3OCVA

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase mutant d66n complexed with 5'-amp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
247
structure length
247
Chain Sequence
EEHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLNETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of nucleoside monophosphate substrates by Haemophilus influenzae class C acid phosphatase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Lipoprotein E
total genus 94
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ocvA00
3B9BA 2YMQA 2RB5A 4UMFA 3WK4A 5AM5A 1U7PA 2B1QA 1RMYA 1Z4MA 3E8MA 3L0BA 4NWIA 5ALEA 2QYHA 5AKYA 3K1ZA 1Z4PX 4CF5A 3W5BA 2DQSA 4BNDB 4FE3A 1RLTA 3MMZA 1MH9A 2ODAA 3DNPA 1ZD2P 2G0AA 5AKXA 3PGLA 3OCUA 4KNWA 1N9KA 3EPRA 3A3YA 3OPXA 4BX0A 4DCCA 1L8OA 2RBKA 5AM1A 3I28A 1L7MA 3NALA 5ALTA 5AKHA 3QU4A 3QXGA 4NAVA 4FYPA 1QH9A 1U2SA 2C8KA 4DWOA 5AVZA 5AK4A 2R8YA 2YJ4A 2I7DA 1KYTA 3OCXA 1TA0A 4UMDA 3QU5A 1O08A 3N28A 2Q5EA 3NIWA 5JJBA 3AR9A 3D6JA 2G80A 2JAUA 3QNMA 2R8ZA 3ZVMA 4BBJA 2AGVA 3OCWA 5FP0A 3R9KA 3ZVNA 5A3SA 1L7OA 2FI1A 3HLTA 2WF9A 4C4RA 1U7OA 3L8GA 3UMGA 2B8JA 3AR4A 5A3RA 3FVVA 3WKAA 2G1AA 4MUMA 2ZBDA 1J8DA 4ZEWA 5ALWA 5AW1A 3ED5A 1NNLA 4QQFA 1RKUA 3NASA 3SF0A 3ZU6A 4BEVA 4NFLA 1ZD4A 5AVTA 1ZD5A 4BEWA 1S8OA 3B8EA 2C9MA 2I6XA 1TE2A 5ALJA 3ZX4A 4IFTA 3WK9A 5ALPA 5AVSA 4YCLA 5AKLA 1TJ5A 3L0CA 3W5CA 3FGOA 1EK2A 4HAIA 3E81A 3J7TA 3KBBA 5AICA 2CFRA 3L7YA 3N5KA 5ALXA 2HOQA 3U19A 1QQ6A 5ALRA 5AW0A 3IJ5A 4RETA 5AVUA 5AK6A 5AIAA 3ZVLA 5AI5A 4HGNA 3PCTA 3E84A 3MPOA 2W43A 2I33A 1Y8AA 1CR6A 1ZS9A 4OHFA 3KC2A 2JAOA 3DDHA 2FUEA 4XE5A 3L8FA 1Z88A 3N1UA 5AW9A 2GFHA 2P69A 2PR7A 2I34A 2MU1A 5AM4A 4BX2A 1U2TA 2O2XA 1RLOA 1VJ5A 2FPWA 3WK7A 3I76A 1WR8A 2Q4TA 2YY6A 1PW5A 2CFTA 2BDUA 1JUDA 3F9RA 4HGOA 2GMWA 2G07A 4F72A 1ZOLA 3WGVA 2X4DA 5IT4A 2WF8A 3L5KA 1YJ5A 2YMMA 4G9BA 3RF6A 3KD3A 3ZWDA 3EF0A 3ZW7A 2NYVA 5ALDA 2HF7A 2OM6A 5AW6A 5AVRA 2YFYA 3QUTA 1Z5UA 3P96A 3HYCA 4UAUA 4Y2QA 4HGRA 3B9RA 2PKEA 1RC8A 2D2VA 3FZQA 4AS2A 2WHEA 3QGMA 3SHQA 4YCNA 1LVHA 5ALYA 1CQZA 4HGPA 3A1DA 3ZTWA 5AKGA 3M1YA 3W5DA 4XPZA 4Y2YA 1O03A 3QU9A 5E0OA 2BY4A 3ZX5A 2JARA 3U7FB 3ZWKA 5AVXA 2OBBA 3FPSA 1RDFA 3KDPA 4EELA 3OCVA 3QUBA 3NAMA 5ALHA 2NO5A 1RQNA 3ET4A 5AIBA 3ZTYA 4DFDA 2ZBGA 1SU4A 1TJ4A 1Z4NA 4YGYA 4CF3A 2W11A 3AR5A 5ALGA 3RFUA 5ALIA 4EX7A 2G08A 3I6BA 4EENA 2HHLA 2EARA 2YN4A 4NABA 1U02A 2GHTA 1ZD3A 2OA0A 3GYGA 3QUCA 2YMLA 2GHQA 1Z4QA 4Y2RA 1RRCA 2YMPA 3AR3A 5AI0A 4YIKA 2AH5A 4MWOA 2ZBFA 2R8EA 4Y2VA 4Y3UA 4KX5A 3UM9A 5AW3A 1L6RA 1ZRNA 5AK3A 3A1EA 3SKXA 5AI8A 1FEZA 4ZEVA 4UM5A 4OFZA 5AHXA 3AR7A 2BDEA 4UMVA 4CNQA 3QU2A 2AUTA 1NF2A 3L0YA 4EZEA 4BKMA 1N8NA 4E88A 1Z5GA 1NRWA 1VFPA 4KYTA 5AKJA 4OD0A 4UU0A 2ZBEA 5AESA 1EK1A 3VAYA 5AI4A 4XQ0A 4KN8A 4FFDA 4DW8A 