3OCVA

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase mutant d66n complexed with 5'-amp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
247
structure length
247
Chain Sequence
EEHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLNETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of nucleoside monophosphate substrates by Haemophilus influenzae class C acid phosphatase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Lipoprotein E
total genus 94
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ocvA00
2FDRA 5ALDA 4G9BA 3L8GA 3WGVA 3N5KA 3J7TA 3N1UA 2BY4A 3QU2A 5JJBA 1L7PA 2YMPA 5AW2A 2B30A 3ZVNA 3NUQA 2Q4RA 2PKEA 1Z5GA 2AMYA 3HYCA 5ALEA 3ET5A 2IOHA 3L8EA 4J2TA 4OCZA 1NRWA 3WGUA 2HHLA 3QYPA 5AIBA 3OPXA 1Z4OA 1S2OA 1Z4PX 4AS3A 3WKEA 1J8DA 3RFUA 2G08A 4FE3A 3ZTWA 1U2TA 3ZW7A 1TJ5A 3SD7A 5AW0A 1N9KA 5AKEA 5ALTA 5AKHA 3L0BA 2G07A 3GYGA 4BX2A 4BBJA 4RETA 1TE2A 4AS2A 3UMBA 2WF7A 2QLTA 3SKYA 1QQ6A 3W5AA 2FPWA 2I54A 3A1DA 3R09A 5AVYA 4GXTA 3QXGA 5ALNA 2B82A 2R8ZA 3R4CA 4EX6A 2OM6A 3WKBA 2HOQA 3OTQA 5IT0A 3ONNA 4L57A 5AW3A 3KDPA 2RARA 1X42A 2YMMA 4EENA 5AW1A 2C4NA 2YY6A 1F5SA 2CN1A 3L1UA 3ZTYA 2AUTA 4PNHA 1Z4IA 2CFSA 4NV0A 4NAVA 4Y2YA 1L6RA 3KD3A 2W43A 1RPZA 5AHXA 4UMEA 1Z4MA 1IWOA 4EEKA 3QX7A 5AM3A 4Y2TA 1RRCA 3EWIA 3NRJA 2ZBDA 4Y2VA 2FPSA 2ZG6A 4DWOA 5AI9A 3ZI4A 2DQSA 4EX7A 3I28A 2P9JA 3DDHA 3KOOA 4IFTA 2RB5A 3W5DA 3L8HA 4KNVA 1ZD4A 4F71A 3U19A 2HI0A 5ALFA 5AKXA 2HSZA 2G1AA 4L6AA 3U7GA 2FUCA 1CQZA 3BA6A 3AR7A 4UAUA 1AQ6A 1ZS9A 2FEAA 2B1QA 1FEZA 3W5CA 2YJ3A 3U7FB 1Z4JA 1RLTA 2IOFA 2W4MA 2P69A 2OBBA 4CE6A 3MPOA 5ALIA 5AVRA 1WVIA 3IRUA 5AKIA 3L8FA 4CF5A 5ALYA 4UU0A 3N28A 3WK9A 5AK6A 1Q92A 1RMTA 2AH5A 2BDEA 1QQ7A 2P11A 1EK1A 3E84A 3KZXA 3FVVA 3R9KA 3UMCA 5AW9A 3U7HB 2HX1A 1WZCA 3HLTA 3L7YA 5ALOA 5AW8A 1TJ4A 2WF8A 1KYTA 1Z88A 1ZRNA 1L8OA 4Y2UA 2YJ5A 2FUEA 4MUMA 1Z4KA 3S6JA 2MSNA 3B9BA 5AK4A 2IYEA 3L0YA 3PGLA 3F9RA 1S8OA 2AGVA 2RAVA 2R8YA 4CNQA 5ALJA 1PW5A 3M9LA 2HF7A 1SWVA 3WK7A 4J03A 2EARA 2I7DA 2GMWA 4NWIA 5E0OA 5ALMA 5ALUA 4BEVA 3FPSA 1WR8A 3FPBA 4AP9A 4UMDA 4XE5A 4F72A 1ZRMA 4Y2JA 5ALWA 2HEGA 3L1VA 3ZVLA 3AR4A 3ESQA 3ZX4A 3OCXA 3QUQA 3PGVA 5AICA 3W5BA 5AVXA 4GIBA 4XPZA 2JAOA 2Q4TA 3MN1A 2G06A 2ODAA 4I9GA 2HCFA 2BDUA 1Z5UA 2GHQA 1JUDA 3EF1A 5AW4A 1L7MA 4FYPA 1RKQA 1T5SA 5AW6A 3E81A 3EPRA 1CR6A 3ZX5A 3A3YA 2OA0A 1SWWA 4UATA 3M1YA 2WF9A 4ZEVA 1QH9A 5AI5A 2R8EA 3DV9A 4ZEXA 3IB6A 1YNSA 2FI1A 3L0CA 4UMVA 3AR3A 1TA0A 2VKQA 3QU5A 5ALHA 5AVSA 4QQFA 5AKJA 2HDOA 2G80A 4BYGA 4YGYA 2WFAA 3KC2A 5AI4A 3FGOA 2YMLA 4OD0A 3NALA 2MU1A 1YV9A 5AM1A 1N8NA 1Y8AA 3UM9A 3ZWKA 2YJ6A 4BNDA 1XP5A 5AK5A 1U02A 4HGPA 1WPGA 1T5TA 4XQ0A 2YN4A 4KNWA 4UM7A 5A3SA 5AM2A 4C4TA 3CNHA 3N07A 2FPRA 1ZD3A 3A1EA 1EK2A 4UAVA 5AKLA 3SHQA 5ALGA 4HAIA 2O2XA 3AR2A 2I55A 2WM8A 3WKAA 3E58A 3MMZA 2O9JA 5T41A 2YBDA 3WK8A 3N8GA 1TJ3A 2FPUA 4FFDA 2ZOSA 2B8JA 3QNMA 2YFYA 2I34A 3FM9A 2ZBGA 2OYCA 1O03A 3AR8A 2YJ4A 5ALQA 5AVUA 4I9FA 1L8LA 3I6BA 1ZD5A 3DAOA 4KX5A 2GO7A 1VFPA 2I6XA 4HGRA 2NYVA 2IOFK 2RBKA 3ZUPA 5ALVA 1RDFA 1RQLA 3OCWA 2C8KA 1O08A 5AVZA 1RKUA 3UMGA 3FZQA 4O8CA 3OCZA 4YCLA 2PR7A 3QU4A 1RLOA 2EATA 3BWVA 3CZ4A 3QUBA 5AM4A 1VJRA 2IA5A 5AI0A 5AESA 5AVTA 2HO4A 4BEWA 2JGAA 2ZXEA 3WK5A 4EELA 3EF0A 4KX3A 1QQ5A 4UW9A 5AW5A 2GFHA 4NABA 1Z4LA 3WKCA 5ALRA 1LVHA 3I76A 1ZJJA 5AVWA 1K1EA 2GHTA 3MC1A 3QGMA 3SF0A 3SKXA 4C4SA 4EZEA 2YMQA 3NIWA 1XVIA 3U7EB 1NF2A 5ALSA 3SMVA 3B9RA 3U13A 4JB3A 5ALPA 5AK3A 1T9ZA 4BX0A 1RMYA 4RESA 2WF5A 3OCVA 3IJ5A 5AKKA 5AW7A 4QJBA 3ET4A 2WHEA 3QU9A 4DCCA 4G63A 3NANA 4XOUA 3NASA 3SLRA 3WK6A 2D2VA 2B0CA 2JAWA 3AR6A 4YCMA 4YIKA 4DFDA 5IT4A 3DNPA 3ZU6A 3KBBA 2I33A 2NO5A 1RLMA 1YS9A 4UM5A 1RMQA 3E8MA 1SU4A 3OCYA 3ZWDA 5IS2A 1RC8A 2QYHA 3PCTA 2EAUA 4ZEWA 2FPXA 3NAMA 2P27A 2HF2A 5ALLA 1XPJA 3RF6A 3QUTA 4HGQA 4B6JA 4HGOA 1L7OA 5AVVA 3K1ZA 2X4DA 3I1YA 5AKYA 4JDPA 5AI6A 4YH1A 4Y2QA 2JARA 5AKGA 3WKDA 4YIHA 1LTQA 2ZBFA 4Y2XA 2C88A 5AM0A 3QLEA 4BX3A 1U7PA 3B8EA 5ALZA 1RQNA 1Z4NA 3AR9A 3ESRA 3ZVMA 4KYTA 3TLMA 5AIAA 4NFLA 1YDFA 4Y2RA 2C9MA 4UMFA 1Z4QA 5FP0A 1NNLA 1L7NA 3P96A 4UARA 3L5KA 4DW8A 1ZOLA 1RKVA 4Y3UA 1QYIA 4C4RA 2CFTA 5AI8A 5AM5A 2JAUA 1J97A 3ED5A 3OCUA 3AR5A 2C8LA 4OFZA 4OHFA 2PQ0A 4HGNA 3QU7A 1U2SA 4CF3A 2W11A 3QUCA 3VAYA 4BNDB 5ALKA 2CFRA 4YCNA 4UU1A 4H1WA 1U7OA 4CF4A 1MH9A 2Q5EA 4L6CA 1YMQA 3A1CA 4MWOA 4Y2PA 1ZD2P 5AKZA 4UASA 2B1RA 3PDWA 5ALXA 1Q91A 4HYTA 4KN8A 2B8EA 2R8XA 2G0AA 2G09A 2ZBEA 1VJ5A 4E88A 3U26A 5A3QA 3D6JA 4IG4A 2NO4A 4Y2SA 1YJ5A 3WK4A 5AVQA 2WF6A 4BKMA 5A3RA
chains in the Genus database with same CATH superfamily
