 4D9UA 3FLSA 4QTBA 2NP8A 5G1XA 2I0YA 4AN2A 5HU9A 4O0YA 1W82A 5CF5A 3LFQA 2QONA 3LFBA 4IWPA 3VS4A 3AQVA 4MBJA 1ZXEA 4NW6A 2C6LA 1ZYJA 2ITQA 5H8GA 3FPMA 3RAWA 3W18A 5CSPA 1OKZA 5ANOA 2O64A 4U7ZA 2XANA 1DAYA 4F1OA 3GCSA 5EQPA 5JKGA 5HQ0A 5M07A 4XLVA 3Q2MA 3AXWA 1IASA 3POOA 4HGEA 3V6SA 4C34A 1OB3A 4DEHA 4TL0A 3ATSA 4I4EA 2WMRA 2X8DA 4BCKA 2GFSA 2HY81 3W10A 5L6OA 4V05A 2BKZA 1ZMUA 4ZY4A 1OUKA 3HL7A 3V04A 5DLSA 4S33A 2XBAA 3OCSA 4J52A 3P78A 4KBKA 4PDOA 4FL1A 3GOPA 5L2SA 3N4TA 3OP5A 3FYKX 4LUDA 5HLWA 3RGFA 1ZYSA 4CKRA 5M4CA 4MWIA 5JFXA 5I9XA 3IKAA 4BF2A 3E87A 5CT0A 2GS7A 5BVWA 4LUEA 5LMKC 3O71A 1ST4A 4ASZA 5ANJA 3BYMA 3KKVA 4HCTA 2YDIA 3R01A 2WMVA 4Y95A 5HGIA 4YURA 5LXMA 4O81A 4R5SA 3UIMA 4F6WA 3UJGA 4TWPA 3KGAA 4RVTA 1X8BA 3BYUA 4GJ2A 5E8VA 3ZRMA 2QOOA 3DNEA 2PULA 5DGZA 5CVFA 3FKOA 1E1VA 2A2AA 1Q62A 3EN6A 4FOBA 3R83A 4MUQA 1TQMA 4ZEGA 2OBJA 1Y6AA 4R1VA 3WIKA 4EOKA 5IU2A 2W9ZB 1U54B 3EFWA 3COKA 3PE2A 3E8CA 4IZ5A 2WMSA 4JBPA 4G34A 5BNJA 3H3CA 3B2WA 5D41A 4D4YA 3HEGA 5LMBA 3OCBA 2EWAA 3OCGA 4OAUC 4ORKA 4M84A 2H8HA 4FZDB 4M12A 3FLNC 5G6VA 4FIJA 3TZ9A 4B4LA 4DH8A 4FF8A 4AACA 3DKCA 4D1XA 3KQ7A 1R78A 2R3NA 4FEXA 5AEPA 4NCTA 3O96A 4JQ8A 5EYDA 3C51A 3FZRA 5H9BA 2RIOA 1Q41A 4IEBA 3UQCA 1VJYA 4AXFA 3TYKA 4MBIA 4AS0A 4U9AA 3ODZX 2QVSE 3RNIA 2YA9A 2WQNA 3OY1A 4Y5QA 2ZV8A 3C50A 3DA6A 4BCHA 4AAAA 4FNZA 2G2HA 2P33A 5GJDA 4U0IA 4V0GA 4OBOA 4FGBA 5IA4A 3U6HA 3OY3A 2PVJA 1TVOA 3PIZA 4ZK5A 3VUGA 2RGPA 4AW5A 4QP1A 4F9WA 2UW9A 4M69A 3O51A 3UQGA 2B9FA 2DYLA 4MXYA 4F0FA 1ZY4A 3W0SA 3DBFA 3N51A 1P14A 4IX3A 1O6LA 1R0PA 2ONLA 2J5FA 2QLUA 3SXFA 4CYIA 4YZMA 4B0GA 5HX8A 3DBCA 4XG7A 1LUFA 2C3IB 2YIWA 5IA2A 3V5QA 1H26A 3TDVA 1YWNA 3DKFA 4G9RA 2PZIA 2OH0E 2OZAB 3D7TB 1RQQA 3R71A 3OF0A 1OZ1A 