1WVIA 1Z4LA 2HCFA 4Y2JA 3L1UA 3ZI4A 5A3QA 2HX1A 3W5AA 5AW7A 3U7EB 5AM2A 2MSNA 4UAVA 2RAVA 3FM9A 1SWVA 2YBDA 5ALQA 3N8GA 4OCZA 2C8LA 3EF1A 2FUCA 4YIHA 2WF6A 3BA6A 4L6AA 1Z4IA 1Z4KA 2B0CA 1RMQA 3BWVA 1QQ5A 4J2TA 4EEKA 4KX3A 1AQ6A 2NO4A 4YH1A 3WKCA 4UM7A 4BNDA 4L6CA 5AKZA 5AI6A 1QQ7A 3AR2A 3NANA 3UMCA 2C88A 3U26A 2YJ6A 2B1RA 5ALMA 1WPGA 2P11A 3E58A 2JGAA 4RESA 2AMYA 4UW9A 4C4SA 2ZOSA 2YJ3A 2PQ0A 3KOOA 1RKQA 2B82A 2HO4A 5AM3A 1IWOA 5ALFA 1XP5A 2FDRA 1QYIA 3WK5A 3QX7A 4I9GA 4KNVA 1Z4OA 1L7NA 1YS9A 2IOFK 4UASA 4HYTA 2FPXA 4XOUA 2FPUA 2WF5A 1SWWA 2I54A 3WGUA 1K1EA 5AVQA 5AKIA 2G06A 4G63A 4Y2SA 2QLTA 5ALLA 2HF2A 2IOHA 4GIBA 2G09A 1RLMA 1F5SA 3MC1A 4UU1A 3SD7A 4IG4A 5AVVA 3WK6A 2CFSA 5ALKA 5ALUA 5AW5A 3AR6A 3AR8A 2FEAA 4F71A 2ZXEA 1T9ZA 5AKKA 4UARA 3QYPA 4ZEXA 1Q92A 3N07A 4JB3A 5ALVA 1ZRMA 5AW4A 2CN1A 3KZXA 4EX6A 2FPRA 1T5SA 2HDOA 3OTQA 3SMVA 2IA5A 4UMEA 2OYCA 2EAUA 3PDWA 4L57A 1XPJA 5IS2A 3DAOA 3L8HA 1YV9A 5AK5A 1RMTA 3R09A 1WZCA 1T5TA 4Y2TA 4J03A 1X42A 2HI0A 4I9FA 3ESRA 3NUQA 3ESQA 2HSZA 2FPSA 2R8XA 2RARA 1Q91A 2YJ5A 2P27A 4UATA 3R4CA 2JAWA 1TJ3A 3ET5A 4O8CA 4Y2PA 4CF4A 3QLEA 1RKVA 5ALZA 2HEGA 3NRJA 1RPZA 4HGQA 3M9LA 3A1CA 3OCYA 3I1YA 3U7GA 1LTQA 3IRUA 1RQLA 3U13A 3L8EA 2B8EA 4CE6A 3WKBA 3WK8A 3WKDA 4BX3A 5T41A 2O9JA 5AW8A 2WF7A 5AVYA 3ONNA 1YMQA 2ZG6A 2IYEA 1S2OA 1XVIA 4Y2XA 3S6JA 3OCZA 3TLMA 4Y2UA 5ALOA 2C4NA 4YCMA 5AW2A 1J97A 4NV0A 1YNSA 2WFAA 3SKYA 3U7HB 3FPBA 3L1VA 4H1WA 3WKEA 1YDFA 4C4TA 3MN1A 2B30A 2GO7A 3IB6A 3QUQA 4AS3A 4QJBA 5IT0A 3CNHA 3UMBA 4BYGA 1VJRA 3CZ4A 2WM8A 1ZJJA 3ZUPA 2Q4RA 3DV9A 2P9JA 1Z4JA 4B6JA 3PGVA 5ALNA 5ALSA 4PNHA 4AP9A 2I55A 2W4MA 1L7PA 2VKQA 2IOFA 5AVWA 2EATA 1L8LA 4GXTA 5AI9A 4JDPA 5AKEA 3QU7A 3SLRA 3EWIA 5AM0A
chains in the Genus database with same CATH superfamily
1JEDA 2R1TA 3ENNA 3GELA 2RG1A 1QO0D 1U90A 2Q6VA 3TCNA 4RTOA 5L7WA 3GEMA 1PR2A 4TXNA 1N25A 2IS1A 3G7SA 1RMYA 2I6SA 3NIGB 2E4ZA 4J4HA 3RSHA 4ALIA 2BKLA 4Q37A 2NSLA 1HETA 3U9SA 1EE1A 1H2XA 1KY4A 2V6JA 1VP3A 1M8PA 2Z09A 4LHVA 3UHFA 5KMGB 3K09A 5I9TA 2PWBA 3GA0A 3BH7A 2H1IA 4YEDA 4AAYA 3PG5A 3TLZA 3FCSB 3EWAA 2H0RA 4QBTA 2XRMA 4O4JF 3VPCA 5J1TB 1D5WA 5JNVA 4EMBA 3PE6A 4XIYA 1UMKA 1F4PA 2Q6TA 5DHUA 4BX0A 4KR3A 2YDYA 1X1EA 4BQQA 1Q0UA 3ENKA 2C3OA 3L9XA 5KHOC 2YBEA 1BROA 5CLLA 4B3MB 5F9MA 2EKZA 4RTKA 2GJ4A 3I28A 4X92A 2A4KA 2IXFA 4LJ9A 3DS8A 1P31A 2W8BA 1YCHA 4IGFA 4ITVA 4JC5A 2UUOA 5ES4B 3DEYX 3LDAA 3Q40A 3FOEC 2ZYIA 5BRAA 2A2ZA 3EXEA 5EKDA 2YJ4A 1NDHA 1ZIOA 1C0PA 4LG1A 1R6UA 1Q15A 4UXJA 4KU4A 5TQ2B 1RABA 4YRQA 1RM0A 3S99A 4K9QA 4FNAA 2IUEA 1ZUHA 3I8SA 5KYWA 3S4YA 2PRIA 3HCEA 3PR2B 3PZRA 3HHPA 1NAIA 5K51A 4PZPA 2V45A 1XI2A 1VMEA 4P5EA 5DNEA 1QHHA 1Z37A 4IX1A 2UZ1B 2QTMA 1K8XB 3WOHA 1SVNA 3ZZTA 1VI5A 3C3YA 2O3SA 2IEDA 1GL7A 1GPKA 4BCCA 1ENOA 2I4IA 3CFYA 