3JRXA 4PFQA 1BXRA 4DV0B 2OHXA 2B20A 1D9ZA 1HNZB 4J6FA 1RS0A 2DQ4A 1O77A 4KFSA 4M9RA 4DYVA 1G8PA 2E5WA 4NZZA 3RSCA 2XCSB 1JHYA 3DJFA 4INAA 3F6SA 4IPTA 4DMUB 3DMNA 1Z2EA 3V8QA 4RXUA 2G71A 1ORVA 5FHQA 3JXEA 5ENDA 1C7JA 1IDOA 1KMQA 2HRRA 2VK1A 2PYIA 1B3RA 5JDCA 4OM7A 3ACBA 3QE3A 4I5GA 4S0XA 4G4JA 2H11A 3UANA 3FWPA 2QM8A 2HCBA 2Z3ZA 4ZK6A 3IMGA 1KDZA 2O19A 5LOVA 1V8DA 1WCWA 3SR4A 5BN1A 5EXTA 1BYUA 5GGYA 4DLTA 5ITWA 1Z0IA 1Z2CA 2VP9A 4JMLA 3ZW7A 3M4NA 4RVHA 2OD2A 3U80A 3NH9A 1V2GA 2DM6A 5ALTA 1XEWX 4XKJA 1KA9H 4R7GA 1QH0A 1VZ2A 1XZAA 4DT1B 2WD7A 3C4QA 3EGEA 1I5OA 1THGA 2UZIR 4X6YA 3RYHA 5K05A 2A30A 3HSYA 5AP9A 2WF7A 1NR7A 2A14A 3H42B 5FNVF 1EFUA 2L82A 1N2XA 3HJUA 3K0CA 4RELA 4B74A 5IEJA 4BEJA 4INJA 3R3SA 1ORRA 2SICE 4K87A 4FIZA 4MV0A 4OHBA 4HWSA 2AMVA 3FTEA 3OLZA 3EARA 2JH8A 2XQIA 3ITDA 1XHEA 3SDZA 4A2CA 4Z4EA 1N7IA 1TZJA 3R5KA 3WAGA 4L51A 4NPHA 5DLPA 3I04A 3Q0IA 5DIZA 3RRBA 1YHZA 3DYVA 3QE4A 2DH6A 4PZYA 3RVLA 2YMMA 1VE3A 3M6MD 3RU3A 2XZPA 4M3NA 3H5VA 3RSFA 4BNMA 2UVPB 2KMLA 4J6EA 3ZHVA 5LQDA 2WBLC 1HZZC 1ZUIA 2AEMA 2Q2OA 2QX6A 4GI2A 3UENA 3PITA 1VLLA 4PN7A 2TSYB 4B3BA 7MHTA 1Y1SA 3GEHA 1WXXA 3KPYA 4B8ZA 4LVUA 1BHJA 4KL8S 1I3LA 4J0IA 4EQ6A 1Y34E 1O1YA 4E1VA 3X1DA 4G0ZA 3PVSA 1EJ0A 2BFBA 1RRCA 4HRYA 2QTRA 4H6WA 4HP8A 4QVKA 2HJVA 1U2EA 2CJWB 1Y89A 1P72A 2MYNA 3QPUA 2QRMA 5D87A 5JAZA 1QDLB 4DT1A 5CDSA 4YLEA 3I28A 3IURA 1YDEA 1ZNXA 3PXDA 4L95C 3A2LA 1PL7A 1KY2A 4CV1A 4AS1A 1XRNA 2PWBA 1M6NA 5I8ZA 3WBFA 1T1IA 1CYEA 2A0KA 5ENVA 2KBFA 2NOAA 3D1JA 4DG5A 1DJPA 3FHJA 5HUQA 2PS0A 2YRXA 3AIKA 3TLCA 3IPRA 4XVHA 3GDGA 3LA6A 1EBFA 2AI1A 2Q6LA 1T1EA 2VDJA 1UWKA 4RAQA 3IJEB 1NQ5A 2NLOA 1NTOA 2KE5A 2YWGA 1SXGA 3CEJA 1D7AA 2IITA 3IXQA 3O94A 2XOKA 3ORHA 4OYLA 1E1MA 5DF1A 5BQXA 1FZTA 2ZI5A 1DG3A 3OD5A 4G1CA 4P58A 4DC1A 4IZ6A 3MPOA 3AILA 2CNDA 1O5TA 2R7MA 4CM4A 1EFAA 3BL5A 5C9ZA 4M89A 3PU6A 2VP6A 1USIA 1XNJA 3C3DA 4RLQA 4YMSA 1FW6A 3MWEA 1GQQA 2QJOA 5GZ6A 5FB3A 1LI7A 4QOGA 4EVSA 3ELUA 5LMNB 4JC5A 5JEDA 1B93A 3RDPA 3QITA 1PWHA 3WLQA 5ICGA 2H08A 4BZPA 3FHTA 3OJFA 2VT3A 3TUIC 5A0VA 4OREX 3L4KA 2ORVA 3NP9A 2CJWA 1AUPA 1Y63A 3HUTA 5CM2Z 4DZRA 3TQHA 4IX1A 2GGSA 3OU2A 2Y0EA 1DCTA 2AR9A 2GCPA 2REQB 3T5GA 4GVPA 5IU6A 2X7HA 3U40A 1GNLA 3QX8A 4J1NA 1ADBA 4O8ZA 1IHOA 1NJ6A 4NYJQ 4G9GA 5K0GA 1GZ6A 1O6FA 4OJQA 1Z4KA 1FU8A 2JC3A 2QSYA 2Z5VA 4NDZA 4C5BA 5A4DA 3JPYA 3VC2A 5JC1A 5KNDD 3HM9A 2HYDA 4GU5A 3MXOA 3NYWA 4FPXA 7YASA 2VK2A 3S2SA 3TEFA 1ORTA 3PRHA 1R9NA 4AUNA 5BMVF 5HIKA 4CNQA 1ZNQO 4DR5B 1URPA 5T6MA 1DBSA 5I01A 1PWZA 1N5RA 2HF7A 2W2PA 3B1KA 4Y2HA 2F3UA 4J03A 1IN4A 1IAVA 3W8DA 4F1KA 1GLNA 1FFYA 3DDOA 3GAMA 3ODPA 4ER6A 4D79A 5A6VA 2R8OA 4EH1A 2A1TS 2D1TA 1E0DA 2JAQA 2QL9A 2YZMA 3GZNA 3NX4A 5C35A 1JSZA 4CLOA 2NZ8A 2RC5A 4EVIA 1QIEA 1PR5A 5IJ9A 3KVVA 1KVUA 3FFAA 3HWX1 3ES9A 2WD7B 4B35A 1VC2A 1BGVA 2V6BA 1GL3A 1FTWA 1CUWA 3QUQA 3PFKA 4YUVA 4Z54A 1II8A 2PG3A 3OZRA 4RGYA 3LX8A 3MWGA 3O2NA 1ZWKA 4ZYTA 1Z0ZA 1J0CA 5H0IA 2ZT6A 3ORYA 3RFFA 4X64B 1KWGA 4P82A 2QZ9A 2C5GA 1L1QA 2ODAA 3IESA 5IKOA 1NBME 3JQ7A 1ZW1A 1EFVB 2X6QA 3LF2A 2QMUA 3ZS8A 3GUCA 3B9QA 3EF1A 4L8VA 3ULKA 4EPWA 1IXYA 6LDHA 2QENA 1XNGA 1L7MA 3CF0A 4EOGA 1XZFA 3VJMA 1EK5A 1B1AA 1E8DA 5EKUA 3ACDA 3PNMA 4PR3A 4BGDA 5KTMA 2NSLA 3GLKA 2Q3MA 1SUBA 4R51A 1PKEA 1M1YB 3MT9A 1V5EA 2IPAB 1DJOA 4ZPJA 5E38A 5C80A 2O59A 3NCTA 1KVQA 1A98A 1FSPA 4BJHB 4RJJA 3ZWPA 4PPGA 2ZI6A 4U7HA 5ERYA 4LOAA 3Q3EA 4HXGA 5EUMA 4CFSA 1T5BA 4RPHA 2QB5A 4RVSA 3OE7A 2EL7A 4ZEXA 4P08A 1GA6A 1V5WA 4AP6A 4LGVA 4HS4A 3KTAB 1OY1A 3V3TA 4E5DA 4CF7A 5JUWA 4CKWA 4ZKDA 1ZY2A 1ISJA 5EHNA 4R1OA 3QP9A 1DB3A 1AU9A 3KUCA 1WP4A 5FOWA 2XDAA 2C59A 2GPJA 3FROA 4I3HA 1D6NA 1G2IA 4ZO7A 3COSA 1FSFA 3EUFA 4KO8A 1O89A 3FNBA 3GLHE 4R5MA 3S2UA 3ZV4A 2J4CA 1ILWA 3O03A 5GADl 2C31A 1SRQA 2FUKA 4I1RA 4Z7QB 1YOVA 4E2ZA 1YJ8A 2XE8A 5K9ZA 1XP5A 2JJQA 4JWKA 3DHEA 4PYLA 1XRMA 3ZJTA 3N2EA 4KWEA 3UNXA 5IKMA 4JNCA 3COJA 4GE0A 3R6DA 4PSDA 2FAXA 4S35A 3FR8A 4QYTA 4UBJA 1YB7A 1XC7A 1HE8B 4DCJA 3KXKA 4E1BA 4H6XA 3CZCA 2GZHA 2C5AA 2ZSAA 4RGVA 2BT4A 2FK7A 2IQ5A 4R0NA 1MQ9A 3SHQA 1P2FA 2ADMA 3PFGA 2ATEA 3TZCA 5IARA 2CMGA 2H4HA 4GL4A 1ZMTA 2W93A 3C24A 3MLBA 5LFAA 1N2HA 4XVRA 5CYGA 2C1ZA 1HT1E 3PQ7A 1CX9B 2D06A 2XH8A 4DDVA 2ZRKA 1Z5WA 2JFYA 3ITKA 4I99A 4TWIA 4ISBA 3AEUB 5FL3A 2J46A 3HBJA 2A35A 3QNMA 2DY1A 2KHZA 3C7TA 2X1VA 3F7MA 4H16A 4J8PA 2N0SA 1E69A 5CURA 3L7BA 4GM1A 5HK8A 4OQEA 5LMUB 3HKDB 4TZKA 1MOQA 1QOQB 4KQHA 5D85A 5FUXA 3ZCVA 4XGKA 2QORA 5FWAA 1L1RA 1YIDA 3EEFA 4UEWA 3R7AA 3DLBA 4RVNA 5B58T 1R6XA 1ZVMA 1NFRA 2B6NA 3BRWA 3HY4A 4FI3C 3MHTA 4X54A 1Q0QA 1VHTA 2I91A 4JR0A 3E9MA 2AC2A 3FYUB 2G70A 1R2QA 3F49S 2YIDA 2RIRA 2Z6UA 2AI2A 3SS7X 5EWMA 1N2EA 3IPYA 3BVPA 4OI4A 5DM70 1E4EB 1J0DA 4IXNA 2O0KA 3JYNA 3NDJA 5JCZA 5DHQA 3I72A 4O4JF 2BI4A 3G23A 4H15A 4WQMA 1G18A 2O1WA 4P36A 3OVMA 5J63A 4BGIA 2A5FA 1A4XA 1U8YA 2O2GA 4JUIA 3WWZA 3B3AA 4UULA 2CJXA 4F38A 1SPXA 5AWFC 1ADJA 3IP8A 3CX3A 3OM0A 4CM3A 4X62B 2IA5A 4MKGA 2G9ZA 2R751 1FL9A 4YHBA 4MUGA 3KVYA 3U6KA 4NBRA 1UEIA 2A9FA 1RI5A 4H9GA 4I7EA 4M36A 4M8IA 1C5KA 2FQWA 3DBVO 4WACA 5EHGA 4ZCLA 1LD3A 3TW8B 3S7TA 3PIRA 4KPUA 2HL6A 3E9EA 2A4MA 2WUWE 5B2ZA 4I1SA 5JH7F 3KOUA 1EE2A 4YDQA 4TS9A 3O83A 2PUFA 3K20A 4WEOA 4EP1A 2JK0A 3OO0A 4KXNA 3ROTA 1TKCA 3I39X 1WHTB 2DCMA 1U7XA 3BH6A 2I6QA 3BHIA 3EBPA 1Z7YA 2QZJA 1V3TA 1NLFA 1YKFA 1XZDA 4D6YA 3W2HA 1I14A 4YPFA 2VT7A 3L3BA 1OI2A 2O3RA 1P0PA 1SBQA 1VL6A 1M8GA 3UYLA 1U2RA 3OZDA 3P5BA 3X1JA 5IDXA 5L95A 1YF3A 1FC0A 3PE3A 4UQPA 1U0EA 2JZOA 