3OCUA

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase mutant d66n complexed with nmn
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
247
structure length
247
Chain Sequence
EEHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLNETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein E
publication title Recognition of nucleoside monophosphate substrates by Haemophilus influenzae class C acid phosphatase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
total genus 95
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ocuA00
2FEAA 1QQ7A 2B0CA 5E0OA 1YV9A 3N5KA 1RPZA 2G1AA 3QUTA 3OCVA 1ZS9A 4YCNA 1IWOA 4XQ0A 3R9KA 4UMVA 5AM1A 3L7YA 5ALUA 5AKHA 3WK7A 2G06A 3WGUA 3S6JA 3W5BA 4DCCA 3W5CA 2YMPA 2JAUA 4PNHA 3MC1A 3U13A 1YNSA 2ZOSA 3QU9A 5ALPA 2Q4TA 5AIBA 3SD7A 1ZRMA 3NANA 2D2VA 3RFUA 1QQ6A 4UMDA 3QLEA 5AICA 4MUMA 1U2TA 1ZOLA 2PKEA 2W4MA 4JB3A 3EPRA 1VJ5A 2Q5EA 4L6AA 4Y3UA 2C8LA 5FP0A 1LTQA 3QUQA 2OM6A 5ALFA 5AKZA 4H1WA 5AI5A 1FEZA 4Y2TA 2OA0A 5AVXA 2R8EA 3OPXA 4HGRA 2FUEA 4UM5A 5AKYA 2WF6A 5ALRA 1F5SA 2JGAA 2G80A 1RQLA 3N28A 3OTQA 1Z4JA 2I7DA 1L7PA 4AS3A 2IOFK 4GIBA 1Z4OA 3TLMA 4UMFA 4BKMA 3L1VA 4FE3A 4G9BA 2ZBDA 2WF8A 3L8FA 3A1DA 4HGQA 2YY6A 3U26A 5AK6A 3QUBA 5AKKA 4B6JA 3ZVMA 5AK4A 5AI0A 2YMQA 3DNPA 4AP9A 4UU1A 2FPWA 2RARA 5AW4A 3WK8A 1TE2A 4KNWA 5AVVA 2P9JA 2ODAA 5AW9A 5AW6A 3DAOA 3ZWDA 2NYVA 1WPGA 5AVQA 4BEWA 4EX6A 2C8KA 1Z5GA 1WZCA 3L8GA 3SKYA 2WF7A 3QU4A 2ZBGA 4F71A 3QU7A 3B9RA 1NRWA 4YIHA 5IT4A 1U7OA 1ZD4A 5AM3A 4L6CA 1ZD5A 3I28A 4EEKA 3A1CA 4OCZA 3WK6A 1YDFA 5AIAA 4NAVA 2CN1A 1U7PA 2GHTA 2B8JA 3N07A 3ZTWA 3AR3A 1WVIA 4KNVA 1O03A 2JAWA 2VKQA 4CF4A 3ZVNA 5AW5A 1S2OA 4BEVA 2WFAA 1RRCA 2HHLA 4UU0A 3ET4A 1VFPA 1J8DA 1RLOA 3QUCA 4YIKA 5ALSA 3SMVA 1RKUA 3BA6A 2GFHA 3ESRA 2ZG6A 2R8XA 2GHQA 3KDPA 5AI8A 5AI6A 1WR8A 3E8MA 1MH9A 3FM9A 2AGVA 2I54A 2YMLA 3ZW7A 4BNDA 4Y2VA 2I33A 3NRJA 4OHFA 3QX7A 4C4RA 3OCZA 3J7TA 3ZI4A 5ALVA 3B8EA 2RBKA 3ZUPA 3R09A 2FUCA 4F72A 3I6BA 2G0AA 4YCMA 3AR7A 3QNMA 2B1QA 3ZVLA 4UATA 2CFTA 1RDFA 2MSNA 3WKEA 3MN1A 4BX2A 1T5SA 4EENA 4EZEA 2YBDA 5ALNA 2G08A 3PGLA 3QU5A 2BY4A 5AKEA 2WM8A 4HYTA 5ALQA 4QQFA 3L8HA 1RC8A 1JUDA 4HAIA 4ZEVA 2HCFA 2HEGA 5A3RA 3SHQA 2R8YA 4UAUA 3AR6A 5AKJA 1YJ5A 2CFSA 2MU1A 3MPOA 3OCWA 2FDRA 5ALIA 3AR4A 4RETA 3FPSA 2EATA 3IRUA 5AESA 3CNHA 2I34A 2NO4A 4BX0A 4Y2PA 2WHEA 5ALDA 3WKBA 3UMCA 4GXTA 3NIWA 3R4CA 4G63A 4RESA 1RMTA 2OYCA 4BYGA 4Y2JA 1YS9A 4OD0A 5AVRA 2C4NA 2BDEA 3MMZA 4BBJA 5ALKA 2YJ6A 4I9FA 4L57A 4I9GA 3SLRA 2O2XA 4EX7A 3U7EB 1X42A 4IFTA 2ZBEA 3ESQA 1QQ5A 2BDUA 4MWOA 3QU2A 1QH9A 4UW9A 4Y2XA 3OCYA 1L6RA 1XPJA 1J97A 1SWWA 2IA5A 2P69A 5ALOA 2YN4A 4YGYA 5ALMA 5AVTA 4IG4A 5AW7A 5IS2A 3E58A 3CZ4A 2HI0A 4YCLA 4UASA 5A3QA 1T5TA 4J03A 4NFLA 5ALYA 5AW2A 1RKQA 3QYPA 3ET5A 2EARA 2FPUA 4FFDA 1NF2A 2HF7A 5ALTA 5AM5A 5ALWA 4CF5A 1U2SA 2HOQA 3U7HB 2B82A 4Y2RA 3NASA 3U19A 1L8OA 1TA0A 4CNQA 4Y2UA 2FPXA 3EWIA 4Y2SA 1SU4A 2WF5A 3ZU6A 3AR2A 1CR6A 1ZD3A 2GMWA 4ZEXA 5AKGA 3B9BA 4XE5A 2QYHA 4NABA 2O9JA 1TJ5A 2DQSA 3L5KA 5A3SA 2W11A 1N8NA 1Z4PX 2RAVA 3L8EA 3IB6A 3FVVA 1XP5A 5AVZA 3KD3A 3KBBA 1Q91A 2PR7A 5ALXA 4UM7A 3EF0A 1RMQA 2HDOA 1U02A 2I6XA 4NV0A 1L7NA 3L0BA 3M9LA 4DW8A 2YJ4A 1RQNA 1Z4NA 1N9KA 2FPRA 3AR8A 4DFDA 2HX1A 5AK5A 4CE6A 5AM2A 4C4SA 1QYIA 1S8OA 2YFYA 1RKVA 1Z4QA 3QXGA 4YH1A 3WKAA 3ZX4A 1YMQA 3NUQA 1K1EA 3ZX5A 4Y2YA 3K1ZA 4J2TA 3QGMA 3L1UA 3KZXA 3L0YA 5AI9A 3W5AA 1CQZA 4C4TA 1RLMA 1XVIA 1Z4MA 1ZRNA 2OBBA 3DV9A 1Q92A 2IOHA 1EK1A 4DWOA 3UM9A 3HLTA 3WK9A 4NWIA 1Z88A 5AM0A 4QJBA 4E88A 2Q4RA 3ZWKA 2NO5A 2IYEA 3SF0A 3WKDA 2ZXEA 3M1YA 4EELA 4HGNA 1Z5UA 2I55A 3WK4A 3FPBA 1PW5A 5AI4A 2C9MA 4UMEA 2YJ3A 5AW8A 3OCXA 3UMBA 3E84A 2FI1A 1LVHA 3D6JA 2P11A 1Z4KA 3I76A 4KYTA 5AVYA 1ZJJA 5JJBA 4UARA 3E81A 3F9RA 4UAVA 2B30A 2YJ5A 2JAOA 5AW1A 5ALGA 1EK2A 2C88A 1AQ6A 2W43A 2IOFA 3NAMA 2GO7A 3OCUA 1RLTA 1Z4IA 4HGPA 5AVWA 5IT0A 3W5DA 5AM4A 4JDPA 3A1EA 1ZD2P 4ZEWA 3SKXA 1SWVA 2HF2A 1VJRA 5ALJA 1NNLA 2WF9A 5AKXA 3IJ5A 1RMYA 3UMGA 2AH5A 3KOOA 3EF1A 2B8EA 3N1UA 5AVSA 2QLTA 3RF6A 3U7FB 2YMMA 4CF3A 5AK3A 3PCTA 5ALLA 2RB5A 3AR9A 4XOUA 2G09A 1Y8AA 3I1YA 5AW0A 4KN8A 4XPZA 4BNDB 1O08A 3ONNA 3GYGA 5ALHA 3FZQA 2CFRA 4KX3A 2P27A 2FPSA 5AHXA 3ZTYA 1Z4LA 3VAYA 4AS2A 3WGVA 5AVUA 3PGVA 2JARA 1TJ3A 2AMYA 3HYCA 4HGOA 3WK5A 5T41A 2R8ZA 2EAUA 2HSZA 5ALZA 2G07A 3BWVA 1L7OA 2ZBFA 2X4DA 3A3YA 3KC2A 4BX3A 3NALA 2PQ0A 3WKCA 4Y2QA 1KYTA 2B1RA 4OFZA 3PDWA 4KX5A 4FYPA 2AUTA 3L0CA 5AKLA 1L7MA 3U7GA 1L8LA 3AR5A 3N8GA 1T9ZA 3FGOA 5AKIA 3DDHA 1TJ4A 3ED5A 5ALEA 5AW3A 3P96A 4O8CA 2HO4A
chains in the Genus database with same CATH superfamily