1QMGA 5D7BA 1NXOA 4E51A 2EZUA 4JFRA 4U1RA 3JYQA 1PKEA 3VH2A 4S0XA 2LDXA 3RAPR 3IQFA 2ANCA 3GFBA 4U9HS 3NH6A 4OU5A 4JSTA 6REQB 4EYQA 4IJWA 1CLEA 2HGZA 5CFZA 2VPPA 1NW7A 3DULA 4XQCA 1DTWA 2OQVA 5EGSA 1DBPA 4YCBA 4R05A 1D2RA 2CV1A 2PWYA 1BCSA 1KK2A 1MRZA 3KCNA 3NEAA 4Z7OB 2G1AA 1NI3A 4FYKA 3DBVO 4MP3A 5IYZA 3FX2A 3UPTA 2AG8A 5BVHA 4NKRA 3BB1A 4HQ0A 1TZCA 4YRDA 2K2QB 3ELBA 2MR5A 3ABQB 3A1UA 3OOSA 1W96A 4XD7D 2HFKA 1V25A 1A50B 1N0VC 3K0FA 4MI3A 4LRXA 2C9YA 4CTKA 1T26A 4BEVA 1MAAA 4AJEA 1EUDB 2GLXA 1RD4A 2QUAA 3GVCA 3HVHA 1L9KA 3QBVA 5KYKA 1UL1X 4EB8A 3A6LA 4GH5A 4OJKA 2OCLA 4JSRA 1XZDA 5G1OA 2GBLA 2V6IA 4MGIR 4MJLA 3OA2A 3WK9A 5T5QA 5KVCA 1NHWA 1SGWA 3VVBA 2RIPA 2YW2A 3SC2B 1JKJB 4C0AC 3FNIA 4OXXA 2WJGA 2HF9A 4DMFA 3EH1A 3AM3A 4QOEA 5DIFA 2F4NA 4X6XA 5I7VA 1PR5A 3BMNA 2VDQB 4DSTA 1WM1A 1DJNA 4EAAA 1A95A 2XEXA 5AK6A 1KZ1A 3F5QA 3RBXA 3UT0A 4F2DA 1H66A 1R66A 4AJ4A 3C41J 3T54A 3T7JA 4F4IA 3G7UA 3SNHA 3PCTA 4KQWA 1AKRA 5EWJA 3P9PA 2RAFA 2C4MA 3O4VA 3MBKA 4PC6A 4H7PA 4WKNA 3MQFA 4UTVA 5BR4A 2VWGA 5IKPA 2Q5CA 2WMOB 2BGLA 2X4IA 4JJGA 4PCLA 5HRCA 2P6RA 2D3WA 2XTZA 4IIXA 1IN1A 3HV2A 5JH7A 2YOGA 3TCXB 5KNCA 1RBMA 3U09A 2O0HA 5JV5A 4FFPA 2A3NA 2E4AA 2Q5QA 1SKAA 3BWMA 3R3SA 3T35A 4EQZA 5BW6B 4DA4A 4N1AA 2ORVA 1EXDA 1K9VF 1XOIA 1BKDR 4MIOA 1NP3A 3K3PA 2JGLA 2TMGA 4J16A 3B6KA 3DYIA 2GMWA 4C7MA 1KTIA 1F7UA 3CUSA 3L77A 2Y27A 1G6KA 5DHSA 4W5JA 3BXXA 5JS8A 5FTLA 5IT5A 2PGJA 2XDWA 2Q29A 4TZ6A 2YMMA 2XCIA 3NCTA 1GNSA 1Q19A 4ITUA 1TM3E 1YSCA 2F67A 3WTCA 2DUWA 2MJLA 2XUFA 1JSLA 2RHJA 4P83A 3WYEA 5MFZA 3GLGA 5GVRA 4H0CA 3UF0A 4UKDA 1VE6A 1W48A 2NV0A 4DXAA 5AVRA 1J24A 3QUTA 1TRHA 3JYHA 1BWPA 2I7CA 1CY1A 2Q9UA 1F5NA 2LKDA 2V7UA 2JZOA 3I01A 1FJHA 2H07A 3EZFA 4HLQB 4K87A 4N3BA 1M54A 1SXJB 4BVBA 2AZTA 4R31A 4EUKA 5C7IO 5LP6B 3BM5A 4HYYA 1S4MA 2CL0X 3EGDA 3H0KA 3NVDA 3UENA 3LP6A 1CF9A 3UAGA 1DLIA 3D3KA 4BNMA 2VHQA 2CVHA 3RK0A 2CXUA 4ZOCA 1NVVQ 3GYBA 2QPAA 3WFIA 4NAHA 5LSAA 1TAHA 3EXHC 4G2TA 1E4OA 4QGBA 1RADA 5AKGA 3TQIA 4BV8A 4C6TB 1L7RA 1ZGJA 3VR6A 5B58C 8AT1A 4LQLA 4Z0PA 5JCJD 2EKDA 2VYNA 3EFOB 2I1WA 3ZX5A 1JB9A 4DMKA 1E1CB 3U7FB 3S29A 5A5FA 5AVXA 1UFVA 4CT5A 5MGBA 5L6LB 4MQ4A 3LDHA 4D82A 1O4WA 1RQNA 2PM8A 3AP2A 1ZCZA 3BMOA 4C2AA 4CW7A 3I61A 1NVUQ 2V6GA 3ZTYA 4O2RA 5DYTA 1JVNA 1UDXA 2AFRA 4FCWA 4MRNA 4ZV4A 3DM9B 2D54A 4UHFA 4DWWA 3EPKA 2QF7A 1NVVR 2C94A 1T4CA 3RUEA 1I36A 2ZCUA 4EX7A 1PI3A 2W2LD 3HQ4O 3IO5A 3RSSA 1ST3A 5HKKD 1Z2OX 4XYGA 3ZJTA 4H18A 3EC1A 3P0FA 1N1GA 1QR2A 1XQYA 2EARA 2YUTA 2WM3A 2ZDQA 4IQGA 5JISA 5DNVA 3GYGA 1E1RA 3ONVA 4DSOA 3G6WA 3JALB 4R8SA 4G07A 1VZ3A 3AIMA 5HE9A 5HIKA 3WIDA 3GLHE 2FOLA 3OHPA 3DHNA 1RRCA 2HRRA 2NPIA 1BE0A 1A8IA 3N75A 3JD1A 4E5VA 1M2EA 4WX2B 1CUAA 2NO1A 2OLEA 2H4JA 2Q8QA 2VEDA 2CZCA 3ESXA 3SBXA 3TDNA 3V7WA 3ZLUA 1RYZA 3DOFA 4FR2A 