5BNTA 1OZHA 4ZAVA 1E1CA 3H1EA 5KU1A 5HMLA 3COZA 3V48A 4BEBA 2HDHA 2AK2A 1CUUA 4XFJA 3OQ6A 4CIXA 2XQJA 1Z5OA 3AR6A 3NXKA 4YQEA 1TZKA 3MWLA 1W96A 3TW4A 1HUQA 1YQDA 3KBBA 3G1UA 1YXMA 1DRKA 1JN0A 1EHCA 3CH6A 3R8XA 4EO9A 2IU6A 1CY4A 1KO1A 4KAJA 2A5GA 4AJNA 2OG2A 2R5FA 1VGQA 4BAUA 3KB8A 4X3CA 5DYNA 1CUDA 3RS9A 1LLDA 1YBVA 4AY3A 2OCYC 4PHFA 3W3ZB 3PC4A 2Q2QA 4TKUB 2NV2B 2ZJ6A 1A27A 3CSDA 3I4FA 3M83A 4J1SA 3T5DA 1XJ0A 4PSUA 4XUEA 3F74A 5ELMA 2IQIA 4OX9B 2Q46A 5EMLA 1Y4ZA 2OMKA 3H3XA 5GAJA 3KX2A 3U1TA 5A5GA 1GZSA 2VQDA 3IR6A 4D96A 2OQ2A 2GF0A 1JALA 4DDMA 1NN5A 5AKGA 3WKDA 2DX7A 4YB8A 5GJVC 1X77A 1SBNE 1WRBA 4E1AA 4E51A 1CPYA 2PUDA 1CF9A 1JE0A 3NM4A 4E70A 1U3DA 2X86A 3DO5A 4JX9A 4CTNA 3DQZA 1TC2A 1UP7A 1RQ2A 4Z8XA 2GZMA 2BPOA 3L8CA 2H2IA 3O3MB 4JS0A 4PLHA 4Q1DA 1ZM2A 2PV0A 5EKTA 4RW0A 4B81A 4NFLA 5CDTA 4AECA 1Y7PA 1GTMA 4DIEA 3G17A 2B4KA 2C9MA 4MLCA 1GITA 2ENWA 4DBLC 6NULA 3NIGB 1AH2A 2PKCA 1ESCA 2NO6A 2WJPA 2ZAMA 4O2BB 1GRCA 1Z74A 2FF7A 2FRDC 2GZ3A 3UAZA 5E7JA 4UAJA 3HM2A 2ERCA 2UUOA 4YRPA 3GG2A 5KVSA 5A0FA 2OV4A 4RKRA 4L72A 3NDRA 1GNVA 4OGFA 1QHHA 5LXTB 4X1KA 3R3ZA 1EVYA 1DIHA 4WLFA 5DYYA 3I2YX 2DBZA 5CYOA 5C8XA 3OOYA 2QA5A 3HTXA 1R9GA 2XWSA 4REMA 3EIFA 3MT7A 2EZUA 4I46A 2P2ZA 3GJSA 1XQXA 1UP6A 4P4UA 3EZLA 1M6WA 3V80A 2A9VA 3ZWNA 4PR0A 4WK6A 3IVCA 4BNDB 2E2WA 2IXTA 3K5HA 3TLZA 3UWPA 1PS8A 2Z09A 2GJAA 2Z4TA 4RK6A 1MJGM 2Q5EA 1JHRA 1S89A 1UJCA 1V3VA 3I83A 4L6CA 4U9IS 5FR2A 5JAIA 3WGOA 5KDDA 2OXRA 3P9QA 4R69A 2GETA 2P5TB 4TUYF 4KXQA 1R4MB 5ALXA 1G98A 4GOND 1TIKA 2CVFA 3A4YA 1PJ3A 2HYIC 5DHUA 2IXBA 3B3GA 4RD0A 4XA8A 1BU8A 4IGIA 2L42A 3MYRA 4E2XA 3L0OA 5F5LA 4HZUB 5AJTA 5G02A 3VZRA 4J49A 4OK3A 1OI4A 1TQ8A 5E1BA 4Q00A 4C7XA 3F4KA 2PX6A 5HQTA 2WFLB 3OZUA 4PZDA 1CS0B 2BY4A 2ZXFA 2XTMA 1KQ3A 1U9JA 3T0IA 2KM1A 5A1JA 1GTL1 3WHKA 1XQYA 2A0XA 4UAGA 4COKA 4FDMA 1XCJA 2Q4EA 2ZPUA 3CUUA 3CB2A 3IP1A 3QLJA 2YQZA 4JEHA 4M55A 4DWJA 1GPJA 5KNDA 5KTTA 4Z4GA 1UBGA 3RT7A 1NE2A 1VG8A 4F45A 4IMPA 1JB9A 4OQXA 4U9UA 2V3WA 2Y99A 4FMDF 4TTSA 1RBMA 1JR4A 1UBRS 1WXWA 2ONYA 2Z8ZA 4FUQA 5DOZA 4F96A 3AEYA 2JASA 3IT1A 5DISB 2XCIA 3H5RA 4N7RA 3Q8XB 1HMPA 1O9BA 2GFIA 2X5NA 3QSGA 4K9LA 2ACWA 3WFIA 3VPDA 3EPHA 4JR1A 4LV5B 4BNTA 3NVKI 1E18A 2OVBA 5EA2A 3WIUA 2AG0A 1IWBB 1R8XA 1CNEA 2CHGA 4RS4A 1CIVA 1U99A 1J0XO 2E85A 4MV4A 4QARA 4WKOA 4L5IA 1J49A 8OHMA 5FT9A 5BN4B 1QE5A 1SXJB 3UMBA 2P78A 1OB2A 1YKSA 3LQRA 3T9CA 2F62A 1TMGE 4ALNA 3Q2IA 1YZ3A 2FPWA 1TZMA 2C7BA 2WJGA 3AESA 2HF8A 4B3XA 3FOEC 1KBQA 4K6MA 2W8BA 2P3QA 4MCAA 3G02A 4CF6A 4X71A 3WLKX 5DP1A 1C0PA 1NRJB 3OFND 4I50A 1U2DA 4ZO9A 1FVHA 4QUGA 4C07A 1QRSA 2WZBA 4A2WA 1I94B 2J7KA 4DJEC 2UXDB 4JI8B 4MIEA 5L8VA 1NSTA 1AKNA 1SKYE 4C0SA 3GCGA 5DV9A 2TMDA 3FPFA 4EF5A 1KVSA 4MV3A 1SRRA 2YY6A 3GAAA 4N8DA 3FDFA 5DB4A 3L1UA 1E8NA 1Y4AE 4BU0A 2SECE 3O1JC 5LP1A 2RGNC 4PX2A 1S7GA 2PIAA 1F8XA 1NW6A 4A6XA 3AHCA 1B2LA 2HWUA 2PCJA 2FE1A 1TK2A 3L0PA 4PFJA 4REQA 1JXQA 3BXZA 5LYJF 5MHTA 3CMMA 2BGIA 4RTOA 3IO3A 1E6KA 4IRUB 5FH9A 4AFNA 4HB3A 1OTHA 4ZRMA 3AV3A 3TOZA 4AN0A 3C0KA 3F8SA 1ZUD1 3QVUA 2BGGA 1R6VA 1X39A 2CDRA 4P4NA 1ZRSA 4Y2VA 5BN4A 2JIZA 2BHRA 3LC2O 1DELA 1XAGA 1PX0A 4O2RA 1TYBE 1K08A 2FCAA 4DCVA 2DLDA 2H3HA 2Q8PA 3A8TA 1D2HA 2FPIA 3LPMA 3ONWA 3K5PA 2E89A 5ESDA 2V8OA 3SBDA 3K4QA 1KARA 4DMRA 3NNNA 1FQJA 1R74A 3B52X 3H2ZA 3ZGYA 1NN0A 5EFZA 1K3UB 4CLEA 2RHDA 3EFOA 4D3XA 3AUUA 5JQGB 4F5ZA 1GPKA 4L6AA 1JA9A 4OK6A 3U7GA 5BSGA 5TGTA 1UAAA 5BV8A 1KFCB 1NI4B 1U94A 2DFNA 2PAAA 5DULA 5FUMA 3PK0A 4CCWA 4M0CA 2J3LA 2OZLA 4RSGA 3GB9A 1O4WA 5BRAA 5CFNA 5A2QA 3HI6A 4M37A 4F3TA 4XYBA 1BX3A 1BCRA 2O48X 4WZBE 3K0CC 4ILKA 1E20A 1W9HA 3W2TA 1M54A 4FEEA 1XMPA 5J4VA 1GNQA 4GPZA 4OHWA 1AKTA 3RBAA 3OFSA 1TU4A 3PS9A 4JBNA 3UT6A 1IY0A 2O2DA 3HDYA 1U63A 4MTLA 5KYNA 1CZKA 3QX3A 3H86A 1T4BA 4YDSA 4KLAA 3DSRA 1BMDA 1U3CA 4H60A 1A5ZA 1U04A 5J9FA 5SZHB 5LD2B 3WGMA 4GBED 4IIBA 2BLLA 1RP7A 5T3YA 2XMGA 1ZDMA 4TL8A 1ZLYA 4RLFA 5E95A 3UC9A 3W0LB 1XL1A 3BGSA 1V11B 2I3BA 4ZHQB 2ATCA 3EC2A 4BLSA 2AOWA 5BR7A 3ESCA 4DMLA 3CH4B 1KYTA 3RIEA 1V7ZA 3EQZA 4UBIA 3IAFA 1EXVA 2P75A 3NO4A 2Q9CA 3ZDXB 1KH2A 5DHAA 4Q9AA 3G2QA 1A8PA 6AT1A 1W4ZA 3MW8A 3ZD8A 4JWTA 3OOJA 3PKJA 3LUHA 2VXBA 3JYOA 1WXHA 2BEWB 4RBNA 4O4HF 5LB4A 1H9AA 1CWUA 1NXXA 3C3JA 4ZU6X 3BX1A 1RPJA 4GHWA 5FI1B 4B4KA 3B82A 3LXMA 3QXSA 4N3AA 2XTNA 3VH4A 2FPPA 4GX0A 5DM1A 5D51S 5ECDA 4LK2A 5G0VA 4CQMB 1SKAA 3WAJA 3Q5GA 3LGAA 2J33A 1KYQA 1AQUA 2VFAA 4M53A 2WM3A 3BWMA 3K09C 2OXFA 4XX0A 4F2WA 1WSDA 2A0YA 1QRDA 1KEZA 3V55A 4HXFB 4ZVVA 2EFEB 2GLUA 3K9QO 2OCKA 3ISVA 4YA6A 1SQ5A 4Q5IA 3C4JA 5HE8A 1ZU4A 5DWQA 1PGJA 1XTSA 4O4JB 4DKXA 4DJAA 1XDUA 2WLTA 3KT3A 1L5GB 4AXBA 1G19A 4D9FA 3TLXA 1W36D 3WLLA 1X2BA 3N8KA 4W5TA 3P9NA 3GZJA 3OJWA 1EM8A 1VMIA 1V4NA 1WL8A 2Q4TA 1MGOA 4NARA 2GZDA 1HNWB 3B5JA 3PHLA 1XJQA 1DSSG 3GT0A 4I9GA 1LC3A 1C7QA 2AEJA 3CZ5A 3GHHA 4KXLA 4RHYA 1L9KA 5BN5B 4GSLA 4GNKA 5ERGB 1E6UA 2DWQA 5AMXA 1DHTA 1X80A 3T9BA 4RCVA 6GPBA 3LT2A 3UZUA 2JG3A 4UEQA 5GGXA 1NRIA 1NW9B 5FEUA 2OA0A 4BO6A 5DI3A 3Q41A 3FXAA 4N7MA 2GILA 2P9GA 5BMVB 