3WZ2A 3BXGA 4FW8A 1MT0A 4QSHA 2OE2A 2V7BA 1KF0A 2VYVA 2WDZA 4UEJA 2G1AA 4ZAWA 1JR2A 4HKTA 4KK3A 2B20A 5EKUA 5KYNA 1B8PA 5F1YA 3WLFA 3OCVA 2R66A 3BHJA 4TTPA 4RK6A 5LUAA 3CC8A 1M2WA 5C1IA 2PS9A 3TTXA 4E09A 1K8ZB 3RKUA 1I13A 1JG2A 1TO6A 5LR6A 1TJYA 2B7BA 1TCCA 3EC7A 2NUTB 4TTSA 3STHA 1W88A 3F3SA 4F92B 3J80A 5HM8A 1TT7A 3U56A 4IIBA 4HWSA 3W5BA 3TLCA 5D1NA 1EP1B 4WERA 1Q6YA 4BTVA 3WGKA 1E18A 3MIIA 1EVJA 2CXHA 1O4WA 3VJRA 2YKGA 2FCAA 2X2EA 4OQLA 4Y2HA 2GF0A 2OQIA 4EVIA 3NHLA 1QKJA 1A9RA 3BJMA 5JI3E 2AZMA 1Z6AA 2GEDA 4UMDA 5FLKA 4YUYA 1U8AA 3GLIE 1B6GA 1XTKA 4MVJE 3G13A 3G2OA 1A1SA 5JAPA 3ABZA 1MAUA 4JENA 3T99A 2CMDA 5F5NA 4YA6A 1Z5NA 3IUQA 2PQ2A 3THYB 1M10A 3FPEA 4YPVA 3ZD9A 4PW0A 4ZPXA 1FJHA 2DUJA 2ODQA 2A1UA 3TEJA 3BS4A 4PINA 4RZHA 3UB2A 3B1JA 4D3SA 4FHGA 4ILKA 4REQB 3I53A 2YYAA 2AVNA 2Y1DA 5EXPA 2IXFA 4IDNA 5A1TA 3WISA 5IASA 4NV3A 3F3KA 1O0SA 2NU9B 3OM9A 2IYZA 3UT5B 1THGA 5ICGA 5K3DA 3OCCA 4RNCA 4JA2A 1E89A 1FFAA 2QI9F 4BMOB 1LTHR 1NOJA 3L7KA 5BR7A 4P6VF 3TN7A 3TH5A 2V9ZA 2WICA 2A67A 3N8HA 5ELMA 4WL0A 3USZA 3ZWAA 3PCRB 3TLKA 4HEJA 1N2IA 3ROPA 1E7SA 2KE5A 3Q3JB 5DPMA 2AK2A 4U9UA 2QM3A 2X7HA 1B6TA 1QF7A 4NK5A 3BK1A 1E58A 3EJ6A 1H6DA 1NI4A 5KTTA 3IKJA 3VNQA 3G23A 3GG2A 2GVNA 3BHNA 3E18A 4YAFA 3ZDZB 1XEAA 1YQXA 2PZLA 1W93A 3R3VA 3U26A 5DSZA 4HAUA 4ARVA 2PFSA 2LW7A 2JFFA 2Y0EA 1FQKA 2ZWMA 5JE8A 2F3TA 3ASYA 3U4QA 5K0SA 1YFJA 2AOTA 2JI8A 4P22A 3I34X 4CDRA 4YALA 1V7QA 5F3WB 3G49A 1QCCA 4TL6A 5B1EA 3GD5A 1DADA 4M1YA 1ZM3A 2VPTA 5EZSA 3T1NA 3ZWDA 4TMFA 2BBTA 2QRPA 4M6WB 4PTLA 5JAQA 4ZZ0A 1HDZA 3Q8MA 1XJQA 3LX6A 3QVJA 1EINA 1D1SA 4M55A 4NU6A 4MQEA 1ZISA 1GD1O 3HR4A 4TWAA 5CHYA 3WYDA 1GNLA 1BD4A 1SB9A 4OLHA 2HWWA 2RCNA 1E7QA 3DMNA 2ZAGA 5LB4A 3CY6A 1V7CA 1BGVA 1U7OA 2PVSA 1XTSA 4EI7A 1DCTA 1W35A 5IMSA 5CEJA 3WL6A 4NBRA 4H7PA 5IVIA 5MN4A 1VCIA 3CE9A 4JX8A 3ROQA 3RWOA 4BNGA 4CDNA 3L8MA 1GAQA 1PHPA 3PCXA 1RJDA 3RFFA 4EPTA 3IA2A 3IP8A 2VH5R 4MGZR 3B3JA 3WMWA 3CS3A 2QT0A 4KN9S 3TLZA 1KKMA 2YHAA 2BFPA 3N07A 2ZJ8A 3IAHA 4C4ZA 1UK6A 3DOIA 1C14A 3WV5A 3ANYB 1KJ8A 2F62A 4IXDA 3RM3A 3WV4A 1OF1A 2PWYA 3S2GA 3LSTA 4AZ3A 3C3MA 2I2AA 1RLOA 1W5BA 5IX8A 3RSOA 1AKEA 2I99A 3ZW8A 1MX9A 3K9NA 4A03A 7MHTA 4CQMB 1Q6ZA 2H1RA 4W8GA 3M3HA 4LDNA 5DEOA 5F7ZA 3LXMA 1ZGCA 4DLUA 4O4IA 2ZUSA 5KX5F 5LM3A 5HP4A 4YRCA 2GOYA 2P4EA 3E8MA 3FM9A 3MRXA 2XNSA 2A1IA 1TVCA 3GJ8A 4KR2A 4K26A 1W5AA 2ALJA 2Z95A 1D4FA 1RQPA 1AXEA 1GEGA 3TQSA 4L5IA 3RYCB 4ZDKA 3MSCA 1FVOA 5LPNA 3RR2A 1XK6A 3EIHA 4FPXA 4RHFA 4DUZB 2OCDA 5BNWA 4S04A 2AUMA 4FQ7A 1WMAA 4I14A 3ZTTA 2ZPTX 1SXPA 4LI3X 3EFOA 5KHLB 3U6KA 2FRDA 4B3XA 2ZRBA 1BN6A 3L7JA 4GPTA 4UCQA 3AR7A 3RUCA 1VPDA 1OLSB 1EXNA 3DP9A 1RZ3A 1S8NA 2O0MA 1FFEA 4PIPA 3SX2A 3DZKA 4W1QA 5IG2A 2QTCA 2QVXX 3KTFA 3LKVA 5IAKA 2QP9X 4QWMA 4CI0B 1JGTA 1YR6A 2C82A 2WHQA 4BRWA 2ZQYA 4F8YA 4DHWA 3RW9A 4G8DA 4RQUA 5DTMA 4BX2A 1HX7A 1DFIA 2WFMA 3PE6A 4NQRA 1C9JA 1AA9A 2EW2A 2H2FA 2IZOA 2J7PA 2YBDA 3IDZA 4YUVA 3TI9A 4DYHA 1J1IA 1FMJA 1IEQA 1EDZA 3HA5A 3KEMA 3DLPX 3N87A 4PYIA 5HRCA 2OHFA 4QUEA 4BZWA 2GN1A 2RAPA 3UWPA 2VSQA 1Z6TA 2B61A 1GAJA 1YRHA 3JQGB 3N0WA 3DEFA 3GLRA 4GI7A 2CNWD 3FB1A 5CB4A 2CV2A 4I1OA 5DLPA 5EINA 3BTUA 3EDOA 1G3IA 3FG9A 3L0IB 2GSWA 1VL2A 1GHTA 5LOVB 4O02B 3NC4A 2YHIB 1GYRA 2OV3A 2Z6AA 1XZPA 3LPCA 2WJZB 2RH8A 2O2DA 2HDNB 3K5WA 4XW2A 4LNUA 3B36A 4I2VA 3OQHA 2COUA 3HKEB 5LQSA 3QE2A 3ZQ4A 3SZUA 5CDSA 4B82A 1K06A 2C2ZA 1MOZA 2QDKA 3PNVA 4MUNA 1ODSA 4CTNA 3NVKI 1ONBA 1CBUA 1UEJA 2HRQA 2BHNA 2I1WA 2QE6A 3LVFO 3OQJA 3WIBA 4AKTA 3KHUA 5DTEA 2X41A 3I6YA 1JFSA 2IU0A 1R0XA 3ZXSA 4YJGA 3IVGA 1XLVA 3DOOA 1JNXX 1XCLA 2W2OA 3PQ6A 5EMLA 3J81k 2H18A 3NIDB 3OKAA 3PQ7A 1MJNA 4DKXA 1U99A 4GYYA 3ZI0A 2D4AA 5ER6A 3PTZA 3F7TA 3PEWA 5JVDA 1WIWA 3NTLA 2YZNA 3WB9A 1WF6A 1OB2A 2BHSA 1D8TA 4DG8A 2I3GA 2D2EA 1ISFA 1SRRA 2Z04A 5DGHA 6CHYA 2D2XA 3NDRA 1RPTA 2HMWA 3VBCA 2OAP1 1N5MA 2PTHA 2ZIWB 2UUCB 4ARUA 2ZBEA 4RVFA 2R79A 2EXXA 1ZWLA 3N39C 1E7MA 3RI3A 3ZY3A 4DV4B 1U9ZA 3CRQA 1I4LD 3HCBA 4HNQA 3E8SA 3C98A 1L6RA 1BCSB 2WMDA 1FFBA 3HDYA 4S1NA 1J97A 2EZ4A 3I32A 4KI7A 3GC6A 5ALOA 1ZCAA 5TJ9A 5CAEA 4ZYTA 2PMDA 4Q93A 3WLEA 3ZLUA 1LBTA 4BNYA 1UKZA 4NFLA 1IXYA 2ZI4A 3N8DA 1RI4A 4RAQA 4TKVA 2WAAA 1ZNXA 3FHOA 4FFRA 3TK1A 4BJ1A 1BDBA 1P8JA 3T9DA 5JJKA 2VDMB 1WP4A 4QU9A 5GOZA 1XCJA 3T1QA 1QC5A 1NXXA 1OUMA 3KAQA 3EAFA 2X14A 1HE8B 3D4NA 4I4TF 2CXQA 3VJLA 3HZHA 5AVKA 1PG0A 1A9QA 1PS8A 2J46A 3GELA 3PB3A 3ZWWA 3OX1A 4C0SA 1KDOA 3AY6A 5EWLA 1VIDA 1QM5A 4BBZA 3T5PA 3GVPA 4MS4B 5EHZA 1KXZA 3FSEA 4A3SA 3W5JA 2E4WA 3ENKA 1V95A 3P45A 1THTA 1Z0FA 2ZIZA 5LYJB 5AUPB 2HIAA 3MELA 5FA5A 4PRYA 4UFOA 1G6Q1 1F1BA 1Y7IA 4RBNA 3FA2A 1MAAA 2AN1A 1GQSA 3QZUA 4E33A 5E9WA 1NT2A 1Z68A 3VPFA 1CB7A 4RZ2A 2BDTA 2W11A 3LL7A 4PLCA 4PXYA 1IJBA 1XAJA 2XQJA 3AXTA 5KYUB 4O2BA 1QZUA 1FLAA 2BGMA 5B1YA 3H9CA 3PEYA 3VYVA 2VKTA 3QVMA 1I4EB 1U1CA 1H2RS 1W0CA 2BGJA 1C80A 1UMBA 3C24A 4MGYR 2WIJA 4NV0A 1UDWA 3RAGA 3X44A 1IZ9A 4HGZA 4Z3OA 1TW3A 3PQEA 4RW0A 5DKFA 1LI5A 1NTOA 4R98A 5JMTA 3IFSA 3QI7A 3SCZA 1CE8B 1V8ZA 1FRQA 2J5KA 3K4PA 4JSRA 3WFZA 2FHSA 3LC7O 1O7JA 1Q0PA 2B21A 3NLLA 1NNEA 5K2OA 3IALA 1KIMA 1XO1A 2W8BB 3WMRA 4BRSA 1YC2A 4C04A 3EULA 4L8FA 5FDFA 4AQ7A 3U3OA 3ENWA 3ZJ5A 5JQGA 2I3AA 1FFWA 2Q4DA 4DSZA 3L0ZA 4ENSA 3WKAA 4DM4A 2XMBA 3C7DB 5F5XA 3EPKA 2AOWA 2ZXFA 3PSAA 2R00A 1WETA 3M6UA 3D3QA 4Y1EA 1NC3A 4DCGA 5AUOB 5DHFA 5C8YF 1N1MA 4K9LA 4D44A 2FMKA 3CO0S 2X5XA 4BZXA 1FNMA 3IEUA 4XUCA 5E1MA 2HJSA 1UC4B 3OOJA 5LZ5A 2Z09A 1OX5A 3FSJX 4CQLA 