5DHPA 4B4KA 2AH5A 1J22A 2ZBFA 4U00A 1GAJA 3EXFA 2HY7A 2P9TA 2H2FA 4GVLA 1TA9A 4NY1A 2PS9A 1Q7EA 1P0CA 3ZDXB 4ZEVA 4XUCA 2WT8A 5AD1A 5BSMA 5JO9A 1CB0A 1RACA 1H1LA 4RHCA 1P75A 4COOA 3RIEA 1QVVA 5CXQA 5LJLA 5IJXA 2OQIA 1OAAA 4JYMA 1NXXA 4AM8A 3CKLA 4KAXA 4TYQA 5D1NA 5J5AA 2H08A 1OF1A 3V7FA 5I4CA 4LSWA 3DCJA 2QLNA 4RPKA 4NEQA 1NQAO 5DJ5A 5A4KA 4E5DA 2YZGA 4WJKB 5KJ6A 4BY9E 1RW4A 3CX8A 3DMGA 3N3AC 2XODA 1Z5OA 4UUOA 1AN0A 4IXNA 2CNBA 3FXAA 1YZLA 2GWHA 2P78A 2WAMA 3SLGA 1R8YA 2WPNA 1OBFO 4J9VA 5E8JA 3UW1A 2ZM6B 4RK7A 4EKGA 3ZQJA 1YACA 2ZROA 4KPGA 4D8VA 2YKGA 1SU6A 3HP1A 4KN5A 1P1IA 3O0TA 5FTWA 1DCMA 2MWMA 3QUSA 3STWA 3T9DA 1C8VB 2WJAA 2C8JA 2L42A 3JY6A 3DAFA 4RPIA 3ZXXA 3BSSA 5AM2A 4BCBA 4BRSA 3RK4A 2NXCA 1QIIA 3L7DA 1PJRA 2PMBA 5HTOA 1F3LA 2V7BA 2GAIA 2QORA 3U4AA 5BMVB 4YIHA 2FQYA 1GDHA 3L7IA 5E7IA 2F1HA 1Q0ZA 5CVJA 3HM2A 1S3IA 1SXHA 1E99A 1XMIA 2ZTHA 2GZAA 3KOMA 2XYGA 4KX3A 4V3BA 3DCNA 2X0IA 2DTXA 3P2OA 1NT4A 4N65A 4LXIA 3GBVA 3AVWA 4Q1CA 1SBQA 5DYNA 2YJZA 2IKSA 3AR2A 2X8AA 1JDVA 2ZZKA 4DLKA 2ZRNA 4Q4HA 1CR1A 1KO4A 1V5EA 3U39A 1DPGA 1OZFA 4GPBA 5B4VA 2ONKA 3L6EA 4GKBA 1FMTA 3VFDA 4I4TB 5EP1A 1EP9A 4RADA 2P6OA 5KWSA 1SY7A 5CNMA 4BP3A 2J31A 5A05A 1V35A 1E1MA 2ERCA 4G0WA 2QTTA 1IWOA 3FCEA 5AHWA 4HLDA 5DGIA 1TL7C 4V0MA 2ID7A 3VTFA 4C04A 1U28A 4W1SA 4E33A 1H6BA 4HMPA 1L7NA 3EXEB 4O2BA 1PHPA 2D59A 1U7ZA 1L5WA 5TLSA 5B6PA 3ADCA 4MI1A 3GPLA 2WTNA 1X80A 3GR6A 3MMPA 2FV8A 1UINA 2C8VA 1J70A 4V24A 5FPQA 3WWYA 4AF6A 4YRBA 3ORYA 2D74A 1QE5A 1E2BA 4AULA 1XRQA 2R1VB 2HRBA 2CF5A 3QKRB 2XF2A 5C3MA 3KB2A 3HNOA 1SNYA 2NXNA 4EUNA 1U6JA 4JXJA 3CU5A 4W8HA 3T0GA 4LZAA 4QT4A 5IK2D 2BHNA 3Q3HA 3LYUA 5HG0A 2G09A 4J94A 1WB6A 2Z3WA 2NTNA 4UCWA 5TV2A 4A0FA 3P4XA 4ZDIA 5ICCA 4IVRA 3H1FA 1M6NA 1T1GA 4DRYA 1QYCA 1D2AA 5LQNA 3MGBA 2C7VA 3MELA 3KLMX 1XGKA 5LCXA 4CKBA 4LTDA 4XR4A 3P32A 4ROSA 1GUDA 1UC9A 2PZMA 1W46A 4PVCA 2WIKA 1O7JA 4DLNA 2LXNA 4OYLA 4E5PA 2YRFA 4TLLB 3JQRA 4N41A 1QG6A 5AUPB 4G0PA 4EW2A 4AMBA 4EX6A 2C4UA 5HM8A 1IK4A 1QPBA 3LOPA 4JLWA 2OO7A 3OPNA 4D5EA 4IJVA 5FDFA 5JFOA 1TW3A 3V4FA 3FUUA 1G2PA 1JA9A 3DL4A 3TPZA 1QIJA 3QFRA 3AVXA 1WP9A 3DBIA 4RYLA 4MWZA 3BE6A 5LD2C 4Y9RA 1W581 3TZKA 5BR8B 3P5SA 2RAUA 1FYFA 5CD9A 2GD0A 3OUUA 1E63A 1X42A 2ES4A 3L06A 1OI2A 2FHPA 3ESRA 4HRVA 4WZBA 5JBNA 2CK3D 2BUBA 4MEAA 5LQDA 4G09A 4L9SA 1MJNA 2J3HA 1XB2A 4N7JA 3KBOA 2B4TO 3LFHA 3M6MD 3C6YA 3H6GA 1VCHA 1K6MA 3DNMA 4JLDA 4NIMA 2P40A 4PSDA 2X1VA 1X9IA 1CRQA 1YDMA 2Z43A 4G36A 2IP2A 4X6YA 3ZGNA 3R0XA 3RSFA 3QVVA 1RKVA 3ELYA 2CL5A 1YVEI 3H4VA 5ARCA 4ROTA 4NMMA 3M9LA 3Q7RA 3UWSA 1JPUA 4W1RA 5F5XA 3C3MA 3K71B 3U13A 4MIEA 1NXVA 1V6AA 4I5EA 2EFYA 1HQKA 4BWFB 2Q99A 4CDRA 5KINB 2XI4A 5B57C 3FWHA 3PFWO 3FSGD 2VJBA 3RT1A 4BX3A 2W6ID 4DIUA 4ZPXA 4RNCA 5JJ5A 5T57A 4CKCA 1I2BA 3A6FA 3I3SR 