1OGIA 3SE7A 1J99A 4MVYA 5AO9A 3AM1A 2IIPA 4EFDA 2FWIA 3LT5A 1UODA 3ZBUA 1YR6A 3TAHA 5CX4A 4DV7B 1SCNE 2XODA 1J2UA 4YI3A 2P2LA 1YZUA 1U8FO 3SIPA 3QMVA 2BR5A 2JFVA 2PXXA 2Q4DA 4CQLA 1ZI8A 3A2MA 1NMYA 2H2AA 3L6DA 2QKYA 1PI3A 3UJDA 1HQYE 3KYCB 5U4XA 1I10A 5TF0A 2AWOA 3AR3A 2P62A 1TA0A 4TOIA 5LZ2A 4YJKA 2HSJA 2YXPX 2VP3A 3E2IA 3GW8A 4D25A 1UFVA 2HDOA 3DW1X 2X6TA 4BYGA 4KN9S 4UHEA 2NXNA 2ASVA 3SIWA 4CGYA 2V5VA 3CZQA 3RV3A 1XE3A 4YS6A 3OM1A 1MO3A 4PU0A 3M6LA 1H85A 2QPOA 3L01A 4HADA 5HG0A 4JHLA 2JHCA 1Y8AA 4X8HA 3PJRA 3EIEA 4RJIA 2OFFA 4M9CA 4EBFA 2IYYA 5E4FA 2FWPA 1HE2A 4MAFA 3T1YB 3KYBA 1PFUA 3UHPA 1ETHA 4HGPA 4Q93A 4CL3A 4EGCB 1EWTA 3NHAA 1WPGA 3A3KA 2IH5A 3DQPA 5HKAA 4HUQA 5LA6B 3DKRA 4LE1A 1IQPA 2Q0XA 4QA9A 1XK6A 1OYWA 1OFVA 3VAAA 2BGTA 4ZEOA 3DKIA 1A96A 2YC2C 2GQ0A 3VR5A 3HN7A 1EDEA 4EPYA 1OFHA 1ZN8A 3JCZA 1GU0A 1AGPA 5ALGA 3LLSA 1ZL2A 5DTMA 3FCOA 4JQYA 3ZZNA 4HJXA 4OKIA 2Y1CA 4H3KB 1U5BB 3EZFA 4ZANA 4AKIA 221PA 3AJ9A 3B1XA 2E4YA 5KCZA 3A4VA 3ZE8A 1QC5A 2G77B 3FBWA 1V95A 5A5EA 2FPUA 3OMXA 4K0RA 2GHRA 1NI3A 1Y48E 1ZN2A 2CKDA 4POOA 1KO8A 4F1JA 2OXEA 4YHHB 4FZ5A 1VHJA 3V4FA 2FZEA 5EJ6A 4JCCA 4JT4A 2VPPA 5CT5A 3W1VA 2EDCA 2VWQA 1SUIA 2EX4A 3AVOA 3QYAA 5IM4F 5ALQA 4LZOA 4ZMSA 3CNBA 2EKZA 4B17A 3LPLA 5LOVF 2H48A 2PQ6A 2IYOA 1FP2A 3VTKA 1EBBA 3AEXA 3N53A 3W5HA 4ILEA 5DN6D 3UKJA 3KDSE 4ZO6A 1YBHA 1QKJA 4FKZA 2Q7DA 1BVYF 4ZIRB 4L9RA 4II3A 2CSXA 1NC3A 1N32B 3QWFA 3CZRA 4WLUA 4XLZA 3LUDA 1XVVA 4TKVA 2IL1A 3KQPA 3QF4B 4D6XA 1PLJA 3A28A 3KOZA 4WKGA 3ZXUB 3UXEA 2DOKA 3GUUA 4DPKA 3G0CA 3PG5A 4RH3A 4YCLA 1DINA 3PGA1 2QZ4A 4B87A 4AI6A 2ZE8A 5CNMA 2QAJA 3E6AA 4ZO4A 3WMFA 2O7NA 4C0QC 2BRUA 3AJAA 2SHKA 2NYAA 3GRVA 3TLYA 3S1AA 4LUCA 1QG4A 3DZHA 1AZWA 4GE3A 5EJEA 3KKKA 3HKDA 1C14A 2GPNA 4DEYA 1J00A 1EXDA 4B40A 3ORRA 4RDXA 3MELA 1VE6A 1TC1A 4GPEA 2HK8A 2PJZA 1Z8HA 2FZGA 1CJKC 3E4CA 2P9HA 4GKBA 1GARA 3PWKA 4OYYA 5FOQA 1GZHB 1K7FB 2R0QC 1WKBA 2FK8A 1MA3A 3LG2A 3WE7A 1B23P 5KTNA 3NS7A 3P52A 4DCUA 1I1NA 5TMPA 5AVWA 4J7CA 2YYAA 4Y9SA 3D2CA 4LYGA 4N7BA 3L7IA 3CLVA 3HU1A 3C43A 1AUXA 2J3DA 4R6WA 4GM4A 3WL4A 2FZLA 5FFFA 4HRVA 3WIEA 4A92A 1QOPB 1L4UA 1T8UA 4E46A 4CT4B 3V1TC 3KQNA 1Q21A 4N12A 3G2NA 3LNCA 2JLYA 2NIPA 2FW6A 5I7OA 4CT0A 1PTJC 2QUKA 5B3KA 3GT7A 1CRQA 3HA5A 5CRIA 4RD1A 4CMAA 3NTVA 1QK3A 3VISA 4AZSA 421PA 2Z5FA 4U02A 3A6FA 5F3WB 5CGQB 4R7TA 1EP3B 1HX7A 4GMFA 2N3ZA 2PXAA 1CQJA 1YA6A 4J3FA 2JGKA 2QVYX 1ZWLA 5JS6A 3ETHA 2IZ5A 1E9CA 3ZEIA 5IAEA 2E6KA 1NNI1 4MWCA 2ANBA 4YCMA 1X7XA 3E1SA 1L4NA 3QPCA 1EUDB 1YB5A 5JLAA 4P5EA 3KQVA 4EZBA 2QWXA 4B4OA 4YRGA 1ABEA 3PPXA 1DJQA 1XV5A 1TF5A 1Q0LA 3PDCA 1Z82A 2QRVA 3ZUGA 4UFNA 1JWBB 2HEIA 3NHJA 2IYAA 2RG7A 3PCTA 4KN6A 4QUKA 3Q5DA 2RJNA 3VHXA 2GM5A 3NGXA 1M2NA 5BWBA 1HYEA 5LU9A 5FBHA 3WNCA 4BQOA 2XBUA 4IIYA 3FNEA 2IHNA 1JLRA 3QUTA 4HGQA 4ARZA 4HGOA 4C6SA 3ZHZA 4PZLA 2MMCA 5JE8A 1TA9A 2ZATA 2QPLA 3KALA 4BIMA 3PWTA 2AOUB 4D43A 5BXYA 2Q4BA 3L4JA 2OZLB 4LHWA 4ZD6A 2ZQ5A 4OLHA 4D4MA 4Y2XA 1ICEA 1R5NA 5EIOA 5C7YA 1QF6A 1KZ9A 2NUAA 1VGVA 3EQ7A 5CVDA 3ZBPA 3L7OA 4FDTA 4M9SA 1VJCA 3C97A 3LCRA 3PGXA 5GY7A 1L5QA 4OX9Y 1G21A 3KKEA 2H1OA 4BE4A 1NI5A 3E9QA 1CERA 2HPVA 3QPVA 4J0GA 1Y1LA 1CDZA 2W2QA 5F12A 3F90A 5HJ2A 4GUDA 4Z1MA 4KG7A 4EDFA 4C4PA 5FUQA 2GN0A 2XQFA 5KC8A 3OUTA 4WI1A 2H0QA 4ZZ0A 3VX3A 1JV2B 1NNLA 4MVJH 5JJ5A 1SZJG 1EWQA 1ZIDA 4DLKA 4D0SA 3PLAE 4CLRA 4EAQA 4YJDA 1SCUB 2ZVDA 3UB4A 3IMEA 4MPDA 1KPHA 3GZNB 1FUYB 4HRXA 4CUZA 2EG9A 5I7HA 4BCDA 1F5NA 2V3CC 2Q0QA 4FSHA 4BLRA 4H77A 4WXEA 3MILA 1G6Q1 4Y6SA 2X77A 3VU8A 2WFZA 3U3DA 4BNKA 4JVOA 4U7FA 2VJAA 3GLFB 4LXIA 5CT9A 3L7AA 3WOHA 1KMNA 1V1RA 1XWWA 2VHJA 1M10A 2NTVA 3LVFO 5TEWA 5ALKA 1X6VA 1WDKA 2JCGA 3AI3A 3NPAA 5JJIA 1CF4A 1RQ7A 1DAOA 4D1YA 5GV7A 1OKKA 2FGKA 1Q1QA 1Q84A 1QK4A 2EZ9A 2OO3A 3JQBC 4J76A 4QEZA 4U7PB 2F2TA 4R9VA 4WEQA 1ZD2P 2VNAA 3H1AA 3ZV3A 5AKZA 4UASA 4C0JA 4COOA 3VDNB 1E9FA 1FYXA 2P6NA 1Q91A 4ZFNA 3V7WA 1IZ9A 4PWYA 3LZDA 3P2YA 2UYHA 4MTCA 5EGNA 4HDCA 1EFHA 4OTZA 3ZCXA 4BP1A 4Q7LA 2Q2WA 3CF2A 2XIJA 1L9XA 2BEVB 1ONBA 1TQDA 1OYOA 3Q3HA 3QLTA 4WY8A 2UKDA 4WJLA 2FPKA 2VEOA 1YJ5A 5G0TA 2X9GA 1JGTA 5A3RA 4PGFA 5IWCA 1KJNA 2GXSA 4URZR 4JSYA 4G9BA 4AWBA 4CR6A 1IEXA 2FFQA 2JRCA 2XA9A 3J7TA 3OTHA 2IS6A 2XUQA 3MS7A 1HOXA 1ZOOA 2Q4OA 3QKSA 4QTYA 4DC9A 2JZCA 1ZUNB 2ZP1A 3MG9A 3DTVB 5KYWA 5A04A 2C0QA 2FMTA 2XBMA 3OOHA 5IW8A 3JWPA 1Z45A 1FX1A 3NATA 2JKYA 1KY3A 4MW9A 4MWDA 3ZXXA 2JCVA 4R4JA 3E3OA 2PN1A 4U2CA 2QBYA 4FJ0A 3QNUA 3QX9A 1W44A 3IC5A 4N01A 3H5LA 3O75A 4FZJA 1JLLA 1CTQA 1T5LA 2UYGA 3V8MA 2DBQA 4FMCB 4K2HA 2Y9MB 3RFUA 2FUNB 5U1PA 1Q1ZA 1JLMA 4M9UA 1I3CA 2ZI3A 3EXHA 1T3SA 5IF9A 1OA1A 1FTNA 3GD7A 3HNPA 2X5XA 1WDWB 2ZBVA 1P81A 2X4GA 4V2IA 4HZUA 4YV1A 4BVLA 1GAXA 5LVAA 3QYJA 4C0XA 4LRXA 1PR2A 2JFBA 4TMFA 4GYYA 4LGCA 1MR3F 2WSLA 4PIVA 4Y6QA 3ZDCA 1EFLA 3G0DA 4N0DA 1PR4A 5KOHB 4M87A 4PNEA 2Z1NA 1SM4A 1C80A 1SQ0A 3K1AB 4RTLA 5MN5A 3IVRA 2W98A 1UT5A 1G4HA 4O0LA 4LOHA 4UNSA 5I9MA 3C6MA 5DTJA 5J2UB 1DAGA 1T35A 5E7MA 4CMEA 3NAZA 3QF7A 1MJ5A 1WIWA 1WJGA 5F2EA 4B3DA 1YR8A 3B7GA 5KX5B 4UZSA 