4MEDA 4BBEA 4DFUA 1IA9A 1GJOA 3UVQA 2Z60A 1FVTA 2HELA 2KULA 3QRKA 3R1NA 3LCOA 4FTAA 4IBMA 4K9YA 4N4SA 1FINA 4H3BA 4BBFA 5A6NA 2EXEA 2X0OA 3T8OA 4QYEA 2ETMA 1O6KA 5HOAA 3SKCA 5HTIA 4Y5HA 3O5AA 5IA5A 4GKHA 4I0TA 4L7FA 5AP0A 3KMMA 3A4PA 4LV5A 2YWVA 4RX9A 1GZKA 4FSNA 2WTJA 3PTGA 3PY1A 3R8LA 3ZXTA 4UMQA 3AC1A 5E1EA 3O2MA 3PXFA 4YPSA 4D4RA 3IQ7A 3NEWA 4ZOGA 3FKNA 5HIEA 1KSWA 5A4CA 4CKIA 4XJ0A 1UA2A 4R3CA 4CRSA 4AE6A 5DMZA 4NWMA 2F4JA 2YJSA 2AC5A 4PMMA 3DKOA 3GUBA 3U4UA 3DLSA 3GC7A 2Z2WA 2W5HA 3HRFA 3POZA 3VQHA 2XNOA 4FSRA 4I5CA 3EQRA 3VUIA 1H8FA 3W2SA 1F0QA 2W9FB 3QD4A 4BYIA 5CAUA 3I5ZA 4XH6A 2O65A 1T46A 2A0CX 2HYYA 3QD2B 1ZYLA 2WMAA 2QHMA 5J9YA 4RQKA 2ERKA 4D2SA 5CX9A 3QRJA 5JFWA 4OR5A 4O84A 3SG9A 4LG4A 3CKXA 3NNVA 5DIAA 1BMKA 4BDEA 3UZRA 4MWHA 4MXCA 1JWHA 5DYJA 1E9HA 3IS5A 4PV0A 1MRVA 4XOYA 2X8IA 3PY0A 5E91A 2VWVA 4NM0A 5K5NA 3S00A 1UWHA 3MVMA 5FBOA 1PXNA 4OTHA 4Q2AA 4L45A 4DGOA 2XA4A 4EUTA 3H9RA 3ORLA 3ZZWA 3AT2A 2WOUA 3MDYA 5E8TA 4PNIA 3U87A 4UMPA 3NAXA 3FY2A 3QQLA 5L2WA 2FA2A 2GNIA 4X2KA 4GT4A 2R3FA 3I60A 3SG8A 4BKZA 3ZEWA 2O0UA 2I1MA 4DITA 2ESMA 3UTOA 4JNWA 1FOTA 3ZO1A 1YWRA 4JX3A 4AGWA 5IQFA 2WEIA 3PSCA 4QMQA 3CLYA 2W1IA 5HD7A 4FTTA 1XQZA 3R7GA 3ZLYA 4J97A 4S32A 4PUZA 3VWAA 4KUJA 4DFXE 5IEVA 2A1AB 5HICA 4HOKA 5BUEA 5HX6A 3TUDA 5IUHA 4R7BA 1IR3A 3G5DA 4A06A 4C4JA 3DFCB 4V01A 2W1GA 3OC1A 2PE1A 4I93A 3GCQA 3UMWA 4CMUA 2XNMA 3NUPA 4HPTE 1GZ8A 2R3LA 5KX8A 2J2IB 5FP5A 4BVUA 4UEUA 4E4LA 3HV4A 3BCEA 5HE1A 5LVOA 1GY3A 4IVCA 2R3RA 1J91A 2ZAZA 1Q3DA 4HYHA 3W2PA 4AA5A 4YP8A 2RFSA 4NYEA 4F7NA 2R0UA 1OIUA 4D2PA 1YXXA 4WRGA 4RX5A 3EQCA 3AD4A 2VWIA 2J90A 4G31A 4FTNA 5C01A 1M7NA 3A7IA 1UU9A 3G0EA 4X2FA 3QZFA 1W98A 2ZB1A 3P79A 3DXQA 3FEGA 4R1YA 3LCDA 1GIIA 1G3NA 5TF9A 