4LNHA 1I0LA 3HCWA 1THMA 4M37A 4U3JB 2HTEA 2I3DA 4H35A 3LBHA 2OKGA 2YTZA 2H1WA 5DYGA 2RGRA 1GNRA 1Y7TA 4R54A 4JWKA 5MDHA 4DE5A 5AJVB 3DEIA 3GRVA 3LK6A 4KO3S 3I3OA 4MV7A 3ZXIA 2HADA 5JSZA 1Z0UA 5C3UA 1Y4AE 3K9WA 4MS1A 3R7NA 3TLMA 4J7CA 3C1AA 2XHEA 3NHKA 4BNVA 4BNIA 2DR2A 5FCDA 1HSZA 4CKZA 4P3XA 1Z2DA 1BHJA 3VSEA 1D6MA 1XAJA 3M81A 4G0NA 4YONB 2B2CA 1Y48E 3U7HB 4DJFC 3L1IA 1E9AA 3PUKA 3KAJA 4V2UA 4B3JA 3BRSA 3I42A 4HVCA 4HDMB 1G66A 1ADFA 1D6NA 2OXEA 2GO7A 1EUZA 2Q3LA 3A4NA 4X1YB 2XNCA 2Q4DA 5FI5A 2W48A 4HEQA 1L8AA 3WRXC 5IT0A 1K7FB 3B70A 4I46A 2XXJA 1BMDA 1V7CA 4JUBA 3DDNA 3LXUX 3GNTA 5SY6A 4P7JA 4EQ6A 1GCUA 4O4LF 1HQYE 4DLBA 2P9JA 4CF7A 3KVYA 1Z4JA 4LYGA 4OLJA 4UU8A 4RCVA 2RSLA 2Z98A 4H17A 2WU3A 3GLGE 5HJ7A 4ZO9A 4P92A 3VOAA 2ZTMA 1SVMA 3EGVA 1G20B 3GRFA 4RZ2A 2YJNA 1PBTA 3JQPA 4UPVA 2O7SA 1L7PA 2VAMA 4GKJB 1XG5A 1Q7TA 2E18A 3SC3A 1D4FA 1VRVA 2JFUA 4QUBA 1PFWA 1SN7A 5DBGA 4B2LA 4AXBA 4CU2A 1Y1RA 3THSA 4L3VA 3JARB 4P84A 3EWIA 1X2BA 1M8FA 1YR6A 3DBRB 5B55A 3D1JA 3P19A 5D3ZA 3WJ7A 5CCEA 3LGXA 4FR0A 1Z83A 2VUIB 3FJYA 3DLCA 2I3ZA 2D0DA 2X1LA 3IEPA 4GQBA 1V48A 2P90A 2Q1WA 3WWOA 4DRXB 5JXIA 2H85A 2OPBA 1SKYB 4YTEA 2GOYA 2AL7A 3DE2X 4MQLA 8GPBA 2ZP1A 2QS9A 4RV5A 2CBXA 3C7AA 1BXGB 3HJUA 1OIWA 4ILEA 3ORRA 2Q4OA 4K5QA 1GCAA 3TB6A 3V1UA 4BFXA 2RGXA 4PHFA 4QVKA 5AK0A 1JB1A 2JLAA 1FA9A 3HA7A 3S27A 2J6CA 2D7CA 1MJ5A 2QM3A 3V1YA 3X1ZA 1LPAB 3RCBA 1KJJA 4WCFC 3IS3A 1XMJA 3H19A 3OG9A 2PZLA 2QE6A 5BYKA 4EO7A 1GQOA 2BUCA 1FQWA 3AB8A 3CUVA 4FQ8A 1R0CA 4IDGA 3O7WA 3SYNA 1QCDA 4EB6B 1UBCA 3GAMA 5GIOE 4F2PA 4H27A 2EHDA 2RBKA 3BK1A 1USGA 1FS6A 4H0NA 4TYMA 4WA7A 4F3KA 1EE9A 3IEMA 5B12A 1DRUA 2OFXA 2GCIA 4B09A 2C82A 3DTTA 4GWKA 2ZK7A 1TEVA 2YXBA 4FYPA 4HLUC 3ZYCA 2DLCX 5KCMA 3UXMA 2R4UA 4FNOA 5C8XA 2FR8C 4GZLA 2MSDB 3ZD6A 1YRWA 3SS7X 2ZUTA 1HFJA 1ORTA 5DW0A 3KSDO 2SKDA 1P17A 2PT7A 1S89A 4TN1A 4S04A 1D2NA 3SDZA 3HCPA 1SUPA 2X7HA 2BFDA 3TXAA 3UBMA 5CVVA 1GUYA 3NOVA 2B7LA 5IKXA 3IV6A 3G9QA 4KEAA 5HJ2A 3JZIA 5SZHB 2PXCA 4FPXA 4X3PA 4OX9Y 3F6SA 1DARA 1ZH6A 3G13A 5FA8A 5DSTA 4D4LA 1S3FA 3RRZA 4CYMA 4XYBA 3L8DA 4UQLA 4G01B 1WMEA 5FP0A 3H9EO 3R9KA 1B8UA 5B7PA 2RHHA 2WV7A 3AVVA 3MJEA 2FZCA 2J7PA 1VCIA 1C7ZA 2FOIA 3RJZA 5LDGA 1KETA 1KMIY 1U3UA 3KZNA 2B7BA 2CJYA 5EEHA 1ZBQA 1U2GC 4B32A 1XK6A 1IY0A 2Y0BA 5DCUA 3LBNA 3CW2A 4EY3A 5J4KA 4WV3A 5I45A 1X39A 4G1EB 1HOXA 4YMIA 3ISJA 3E7XA 3TLGB 4DNXA 5CLJA 1EB8A 3D81A 3KKEA 2WQ7A 1UBTS 5K3EA 4UVDA 4D9GA 1E6CA 1L4FA 1PJSA 3ZNNA 5AUQA 1AK2A 2JJ1A 3ED5A 2C59A 2IVFA 3IFSA 3DTVD 2IS4A 1NU8A 4DBVO 3RAJA 3THXB 1W87A 3N2KA 4NFLA 1ZD4A 2O8EB 1HZZA 3LKZA 3R74A 1UDBA 4UHBA 3PXDA 2ZI7A 2EIXA 5K0JA 4QFCA 1RIIA 1Y6GA 4KQEA 1QDLB 5C1IA 4R68A 5IH3A 1CC1S 5AKLA 3KKOA 3R3UA 4PIPA 3AHEA 4LMAA 4XJVA 2P9CA 3S7TA 4TVKA 5J2UA 5T4EA 2H48A 4LFAB 2XXBA 5L4LA 