4LJ7A 2ES4A 4XWWA 5IT0A 2VHTA 4G5XA 4D02A 5J4KA 1Y4DE 3ANLA 3ZZ1A 1Q14A 5E6SB 3SHFA 3WLPA 3RIHA 1YASA 5K0CA 4URUR 4PNHA 5KJEA 1AY0A 4NCHA 3STWA 5F9MA 1C3EA 2CFSA 3RB8A 4AUMA 2ZIXB 1Z83A 1NVMB 1NVAA 3EODA 1DC4A 3FNQA 4GLOA 4H31A 1TK3A 2HMTA 4A6EA 1G0OA 4OQLA 2DAPA 3DMTA 2UYCA 1LK7A 2GBLC 1MB4A 1VJGA 3EG5A 1NR1A 4JJ7A 2DB3A 5ICEA 3ADBA 1BQ3A 1Q1GA 2FEMA 4L4UA 4W5WA 5SY4A 3BWEA 3D2AA 4MIOA 1CZNA 4O2BA 3SMQA 3V1LA 2FN3A 5HIAA 2I3DA 2GAIA 1ZOSA 2JAHA 1IQ0A 3B1WA 1Q1AA 3LT1A 1HOTA 3F3YA 2IUYA 3MHPA 4OHUA 3RYHB 2WM9B 4DIMA 2VTBA 1NYQA 4E3WA 3LCJA 2H4JA 3L05A 4NBTA 3DFZA 4QNRA 2V9PA 2COUA 1V1MB 2C98A 5ILGA 5AR1A 2IOQA 2HCJB 4DAOA 1TRHA 2CWWA 2LIVA 1JFLA 2R96A 4FXOA 1JECA 1P80A 2FYTA 2HI0A 4LYEA 2QRQA 5EVCA 3P4UA 5GQSA 1BXGB 5EMNA 1HT2E 2SCUB 3VZBA 3CLUC 1KMHB 3OIFA 2XTAA 5ENZA 2VHYA 2ZS9A 2QN7A 3LO8A 1TIBA 4IVRA 1LLFA 1WCXA 3EYAA 3NKVA 1RHMA 4GEGA 2X13A 1F9EA 2V1UA 2JBAA 5EJGA 4MJ3A 4QPNA 2VP4A 2D2EA 3K8YA 1N78A 2INGX 1MQAA 3DAHA 3DL7A 4CE6A 4FM9A 1WB6A 2O8CB 3IEMA 4MCJA 2JFPA 4HDMA 3RAFC 1ZH6A 1M8JA 3TDNA 3DFKA 1BMFA 3EG9B 3LD9A 3WZ2A 1E4YA 1M2FA 1GY8A 1H2ZA 4M86A 5ITVA 3N28A 4NHEA 3LBHA 4HJRA 3S5JA 1TJNA 1I2DA 5DX8A 4EG8A 1I0LA 3A05A 3C48A 1Q1EA 4MKIA 4Q9HA 3U4HA 5FPKA 3JVEA 1E77A 2YXNA 2XKAA 3K9GA 2CHUA 5TRTA 5JBIA 2FW1A 3SHOA 1WZCA 1U4OA 3EOZA 5HDBB 5JPDA 3PEWA 4BLWA 3KD2A 3VNBA 1TF2A 2PD6A 5CEFA 1M33A 1TJ4A 2J9YB 4JELA 4KQKA 3OQPA 5SYMA 2VDLB 3RJZA 5IXSA 5KWJA 1Z36A 3F1KA 1ZRNA 2QE7D 1QE3A 5HZKA 1OXUA 3K9HA 5IK2D 1Z2NX 2W6QA 2YJ5A 3R7WA 4EY7A 1VLQA 1PLLA 4UPEA 4OI2A 3IS3A 1KDOA 3S6JA 5AK4A 2XE6A 4AJEA 1LV8A 1S8NA 1WMFA 3E03A 4Q4HB 2HLHA 4UCWA 4W1SA 3SXJA 4BMDA 5EMJA 5I7FA 1RACA 1T3LA 2HB6A 1GQFA 1TKAA 5ERXA 2XMQA 2CNKA 2ADFA 3THWB 2W2XA 4UNQA 2OHVA 1GL6A 3FJ1A 1UJ2A 1AGXA 1QH1B 3HVUA 5CIQA 1K2WA 4XJTA 3JAWB 3ZHSA 2HU5A 4C7KA 5FPTA 1AHPA 4NWIA 2BR3A 2BZGA 1BS9A 1I3NA 1T8YA 2ZJ1A 5FLEX 2WYVA 4E5YA 4DSZA 1ZN7A 1CT9A 5BQOA 4CHTA 3K53A 1XRPA 2MINB 5EIEA 1YIAA 3R3VA 1ZRMA 4HYQA 1V2HE 3OTIA 2HPHA 4JD5A 4A0RA 1EDDA 3FYUC 4I55B 5B3AA 4YT4A 5I4KA 2YZKA 2AWNA 4FINA 5CVJA 2BGUA 1QYXA 3F1LA 2Q2VA 2APJA 3NT2A 1G7TA 2X41A 3IIKA 2G9VA 2YV5A 2QXYA 3P4XA 2OCXA 3IR7A 4ZDKA 1O6BA 2OCBA 1B8UA 1A77A 2W6ZA 4TTIA 2ZBPA 3QMMA 5TC4A 3AM4A 1S3SA 2XPCA 3TSAA 4Q39A 4C21A 1M3SA 2JJ2A 1GAJA 5JCJD 3AB7A 1E6LA 1CRPA 4RX1A 4AJ4A 4DUPA 4U2EA 4I3GA 1R5BA 1UBFA 4QULA 5EXSA 4EA7A 5BV7A 2A0WA 2NTNA 1RKQA 4V0KA 4DSOA 5AW6A 4MKRA 2YVAA 2EWWA 3N2NA 1YDWA 1AB6A 4L28A 2XDQA 2ZYAA 1YRQA 1EUQA 5AK0A 5ITZA 2XXBA 4JYCA 2FMKA 2R25B 1XEWY 2W2OA 2RH4A 5FL7D 2C0PA 3DPSA 5MGBA 2W83A 1GD1O 4PGHA 4UPDA 1SK8A 4UTNA 2C7RA 1P39A 1T4CB 1GQSA 3NTQA 3VJRA 1U2PA 1VL5A 1B4DA 1THTA 2WF9A 4FEYA 2FU5C 3RUFA 3FUXA 4TTAA 4LSMA 4AJPA 4J0EA 4B4VA 1IH8A 4BNJA 1JFRA 1LI5A 4DUGA 4W6QA 1EX7A 1VPEA 2M9MA 3PTZA 5E9WA 3WLJA 2IXDA 3VV3A 5CFZA 1VIDA 2W4IA 1I7NA 1IIBA 4AJIA 1YQWA 2ZRHA 4B1FA 5AVSA 4ESVA 3K6SB 1C9YA 4L5AA 1Y5RA 1FSSA 4IIFA 3HV0A 4MQFA 4PLCA 3PQ8A 4ZAGA 5K09A 1TYEB 4RF2A 4BV9A 5CTJA 1X92A 2WTMA 4OU5A 5AOCA 3T15A 3VNVA 2Y6UA 3RE1A 2O5VA 3NALA 2IU3A 1N6RA 4Y6LA 2QD4A 4KHZA 3KOWA 4CM7A 4QG7A 4CCAA 4Q6BA 5COAA 1OXXK 1WMDA 2I8CA 4LRTB 3A7EA 2VF7A 5K0SA 1QHGA 3DT6A 1CLUA 4Z7JA 4FFOA 1SBHA 5CW1A 1L7RA 1DBQA 5JCPA 4NCAA 1P7YA 2O14A 2AG1A 1ADGA 1GKYA 2OPBA 2P7IA 5DP2A 3L6BA 3GF4A 3NWJA 4KXVA 1Q22A 4IMJB 4MA4A 1QIFA 4E0BA 1XZLA 4P3YA 4E3ZA 5IVIA 3C6XA 4DBZA 3CNHA 4ZDIA 2B2NA 3G89A 2XMDA 3HB0A 2QX4A 4S2EA 1GN8A 3THXB 2WJAA 2ZJBA 1BC5A 5NLLA 2GVZC 5K8TA 1M2VB 1A9TA 3BFPA 4ZVSA 3EK2A 2W58A 1ULBA 4IM7A 1QAQA 5THXA 1U2GC 3R76A 1DMRA 3IIEA 2IK8A 3TSYA 1SCBA 3QFTA 1NMZA 3IBGA 4LYHA 1LPMA 3GCDA 3N2YA 1FUEA 3B1VA 4K88A 1H05A 4PZAA 1I9CA 2FEWB 1TUEA 2QVCA 3PEEA 4NENB 2Q99A 1Q15A 1L4GA 4UPVA 4U2GA 4ZOEA 5ELXA 1FZQA 3LAWA 4KMSA 4LXGA 4NOLA 1FXWF 3CR3C 1QWSA 1KU6A 4R2IA 4MP3A 4NFHA 1QRRA 1WM1A 1RJEA 3AR8A 4QQRA 4V24A 1S2IA 5FPQA 1KR2A 4G1MB 3FRJA 4YREA 2FQ1A 5BOSB 1L6IA 3H2SA 4ZOCA 2VO1A 1RABA 2JH3A 5CEJA 3BXEA 3KYDB 3T95A 1Z2DA 3FKQA 5HJEA 1Z0DA 3NTLA 2XJ9A 1Y80A 1PWXA 3KJIA 3EQ2A 4IR7A 4MA5A 5TGZA 2XE4A 3PC7A 4K6KA 2C7VA 2ZYIA 4I66A 3X2SA 1Y1PA 4HSGA 1K5GA 5L3QA 3RRFA 3O4HA 2EV9A 5DTQA 3DE5X 3WLRA 3ZGXA 2XRFA 1ULTA 4JJKA 2XUKA 1COWD 3GJXC 4LQCA 3ZKAA 5D5PA 4R81A 5FNZA 4YRIA 5KOIA 2O8CA 1MBZA 2P2DA 1QO7A 2YVKA 4ROSA 1T1GA 4HO1X 1YJBA 4PLTA 5ES3A 1ZMXA 3DZKA 3G9UA 1K9VF 3EXG2 4L9AA 3VKFA 2H2DA 3UK2A 4GP6A 2Z0MA 1XJWA 1KAGA 2Y77A 4OP3A 1G4UR 2HWXA 3OJOA 4WNAB 5AM4A 4N47A 5JLJA 1B15A 1BXGA 1EFVA 3IHTA 4LJ6A 1JLHA 4KR2A 3DC2A 4NEHB 4IDCA 3HVRA 1FP1D 1VLJA 1EHIA 1XSEA 2ZM6B 1AX9A 2QD3A 5BYJA 4QHYA 3PD0A 4NULA 1VKZA 3U4CA 4D6PA 5IFLA 3D64A 3C3WA 4WW0A 3G8YA 4MB2A 5FJJA 2XXJA 3V8BA 3WKCA 1TW3A 1OLUA 1JI3A 1S3IA 1XK7A 2ZTSA 1ZJJA 2WV7A 2P8SA 3FGZA 4EQZA 3I8XA 1K1EA 3ICPA 4WXRA 3TW0A 4PHTA 2ZAGA 4PS1A 4YV2A 3BSWA 3G0BA 5IMBA 1DMSA 4E21A 1C3LA 1DAEA 8ADHA 5KNCD 4US1R 2HD4A 2H29A 2D7JA 3PYMA 4GD3Q 4NE2A 4LGYA 2PBRA 5SZJA 3TEJA 3AF4A 2J5XA 3JQQA 5I51A 3I9LA 4CKCB 4LXHA 5I7RA 4EDHA 1W0KA 2PZ8A 5CXXA 4MRAA 3LY5A 4FYMA 2VJMA 3IOMA 