1A04A 2DFKB 3M4ZA 5C7YA 2W71A 3DXFA 3IPYA 3KP1A 2A58A 2J3JA 4JC4A 4PE5B 3LTNC 1QUFA 2PA0A 1AZWA 1HM5A 5JO0A 1EVQA 3R7DA 1ICEA 1IEXA 3QF7A 4QUGA 1JQAA 1UK9A 1VDZA 2AR7A 5WRFA 3UC5A 4D4GA 4EA7A 2VDRB 1ATIA 2ZSHA 1I3LA 1H6AA 1IY2A 1F8GA 1HYEA 4JBLA 4E30A 1KY5A 3PXBA 3I6ZA 3B7WA 2EC5A 2GESA 5DCUA 1PR2A 3ZK7A 3E3NA 1JILA 4H6XA 4BFSA 2WABA 2C4WA 2IEAA 4G67A 3CCBA 4J0GA 2XTZA 3FMPB 1K7EB 3NWOA 3PITA 1Y7TA 4JQYA 4PR3A 3R7NA 1D03A 2IU4A 1GA4A 4ZC8A 4U2CA 4RA9B 4KQ9A 1PSZA 2PV0A 4AF8A 3QLVA 3E81A 5BV1A 3F9RA 2D1TA 4MINA 3SFVA 1EK2A 4L4ZA 3W1EA 4FILA 1EWRA 2OMEA 1YUNA 3HJCA 2W43A 1AX9A 2OHJA 3KKMA 5HF6A 4LW8A 5PNTA 1TAHA 4HMOA 1P1KA 5AVWA 3EMDA 5KIAA 2RONA 3UKDA 1SFRA 1YS1X 4EJ6A 1M1UA 2OHHA 3A1EA 3W6ZA 1FX1A 1QFZA 2H4HA 2R84A 4LECA 3UMMA 1QV6A 3N76A 3QM1A 4JQCA 4ZEWA 2ACEA 1QF6A 3QYJA 4MX8A 1TIKA 1E9DA 1ADYA 2GHRA 1J2TA 5ALJA 3U3DA 3I58A 2D5BA 2Z5GA 3BSFA 1CUDA 3G2JA 3I9V6 3EXAA 4QDTA 3KWMA 1PE0A 3BMOA 1Z08A 1RMYA 1U3TA 4OO3A 2GF2A 2FF7A 4MWTA 5D85A 5BQFA 4E07A 4MWEA 2AH5A 3HDQA 1DEOA 4Q3CA 5JSQA 3QW2A 3OTGA 3BBPA 3EVFA 5P21A 2ZB8A 3OY7A 2FLKA 3OE1A 2HRZA 3DEYX 3U7FB 1OLOA 2YMMA 2W6QA 4DC1A 2QJRA 5JC1A 3C15C 1MT3A 2QQFA 3ETDA 5ESWA 3NTXA 2OHXA 2I67A 1NA5A 1VLLA 2B2CA 3OOWA 1GY8A 2CJWB 1TYEB 4FT4A 3HEMA 4BNDB 2DQZA 3GGGA 3F8TA 3UFXA 5EJEA 3VA7A 4NYMR 4L8GA 1NX9A 1USVA 1NUTA 2PBRA 4RTNA 2V7UA 1KERA 3PHGA 2BKLA 4ATNA 5TQ0B 2V6BA 5AHXA 3PS9A 1OBFO 2IHVA 5HG0A 3RIXA 2V4ZA 4WIAA 3TM4A 4BNMA 3CH5A 3LQ1A 2C5BA 1WZEA 3PGVA 5ER9A 2G6BA 3NC1C 3W3AD 4CEJA 5I8ZA 4DIEA 4L74A 4LZAA 4XGRA 3LUFA 4TRRA 2BPOA 3WK5A 1G1MA 4UHEA 4QAQA 1JP7A 2GBCA 2IGTA 3L04A 4IRXA 2HSZA 5FFNA 4AULA 3BWVA 3UTDA 4QZVA 4PG8A 4UU8A 2WFLB 3JQ9C 3WYGA 4JUBA 4MMXB 1O9HA 1BDHA 4K6FA 4EEXA 4WOPA 4HNAB 4RO0A 3OZTA 4G1VA 3H0CA 1C3EA 5D6NA 5B4VA 3WWPA 2P7HA 3T3PB 3ZLTA 4TLCA 2ODNA 2HBRA 3BYZA 2P67A 5DHAA 1WNTA 1XCBA 2ZI6A 4QHSA 4EW3A 2OZEA 3FHCB 2JCBA 3GMSA 3KJGA 5GIOE 3GLFA 3ZCUA 1Z45A 4RFVA 3BT7A 3WGLA 1HSOA 4GX2A 4CKXA 1XZMA 3PX2A 1OD6A 3MGGA 4NYIR 4FKZA 5MHTA 1NVFA 1FPQA 4W5HA 2FX2A 2ZDQA 4JJZA 3OZXA 5KYYB 4HDMA 3KVVA 1DHRA 1A3CA 1ETHA 1Q1QA 1EGHA 2HO4A 1U7UA 2LD4A 4H17A 1HDOA 4QOSA 5EHGA 4R3UC 1TT5A 5EN4A 3WMGA 3PE4A 3W78A 1NR5A 5K0EA 2WJVA 2Z1DA 3RJ9A 2HF9A 5TEWA 1T25A 4DLKA 1TI7A 3DLTA 4LYHA 2DFLA 4ALNA 1AUOA 1O96B 3WL8A 4XDYA 4C01A 2JH8A 4AI6A 1E77A 3T3OA 3VNBA 3DBRB 3QPBA 2PHZA 1U3UA 1WJGA 1P18A 3T4PA 3WK7A 2OCIA 1YU9A 3LT1A 3KQSA 5DNDA 5FEMA 4AJEA 5IJ9A 1PIWA 1ZK2A 3V1YA 3W5CA 2DQ4A 5FD8A 2R5FA 3OWHA 2ZM6B 5KDDA 1KY2A 1V6SA 2JVKA 4MW5A 2QX9A 3KUXA 2HMVA 1KZ9A 1R0CA 1EFUA 1QP8A 2XVXA 4EGJA 5FL3A 2MOKA 2CUTA 2XB6A 4WV3A 1HNZB 3GJ4A 3RFUA 4Q4LA 2VF4X 3UQZA 3AONB 2E18A 3NTQA 3AETA 3LOQA 4GL4A 4J76A 4JNCA 1RJ9A 1P80A 3BN3A 2Y1EA 3D0OA 1JKJA 1QLWA 2KWIA 4O4IF 2Q5HA 3CCCA 4CFYA 1Z18A 3KFXA 1MAHA 1R6AA 3CF4G 1SHZA 4JB3A 2JLSA 2VBCA 4B48A 5LLDA 3O4RA 2AFIA 3H17A 2ODWA 2RK6A 5H81A 4C5BA 1YR7A 4QPPA 2FW8A 1SVLA 2RHGB 3BX1A 5AKZA 1QRDA 2UYCA 1XAIA 3G1WA 5D7BA 2GVZC 4W99A 2R2AA 1OV6A 4E14A 5K8UA 3CB4A 1U2QA 4CU2A 4KN6A 3V4OA 4MP6A 3TE7A 4I0WB 1G4HA 2EYQA 4ESOA 2FUEA 4QKQA 3HPQA 3SVLA 4B74A 2BEVA 1NLMA 2ZS8A 4K46A 1PJ3A 3QKTA 2AN5A 3AY3A 3GEGA 1I1NA 4JJAA 3AG5A 4Y7CA 5AXAA 5B1DA 1XA3A 5ITZB 4MWGA 4OQ4A 1YDHA 2H29A 1H2FA 1KBZA 1BXKA 1P0QA 3ONWA 1S3FA 4IJQA 3T4UA 4XFDA 4XTRA 3BF8A 4LKOA 2ADMA 4IH4A 4EI9A 4EVSA 1XQ1A 1K86A 1VE1A 4JVNA 5EHIA 4U2FA 5DFAA 3Q88A 3T95A 1J2JA 3PXEA 1P0CA 4YQYA 1SK9A 1MUUA 4Y0VA 3G88A 4CM9A 2NP7A 3E3AA 1O1YA 1G5QA 5K3CA 5D3MB 5CB4F 2DWOA 1RADA 2EFEB 2OP0A 2CUKA 1J9EA 3DE6X 2GBIA 3ID6C 4CL0A 1FUKA 2P9YA 3ASUA 3T6KA 1PQ4A 3L3BA 2ZFUA 3S2UA 3LJKA 1P1BA 3WK8A 3TQOA 1T4MA 4NV1A 3AM5A 3C74A 1RWXA 4Q7JB 2ATIA 2TMKA 2J07A 2A5LA 1GXSA 2BSQA 1MW8X 1X7HA 3OEWA 2RGGA 2NYVA 3OIGA 1OCEA 5THXA 3LX4A 2YUTA 4JLNA 3HBFA 1WPGA 3ZCPA 4BJ6A 1BXRA 2E55A 1XDZA 3PXXA 4TVBA 2Q6OA 2QQ5A 2BR4A 1Z5GA 4L4UA 4ETIA 3D1LA 2H52A 3BE5A 5BQXA 2ZZNA 3H99A 4CCWA 1J0BA 3P20A 1JJ7A 3B2NA 1O2DA 1N2HA 3B9RA 1NRWA 5FPPA 3ZN2A 1CRLA 5JXHA 1B15A 4ND3A 4U8HA 1GTZA 2CMHA 4HXGA 1UBNA 2Q50A 4P4GA 1XZCA 5DP2A 5BQ5A 4A8TA 3C16C 2P3OA 5JVDF 5LVAA 1ES9A 2GSDA 3EE6A 4DCUA 1DAGA 4KAFA 5E7IA 4BQNA 5GINE 2D59A 2VXBA 3N8IA 4C14A 3X3HA 3NZEA 1UEXC 1WG8A 4BEBA 1NF3A 3LBHA 1TJNA 3R77A 4JYCA 2QS9A 4NAVA 1QFSA 2GH1A 2V6IA 3IO3A 1FJGB 3MA0A 2CCJA 2BUCA 2W6MA 2XUIA 1O94D 5H5JA 2GBLA 3CLVA 2NTEA 4XA8A 1H42A 1OXSC 2EWVA 4MCJA 3VV2A 2K7ZA 4NZNA 6REQB 1Y5NA 3JALB 5K0JA 2JGMA 2QL9A 3EVZA 2XMPA 4GO1A 1TRHA 5E6SB 3BE8A 1M1YB 2FX3A 2OBNA 3KHTA 2W2MA 4PLYA 2WQZA 4CLRA 3FNHA 1P9RA 2R85A 3L06A 1R5BA 3K9CA 1IOZA 1UKAA 3ZU5A 2PLWA 2PX5A 3CLRD 1HPLA 4WKNA 2JJ8A 1ZH0A 2F3PA 2GHQA 1HOTA 4RPGA 3W1WA 2VDWB 2OG2A 4WNCA 1QHYA 1X92A 2F1JA 3GNTA 4CKYA 4EG8A 5BN4A 2X3UA 5E9JA 5EQFA 3F6EX 4R8RA 1AVTA 4Y2VA 3CNLA 1T8WA 1V5IA 1YZQA 4FI3C 4R7TA 4Z1MD 4NBTA 3VVBA 5FUQA 4J2HA 1BJTA 1DFGA 4OH1A 1EXVA 3J7TA 4CODB 1Y33E 4JYAB 1W581 2R96A 3CF2A 3DAHA 4RSMA 3UO8B 3UV6A 3CR7A 1M2VA 1GFZA 1C0EA 4FDUA 4CIBA 2GZAA 1DAHA 2XAUA 3HR8A 3T3GA 2EX4A 2WINI 3V7YA 1C0PA 5I01A 3OP4A 