3E63A 4BDDA 4BIEA 2PMLX 4A4LA 4O91A 4N57A 4ZP5A 3A99A 3A8XA 3PP0A 4DDGA 1H25A 4FV1A 3UNZA 5KMJA 5GINE 3R1QA 4NKAA 1ZARA 5FD2A 3NCZA 3F2RA 2QURA 4YZNA 4CQGA 2OJ9A 4KS8A 3F5UA 2W1CA 3UYSA 1VLRA 2X2KA 3KC3A 3DK6A 2GHLA 4E7WA 2QR7A 3ORNA 1TQPA 4GL9A 1CDKA 3R9OA 4KINA 3V5LA 5HTBA 4UZDA 5IQIA 4G3FA 2X7OA 4L00A 4C2WA 3PJ1A 1YHWA 4YZDA 4F7LA 3IO7A 2UZUE 2WTKB 4DBNA 4YPDA 3LFDA 3DPKA 2Z7QA 2GSFA 1NXKA 1JKSA 2Y4IB 3GQIA 2C6OA 2CSNA 3Q4TA 3FMDA 4YJSA 4ZXTA 5CU3A 4YTCA 3EQIA 3RVGA 3UDZA 2B54A 3EHAA 4ZSJA 3GQLA 5HESA 3V01A 4ENXA 4BR3A 3D7ZA 3FSFA 3GU7A 4KKHA 2I40A 2BDJA 3ALNA 1MQBA 4G17A 3COIA 4IH8A 5C9CA 4WNKA 4BKYA 1AD5A 4U3ZA 5GNKA 1TZDA 3BV3A 4JDIA 4ASDA 4OT5A 5K4IA 4XLIA 2G01A 4BGGA 2PWLA 2XS0A 3HV7A 3MB6A 1SM2A 3PY3A 4RC3A 3OWKA 4GK3A 4LOOA 1ZAOA 2YCQA 4UZHA 5EDPA 2Z7RA 4KAOA 3WARA 4YJTA 1H00A 4G3EA 4FTJA 2FO0A 4U41A 4C62A 1Q8UA 3QLFA 3F5GA 3GCUA 4CG8A 2XCHA 2RFEA 3LJ2A 3PVGA 4JBOA 3OT8A 4D4SA 2ITUA 2PVMA 3NUNA 5CSXA 3LJ0A 4J71A 2BALA 3CD8A 1JSUA 3P7AA 4V0GB 5LOHA 5C4KA 2XB7A 1XBBA 3L8SA 2XNNA 3H10A 4RWKA 3Q96A 3VBXA 4O7TA 1APME 4RLLA 1Q24A 3RZBA 5CS6A 1ERKA 4AX8A 4M69B 4EK4A 3BZ3A 5E4HA 4KIKA 3FC2A 2QU6A 4EHEA 2FB8A 3VS0A 3UIXA 4BDBA 3FZOA 2CCIA 2E9VA 2FSMX 2WD1A 3AMBA 4QYHA 5DFPA 3RK9A 2C6KA 4PF4A 4APPA 5KHXA 1Q4LA 5CF6A 2C47A 3HGKA 5EG3A 4CMTA 2B9HA 4O2ZA 3F3ZA 2XM9A 3R9DA 5CU4A 4L7SA 1OIRA 1Z9XA 1M14A 1WVXA 3VUKA 5J1VA 2RL5A 4KRCA 4XG2A 5DEYA 5GJGA 1R0EA 4DG2E 3G9NA 3C4FA 1ZMWA 4RT7A 1IAJA 4I22A 4AZWA 4F64A 5CEQA 3ORMA 1WBNA 1FGKA 3ZC5A 4FGRA 3HMIA 3MTFA 4O6EA 4ZS0A 2XK8A 2J0LA 5ICPA 3RCJA 4D58A 3NUXA 3PA4A 5F4NA 1Y6BA 1ZWSA 5EOBA 5HKMA 5BV3A 3HDNA 3LXPA 5B2MA 4BI0A 4JI9A 3GFWA 3VF9A 3VUTA 4A7CA 4BTJA 4FTUA 4D1SA 4EH5A 2Q0BA 5CAOA 3HV6A 3HP5A 1DI8A 3KRWA