3IUJA 3KL4A 1C4WA 1EYZA 4UTOA 4ZXFA 4D99A 3GPLA 1UC9A 3W6UA 1E92A 3AUSA 4P0TA 2GEJA 1MABB 3CRRA 2Q8QA 3SIXA 3GJTA 4AB1A 1E60A 3EPPA 1IZZA 1N5IA 3QRWA 4HZIA 4RJ2A 4BAGA 1I30A 1G6OA 2I2CA 2BL4A 2DH5A 4G63A 1ZA2A 2PRKA 4TUYA 3U3JA 4L4SA 4R8LA 3JQAD 4XYEA 3GLGE 1D09A 4OFXA 5GWXA 2I4MA 1OXSC 1QORA 2HLDA 4LY3A 5SICE 2RAUA 4DLBA 3QFSA 3ZU2A 1J25A 1Y5LA 1Y8ZA 2WVAA 2FJUA 4XUGB 3F71A 3EAQA 1WUKS 3PUWA 4ATNA 1RMQA 1JFSA 4EVQA 4Z9YA 4Q7QA 2W9XA 1IHXA 1E2DA 3ZWDA 5LXTF 1C9JA 1AGRA 1QYVA 2AHOA 4FOLA 1RAHA 3JWEA 5SV2A 1E1LA 3CBGA 3EDMA 3ETGA 1O87A 3NAMA 1Z0UA 2YR0A 5F2OA 5REQA 2MSEB 1P9OA 2V6GA 1M8FA 3GJ3A 3U4IA 4C0KA 5H4GA 4DB4A 4MUAA 4UC0A 2AIRA 2OXCA 4EVRA 3F2IA 1P4JA 2GUWA 1U7ZA 1WD7A 3O3CA 1GGJA 4JJ4A 4MWGA 4P86A 5EE9A 4CEHB 3BMOB 1N0VC 3ZVRA 2QBYB 3AP3A 3TTYA 1SCAA 2ODPA 1PQPA 4XQEA 2ZYTX 4IQFA 2OGZA 4LRWA 2FMFA 3D6FA 1K75A 4D97A 2PUHA 2DG2A 2HK6A 3N2KB 3KKQA 4G0XA 1TT7A 5EMMA 2XE7A 5K3FA 3L6OO 3QTBA 1UC8A 1KXZA 3HNOA 3NBFA 3BMCA 3EFHA 1J2YA 4C4XA 1GL7A 2DF8A 3T9DA 3HKEA 3OM9A 3U5ZB 4LXUA 3TSCA 4G5SA 1DVRA 5DYTA 4RYDA 1U4NA 3A9TA 1CUYA 4QBTA 2OV1A 4RE6A 1JPVA 1RJWA 3WWYA 2H2FA 3FLMA 5SYAA 5IAGA 3T7EA 4E11A 4XGQA 3HJTA 4LQLA 3IKVA 1YBFA 4TKLA 3Q7SA 4DV3B 1NBAA 2EWMA 4Y3UA 3O0DA 4EI9A 4ZYUA 1CXZA 2ZJYA 3GJ0A 1B0UA 4BLQA 4TWAA 2FNAA 2V6FA 1SUWA 1ZI6A 3BWYA 3K5WA 1P4RA 1REQB 4ZWNA 1V16A 4QQKA 4ZK2A 1H2XA 3S2IA 3LUKA 1VRCA 1ZK4A 3GRYA 2B92A 5DX0A 4DQVA 1HE5A 5EWLA 2RD2A 3TQFA 4IIVA 3QU7A 2EVWX 3IAS6 1B73A 4UOQA 2W11A 4CTKA 1WMEA 4PLGA 3W8NA 3GJ7A 3QHAA 2IEDA 3VKVA 2ZYHA 2PVPA 2EFGA 3C85A 4HDAA 1BDJA 1P0MA 2QX7A 3E15A 4ETIA 1CFJA 4ZC1A 5AW5A 1IWPB 2N9UA 4CLXA 2Y2UA 4CXMA 3RC8A 5CB6A 1EQAA 3B36A 3BL6A 3GLVA 4FFWA 2RH5A 3ER6A 4PO9A 3HVKA 2FSVA 4P4SB 3WS7A 3EZ9A 4HPJB 5I9LA 3BIOA 2O8BA 5K4AA 3VR4D 4QEKA 4ERXA 3TGLA 1OWNA 4HYTA 1J1ZA 2ZYGA 2OECA 4C29A 1J23A 1M34E 3BD6A 3N87A 4J0KA 1Z0AA 1XO1A 4JBWA 2PT6A 5DGHA 1Y9AA 1EINA 4D45A 1R4AA 3OT1B 3BIJA 1DUVG 4NSNA 3WR5A 4ZKEA 3ND9A 4QTZA 1F6WA 1BHO1 1SXJE 4NE7A 4PS0A 5HIIA 1T4GA 3N5KA 4BFWA 3GXOA 1BTOA 1ZYUA 5CAEA 3KKLA 4YJ2B 2YMPA 5LZ9A 2XGGA 3RGWS 5TGDA 4YGXB 2VN8A 1Z6YA 2PZLA 4FTWA 3TLGB 2JA1A 1NM5A 4B2LA 1R9JA 3HYCA 2JK1A 3LPDA 5BORA 3EGDB 3OZEA 3UUGA 3WL5A 2GF2A 2Q6TA 2XMCA 2PE5A 2JGDB 2PH5A 2V55B 3K73O 4H7PA 3ZHXA 3D4OA 4KIUA 3WBKA 1X0VA 2KPOA 5B58C 4M46A 1Z4OA 2VOJA 3QKSB 1P0FA 2BKLA 4J0CA 2C7QA 2UUCB 5M04A 1Z4PX 4RD3A 4Q4JB 2PSFA 4RL6A 4XM2A 5ESRA 4X7PA 3TSZA 4F5EA 1EUCA 3PUKA 3ZV6A 4EL5A 5KWSA 3QG5A 3KSAC 4P3OA 1TJ5A 3BDIA 1IBMB 2GN6A 3BULA 1FVXA 4HQFA 1IY9A 5K0NA 3ERCA 2C99A 1NQXA 1XZPA 2D5IA 2ZT7A 3AHGA 3FYTA 2HXSA 3GUYA 3GYGA 4A2QA 2VHZA 4BCBA 3VKGA 2BEVA 3D3WB 3EDOA 2VI5A 3PC8C 3RYFA 4V1CA 3PVCA 2O8FA 2AZTA 4JBXA 4MULA 5DE3A 4EIWA 1PK8A 1GG2A 4IH4A 1Y37A 4YBZA 2ZDGA 2WC1A 3GLIA 1HA3A 3TZKA 1M2OB 4CDGA 1LA2A 1BW9B 1SVOA 3ILHA 4CW7A 3RRJA 2RH8A 2O0HA 2YVLA 2AD5A 3L5OA 4GS5A 4FWBA 1GV1A 4DSNA 3RHZA 1A8SA 4D81A 1AKWA 1W94A 3I9JA 1UWCA 3RT1A 3T3NA 5BVHA 3I5AA 3V5NA 3HBAA 3ONNA 4MUYA 1S5PA 2XZLA 3LHIA 4N6GA 4NG5A 1U7TA 4RFVA 1EE1A 3CM0A 3WA7A 4DEVA 1CUFA 2CN1A 5D86A 3SJCA 1JSXA 1Z4IA 2AVNA 3QELA 4OLBA 4NH4A 4X91A 3PEFA 1N0IA 4UCFA 3HDTA 3UMJA 4XI9A 4KVZA 2BDTA 4NC9A 1OT3A 5H1YA 1F2UA 3V8NA 1LLCA 1SD1A 4LBZA 3EEYA 2Q9AA 1S96A 4UMEA 1TZCA 4RHFA 3FW1A 1TNDA 5HQ3A 1JMYA 2EP8A 3SZOA 2GXQA 1NZJA 1OX6A 2P91A 1A9ZA 1YHNA 3OECA 5IAOA 3ABZA 4D8YA 2IYSA 1Z15A 4WASA 5DLQC 2ZG6A 1QTQA 1X7DA 1SQFA 4JJ6A 4A8JB 1Y8RA 5IT9A 3F6BX 2NU9A 4PBSA 2GJ8A 4CIBA 2VKTA 4HQ6A 3CVYA 3EHDA 1D0IA 1EX1A 5KOJB 1X8LA 1JP7A 4IJ5A 2NU8A 4ALKA 1PV1A 2Z98A 3IA2A 2HFJA 5CPBA 1QXSA 4L0DA 2UV8A 2Q6OA 2GN8A 3O47A 1RKXA 4FNGA 2WFMA 1T0JB 1UPXA 2AE2A 1DX9A 5DHRA 3LQ2A 3BZWA 1XCGB 1JXMA 2LCIA 3C70A 1QKIA 5ARBA 3L8ZA 4HN9A 4Q3NA 4Z2YA 1WXFA 1H8HD 1E3MA 2IOFA 1XEXA 1RCUA 4XD7D 1I4OA 4P92A 4L85A 4MMYB 4D46A 3IBSA 4IFBA 3W7BA 4NNJA 4MW5A 4CMJA 3F7OA 3EZGA 1XA4A 4IWXA 1FK8A 3KYIB 3PQ3A 5HGXA 4PCVA 4FNAA 3G2OA 5JO0A 3TIIA 1SCDA 2QLNA 2GPAA 1Y8RB 2ZJFA 3B8HA 4IZIA 4E13A 1TM1E 3FVVA 5FI0B 1LPNA 4PYKA 4HBZA 1V5GA 1E64A 1UDBA 4OFBA 4XDHA 4BNIA 4F56A 1BMQA 3AUFA 4WESB 7ADHA 3OPQA 5LWHA 1QYCA 3CH5A 5HM8A 4RM2A 1YU6A 2WM2A 1CQWA 4ETWA 3D7MA 3DEAA 1HT0A 3JVVA 4X8LA 5P21A 1DAFA 4OI1A 3ZDRA 1KERA 2B4QA 2ZULA 1DP4A 1OPRA 3K09A 5TMEA 2QJWA 3M1IA 4C0WA 3QIVA 4LC9A 2FWAA 3NUZA 3GEEA 3RSLA 2OR3A 2PL3A 3IXLA 2W2VA 1YDMA 2GAOA 1WXQA 2RGCA 3DHVA 3JQCA 1U65A 1MAVA 3KS9A 4WUVA 1VOTA 1YC5A 5E9AA 5PNTA 1HDZA 3UV6A 3WISA 2JIBA 2PFSA 3PX3A 1HKUA 4KTTE 3GRKA 2IELA 3OO1A 2C8VA 2J0EA 1RC0A 5JDIC 3KOXA 3GJ4A 1W7AA 4JEMA 2ZCVA 2V7EA 3K1JA 3MRSA 4QUJA 4O33A 4ZV4A 1CEQA 2II6A 3NR2A 4HLCA 4ESHA 1E1QA 3CRVA 4PHHA 1HZZA 1ADYA 2VP0A 1B3BA 3U3XA 1COWA 3G8BA 3GBSA 4L9SA 3UO8B 1VE1A 3VNQA 3WJAA 3M1AA 1ESZA 2AHRA 4MUHA 1EQ2A 2X22A 3H1GA 3U44B 1GCOA 2YDXA 4HNVA 3ST7A 3W8EA 2YWBA 3NWOA 3AR4A 3PXBA 4L9WA 3EXIA 1U90A 5G4KB 2Y1KA 4DAEA 1K7EB 2CYBA 1YBAA 3V33A 3T3HA 3THYB 4KO3S 3VOAA 1ZNYA 2A3RA 3MN1A 1X1QA 3MCAA 3DOEA 1DCMA 1EUCB 2O23A 2OP0A 1JW9B 1C4KA 1TECE 4TMWA 4CU2A 2Y4OA 1UMDB 2PBZA 2QRZA 