4B2LA 3WGQA 4AZSA 4CHTA 5ES4B 2G6TA 3NYWA 2GTHA 1SQGA 3PF9A 2PD3A 3KR0A 4RZUA 3DT8A 1EK6A 1P7YA 1OWPA 4KXYA 4MULA 3I9LA 1ZI6A 3QI2A 5E3JA 2A84A 5JHHB 1JW9B 1RBMA 4G24A 1PJSA 1BH6A 1MO4A 2V55B 4PHCA 5EVCA 3WGYA 4DGSA 5BUCA 3KSBC 2ZZMA 1Y7HA 3PK0A 2EGHA 4O2BF 3NTRA 1ESEA 3OM1A 5EEGA 4ADSG 4ZJUA 1RC8A 4AF7A 2QMZA 1XBTA 1I3MA 5FB3A 1XX6A 4H3SA 1HXHA 3S55A 3HVRA 2H1OA 4I2NA 5B30A 2EFDB 2ACKA 3GGCA 2J7KA 4ZDIA 1CZLA 5AKJA 3ZWPA 3CEAA 1GKKA 2EEPA 5DTRA 4I5FA 3K0HA 3PQ5A 1CERA 1P1CA 3E22A 3OHMA 2QZ4A 4NFHA 1WPRA 4US0R 5KC9A 4ND4A 2JLUA 1J22A 3GO4A 4QUAA 4AK9A 5B5SA 4L07A 5T3YA 2PZFA 5G1OA 1E9EA 5JQGF 2HLDA 5ANRB 2BF7A 3ODPA 1U0TA 4GXTA 3RVNA 3R4CA 1DKPA 1FFXB 4NR0A 3IP7A 1QHHA 5HZGA 2C9CA 2H7VA 1JIUA 2HPAA 4GMGA 2N1BA 1MVOA 2OY0A 4R2LA 4X8LA 4PHGA 1NF8A 1USIA 4DDKA 1Q5PA 2UUPA 3P8ZA 2AN3A 2JFBA 4KIJA 3N3BC 4OK5A 3V8VA 1IOVA 3LLVA 4NAUA 2NUTA 2AVDA 2FOXA 4F3CA 1YFKA 5CTJA 3C4QA 4C1NA 3C8MA 1AQJA 3TKAA 4R83A 2IX3A 1GUFA 2C7GA 4QC2A 3VH1A 2XYPA 3U7EB 5IF3A 3P2IA 2Z0MA 4ZN6A 1HE1C 3QKRB 4NKRA 4S0XA 3MNFA 1TZKA 2BJVA 2PQ6A 2YXPX 1XFDA 3G82C 3WYCA 3QHAA 3BIOA 3IVMA 2XKBA 4P1ZA 5F77A 3EBLA 2OSVA 4X8HA 3Q7RA 4MWZA 2CLDX 4MW0A 2ZBUA 5A3QA 1PDVA 3J81A 4PGMA 2R8PA 4PGFA 3HO1A 3GGOA 1P17A 2A88A 2QSYA 4DLNA 2IP2A 3KE8A 2FPUA 4RV5A 5TE9A 4ZZIA 4RXUA 1NN5A 1Z13A 4UUNA 4TT8A 4EKIA 3GAMA 4MIOA 1RWNA 2ROQA 1V7ZA 1GITA 1JQDA 1OGIA 2O7RA 2JJ2A 4REQA 3VKVA 4CF5A 1BE6A 1UAYA 4PYQA 1ZUHA 4F9TA 2V6GA 2EGUA 1I1QB 4FINA 4MHOA 1LUAA 3MFYA 1GTMA 5ERGB 1B0UA 1X15A 4YMGA 4LWPA 2QX7A 2HM7A 5DJ5A 2QP3A 2ZT7A 3AF6A 1H5UA 3FDJA 4OLFA 1L5YA 1PFUA 3C5VA 4QT4A 4B7ZA 3GHHA 5HKKA 3NWBA 2QRGA 1MW9X 1XQYA 1JZQA 4OHKA 4ZYLA 4JXZA 3BRSA 5CVVA 5C81A 1E2NA 5FOSA 3HXKA 3RE1A 2DWPA 2P0EA 3DTYA 4FFBB 4TTAA 4OXQA 2ZK7A 5CMLA 1HE2A 5JJCA 3UAGA 3MJEA 3SC6A 1R9JA 1QONA 4GMKA 1YZGA 3OA0A 4JB0A 1Y8CA 2O9JA 2GCNA 2V5UA 2AMJA 3SZGA 3JQ6A 1PYOA 1ZM7A 4GF5A 3JWHA 4C20A 1A71A 3D6NB 2PS3A 4UJ3A 1LXCA 3BC1A 2QRJA 3RVRA 3KBBA 3SS9X 2O0JA 3DE5X 3L7IA 3BWXA 1AV6A 4XVQA 1QB7A 4I8DA 2BHTA 3K0BA 4KQ2A 1GPBA 3EBPA 3RYTC 1NR1A 1PT6A 3H42B 3UATA 4UHBA 1Z4NA 5C1DA 2XXBA 3AR8A 4M6WA 3RANA 3MK31 1LH0A 1QORA 2VDLB 4AX4A 3E2MA 4QDZA 3G0DA 4R69A 3ICQB 1PNOA 3NXKA 2GETA 3N2YA 1BW9B 3CH7A 1WSAA 1ZJ6A 2RH4A 2ZVJA 4HADA 4HY3A 4B17A 2UZAA 1S8OA 1R6UA 5SYMA 3BK2A 3TXXA 2Z8ZA 5JJIA 3FNBA 3DOHA 3IPAA 3SYNA 1FMCA 1DPGA 1O97C 5AHRA 5SYAA 6NULA 2VQ6A 2OWDA 1O8CA 2C7VA 1L4FA 1ARZA 2GCOB 3IUYA 3QE3A 4PGHA 2YWGA 5A02A 4XWYA 3ORHA 1FNCA 3FCSB 1K7YA 3H18A 4WTOA 1OOEA 1GLGA 2G9UA 5L53A 3R3UA 5CT5A 1DEHA 1W94A 1HLDA 3BSSA 2R7LA 3OF3A 4UVGA 3WGJA 1PU2A 2DUUA 2X2OA 3OJ0A 3H5TA 1UUFA 4YLEA 5JNSA 2Y2VA 2GERA 3AFGA 2HAEA 3KDSE 1J0DA 2V8OA 2ONCA 1E3EA 2OV6A 1B4DA 2VP6A 3A04A 1DRJA 3CUWA 3RC1A 3VSBA 4HDSA 2X40A 4JKIA 3CKMA 5CVEA 3FF1A 4HYEA 1TNDA 4HQ6A 4DRYA 2CXTA 1N34B 2D1YA 2EIXA 4MVJD 2OHIA 3B85A 3S99A 4YBRA 4Z7OB 5DCLA 2XTNA 2LRHA 1L7EA 3H1AA 4UBMA 4QTZA 2PS0A 5ABPA 2XB4A 5CDHA 3N7AA 4KLAA 4R1TA 4H4CA 4I7EA 3D6FA 2Q4OA 2H0RA 5LLTA 3TVDA 1NVUQ 1ZL2A 1EXMA 1O87A 2VPWA 1HFKA 2MMGA 4I50A 3UMBA 3OPNA 3QBTA 2JEYA 4M0LA 4PAOA 2X8WA 3FUWA 2PZJA 4RDHA 4TLLB 4HNUA 4R7GA 1QIJA 4OHMA 2QPLA 2H07A 4R1SA 3D6JA 3IPRA 5KB3A 5KS2A 3RYCA 1A27A 1NQUA 2M6KA 4OGFA 5F2OA 4CLEA 3OFVA 3QELB 1BX3A 3DMTC 5K0BA 1PK8A 1C41A 3GJ6A 5IAOA 3F6BX 3VX3A 4BGDA 2C7QA 2FZ4A 2WTXA 4TUYB 3RTAA 1DDGA 2YS6A 3G3EA 5TGDA 4JI6B 4DCJA 5IFLA 3D6UA 2E85A 3AEKB 3IOMA 1BMFD 3B78A 4N7RA 2VH1A 2AD5A 1F4VA 1D9ZA 4BFTA 2JCXA 4L3VA 4ZANA 1MMFB 3EODA 2FF5A 2EQAA 1M34E 1XGKA 2FX5A 3F5QA 3KB2A 5H3HA 2PZGA 1KZ7B 2QN8A 4FCWA 5C5IA 1OE0A 2XBUA 3QVKA 3ECSA 3GLTA 3FSGD 2ZYTX 3KKQA 1VPWA 3UMGA 1BYUA 3TSYA 3JQGA 1XL0A 3ABIA 1XLWA 2H51A 5BN3A 3DE1X 4R3WA 2F7SA 2WSSD 2GAAA 1SCNE 3D7KA 3KUUA 3QOYA 4OPMA 4LHYA 3KPYA 2AZDA 1J23A 4TTQA 1WCYA 5LOVA 3R9WA 2YHIA 4P3KA 2EHJA 2NZVG 5DTJA 2XZOA 5I47A 1RR6A 3KKOA 5E6UB 1HTWA 2QXUA 4HJRA 3EH2A 1FSSA 5SY9A 1PX0A 2P9ZA 4QGHA 3OLZA 4BLOA 1DKNA 1E6EA 1VJ0A 2Z58A 2P27A 4L95C 4UPVA 2XLCA 3QQPA 2QMOA 4RWEA 2NZUG 1I0ZA 3DW3X 4ZT6A 2VYQA 1DOZA 4M53A 3VZBA 3GMIA 1P6XA 3OZFA 1XMIA 3MG9A 1Z75A 4NJEB 4Z9YA 1YSCA 2AMYA 1XCGB 2DYKA 2VNJA 4HB4A 4HGOA 4I55B 4M1TA 2QA5A 3DXYA 3FBGA 4CIXA 5B3AA 2BMFA 3MHTA 2QM0A 4YX9A 2O2JA 3GJ5A 1V11B 2V4MA 4L3WA 2ZSBA 1OWMA 4GBJA 2R68A 3RU3A 5L4NA 4KG7A 2Z83A 4LVNA 2FN8A 3P9RA 5TC4A 1HGXA 2LPMA 4D2IA 4MQFB 5BWLA 1P5ZB 3LY5A 4YUWA 4QQKA 3L0OA 4EPVA 4TWBA 1BCSA 3N2ZB 2NSYA 2GRUA 3E27A 1I7QB 2BHLA 4ZO9A 1IUPA 2AE2A 2WIKA 121PA 4IMJB 1Z2DA 2ST1A 2BGLA 3PDWA 4NZPA 4B9AA 2WYWA 1BIFA 2WYUA 2PX4A 2BM0A 4WXRA 1A8QA 2F8TA 1WP9A 4YRBA 4XCXA 3VYSB 1WCIA 1B6SA 3TS1A 2XMQA 4R0VA 4AXBA 1N78A 2JGDA 1MTOA 3FGOA 4ME6A 5AKIA 2GUWA 2R4UA 1JHMA 1P0IA 4BUJA 1FXWA 3F6RA 5FAXA 1Z07A 4RNDB 1PFWA 4YJFA 3PWKA 5HUQA 1MNQA 4QPJC 5EJAA 2WRZA 3N5KA 5DK6A 3RVSA 5LYYA 1TECE 1K27A 1ZN9A 4GMDA 2VSYA 4HLDA 4XCQA 2BTOA 1IVYA 2GO1A 4H7FA 4JLAA 4LUCA 4UAGA 2HMYB 2HT1A 4MS4A 4TOIA 4BKQA 3IE2A 5CK4A 1U4OA 3L2OB 2VYNA 3OLXA 4LHZA 1NLZA 2ZSJA 3LNCA 2ACVA 4P4SB 5AKHA 5B1SA 3B51X 5LYJA 1ULAA 