4WN9B 3W1EA 4NZ9A 3WS7A 4YAGA 4JQSA 1KAQA 5DHTA 1SKQA 4BRUA 1Q0LA 3NCHA 4F56A 2D5LA 1P9RA 2OC9A 2ZSHA 4HBZA 5BMVA 1Z06A 4KXFB 1FSGA 5AI5A 1B8OA 5AYVA 1I7DA 4AY4A 3LS2A 1H22A 5C8ZA 4FYYA 1NI5A 2Y1WA 2ZKIA 2PSSA 1JXMA 4Q9LA 4BO7A 1OXSC 4GP7A 1VSQA 6LDHA 5ITVA 3P97A 3H11A 3T3EA 5COAA 4QPCA 3S2GA 2DT5A 4ZU3A 2LKCA 3ANXA 5A4JA 1C3JA 4QE3A 1OLXA 4HQ6A 5A0FA 1GILA 4JODA 1XU7A 2VYQA 3EOZA 2IWHA 4PR0A 3K2QA 4FEEA 4G41A 3TW0A 3V8NA 1SG6A 4EECA 1E4VA 1WR8A 3P9CA 2PKYX 2ZBUA 3NT2A 4PC3A 3U48A 5DZSA 3OIYA 4KJZA 4N82A 1A2BA 1BAPA 4HCJA 4GDMA 1DTSA 5HDQA 1P81A 3CJQA 1S1CA 3G2JA 1P2FA 3KOUA 3ZV7A 1LS1A 5B4UA 1LNZA 3BF8A 3N2EA 5BXYA 2F8SA 3GV0A 5CHYA 3CVVA 2NZ2A 3FR8A 3AW9A 3NRBA 1PZNA 4HAXA 3ESBA 3KD3A 3UNXA 4XFKA 2FETA 2I2WA 2O6HA 4PBTA 4WFIA 3PJRA 2OBLA 1B2RA 5BUQA 3V00A 2AZDA 3W6ZA 4X62B 3LUDA 5L3ZA 1VL0A 1GQSA 1R9NA 2JH9A 4KMRA 4J1QA 4PO9A 3GBSA 1MNQA 3IVXA 1E8MA 2SNIE 4X3OA 4LHYA 1ZD1A 1UFKA 2AOTB 3FOCA 4MUYA 3VZQA 4MVWA 5CTAA 2BMWA 3G0HA 2BFOA 4D6YA 1YVRA 3FZQA 4RIGA 3UV6A 3FCOA 1ZC3A 3QI7A 2VT2A 2Q3MA 3EZ2A 2COEA 4UTXA 1XEXA 4PG5A 4XD2A 4OBEA 1AZSC 2VOJA 5F76A 4AF8A 2YV3A 3P1JA 4ZQEA 1A8UA 3KWFA 5EWMA 1XA0A 1V5GA 1ZP6A 1TM5E 5JNLA 3NBXX 1RDFA 2PDAA 2GAFA 3TK1A 1EFRA 1EWVA 2HD4A 5DLQC 3UGQA 3NAMA 3AM4A 4IZHA 4Q1AA 2W8BB 1GFSA 4IGAA 1XJWA 1MB2A 3VUEA 1A97A 3GFRA 3EC2A 3KIPA 4G1CA 1SIBE 4I9NA 4U6SA 2FMXA 3VAZA 4YFVA 3JVIA 1Z0FA 1Z45A 2QWXA 1Z4NA 2ZBRA 2NOAA 1X7YB 3HDJA 3V1MA 1MR3F 4C5AA 5AO9A 2PCJA 4C88A 1XRRA 2C2ZA 1U0JA 1B93A 1RWBA 4FZRA 2ID4A 5C32A 3PWSA 4FOTA 4HZIA 5JD5A 1XLUA 2CV2A 1WCXA 2CMHA 2AD5A 2BL4A 2XA2A 3AUJB 3R0IA 4AZ3A 1XD8A 2HHLA 4YUAA 3H17A 5JXWA 1ONNA 1U02A 2X8JB 3E27A 2F00A 3PNKA 5K4AA 3AETB 3MFYA 3V8BA 1O95D 1EFVB 3QPVA 2GHQA 1H0SA 2XWSA 2IH5A 1COWA 4DG9A 1IEWA 5BR1A 2ZCVA 3EG9A 3VH1A 2GCNA 1FX0B 3W6PA 2VHVA 2B4AA 2XSZD 4ZODA 2AFHE 4R5HA 4N18A 1YZGA 3MWFA 4KUGA 1ICEA 1PR6A 2KHZA 3AL2A 1Z38A 1XEAA 3O21A 2NVBA 2YHUA 3OE7A 3S2SA 4EI9A 2H2HA 3BRCA 4MVJG 1ILEA 2P6MA 3WLHA 1ZNYA 4ZJYA 3TQOA 1I9CA 3CH5A 4UUPA 4L2IA 1GNQA 1G5FA 1K6XA 2F9LA 4OP3A 4RD3A 1ZSYA 5D2CA 1UAAA 5HS4A 2WP8J 1BC5A 3LY7A 4CDMA 4WDRA 1EX7A 1SC9A 2JEYA 2GNAA 3DHEA 4LV8B 5ETJA 5HDBB 4OD0A 5JOQA 1J49A 3U17A 1W4RA 1KWKA 4JQCA 1BFUA 2WAXA 5CX1B 4ME6A 1QE3A 3RS9A 5K0CA 1QU3A 2FFQA 4MQ5A 4TQAA 4JI5B 1I2AA 2W58A 5KNDA 1QPZA 2TECE 4OFXA 4M1SA 2HSWA 4AJJA 2QZZA 4HQKA 3L8ZA 3KNZA 4P3NA 5F51A 3O26A 1DWPA 4D45A 3HBAA 4OV6B 2DSTA 5BV7A 3UHJA 3QX8A 5AP9A 4RKRA 1ZRSA 5F64A 1RAFA 1G8AA 3G02A 3GA7A 3DV2A 4PC7A 3QH4A 3M1LA 4DV4B 1DQPA 1XDZA 1ETUA 3GD7A 4NNOA 5EHQA 1PLJA 2NU7B 3VKWA 5BV2P 3D0RA 1A5BB 5E2AA 3AEQA 3GF4A 4EPVA 1LQUA 4CJXA 1EK6A 3DFMA 3ZZ1A 4D57A 5J43A 1XL0A 3A2LA 5E6RB 3R5HA 2IYFA 2XCTB 1XUOA 4QHTA 3CEPB 4YAWA 1DC4A 2G40A 1C4XA 1VSVA 4B6PA 1P8AA 4CBVA 1W5BA 4HFJA 