1U1IA 2G1PA 5JSUA 3OIGA 1L4KA 2YV2A 3LI2A 3D02A 1Q44A 1G21E 3GQBA 2DFKB 3R3WA 4WGGA 5EERA 2AJCA 2KWIA 4GICA 2C07A 2QRUA 3D6AA 4B7UA 3R7FA 2OSVA 1T4MA 2Q29A 1OQAA 5FX2A 2W71A 3FPCA 4F8JA 1K9SA 1GILA 3IBTA 1JEQB 1ZJ5A 3LKDA 4G4GA 5EQJB 2NV6A 4BYMA 4IIJB 4PGMA 4RADA 2CB9A 1HE3A 3PXGA 3IAEA 1P74A 2VDNB 2O3JA 3S2GA 3UJ6A 1XTJA 4DLAA 1WF6A 2IIQA 4IJVA 4A0FA 2NZWA 1FFGA 5AI5A 4Q3DA 1EWKA 2ZVQX 3IOEA 2QIOA 5MFZA 4D9NA 1Q57A 5F7XA 4FFRA 1E3JA 3DUFA 3WQSB 1UFOA 1RZRA 1V9LA 3VU9B 4D4JA 3PRKE 2CBXA 3FHCB 1IPHA 1AS2A 1JILA 1KU0A 1R5OA 3KOYA 4L8FA 4JAVC 5LKRA 1T26A 2DUJA 2QT0A 3EE6A 3GN1A 3IULA 3LH5A 1CDEA 3OE7D 3ONEA 1FRVA 3BCHA 2QRPA 4XM0A 2M6KA 3S4YA 5DFAA 1VE5A 2VJCA 5FBZA 4KPFC 3W5UA 1T6ZA 1U0GA 4ADSG 3I12A 1RHJA 4LDQA 2B1IA 3C2QA 3QJGA 4DXDA 3LKZA 4YJFB 4WECA 2ORED 3KT0A 1Y9EA 4LEIA 4NBNA 5THKA 3DDWA 2WTAA 4QWMA 3QVGA 1KHHA 2Z2YA 4R83A 3H9CA 4XSVA 4UFOA 3GAZA 2JDID 1FTGA 3E2MA 4JL8A 4Q9JA 2C96A 5EWLB 3AEKB 5A3SA 4DQUA 2VT6A 3H87A 4JBGA 2OE2A 2FPMA 4MQ4A 1FXWA 3NHMA 1GFSA 3CVWA 1QFMA 3K4HA 4ZAXA 3EXG1 4DNQA 2O2EA 4DWWA 3C1TA 3H8JA 1NUAA 1RWWA 3OT5A 3FNHA 4IH1A 2MR5A 3W6PA 4BKUA 1IE3A 3MJFA 3GN2A 1KO5A 1O94D 4UREA 4AL4A 1C1DA 4D0NA 4F04A 1UOPA 4HDNB 1FNCA 2CLCX 1KEKA 2POCA 1QG2A 2JFOA 3ZHBA 3RSOA 2GAAA 4J0DA 4FFDA 1KKUA 2XGJA 1XVAA 4KH1A 1NLYA 3DBLA 2C9DA 2WA2A 3X1YA 1ZZEA 4YUWA 3ABIA 4G65A 4K1LA 4FJ1A 4FW8A 4NCXA 3R3UA 4KXUA 1RYHA 2G1UA 2PVSA 3IT3A 3A2NA 1Z06A 3CJTA 5KTYA 4D0RA 3WDLA 1U0TA 3OLXA 4RHTA 2I6XA 3NZEA 4XIFA 1LGYA 1JWAB 3B6KA 4ZVMA 2EGUA 1N6LA 1TEVA 4I4LA 4PTYA 3U7IA 1HXHA 5ALVA 2IYPA 1OU4A 3HA2A 2LW7A 1XP8A 2DY0A 2XZTA 3P9PA 1KI8A 1PFVA 1J6UA 3A70A 4P53A 4Z99A 3RR2A 4FSXA 3WSVA 4B33A 3HP1A 2XCRB 3OWOA 3VSEA 5TVGA 1SIWA 1BRMA 3GGCA 2EFYA 2VVTA 3IDFA 3K0KA 2F1KA 2NVBA 4U3JB 3ZNQA 1TVKB 5KSZA 1L5OA 2FW8A 4HLDA 1U5CA 2XD4A 3AF3A 5TMDA 2VIIA 4UXJA 1UQRA 2ZUDA 2VZ9A 1IN5A 2J3MA 2BCGY 2EATA 2VQSA 5TS3A 5D7NA 4MYHA 3UA3A 3RNOA 5JH7A 2VOEA 1PK7A 3IOBA 3CUWA 4JT8A 4K9QA 4MGYR 2JIDA 4M38A 4OPMA 1NXWA 4G41A 5BYAA 4F7DA 2ERYA 3NOVA 1VSVA 3LQ4A 1T9AA 5K3BA 1N92A 3VTZA 1HRKA 3TBKA 1PQUA 5HF8A 2IS1A 4W9RA 4PYMA 1KQNA 4AAYA 1R0WA 2FWBA 2OC4A 3HR8A 1G8MA 1K88A 4LE2A 4O4JA 3I09A 2CNLA 3TTWA 1E66A 3Q7QA 1MW9X 3IQEA 3T1QA 1N0HA 3TR0A 1QFJA 3SF0A 5LZ7A 2OTCA 3NIWA 4LA4A 4CYMA 4ACBA 2QRNA 2AG6A 3BK2A 4XX0B 2IFTA 5B7QA 2K7ZA 5J4LA 4N6OA 4BRWA 2W42A 2ZJOA 1UM8A 1IK4A 3JWGA 2B3TA 3OLVA 3F5SA 3GOQA 2W6IA 4ZCIA 2A5YB 3MTDA 1BS1A 1V37A 1Z35A 4JBLA 2ILTA 4NS1A 1MO4A 1QLWA 3CVUA 1IVYA 5EESA 2W6JD 1EVKA 3ZHQA 5H9WA 1HL3A 5H68A 2YJZA 3D5QA 1Q83A 4YJHA 2VDWB 4V3CA 3AFOA 4LF9B 1P2DA 4ND8A 1NATA 1NN1A 3JZIA 2JLVA 4GMGA 1YBMA 4A16A 5JCXA 3ND7A 5K3CA 1QRUA 2OFWA 2VZLA 1PHRA 1JFVA 3CV3A 3RKRA 3OKAA 1BW9A 4EB3A 4WN9B 3ADPA 3ZLJA 1ZK0A 1E0AA 4OK5A 3V4RA 1K4YA 2PSDA 1DWQA 4UM5A 2QR3A 1G1MA 3ORSA 1HEUA 1MAHA 3QYFA 1GFZA 1DS6A 2DTDA 3KZCA 3AFIA 3M4ZA 4WY2A 1US8A 3HRIA 2AYXA 4RK7A 4F8YA 4X65B 1UPBA 4IDAA 2W0MA 3GUHA 1HC7A 2GBPA 2HM7A 3HB7A 1Y8CA 4ND4A 2WMYA 3D3QA 5EINA 3W05A 1JBEA 5B6PA 1KRXA 2IKSA 4UTPA 3ZQKA 5A5FA 4B3SB 4B6GA 4M1TA 3HU3A 2HBYA 4DABA 3DAFA 3ECAA 2GSWA 2C4UA 4AN1A 4RZUA 1JZTA 3JQDA 5GM1A 1Z6QA 2DPMA 3HYTA 4N0QA 3K1ZA 3V1NA 1KRWA 5D01A 1QK5A 4QGFA 1OILA 2BZ0A 3I1YA 4HNAA 4MRMA 5AKYA 4FOTA 1AMNA 1BMFD 1XKQA 5DH9A 2QDKA 1GSAA 1YL7A 1B8VA 2HU7A 3NYRA 4OOEA 3ZHOA 5BOSA 3GLFE 3I8OA 2O5EA 3WGLA 1RE1A 3N6RA 1IOLA 5B1EA 3MD9A 2Z6AA 2IHUA 1ONNA 1GKLA 2QT1A 2FN9A 3NVDA 2LIPA 4FS8A 4O4LA 3IVXA 1CS0A 1ISSA 1IVSA 4EZIA 3ICVA 3WYBA 3FETA 4G3XA 1XXHB 2I1VB 2AE1A 4XOIA 4CODB 3C4VA 1PTKA 2NAFA 4R2KA 2DQKA 4RKWA 2HCTA 5FP0A 3B9PA 5IK2A 5IUKC 2VTDA 2JIPA 1FPQA 2ZE5A 4OL9A 1H4SA 5E3HA 4UNPA 1TM2A 4IIUA 1C2YA 3PENA 4GOMD 1QYIA 2ZI7A 1DUIA 3BREA 3MGAA 4JBYA 4OQYA 2C95A 1S0UA 3KNZA 1RQGA 1S01A 2IYRA 2QTAA 3UAGA 4QBGB 1QFSA 4GKVA 4IIDA 1N5MA 4H35A 3PQDA 4YR9A 1XA3A 4B3IA 2W2NA 5LIRA 1W35A 3SWWA 2OZKA 2Y68A 4UVHA 5ED4A 5E6RA 1SBIA 4HGNA 4BVEA 1F8GA 2ODNA 5KVAA 2ISSD 1MUUA 1ZXXA 2C2YA 3F9IA 5TS2A 1W30A 1YL5A 1DOAA 4Q34A 6ABPA 3I6ZA 3RSGA 3VBCA 1YI8A 1YUBA 2DPHA 3I9V6 4U8HA 1P3JA 1TPYA 3HMKA 4Y98A 3VPXA 5JNLA 4IKEA 1YCGA 1GPYA 2JVKA 1REQA 3L77A 4MITA 4QPPA 4WJZA 4ZCSA 4ARSA 3O31A 4QXAA 2ZIUB 1G7RA 1YSCA 4IUCS 4AWXA 1QCYA 2QP3A 3P8ZA 1C30A 4J7UA 4YMGA 1I7LA 3K6SA 2D1YA 2JFZA 3OLWA 1E8MA 4N1AA 3W5VA 5DXAA 4RGQA 1P7CA 4GXRA 1OH8A 4GAEA 5KS2A 2HLNA 3B7PA 3WK4A 1T2UA 3VMFA 2GEVA 3TLAA 2GTIA 2V74B 1VLVA 4TLEA 3UB2A 2ZZNA 2ZAIA 5I9IA 4UDNA 2AZ4A 2XY4A 5CHYA 1P7ZA 4I4IA 5FOVA 2O7VA 4MI6A 1R4NB 1FCJA 1GFWA 3BK7A 2JATA 2OP1A 2E48A 2I9PA 2WDPA 4BO8A 1FNNA 1X7ZB 4PO8A 4TMKA 2HGSA 2O8EA 2OBNA 5T7BA 3QI7A 4Q7EA 5HGJA 5HVNA 7MDHA 3SI7A 2WJ3A 4MEAA 1PJAA 4O1MA 1ZI9A 2H85A 4BJ5A 5DGDA 1N8SA 3ZTTA 2ZIAA 2ZYWX 2C82A 4BKPA 1TMOA 4M49A 5AIBA 3QE2A 1GCAA 4LDRA 4P4LA 1SOWA 1WF3A 2OB1A 3MSCA 3NBXX 3UT5B 1N5LA 3P9KA 4UTZA 1ODFA 4KXWA 1N25A 1R15A 4KQMA 2ONCA 2FKNA 4XM1A 1TF7A 2TRSB 1CU1A 3MUFA 1EM6A 4O4IF 2J5QA 4OHZA 1SCIA 1GDDA 2D8AA 2B7LA 4W9NA 1AK1A 1U2TA 3H3JA 3SF8B 5GONA 5AW0A 1Y6RA 3FF4A 1W1IA 4IAOA 