4F3NA 1SUBA 3MBIA 3R24A 2GN6A 1C7JA 1BHSA 3A11A 5DBIA 4RDXA 1DMSA 3V4PB 1PEAA 2XCSB 1DL5A 2V74B 3KR1A 3QOFA 3QU9A 3QLTA 1NJSA 3KALA 2OV2A 3PLNA 2R48A 3A4LA 3L8YA 3SQOA 1VHQA 4D9BA 2IT1A 2FSSA 2ZR9A 3CQ9A 2X8JA 2W2PA 1LLDA 3TX6A 4MYDA 4AUEA 3KOXA 3NPAA 5KOYA 3CSUA 5FPQA 3FTFA 3VC2A 5JT1A 5CH3A 4FWTA 3NHRA 2NSJA 2PKEA 2PKWA 4P7GA 1ZN8A 4JH0A 3FROA 4PX5A 3VR3D 1NXWA 4CL2A 4LXHA 4O4LB 1E6CA 4L6AA 4MZXA 2XGOA 4OX9B 5FP0A 3INTA 1HYGA 2CLIB 1YL6A 4MRPA 3SZ3A 1G8JA 2WD7B 4RIEA 1M66A 3UOGA 3THWA 4UHFA 4IUDS 4H1WA 2VCEA 1L4EA 4YP1A 4QHTA 2GCGA 5CFZA 3IS3A 3G2QA 4MUAA 1M8FA 2QORA 3UXMA 1PKEA 1XTTA 2C00A 1E9CA 2FUNB 3EZGA 4DMRA 1UAAA 4J29A 2X0JA 4FGJA 4KFRA 4UUOA 1T15A 2FQXA 4OQXA 4ZVTA 4UHDA 2QIPA 3NGMA 4RLSA 3W34A 2X0DA 4RHXA 4QD3A 1XTVA 3X1XA 5BWCA 2G80A 1RQLA 2E5FA 3QF4A 3P9KA 3ILXA 4MW4A 3DOCA 3VO2A 4Z4QA 4JI4B 2OR3A 1MIOB 3EN0A 4NG4A 2XBMA 2SBTA 1NJ1A 4LRQA 1LGYA 1I4WA 4ZCLA 3HI6A 3LH5A 3A6GA 5CA0A 1WUHS 2VT3A 5BNIA 4G26A 3LGSA 4KE8A 1CY2A 2E6KA 1ULSA 2F1OA 2JLAA 3ZS8A 3ZOZA 2VSFA 3UPUA 3SKVA 5CCEA 1ZRHA 3PGKA 3VOTA 2O50A 1G63A 3QY9A 2BONA 2DCUA 2YW2A 2C61A 2ZRDA 1GTVA 5LB2A 2V03A 3BWEA 2Y2UA 1SUWA 2IH5A 4WLEA 2BTQB 3QWBA 3I9KA 5AVVA 5AW9A 3O7WA 1M8JA 2VWGA 3BD7A 2PV7A 2BZ1A 2XHEA 3GRPA 3O26A 4FJ1A 3OLCX 3R3WA 3EC2A 1ZD8A 1T9GR 4BEWA 1I7PA 3A6JA 1ZIPA 2ISCA 2L0XA 2ZTHA 3I0MA 2P35A 3K6KA 3EB9A 3OPQA 4LOAA 4QBKA 4QYIB 1Z0KA 4RA9A 2Y4NA 1K3TA 2D2IA 2JLCA 5DHQA 3HU3A 2C07A 1PD1A 2G0TA 5GV7A 3G2LA 3TLGA 1NMSA 1HQDA 1XTUA 4TYYA 2B7LA 2YZKA 3QA3E 4P0PB 3S28A 2Y4OA 2P79A 1TTQB 1E6UA 3CR8A 3U2QA 1CQXA 4JCOA 1XAGA 1PUIA 2Z9BA 3FRHA 4PHTA 1B0PA 1PCXA 3AFHA 3K20A 5CLIA 2Y8EA 5ESXA 3OTIA 2CDBA 4N5HX 1PR9A 1F0NA 4C6HA 4OJQA 2B4AA 4LGMA 4K8RB 5JALA 3PUVA 4JLJA 1SU8A 3W5VA 4MYTA 1DBQA 3M3PA 1LV7A 3I4CA 1NQXA 1S2DA 1JB9A 4MI6A 5C2JB 4HAVA 2QF7A 1Z6QA 3T7CA 2CXNA 2FYTA 4GYKA 4YN3A 2XVYA 1YL7A 1DLIA 2C92A 1N8KA 3DL0A 3NM4A 4ZMRA 5A5DA 3T1HB 1Y9JA 1ESDA 1C9KA 4YJ2B 5AMXA 1CZNA 4Z53A 1DINA 3G6KA 1N3IA 3KJQA 1LFDB 3U1TA 2YXLA 3T5MA 1GKYA 4MI1A 3RGWS 4D74A 4LTDA 1M6EX 2QD3A 4MGEA 2WM3A 3DSRA 4HI0E 3FCAA 3UGQA 3B38A 4DSTA 1YULA 3MMXA 4EARA 2BKXA 3UK2A 4GM4A 1V1MB 4S24A 3TBHA 3UK6A 4BU0A 4WLOA 5HIAA 1AQNA 5F98A 3ML1A 3M5DA 3WNDA 3JQ9A 4BNDA 1S2NA 1UBEA 4RZSA 4WXEA 2AA3A 4NPAA 5KINB 3UJNA 3EZXA 3AHEA 3GRRA 9GPBA 1DAIA 2OSBA 4ZZ3A 5JCXA 1XZNA 1VI2A 2A0YA 1FCJA 4Q3LA 4OG2A 1I2BA 2WE8A 5TQ0A 3ZD6A 1T9DA 3A3KA 5JD5A 1U8CB 4JDUA 4QFDA 1YK1A 1QE5A 2IV3A 1U4NA 1PYGA 3WIEA 4UVEA 4WLVA 3D2AA 3N86A 2I3BA 2B1QA 3P9XA 2AMVA 2OO3A 4YCAA 3W5UA 1C9EA 4U02A 3ZK8A 4ROSA 3EZ6A 1U2ZA 2CFTA 2EU8A 2YCBA 3NKLA 3TOSA 2EP5A 3HKDB 5GY7A 5ICMA 4PYNA 4AX8A 1YNOA 3Q6IA 3UHOA 4DLSA 1O57A 4Z4CA 2QVGA 4XB1A 4YRKA 4R2XA 4DJDC 1V35A 1NVVQ 1W0JD 2QM7A 3GJZA 3HWRA 3HUEA 4JBXA 2WWGA 4UTXA 3W8DA 2XY4A 2Q2WA 2WUFA 4HNAA 4E2FA 1X9HA 1WHSB 4M3NA 4EA6A 2BFOA 1NW7A 3G1TA 2DG2A 2FEXA 3OMWA 1PO7A 1JA0A 2NTYC 4OHVA 3VMMA 5JZBA 2R1TB 2V5VA 1LLCA 1KYXA 4KQXA 1U8FO 3LE8A 2JZCA 2FWBA 1WKBA 1OXTA 2BRUC 3JATA 2CFSA 2A9PA 4ICIA 3TMYA 2M98A 1C50A 3H04A 3MERA 5ALIA 1T8RA 3PXCX 1DKUA 2DZDA 2EATA 4MR7A 4N3GA 4X24A 3A1TA 1NJ5A 2MSEB 1MAVA 2ZWOA 3T41A 5B58C 5J4VA 4NE7A 3LHIA 2FGJA 3GGSA 4BX0A 3TLBA 3M4XA 5JARA 4RGYA 3IC5A 2VHVA 4YECA 1ZNZA 3E4CA 3MWYW 1ESCA 2YN0A 4NSNA 3A2MA 1ZI9A 1KMQA 3NIWA 2ZUDA 3LDFA 4G63A 3CPJB 4WQMA 1W73A 1ZM9A 1NWCA 4K6KA 3RARA 3DW1X 3FB4A 3MRVA 2YR0A 4MSUA 4AZWA 5DYWA 2VNAA 3MXTA 4XUDA 5K0LA 1ZJ5A 4KWEA 4AU1A 1LK7A 2FB9A 3AUXA 3TRIA 1JR6A 1O96A 4UBOA 4DNXA 4RIGA 2PANA 3GD7A 3LA6A 2PU5A 2XZTA 3GWZA 3FZGA 4RY2A 4RXMA 2H7YA 4ZXFA 2PFGA 4U7JA 1UZLA 4HUQB 2OCYC 1X42A 4OMUA 3SSOA 1CS0B 3UW3A 2V4UA 5BPHA 1PX2A 3T94A 4INPA 1B41A 5LJLA 3IKLA 3KCQA 3P9QA 4JEMA 3KXPA 1P1RA 2VAXA 3B7PA 3L4BC 1Y9EA 2I6FA 1B3BA 3NV9A 5EUMA 5FWAA 4B46A 4D8YA 2HI0A 4I50F 4UE2A 1CT9A 2IHZA 4IQ4A 3FH0A 1L1RA 5GM1A 5AW2A 4FKBA 2PX6A 3IO5A 3IAM1 3KETA 1RKQA 2CHUA 2PAAA 3HSSA 4LAFA 3ET5A 1WD7A 4PLWA 5EWMB 1SRQA 1VXRA 2A30A 2E87A 2HF7A 3E3OA 2LCQA 3RV4A 3NEPX 4C0AC 4CR8A 4DC0A 5G0UA 3KJEA 1KSFX 4YACA 4ZODA 4D4MA 5JWOA 1SQ0A 3CZPA 4D99A 4K0KB 3GCWA 2VQSA 5JAZA 2GPSA 4D82A 3VC3A 5K0FA 1G8GA 6LDHA 1ZIDA 2KBEA 1GA1A 3D8RA 1BC5A 2A5GA 4LXGA 4OB6A 2O3JA 4OQDA 1OIVA 1THMA 4Y2SA 4YC7A 1N1GA 3THOA 5ITZA 4MQUA 2QP4A 4J8PA 5SZJA 2VT7A 4MVJI 1DHTA 4HWPA 4JMPA 4MV8A 2I2DA 3EEOA 3FTPA 4EPXA 1MEEA 1IEWA 2Y0DA 3VGPA 1JBKA 3MBKA 2YNMC 4AD8A 4B4DA 3QY0A 4FCVA 5JEDA 2PKXA 4U2EA 2O7SA 3NB0A 5CRIA 1C3OB 4OA8A 4S1OA 3VYRB 3BAFA 3IP9A 1KQNA 3ZWQA 3UANA 2NT4A 2BCJQ 2PRKA 3QPCA 4U3JB 4YI3A 4RHUA 1EIZA 3L5KA 2ZCJA 3LUHA 4A2PA 4OM7A 3ROTA 3O8LA 5K01A 3IB6A 3O21A 3Q5DA 4UNPA 4EGFA 2YIJA 4R9UC 3VR5D 4BNFA 4DQDA 3M83A 4F8EA 1Z5WA 5JCZA 4DV6B 2L17A 2ZIUB 2Q5OA 4D56A 4BNNA 1VE9A 4GSLA 3BXHA 2HDOA 2GBFA 4CMIB 3TIGA 5LOVF 1FP1D 1DV1A 3L0BA 4YRTA 1JFRA 5FYQA 1D0IA 3BZWA 4R2JA 1VJCA 4KE9A 2E89A 3FR8A 3FI9A 3LNTA 3ZVRA 3X0DA 1HSZA 4UHHA 4B3JA 1GNTA 4KVAA 1N2BA 4W82A 3H5LA 4LHXA 3DKRA 5BY2A 2AJ8A 2UXCB 1XEXB 2AB0A 4KH0A 2V9PA 4H7DA 4ZJYA 1Z34A 1NL3A 3IUPA 2DFPA 2ZTSA 1EFDN 