1IB0A 4Q1BA 3G5MA 3WSWA 7YASA 4TLMB 1WWKA 2ISQA 2JFYA 3PFFA 4BNDA 4D9CA 3PYLA 5TJHA 3OHMA 4LJ5A 1TMGE 4P53A 4YA6A 1JIUA 4ZEOA 5J4YA 3UMCA 2RH9B 4C78A 3GC6A 4OB6A 5EKXA 3AH8A 3K8YA 2HO5A 1PR4A 4PSVA 1E69A 1SQ0A 2LUOA 5A9SB 5D3KA 5CDHA 2W2VA 2DM6A 3TG8A 3CCCA 2GZRA 4OSEA 3T7SA 4DLVA 4J0CA 3LC0A 4PN7A 5CB4F 1NBEA 2BKVA 4I8IA 4IIDA 3RKSA 3P27A 1Z36A 2ZYGA 5AM3A 4TVOA 2D0IA 3H9QA 1OILA 3F3MA 1U9IA 2Q3BA 2TS1A 3LQYA 2DECA 2DHQA 3X1YA 3Q3JB 2WJJA 2XJ4A 1YIAA 2OILA 1A7KA 1MKYA 1UJMA 2NW6A 4RDXA 1DBRA 1GGFA 2I54A 2XDQB 3GRZA 5FNVA 4QXQA 1EXMA 1JZTA 5DSZA 4HDCA 1V1JA 1JTFA 4CPDA 1ZAKA 3BBPA 4KLRA 4YJ3A 2H5IA 4Y2SA 5CIQA 1JXAA 2XUIA 5DNDA 3W7BA 5CFNA 4HR7A 2I1QA 2IQ5A 2WJHA 4EL5A 1HX7A 2WE8A 5IJ9B 4FDVA 2B25A 3KG2A 1OWLA 1RRGA 1H2EA 5EHXA 5KTSA 4QNRA 1A5AB 1WOYA 2HF8A 3T5AA 5FV7A 2H2AA 1K7CA 2JLCA 2VHYA 1X1RA 4RVSA 4OMUA 2BFFA 2OK7A 5ICMA 4QVIA 3U37A 4BVFA 1UXJA 4KFRA 1V71A 2AJDA 4GLJA 4OFWA 5G3YA 4B7UA 2E21A 4I2VA 4IXMA 4K9MA 4P36A 1NYQA 3ENVA 3O73A 3Q0EA 1KY3A 3IEIA 4G0ZA 3DYBA 1A5ZA 3HY3A 1LNSA 4D9JA 3SMVA 2IA5A 1R4AA 2DH5A 4MO9A 3AXSA 1K75A 1GXSA 1OV4A 2RHWA 3NBAA 3OIFA 3L8HA 4RELA 3ZHRA 4OQNA 5FD8A 1Y3BE 2ASVA 1LI5A 5A3JA 3PK0A 2EU8A 4G5XA 5FTKA 4J1NA 2HWWA 3G82C 1RBZA 5BQFA 2AG6A 5B3AA 3RJTA 1SXGA 2G4VA 1OGYA 2EFDB 2R8XA 2IJGX 3T7TA 3ISTA 3U6KA 2R7AA 4J6EA 1NBAA 4JWTA 5HMMA 1QFZA 2PGLA 2XKAA 3UOWA 4HNSA 4Q4DA 4RH3A 4CVNA 4L7QA 4R9UC 4QASA 2WJZB 3ORFA 2VJOA 1EP1B 1VGQA 3T3PB 5HKKA 2R6JA 3GZJA 4RULA 3P71T 1NW6A 2OGTA 4AJ9A 3L8EA 4Q3DA 1F0PA 2O4UX 1E9VA 2Q9CA 4AN0A 2NU8A 5K3FA 3ZCQA 1E5VA 4LXYA 3TTUA 4GR4A 1IBRA 1KVQA 2GETA 3K4HA 4QDOA 5DH9A 5BWCA 1Z0KA 3IMFA 3AI7A 2IDMA 1UKBA 4CFZA 2NWQA 1SIOA 2AB0A 3DTYA 1P72A 3ZHUA 3U3XA 2ZG6A 3KLNA 4J1SA 4MUXA 2QVBA 4ZVNA 3JRXA 1MH1A 3A4VA 3HR7A 2FR8A 4XDHA 1A96A 1HKUA 3PCRB 4OUKX 4R84A 4YB8A 1SZJG 4CQMB 2AYXA 4IXDA 5B2EA 4EGQA 3EEIA 3N2IA 1M7GA 2F2TA 4U4AA 1KQFA 1JSZA 1JX6A 2IITA 4FEGA 1Q77A 5I9MA 4G67A 4HXGA 4B80A 1X3LA 3CINA 1PQYA 2VNAA 1HRKA 1ZM9A 4C22A 4DGQA 1DRVA 4DXDA 4LJRA 1YJXA 3T7AA 3ABSB 5FWYB 2PIDA 2IBMA 3MYYA 1AA9A 1TYDE 2Y92A 3H7IA 4Y9UA 3L92A 2CNWD 3QYFA 3UFBA 5EPUA 1ODIA 4AYWA 1Z5ZA 1TIKA 1X6VA 2C3PA 4DLLA 1W88B 3HXQA 1ONPA 4PTLA 5DK4A 1JGTA 2G5TA 1X86B 3ZUPA 3UK1A 1G41A 5GONF 3ZS8A 4W9MC 1PJ8A 3G85A 3R3XA 3FE2A 3IBYA 3ZDEA 3RJMA 3DWFA 4E2WA 2QPTA 2QZSA 1AV7A 1LSJA 4QDJA 3KQSA 3A05A 2B4RO 2I6FA 4B6JA 3PGVA 4LDQA 1SHLA 5ALNA 4AN1A 3OQNA 3GOHA 3TTXA 1LI4A 4KL8S 2RAPA 3IAEA 4MVJP 4QJ4A 2BV3A 2HA3A 3PE3A 4NCBA 2WKPA 1LFDB 1C9EA 1DELA 1T9HA 2VDJA 3HADA 3V32A 3I39X 3LC2O 4PBRA 4YJ2B 7AT1A 4JDPA 3PFBA 5HMLA 2EP7A 2IZ0A 3HSYA 3TG2A 1JG1A 4ZT7A 4BEJA 1L6IA 1HL7A 4XJSA 2BI4A 2NP7A 1DZIA 4OQLA 3REOA 3PX2A 3ZI7A 4CDNA 5HX7A 1VJCA 3MJFA 3QW2A 1FXWA 4IOKA 3BGWA 2GBFA 2ZDGA 2XX3A 2ONJA 1DKLA 2JBHA 2X22A 