2UVDA 1GPWB 5HCNA 3S7ZA 2JIRA 1A95A 3I1FA 1L7AA 1J42A 2H4WA 1IK6A 5AHRA 4EW6A 5CVTA 4JLAA 4NCIA 4RY9A 2O5CA 3WOVA 3MRVA 4IIGA 4KDFA 5FO0A 1S1CA 5GOTA 3BWDD 1BKDR 1SC9A 2D5LA 4MLPA 3W5AA 3U7QB 4BWVA 3LP8A 1ZK1A 3QFRA 4UJ5A 3VU0A 4W6ZA 5LQRA 4WPGA 3O74A 4B9AA 4GXTA 4KV9A 3JARB 3DEJA 3ML1A 3QXGA 3RVKA 2QMEA 1P1BA 2B82A 1SK9A 1H1LB 4XWYA 1Q5PA 4JP5A 3ZLUA 1MABA 4NLLA 2G82A 1D5WA 4OSEA 2B7CA 1XLTC 1D2EA 2CLFB 2G83A 1F5SA 1BE8A 1G8JA 3R5FA 4I6EA 4UUMA 5JD6A 1ARZA 3NIFB 4EY4A 1U2ZA 1CK4A 2AUTA 3GC6A 3KZKA 5KVQA 5HUJA 3K9FC 1JYFA 3CO0S 4J2OA 2FG7C 3EAFA 3I05A 3HH8A 3HUFA 4CKCA 3PD1A 2IYWA 4HNQA 3NIDB 3RS4A 4RDCA 4R1TA 3SX2A 1CJVC 2BF7A 4HAUA 3VZSA 3AM3A 4BQSA 5JASA 3PXAA 4MO2A 3ZLTA 3ZW9A 1C50A 1SVLA 2HQSA 1B8PA 4RMGA 3K1YA 4RWEA 5KSWB 4MQBA 2WT4A 5IJXA 3I8SA 5EJIA 4ZT3A 4ASUA 1MFPA 2HIMA 4DEXA 4ZJYA 4F4CA 5IZCA 1A9PA 4MW4A 1Q7RA 1TAQA 2W2TA 4PM4A 4NY1A 3AUAA 2V8BA 1FPMA 2AFHA 1A9YA 5K8JB 2UYOA 1UDWA 3EXFA 2LNDA 2CLDX 3GLHA 2BFPA 1JG3A 1GZUA 2ZANA 4X60A 3SSOA 1QB7A 2VHQA 3L8HA 1I5EA 1NRXA 2W2MA 3EBOA 1MV8A 3Q7EA 4D3SA 2AQ8A 3F6PA 2YOGA 5HS6A 4CFZA 1JTVA 2C03A 3TXXA 2G9RA 1W36B 3V3KA 1KETA 3FDZB 1AZLA 3CLTD 3B6JA 1WULS 3LWBA 3BC1A 4IJMA 1IQUA 4YUXA 1PFKA 2Q3FA 1HBJA 1NKTA 4IYRA 1L4HA 4P3PA 2D4HA 1MB2A 1ST2A 3M6AA 4LWPA 4KNYA 4EYEA 5K2MA 2BGNA 2OHFA 3JSAA 4YROA 3ROFA 3K9LA 4S04A 3FTCA 3OAAA 3GCXA 4O3MA 4UD2A 2BZSA 3UJCA 2Q3BA 1EB9A 2BWJA 2P35A 4Q3LA 4BNVA 3VR4H 5JOQA 3RRNA 2VJBA 2YCBA 2YV1A 5CBPA 4TVKA 1ZX1A 5C8YA 3EC1A 5C0OE 4IEIA 4BPRA 1FX0B 4ICIA 2NUBA 3WK9A 4RZSA 3DP7A 3JS5A 3QW4B 3UJPA 4BWGA 3AIIA 2RCYA 4J3NA 4PXSA 5KNDH 2Z4SA 3GP5A 1CUCA 1H0RA 1N5DA 3CUVA 3HY3A 4AO7A 5IT5A 1O94A 3HZZA 1NUQA 5ALOA 4NI5A 1P62B 4B9EA 2Z1DA 3LUAA 4JXJA 5GZ1A 5LNK1 1X70A 5K6TA 2E4XA 2WK1A 4NMXB 3UOWA 4URVR 3PFIA 4P2GA 5A3VA 4TMZA 2HHHB 1ILEA 3AVWA 1GZ7A 3IQIX 3W06A 1RYFA 3OKCA 3IKJA 1KH1A 4YTEA 1SCJA 2AN9A 4JSRA 1P4AA 3DLIA 3DXXA 4YMVA 5CD9A 3SC3A 5KJFA 3MJVA 2ODBA 2E6UX 1FFAA 4Q3EA 4RCZA 4HB2A 2B9VA 2ARKA 3FKSD 5CJPA 3QBVA 1JU3A 2MSCB 4GVLA 5BRNA 1A97A 5ALJA 5IAAA 1SMKA 3FPHA 2WG2A 3KWLA 3M9LA 2ORIA 3AHFA 3O1LA 4N76A 4KP7A 3TGWA 3WBBA 2PKQO 1ZSYA 4JP3A 5F5NA 2GX6A 5IN5A 3WZLA 2UVQA 1N6OA 3WJ1A 4RULA 1YZYA 2ZCJA 5E0OA 4DLNA 5CDHA 3ED1A 3EF3A 4RK5A 2XUDA 2ZYRA 2XLCA 3ESDA 1EVQA 2QMOA 1O4VA 3NOQA 3L1VA 4JKYA 1UBCA 4R16A 2E49A 1FSGA 5EJ9A 1YOVB 2R2AA 1X8XA 1IONA 3OHMA 4KPUB 2NO9A 3DV0A 3VX4A 5IUNC 3WBJA 3ASZA 2BMEA 1TVCA 4DIBA 1G8KA 3OEEA 1E3IA 1U81A 2BLNA 4Y9DA 4IUDS 3SLKA 3SC6A 3R5TA 2Q41A 1LXCA 3SQMA 2IY9A 1MX1A 4DGSA 3TTSA 3OU6A 1QIHA 3BBPA 3SS9X 4MJXA 1XF9A 1XQ6A 2O20A 2XZDA 4HB4A 2H2GA 3GEIA 4QQNA 3PUXA 4J07A 4LIPD 2PA0A 3WLMA 4EEXA 5K99A 1R9MA 1WE2A 4NS4A 5LUAA 4O4LF 1SOVA 4KO1S 5IJWA 1CY0A 2YIVX 2YWFA 2GDJA 2P4QA 1V45E 3VFDA 3MUEA 4EB6A 1UC4B 1XA0A 2PZJA 3IBCA 2VR1A 2B9EA 4REOA 3LUBA 2QTVB 3WC4A 1E9AA 1MQSA 4MK4A 3E5HA 5FCDA 2GBFA 1JU9A 2WYHA 1YZTA 3B78A 3G9ZA 2X14A 1Q74A 1Z6TA 4RHCA 2C9ZA 4E14A 4ZVPA 2A58A 5DHPA 2R8EA 3KYJB 3OESA 1ZL0A 4HEA1 4AWAA 5IDWA 1KL7A 1Y6FA 4LX0A 5T8KA 2BF4A 3C6QA 1EIZA 2WIGA 3BMXA 2HNBA 3TINA 5LU8A 3BTOA 3DAYA 1BWRA 2XLBA 1H3EA 2DFLA 4PG4A 1DJLA 2VHUA 5DXFA 3LIPA 1CIPA 5B1DA 1FBTA 3UKDA 4Z0HO 1H6DA 3WMEA 4G0UA 5HA5A 2D1RA 4H6VA 1GNRA 4LSZA 4GBMA 2QRHA 1R66A 3AXTA 1RWVA 2GCIA 2X8LA 3CRW1 3W9SA 2BGWA 4JQSA 4URXR 4LJYA 5LYYA 3FCAA 3G1WA 3EUAA 4Z7OB 2BMVA 1OAOA 4W5JA 4BXOB 3WMWA 2XJ4A 3JV7A 3HB5X 4ZT6A 3W3AD 3ZD7A 3CF4A 3LC7O 1H2AS 3JALB 5DBOA 2RGRA 5K2OA 3X2EA 4QJIA 4EBBA 4J4TA 1ESEA 2QQ0A 1DX4A 2BHTA 3G68A 5CA0B 3ANMA 1UBHS 2QW8A 4Q4AA 3BAFA 1A9OA 4ER5A 3N76A 3DKPA 4AG3A 3HCWA 5IN4A 2R9VA 1GKUB 3DFUA 1Z38A 1O0BA 3DBHA 3THWA 4KBFA 2EF0A 2WM8A 4NCNA 2WWYA 1JYEA 3KQTA 3PQCA 1CV2A 1LJ8A 5JZOA 2Z3WA 3MBKA 4S24A 2GD2A 4TTTS 5C46F 1KJJA 5CXQA 5JROA 1G3IA 1N36B 2D13A 3BZBA 3BH0A 1SD2A 1AKEA 2XIQA 3HJNA 1A50B 1E7RA 3EGVA 3CCFA 4O4LB 3CLRD 3D0QA 3ZW8A 2WILA 5FBQB 3WWCA 2QTWB 3B1FA 4C7MA 5T5QA 4CKWB 2DC1A 1AN0A 5KTKA 3BUSA 4MDEA 2NUAB 2YYZA 4M0DA 1ZJWA 1IATA 3I9FA 3F7TA 4UUNA 1ELOA 4HGYA 4HGRA 4MCIA 2IOFK 5PGMA 2HW8A 4X0EA 4NEGA 2J9XB 4RPKA 1M75A 3HQ4O 1L7VC 1DO2A 1XHFA 3CUSA 4HUTA 1KKLA 4P4GA 2GJKA 4DA6A 2YHIB 4UNIA 1WLSA 4PZCA 2BMJA 3R3YA 1PEKE 4DN6A 1MJNA 3GJ8A 1M1YA 4ER3A 5BSWA 1JKJA 2OD7A 4V3BA 4W99A 3UMGA 5KYYB 4TZ6A 1QF9A 1MDFA 1F9AA 1NJ8A 2JCXA 3QWIA 5DDIP 1MZPA 2EHDA 3O4FA 4A10A 3D6MA 2DPYA 2OZEA 4KI0A 4FDLA 2V3VA 3NHSA 2JFHA 3WLNA 4F7WA 5C8ZA 1X7HA 3OP4A 2RHJA 3OD1A 4TSFA 5LKAA 2AFIE 4G5YA 1RXCA 3CKMA 1HETA 1CYDA 1EUDA 1MF7A 2G1KA 4PRYA 2NUPB 4XQGA 2JGMA 3F6EX 5F3RA 3N7AA 3UCFA 3HL4A 1BNCA 4IICA 5EKSA 2QJRA 1NBEA 3UN1A 4L2IB 2CVOA 1R0KA 3KO8A 5HRAA 4GOLD 3SYLA 5C81A 4X90A 1UDCA 4PPQA 4TV9F 4XEUA 3BG5A 1GV0A 3IAS1 2OV8A 3GAFA 4EKDA 1ENOA 4ZMRA 1EQUA 2PGNA 3VR5D 1AQNA 3DE6X 1FSZA 1GGMA 2BM8A 2D62A 2HA3A 1K66A 3NMUF 2QNBA 1FLDA 2BI8A 2XGOA 3CR7A 3MB8A 2IYQA 2PYDA 5LBIA 4ESEA 5CR9A 1DQPA 4YJ3B 3G85A 4M54A 3KU4A 4D9IA 4GX2A 1W8DA 2ORWA 3SZUA 3WNVA 1AXEA 1B2RA 1P0QA 1XDSA 2VA9A 3DWEX 3GG9A 2CLEB 4JB3A 4K6OA 4KQXA 4DMFA 4ZYXA 4TTJA 3MPUA