4Q12A 3R7BA 1A69A 3BMCA 2JBHA 2VBIA 1BXGB 1J2YA 1W87A 1Q11A 2HNAA 3IX7A 4RTJA 2XDWA 2JGLA 3E9MA 1QX4A 1YMQA 2GK3A 4KFUA 4PSDA 3A9UA 2A4KA 1ZK0A 2I91A 2A9QA 3ZX5A 3Q3HA 1JTEA 4FTWA 4REMA 1GTRA 4WOCA 1IHPA 1DSSG 3PC2A 2FA9A 4J2TA 4M86A 4NE9A 5DGXA 5AOAA 5KOIA 2WQ6A 4Y1FA 4XJSA 1ZVMA 1ODTC 3S2IA 5IHPA 2H5IA 3B6MA 1K6JA 2V7TA 3AC0A 4U7GA 2VRCD 5B6JA 5AQEA 1QX3A 2G17A 1VL8A 1AQLA 4RH1A 2O8CA 3RQIA 3D4BA 4OUDB 2C5LA 1QFMA 2GD0A 2YDYA 5DBOA 3W05A 1EU1A 4BU1A 2NV6A 3MGKA 6REQA 1G8AA 3EY9A 1FSZA 2YWXA 1A5ZA 2ETXA 5E6SA 1TZJA 3SF0A 1IMOA 1O6ZA 2ZUCA 3FYSA 5AH0A 1KVUA 2YV1A 4QELA 3N0TA 1LV8A 1S2LA 4DMGA 1P6UA 2VP9A 1XZGA 2P6MA 4J3FA 2CB0A 1PW5A 1KHTA 4HWOA 2Z98A 3S4YA 4NXMB 3NUGA 3AT1A 2VDWA 3IQFA 2I78A 4RGBA 4UMEA 3GYBA 4HL6A 1VFNA 5AW8A 3VU9B 4IXTA 4JOSA 3B7GA 4WFQA 1L4BA 2Z2ZA 4HOYA 4PZPA 2XZDA 3EQ6A 1FXWF 3IOBA 1RJGA 5MDHA 1SCIA 2ECPA 2VT2A 4NH4A 3L5OA 5K2MA 3U7QB 1Y7PA 2JJMA 5DNEA 2ZRKA 1LW7A 2H16A 4PX2A 2L2QA 1TA9A 2V5AA 3DV0B 1F6BA 6PFKA 1OLUA 3A28A 2C3YA 2OXIA 3JYQA 3HVUA 2NU8B 2WUDA 5EE0A 5L3ZA 2YWCA 3NHKA 2X13A 4KDRA 4M1QA 2RKBA 2N46A 2HD4A 5IK2A 2XKKA 1WMFA 4G8CA 1H3NA 5LYJF 5F76A 4JYPA 3Q87B 4O2AB 4YMHA 1ISIA 3DZIA 1J21A 3OA2A 5LNK6 3NBQA 1GNRA 1L7QA 1EAYA 3CPSA 2Q0SA 1CTQA 3IDFA 3AEQB 1DB3A 3MGCA 1SWVA 3OETA 3CHYA 4LOKA 3ISJA 3FN4A 2R6GA 2VEDA 3AOEC 2Z2IA 5JXJA 4H1UA 3AUJB 1EJ0A 4XJTA 5BR8B 4GGMX 1SBIA 1M6NA 4E21A 3MS7A 2JZNA 4LMPA 2GK6A 5EPUA 1X8JA 4WCFB 3DP7A 4DA8A 5BSHA 3HI4A 3O74A 4TZ0A 2QTFA 2AD1A 2WB4A 2FOLA 2I4MA 4DR1B 1L4KA 1TAUA 4J91A 2J3HA 1ONPA 2FP3A 2LBPA 2YWEA 4KR3A 3HM9A 3UOWA 2Q2NA 2YIDA 5DCYA 2P6UA 3EGDB 4EG0A 4FJ2A 2WNSA 1M3SA 4RF3A 5ALLA 5JS2A 4YCMA 4XOUA 1Y8AA 3WLJA 1T91A 4Q9AA 4QGAA 3CX7A 1QU2A 1DLJA 4OJNA 2EWWA 3CEPB 1E2MA 5ADHA 2W6JA 4CM5A 5BV2P 1KI8A 1T4DA 4NCIA 4E5NA 2TMGA 4ZQIA 4KLZA 1PN3A 3DULA 5DGIA 3Q6MA 2CFRA 3TX2A 4D57A 4G0PA 1CV2A 3EVAA 2BCEA 2FPSA 4WCFC 1FQJA 3DBVO 2HJWA 4U7TB 2AZXA 4G0WA 1P2FA 3BOSA 1YCHA 2BZSA 1Y8QB 5JNLA 1LSJA 1NFFA 2H1HA 2Y27A 2JEOA 5DM60 3ZJUA 1TRKA 2CB9A 3N53A 5JAMA 1EVKA 3BVPA 4A36A 3TRKA 3JYNA 1JHOA 1F06A 4M9SA 3OF2A 3AZQA 5CNJA 5E95A 3GFVA 4MGKR 3CO5A 4LJ6A 5CA0F 4JJGA 3O93A 4Q3DA 2YFQA 4ENVA 1FL9A 4LE1A 4CW7A 4J0CA 3GRFA 4EO4A 1AK9A 3QTTA 4WFIA 3QHQA 3QLJA 3WIOA 4EEZA 4IQFA 3K0EA 1VOTA 3ON5A 2HNBA 4HLCA 4P83A 5CK5A 5EA2A 1T0BA 4DBVO 4Z7JA 5KNBD 3CFYA 1Z15A 3I4FA 1OBCA 1PNVA 2J31A 2RGDA 1C9MA 2FWPA 3D3NA 1O6FA 1QG2A 1WPXA 1GSAA 2GPAA 2Q5LA 2D7JA 3A4NA 3IBYA 1A9TA 4FHZA 4I08A 1QP4A 2OCPA 3FBTA 3OOYA 4Y0NA 4YRGA 3D5QA 2HJ9A 4A2CA 1U0EA 1FVFA 2ECOA 1F0KA 3A9WA 3CEJA 3HBLA 5FJIA 5DI3B 3O4IA 1RRFA 4XJVA 1TJ4A 1N9ZA 1NX6A 3OEHD 4HDNB 5JNVA 5FUMA 3CGGA 2JAXA 5DBFA 1VHDA 1MX1A 3FR7A 2AFHB 1BO6A 4P3XA 1RPZA 2QTBA 2QN1A 4CIAA 1UANA 3T4XA 1HZZC 1PJZA 1ZM4A 1DRUA 1E60A 1R6VA 4LC0A 4ZVMA 3G0IA 2P8SA 1CVIA 4Q1EA 2HCTA 4MGIR 1CX9B 4UBJA 2AG5A 1BA3A 1CJBA 4UMVA 1XNRB 2NNWB 2YVAA 3KAKA 1RT9A 3MM4A 4JP5A 1N2SA 5EJ6A 5KBYA 3EA5A 3MUEA 1V96A 4YP6A 3WY9A 4ASUA 4TYNA 1YHNA 3E0QA 2R6HA 2XNCA 3EVCA 3OTOB 4A7PA 3GBVA 2GK7A 2YMPA 4RTPA 4F5WA 1VG9B 4JZYA 3VGJA 1HTBA 4A27A 3WGZA 3GLUA 2JZOA 2EZTA 2VA9A 2VWPA 2EFJA 2WWTA 3I2HA 2CEAA 3FMIA 2GF9A 4OB8A 2J4DA 1V41E 4CHGA 3ZZMA 3PGJA 1KKUA 2F9FA 4KQMA 4OKIA 4MUIA 5COAA 2IYXA 3CJQA 1UIRA 4C0KA 3NDPA 1I1OA 2NPIA 4C2UA 2FR0A 3I72A 3BORA 4AT1A 3IKVA 4P5EA 5ITVA 1WKVA 1EZZA 5AJWA 3GNLA 3C87A 4PQRA 4R9NA 4C2BA 1ID8A 3C1AA 2H59A 4EHNA 1G3RA 4L1KA 4QXQA 3BE6A 4YEDA 3NUZA 4KXMA 2WQ7A 1NPYA 1UIMA 1BW9A 1I51A 2FW7A 3I2GA 4IV0A 5JMWA 4MUYA 2CYCA 1Y6FA 1PNRA 1UBCA 3GLFE 1ONSA 3AVOA 4LYAA 1GP2A 3S1LA 3WLMA 4C7OB 1EBBA 1ODJA 4G0ZA 4NCNA 1EP2B 2GCOA 1TQHA 4Z2AA 4RQAA 3GU3A 4N0DA 2VSOA 1J42A 5JG7A 5KTNA 1QU3A 4UM5A 3BPSA 3GRYA 4LZNA 4OBEA 1IWPB 1GFIA 1L1QA 3T4EA 3T7DA 2HMAA 4XWKA 5KNDA 1HURA 5MGNA 1W1UA 4CWAA 3NBUA 2OBXA 3OFSA 4D6XA 4MLPA 4TWRA 3ELBA 2W2VA 4M21A 4BMNA 3FYHA 1V71A 2EP7A 3DKKA 2XSZD 4NZ9A 1T13A 2ONKA 3EVNA 2WKQA 4B31A 2I2FA 4ZHSA 2LDBA 5AXBA 2NSHA 4BJ3A 4YAGA 5HWSA 3ANLA 2ZBVA 5DM0A 1GGVA 1TO1E 4UCXA 1M73E 1R10A 2WF8A 3FIUA 4PPNA 4RQBA 3DMTA 3O1HB 4GR4A 4B3SB 2BGUA 2R44A 5E38A 4JFRA 2E3JA 2B92A 1QVWA 5AOVA 4CV1A 1QRAA 2QTWB 4N47A 4WLUA 1N9GB 3EW9A 2HN9A 3IOEA 3MYRA 2OT3B 1WHTB 1XRRA 2FPWA 2XUFA 4WZBB 4Y6RA 4E1AA 2R6CA 4ZTUB 3I2KA 2XE4A 2BC9A 4GQAA 1QTNA 1V8PA 1NVBA 1YA4A 2WILA 2A0XA 3UWOA 5KNDH 3HCNA 1RQ2A 1NUAA 1M2EA 2N47A 2VQ3A 4BVHA 1QHSA 4QX6A 4J4BA 1GPYA 2CF6A 4L9RA 2FSHA 1BMDA 1G6KA 1IAQA 3D7NA 5JROA 3H5VA 3PQ8A 1XTBA 2ZBGA 2GDJA 3B9QA 5E9QA 2C0QA 3RB8A 3GA7A 1XELA 1RAFA 2GPBA 2AFIE 4J9UE 3ESDA 2ZCUA 5D2CA 1L1EA 4TUYA 4Q37A 5JSUA 1RW4A 5A4JA 2D5AA 2IOYA 1YVRA 4UNQA 5FIUA 5BRAA 3PFNA 2IKSA 3ZJTA 2O1EA 4RIHA 1E1NA 3W5IA 5DYYA 5IEBA 1EJ6A 3OJOA 2PD4A 1PUXA 2J3LA 4JMLA 3GZJA 4JP2A 3ER9A 3M8KA 3VAAA 5KTKA 4ZI2A 4A23A 1V9LA 2A9OA 1U7PA 2G71A 1SXJB 2YV2A 1M2JA 2AG1A 4J4HA 1YCGA 1R88A 5DLYA 5K3SA 5IKOA 4LJ8A 2EJBA 2PMFA 2B98A 5K8JB 2VZLA 1H2ZA 3NKVA 4Q4AA 4L75A 3HDHA 2JFXA 5KSPA 1RRCA 4DJJA 1S5PA 4UTRA 3R8FA 2PLAA 3IBGA 3BFJA 1O89A 1VYTA 3QFCA 2O8FB 3NV7A 2IHYA 4DARA 2Q3HA 2OD2A 1AB5A 3EBOA 4YUAA 1RRMA 1YMVA 1E61A 4E08A 3DHYA 1Q7CA 4DG9A 1B43A 4IDFA 5HA5A 1SXGA 4MV4A 1BE8A 5E6UA 1D2NA 4MHTA 3FMFA 4WNYA 5LIRA 4R8SA 2PUCA 1JEJA 1JBQA 4YQEA 1XJWA 1QIDA 2FFRA 4BNIA 1ABBA 2X5OA 4G4GA 4GYWA 4J1QA 4QPNA 3MMSA 5CFLA 2A0UA 1LX7A 2CV0A 1UM8A 4EYKA 3O8CA 1WXDA 1MBZA 2ZTVA 3WBBA 2YOGA 3ZUPA 1KYVA 3FCUB 4M2LA 4BECA 3PGXA 3IILA 2NV0A 4BLSA 3AM1A 2G4VA 4FMBB 1VIAA 3KFVA 1VL0A 2FWMX 4DSUA 2EOAA 2CNNA 3QYFA 1U3GA 1Z17A 3GNQA 1NOIA 1BOFA 2AJTA 2FZEA 4ISCA 4MUFA 4UUMA 3WJ1A 1KEKA 3Q98A 4R5MA 3FDZB 3FPCA 4I55A 2ZVQX 3A05A 4RCZA 4YJHB 5E7JA 5K3BA 1T6NA 3NQ41 2VHUA 3NETA 5FNZA 2DU8A 3D1VA 2BWJA 3V55A 1V11A 1QIEA 3WKEA 4XSGA 3E1GA 2QSZA 2GN9A 3RSLA 4UUQA 2PG3A 2WTEA 3NFYA 3MTBA 4M9XA 1RP7A 3JZAA 1FU8A 3A2KA 1ZEMA 1H2BA 2NXWA 2P2SA 3BXOA 4S2UA 3VYUB 3MT9A 1WCWA 4WXHA 1T35A 3U3MA 2MYTA 2QL7A 1RHUA 1E20A 2ZIFA 4ZEVA 2W6PA 3ZNOA 2BH2A 2NVUB 2J9YB 2C98A 3EQZA 3SC2A 3E82A 3O3NB 3PJRA 1UMKA 3GZNA 1G0OA 1A82A 3CRMA 3PNOA 3NNDA 3UHJA 1QHXA 4LJYA 2I66A 2JGKA 3HCAA 4IJUA 4OHWA 4KACA 1DFHA 2ZRFA 1YOBA 3AVXA 1LJ8A 2ZGVA 1HEUA 1OAKA 4AJ1A 3KVNA 5IT5A 1E94E 3FY4A 4QRDA 3SBXA 1EVEA 1R9MA 1E2EA 3W6OA 3KG2A 5H16A 2PPVA 5M04A 1I2DA 4ZCMA 3WMEA 5MF6A 4AYTA 4DQ0A 1UM9B 2K2QB 3DT9A 4Q5IA 3WQHA 3O1LA 1A2OA 4JOBA 5JFTA 3ETCA 4KGVA 2ZULA 3QEOA 4X66B 2XDAA 1YS2X 3PUKA 2BFWA 1DARA 2GXUA 2ZM5A 1QVZA 4TKLA 3RSHA 1ZOOA 3EXFB 4FI3F 3LUDA 4P4SA 5IVPA 2I6UA 1DRKA 1Q0RA 2SECE 2HUPA 5BSVA 3SQWA 2W6ZA 4Y9SA 2POCA 3LI2A 3H5IA 4CU5A 2X4LA 2VJMB 1R8YA 3TZCA 5G0WA 4DLTA 4TRMA 1B00A 2XUAA 4E4RA 1S1CA 2WDPA 5C32A 2PMKA 2A5FA 2WD9A 3S8EA 3R5JA 2Q4BA 3A36A 4K6GA 4WY8A 5B64A 4YT2A 3UY4A 4KDCA 4DYDA 1JEOA 2O57A 3K96A 3L8CA 4GR9A 1Z0ZA 5B7GA 5C51B 5EQJB 2FDXA 4UJ5A 3FI0A 1KQ3A 5IBQA 4OLAA 1ILEA 4M60A 1X38A 4ARSA 4O4LA 1HBJA 1V43A 3PE3A 4P92A 4BO8A 4C7KA 1OI3A 4NZYA 2RGUA 2O19A 4EQZA 3R1IA 3DVQX 1BVRA 3IAFA 4DIBA 5L3VA 1Z28A 3M81A 3EEYA 3DVAB 4ZEOA 4R05A 1MXFA 1Y5RA 1GRQA 1RWVA 3BWMA 4N49A 5P8WA 5T67A 3SJBA 1Z5ZA 4CQJA 4PN7A 5FWDA 1F7VA 1W5SA 2FCRA 2AK3A 2X0RA 4JELA 2QMEA 2DKNA 1L1FA 2N75A 1K0UA 1UJCA 3NWJA 4ITRC 5C5EA 3PA8A 2WF5A 3ZU6A 2AUNA 2I2WA 4POOA 4Q9LA 3ZVKA 2ID4A 1MIOA 1BFDA 2JIZD 4PWYA 4YV0A 1NPTO 3AO0B 3GN2A 3UV3A 2QJTA 1XKTA 3NAGA 2P0YA 1PBTA 1RM4A 3ZWBA 1R18A 1BU5A 4EL0A 3JVVA 3P32A 2ZKLA 1N8NA 3KDAA 4K7JA 3T7SA 1VYVA 3DM9B 4FOOA 4KI0A 3ZE1B 4OU4A 1JIIA 4UTVA 1QH8B 1XZEA 5IC5A 4ND2A 1G5FA 1WRBA 1E9FA 2QN6A 1XMVA 3Q5EA 3TE6A 2IEDA 3F97A 3S8YA 2BTQA 2GZRA 1WEKA 3HC7A 4PZ9A 5EC8A 1UINA 3DE7X 1XT6A 2AW3A 1S8FA 1ZCFA 2Q9CA 4R51A 3PFGA 4OKSA 5G02A 5F1KA 4G3XA 3D3WB 5FH9A 5C1OA 3VOSA 5KKNB 1CYEA 2WMOB 2ODPA 3CB2A 4URYR 1K68A 2HKIA 4KWIA 4QYIA 4ZI5A 1Z7WA 3LHKA 2V7EA 1BDJA 1T26A 3FBWA 3CG4A 4IOMA 2YFYA 2Q3BA 1KMHB 3HDGA 3MJTA 2NNLD 2JASA 2P4UA 1PKXA 2XODA 3H6KA 4BQPA 3W4KA 4DNOA 3DG9A 2DEUA 2WZCA 5FXMA 1DG9A 1YB4A 3TJMA 4F6RB 3VKWA 4PRLA 3RSGA 2JHAA 4M7WA 5C3UA 1SQ5A 4B6QA 5FX2A 1ZUIA 3OOSA 1PFGA 3K1ZA 3NNSA 1QK3A 2C5HA 1LC0A 3MQ4A 3DVRX 2JKZA 4JX9A 5FJJA 2PUTA 2AC7A 3WNBA 1NMZA 2C94A 3H2HA 3BL6A 2QGZA 1VZ3A 1XD2B 1ZRNA 4D3YA 1A72A 3AESB 2CD7A 3M70A 2QSUA 1XRLA 5DSXA 3DFFA 1KORA 2OCXA 3B5EA 4Q16A 4RUKA 2RC5A 3QBEA 4LY0A 1ZN7A 1Z88A 3UH0A 5J47A 1M5RA 3NMUF 3CSDA 5KO2A 1H2XA 1LRLA 2Q4RA 4YJ2A 4NCBA 1MQ8B 3H4IA 1ND6A 4PO9A 2VQEB 2XE7A 1MENA 3NRCA 3UPDA 1KJ9A 1OWLA 2I55A 3FPJA 1NVTA 5FO1A 2Q7OE 2VATA 1HZJA 5IW8A 1ZDMA 4ZZ1A 3ZWNA 4Q1FA 2IXTA 1P81A 5AXCA 2H1IA 2EW8A 1XAHA 1U2DC 4LF5B 4IZOA 5JRDS 4F85A 1PV1A 3FNIA 4NEGA 3TSWA 3ZNNA 1KJNA 1ZM2A 1ISSA 2GEVA 3N2GB 4D0SA 1OQAA 1LPSA 2WAXA 3RVMA 4J0KA 3C4JA 3OU2A 4TV8B 3S5UA 2VYVD 4D98A 4M36A 1ZXBA 2BRUA 3ECAA 3VNSA 2ZDGA 3AQIA 4H6VA 3B3FA 2R62A 5KQSA 1KAOA 3DFMA 1X14A 1IJKA 1RYYA 4RK5A 1SOVA 3TQIA 4UXJA 1RLTA 3A7DA 1ENOA 1L8QA 3OOHA 3BD8A 3RH0A 3HKDA 3RT9A 3H1TA 4I8IA 5LLSA 2FN4A 4TTTS 3OPMA 1LDEA 1OFVA 1MABB 3SNKA 4HF7A 4XZ3A 3ZIAA 4Q82A 4U00A 1V2HE 1T4BA 3O75A 9MHTA 3EA0A 1M83A 3E8XA 2VYFA 3WLQA 3SOPA 1IQ0A 1W2HA 4CZ2A 1BDMA 3KUDA 4TM7A 1FVXA 1RCFA 3O2NA 3HVKA 4FBMA 4EZIA 1VHTA 3CPEA 5EWJB 1O9GA 3PEVA 3RSQA 1TVKB 5BRJA 5L95A 1TTTA 3V7WA 4JI0B 2EJWA 2PMEA 2QRKA 1KAEA 2N9UA 4XVHA 3L18A 3H2YA 4PHHA 4ED9A 3LHSA 4EKNB 4OYRA 1HO3A 621PA 5DXAA 4LDPA 2C4MA 4L27A 2P6OA 1M54A 1I4TD 1PR6A 1AXRA 3QQ5A 4ARZB 2BH9A 2DVMA 1XN1A 1M75A 2DOKA 2IUYA 3D4PA 1DIRA 1XZFA 4XB6B 4YAOA 4G85A 4A5OA 2W48A 4XIFA 1DXYA 2DTEA 4CLHA 5CEFA 1QHGA 3HY3A 2GD1O 2RJOA 5KU1A 1RXWA 3W9SA 2RBEA 4V0NA 3N0XA 1E98A 3L4BA 1QR6A 3WGVA 3QV2A 4MWBA 1RHKA 3HZZA 2YWFA 2IYUA 1S2MA 4LQDA 3EFHA 3ZG6A 3V4VB 3LRPA 3MTGA 5J43A 2X1VA 4QBTA 1RACA 4GSYA 1R3DA 4I5DA 2Y0PA 2QVZX 2Z2JA 1KK3A 3HSKA 3HV0A 4QUKA 1KI6B 2DFNA 4AJ4A 2SKCA 4L73A 3FVQA 4IDAA 1D6SA 2D00A 4RVGA 1BCRA 3MLBA 3PHHA 4HUQA 2QTZA 4TT3D 4YXWA 1CS0A 4Z6KA 3V2IA 4R8VA 1WA5A 5B7PA 2BGRA 2IS1A 5TMEA 4QBGB 5DBHX 3QEKA 3ZOKA 5GJBA 5CU7A 4CEIB 4HVAA 5AFSA 2W90A 4FSDA 1G7RA 5HZMA 1UT5A 3OPYB 3T5GA 1KFJB 2BYTA 3KOZA 4KYUA 4UM9B 1UOPA 4BNZA 2HHAA 3IHTA 3PPIA 4PZYA 5IP5A 3UEOA 4NXNB 4RJJA 3HYRA 2KW5A 5C7IO 2ZUVA 1D4AA 2HIMA 2BKAA 3MWJA 4ID3A 2YNMA 4TKMA 1S6YA 3CLTD 3H4VA 4OOFA 3NCTA 4FQ8A 5EWMA 3TQHA 1TCBA 2B25A 2W2NA 4QYXA 4FBGA 2HU5A 4C3VA 5C4GB 2XRFA 1FP2A 1I24A 2H0AA 3OM8A 4TQGA 4DIUA 1YB7A 2I1LA 2QDXA 2IY8A 1LJUA 1EFTA 2VJCA 4TUYF 2PUFA 2JFWA 1ONOA 3Q41A 4F86A 3K72B 1GQOA 3QUTA 3PXUA 1OFHA 2DCMA 3IDQA 2IZ5A 2O2EA 2IS6A 1ZS9A 3AHJA 3JCZA 1OYVA 2H85A 4HFJA 3L6OO 4HWTA 2JVJA 3PI7A 4AVYA 2B4QA 3COWA 3HGTA 3WGNA 5FR1A 5B3KA 2X0KA 1NQOA 2Q6LA 4M1MA 4BC0A 4C87A 1PJQA 4MB0A 4UHJA 3WL4A 4BFUA 1EX6A 4V0LA 1C3OA 3KQOA 1E2FA 5CPFA 1VJTA 4PLTA 3GDWA 3OSZA 3FUTA 4DLPA 1W8DA 4YPOA 2FH5B 4LFAB 4FFPA 2JLQA 1W76A 3FPAA 5LQJA 2D0DA 1IWBB 2OV8A 3JQPA 3HB0A 4IJWA 1KIAA 4JGIA 4CQNA 4EFNA 4TRJA 2L18A 2J41A 4ZA2A 2QPAA 3PZRA 2QJOA 3F74A 5B58T 3VISA 5A0FA 1VMDA 5LMNB 3DHVA 3QLEA 4K1LA 4CMIA 2E4ZA 3K35A 2B9EA 4G89A 5BT8A 3C41J 3U4AA 1W9HA 3BSYA 2C8LA 4Y3UA 4MUBA 1UXGA 1DQSA 4JWTA 4QULA 5TS3A 1XKLA 4JT8A 1BKDR 5D3ZA 3TBKA 3UAYA 2ID8A 3JWEA 4V0QA 4ECEA 1VGQA 2VN8A 4MPPA 2H9YA 2G70A 4W1PA 4FR5A 4JSYA 3V8PA 1Q7TA 4CKEB 1GGNA 4DUGD 1NPDA 1FFCA 3AUFA 4JLMA 2I65A 3CNNA 4ZIRB 5DYGA 1KMCA 1PFKA 3QENA 4UBNA 5A6SB 4YFYA 4UFPA 3CT6A 2WF6A 4I55F 4K81B 2O7QA 3HJRA 3KOWA 1OVMA 2X1HA 1SURA 1ZZGA 1ZMTA 3GL9A 4HZUA 1YQTA 3FOCA 1SPBS 2TSYB 1F8XA 3GARA 4IZHA 4JSTA 4V02A 3T7RA 4CTJA 5KWIA 2VHXA 3NRBA 2FN3A 3L1VA 2F55A 4OUDA 3OZAA 3TUJC 2PMBA 2HLNA 4A0HA 1I8TA 2R9VA 2WAOA 2YY6A 3PQCA 5EEHA 1YC5A 1QFJA 4HN9A 4OREX 3FF4A 3QHPA 1NHWA 5FLYA 5FR2A 1NYLA 4JY7A 4KTVE 5AI0A 4F9GA 2GD2A 3BMQA 2QD1A 3OEED 1YR2A 4ERNA 2QT9A 5JZSA 1BKYA 4H16A 4V3CA 4IDGA 2P9JA 1M5UA 1VKRA 2ODAA 1H6CA 4DQXA 3VU9A 1UFRA 3OZCA 1JKMA 3GQBB 4M9ZA 1W0KA 4XLTA 4JC0A 1TFRA 3AOEA 4ZYYA 2G4LA 3QXXA 4XDZA 2DLCX 4W5JA 3PENA 3S7TA 3X2FA 3LFHA 1MPXA 2DBRA 2KM1A 3DV0A 4ENTA 2ECFA 1LDBA 1YKSA 4CGYA 3Q9SA 2NQ8A 3JQRA 1JB1A 1ELOA 4D0LB 1SXQA 3HU5A 1E7YA 4IFIA 2E4XA 2FQQA 4LRTB 4UUBA 1POXA 3OZBA 3SFZA 3H2BA 4O2AA 4D79A 2ZYVX 2EGGA 4G5YA 3H4MA 3NWPA 2GCIA 4M8KA 4HEA1 5EMJA 3IR5A 3FDIA 3MD9A 2XRMA 5M7EA 4B3HA 3KWJA 2GHTA 4XVUA 2QAJA 3BILA 4Q6BA 1ECFA 3Q8XB 4ZAFA 4I3HA 4EM6A 5KNCA 2C58A 4H4DA 3TKYA 1QGAA 3P71T 2JFVA 2YRXA 3B82A 3P1JA 1QDEA 4R68A 4OHPA 2R6DA 4N5DA 4WCFA 5CLHA 3K73O 1S2OA 2XQIA 1E3JA 3PTLA 3ZNQA 4DAOA 2AEMA 1EQAA 3AV0B 3HUFA 5KTSA 1RZRA 3VU1A 4D46A 5K8VA 1SUPA 3B89A 1TKBA 5HXAA 1JIXA 3VVCA 3UBMA 4O4LF 2OB1A 3ILSA 2ZG6A 3KUCA 2KX7A 3DAPA 1B23P 3UUFA 3DTVD 3N9IA 1L5ZA 4J4TA 1GJRA 1GPLA 1MAWA 2IYQA 3MWLA 3VHQA 1TAGA 1R0YA 1VRCA 3LQYA 3QX7A 3WOHA 1E63A 1T5LA 1LQTA 2VZ0A 4QO8A 4AY3A 4Q7QA 3X1WA 1I4DD 3ZCSA 5ALVA 1T2NA 4B3IA 3W5DA 3FPGA 4QXOA 3A1FA 3LD9A 3COJA 5FBHA 5K8IA 1ZOIA 5KNCH 3VR4A 2CK3A 3K8ZA 1F12A 5GJWC 4GZ5A 4F72A 3TSOA 3QUAA 3DLBA 1Q95A 1HDGO 4OLBA 1L5LA 1PBNA 3Q72A 3A6FA 5K05A 1HNXB 4HJXA 1JVNA 1KP2A 1Y8QA 1FFHA 1J8MF 4X71A 2I4LA 4Z5XA 4HBZA 2BFEB 1RYBA 5EMNA 4G0MA 1I14A 3W2IA 2G40A 3CZMA 1DNPA 1L4LA 2XR1A 2K6GA 3UB3A 3ZVLA 3BWYA 5BWMA 4KRGA 3VI3B 4IH9A 1AZTA 3DLAA 3G5LA 1Q1ZA 4M9UA 4RCVA 4B73A 1I9CA 1RXVA 3UA3A 4IVPA 3ZD7A 1RM0A 4EZEA 1Q77A 3HA7A 2JB9A 4GUAA 3HUTA 3ICEA 2GCEA 4WACA 3U40A 1ZCZA 4DDMA 1HZZA 2DE0X 4F97A 4M8NE 1AK2A 1GYPA 5JDIC 1ZINA 3ZQUA 1RE0A 5JNTA 4RD2A 4RD6A 1HQCA 1G5HA 4RZIA 5HEKA 1QTIA 3TNFA 1K6MA 3SHQA 3VNAA 5AJZA 1WL8A 4C6SA 1JNYA 4M1SA 3MPOA 1TM1E 3UWDA 4AJNA 2YC4C 3VR4H 1FJXA 3DYVA 4O4HB 3BB3A 2YWJA 3AR4A 2OPBA 4NX2A 2GYYA 1X7ZA 4LXIA 3WLAA 5C31A 1WUKS 3CW2A 3R9XB 4X93A 2BFBA 1UK7A 5DI3A 5K8LA 1Y5LA 3FLAA 4GG1A 4GWKA 2CXXA 3DF9A 4HDNA 5FOWA 5FULA 1IJEA 3UB4A 4BNTA 4TTIA 1I6LA 1Q16A 5JAUA 3IEPA 2PH1A 4HVCA 2NZYA 2PL3A 4YCDA 4RESA 3SSAA 4BVAA 5K0CA 4KLNA 2ZUTA 3ZBPA 2OC4A 3SE0A 4PRKA 4GKKB 2AXNA 4DABA 4BYGA 1H8HA 4M1WA 3ONVA 2BDEA 2YZMA 1GQFA 1XE3A 2I6QA 3FPKA 3GAAA 3C85A 3Q10A 2IYLD 4OGWA 4D9IA 4N7JA 4RHYA 2PKYX 3ZDXB 1X7XA 2GCPA 2QLFA 2YJ6A 3ZHZA 4I9FA 2UXDB 4C03A 1Y1LA 1X3SA 4FW9A 3JVDA 2XJ9A 1VI5A 2H8KA 2FMHA 4GECA 3RJMA 3ROKA 3EUAA 4RQTA 5JH7B 3Q7IA 1E4VA 1R0KA 3Q3EA 4FS3A 4OOEA 4IFTA 4YJ2F 1EUQA 1VKZA 2W2XA 1KDZA 4XKJA 3IUMA 3KLPX 4G4SP 4R1PA 1R8XA 1V1JA 2OGSA 4W9NC 1OXVA 1W5TA 6ABPA 1KPIA 2G5PA 2LUOA 1L5SA 5AVTA 1W2WB 4RY0A 5FBKA 4RYDA 1TZMA 2PEZA 2R6FA 2J30A 1YJXA 2VDUE 2OCBA 3G2NA 3HLYA 4KQFA 1DO0A 1JTVA 5GVRA 2O14A 1V9CA 4FSXA 2OVFA 5G1NA 1HR0B 2BLNA 2QVBA 4FK8A 1JMYA 1ST2A 4HX2A 3LCUA 1PJRA 2QUHA 3E2IA 1N0WA 2E21A 1BHJA 1CHNA 5ALWA 5SV2A 3DL4A 5CEEA 4V39A 2AXEA 1IN7A 2HOQA 1BRTA 2JRCA 2VXOA 3F3MA 4I19A 1M8PA 4MEJA 5E7QA 3T5AA 3C43A 1YRQA 3SAJA 1L4YA 2V65A 2AFRA 1KWKA 4CR7A 4HYYA 3CJTA 1US8A 3IV9A 4KHZA 1QF9A 1E6LA 1U0GA 2FFQA 5E2BA 4WZAB 4WA8A 1BEZA 3L8DA 3N8NA 4AG5A 2EYUA 4RJTA 1PS0A 3EDYA 3HL0A 4IJMA 4LKRA 2B8TA 3V8BA 5TQJA 4BWVA 4ZYVA 3LUPA 1CJKC 1UJ6A 2NMVA 2QR3A 4A82A 2P65A 2YZ2A 1KRWA 2XPCA 3D7LA 3TNLA 3WIDA 1LRJA 3F0TA 2P78A 4X60A 4FEAA 2INGX 1CUSA 1LTKA 1UBHS 5TY0A 4OI1A 5EP4A 4K9OA 1S3GA 4K40A 5TXGA 3ZC3A 1AUXA 2PUWA 2YVKA 3D4LA 3FX2A 2WYOA 4BZPA 4E51A 1GPWB 1I80A 2APJA 4JB8A 1WHTA 4U0JA 4WZBA 4LQLA 5C8VA 1JA1A 1N5KA 3GH3A 2P3QA 3BGSA 1D1PA 3EYWA 1V8FA 3QLUC 5E4YA 1OKKD 2XUQ