3KD2A 3PVZA 5CEFA 1L4KA 2XR1A 3WB9A 1ADBA 4JASB 3RVJA 3ZWWA 3F6BX 2Z58A 3PNLA 1EBUA 1TF2A 1H93A 3PRYA 2NU6A 1N5OX 1DINA 4F5WA 4UFPA 3R9WA 1EKXA 2EZ4A 3NLLA 3A6PC 2Q62A 1W49A 2FRXA 2HXSA 2W6OA 1NUUA 1YKFA 4B3BA 2BKUA 4P6VF 1MH9A 4TMYA 5IZCA 1U0TA 1OH6A 1G5QA 3LX8A 4RHEA 3QF4A 1S2NA 3OIUA 4LY6A 2P9YA 1P1CA 2IXBA 4OQZA 4PLTA 2X9LA 2I80A 4ZVPA 5EFOA 2R6R1 3TPFA 1UBKS 1YBMA 4OMFG 5EYPB 1WHSB 4ZFNA 1JBKA 3TLBA 4Z49A 2HMYB 2JIOA 1OIVA 1XYYA 4GG1A 5AM1A 1GTSA 4JLAA 3SDBA 5EIOA 1G98A 3P8ZA 3QTLA 3TLCA 4BUJA 1EM8A 3GVXA 4EARA 3TKYA 1U2SA 4LYHA 1FX1A 4BXOB 1ZM7A 1I10A 2ZSKA 4YY3B 2CL6X 3CEHA 1P2VA 4NJEB 2X9VA 3KLOA 4QPJC 5JD6A 3H9BA 3DZHA 1GCGA 1UXOA 3EUWA 4KE6A 1GZDA 4OIFA 1NY5A 4RL4A 4NP6A 2FU5C 3W1WA 4D42A 1R0LA 3ME5A 3HSKA 3IOYA 4R0NA 4XFDA 3TFWA 2Q6KA 4L6IA 4I99A 3TLYA 3JRWA 1NVDA 3E3MA 4RL6A 5DT9A 4OFBA 1R9JA 1LJLA 4LDZA 1Y1SA 3FVWA 2PH1A 1VGRA 2VO1A 3RIYA 1IAQA 2GXUA 3AR9A 5F9FA 4YJFA 4QUHA 3TZBA 5HUJA 3FWYA 1DEAA 1OHHA 5K6AA 1MD9A 4ZU6X 3EYWA 3ILVA 2FUG1 1KBZA 1J6UA 3B82A 4OHPA 2NUAB 4C2BA 4D3XA 4F0JA 3F8SA 5IJAA 1VHQA 4NMLA 4RVUA 3I09A 1FSSA 4EG3A 1R8XA 4WCDA 4CLXA 5ICEA 4KQGA 2UKDA 5A3SA 1DDOA 3NRCA 3R7FA 3N8HA 3DCYA 1RWWA 1DEHA 1VMKA 4EB3A 2UZ0A 2Y6UA 3VV2A 3G23A 2F1IA 4BP9A 1Z6YA 1FVHA 2PLRA 3BWCA 1G21E 1TQ2A 3QFSA 4B6FA 3EZ9A 3G2NA 4Q9IA 1EJ2A 5DSXA 1NXPA 3AJDA 4YDQA 2AKEA 1NVTA 3P45A 1YONA 4HB0A 4WAUA 3W5CA 4FNMA 4MRVA 4RKQA 1MX1A 2LIVA 1EGVB 3ZOKA 5DKFA 4E2YA 3L79A 2XOKD 1TCUA 2GAOA 3O3CA 4ND1A 3RB8A 3S28A 3VYUB 3LBFA 1F60A 2CUZA 3A06A 4NESA 4TYPA 1NJ1A 5EJGA 5FLEX 3LX4A 5IAKA 3DT8A 5JASA 3GGSA 4XVQA 2XUQA 4L22A 5TPWB 2XF8A 1D9ZA 4D0GA 3CLSC 2JC3A 4CQMA 2IH2A 1A9SA 2Y2UA 2V65A 4IX9A 1UXGA 4U9IS 5DGCA 3DD1A 3H5RA 1IVSA 4FDMA 1T0UA 4MYRA 4O4IB 5CTJA 3UKJA 3SVTA 3LWZA 3KUKA 2P2NA 3ZXYA 3KVRA 1U98A 4HZUA 2HOQA 4URYR 4F4DA 4GI7A 3T9CA 4C6RA 1SA0B 2BGIA 4A73A 2IF0A 3MPUA 2A88A 3F4BA 2N1BA 5B5SA 2W2KB 2V4MA 3I52A 4OA5A 4BO0A 2F3RA 2I78A 2JASA 3REQB 2AF3C 5KYTA 3IIEA 3HCOA 2FQ1A 1FRQA 1TLLA 3AT1A 4JU9A 1RRKA 2JIMA 3WR5A 2Q2QA 2DPYA 5BV0A 4H2DA 2ARKA 3WGHA 2PCLA 3ICCA 2YWDA 3FETA 3QV2A 1PGNA 2R8BA 1Q1BA 5HPYB 3DSRA 4ZT5A 1D2GA 4PYJA 5BUSA 1Y7IA 3PD1A 5FBZA 2FDCA 5ARBA 1P73A 3FTCA 4IICA 3JQAD 3I76A 1L4EA 1GQYA 2YUIA 4PX3A 4AC9A 5CH8A 1DSSG 3QIVA 4M98A 1U1EA 2HIHA 3W9UA 5CW2A 3M6WA 1XC7A 2HMUA 3X2FA 1Z0AA 3HKDB 3W3AH 2ZPAA 3HEBA 4IV0A 2GVNA 1U4SA 3O92A 3TW8B 4FYWA 4NL4H 4PYIA 2A0FA 3IYLW 3UQYS 3V3KA 4LPSA 2RGNA 1N2EA 1NVGA 1R0KA 2G9RA 3PQ3A 1Y33E 4YLEA 4HDKA 2O19A 4MHOA 4C43A 5C0OE 3Q2KA 1Z5UA 2IDKA 3P96A 4UAUA 2G4CA 4F5YA 2AZXA 5D86A 1KRHA 3DZKA 4JV5B 2WDZA 3A27A 1VZ2A 1QVWA 5B1HA 3M3HA 1BX1A 1U4NA 1MNAA 2AEEA 2WYIA 3EOBI 3VR4D 5EHZA 1UPFA 3FOFC 2F3UA 4NICA 1YF3A 3PEEA 4R1QA 4NH0A 1BE6A 1NOJA 3RV4A 1QIHA 1NDUA 3VU9B 1IN8A 4P1ZA 1ZIYA 1N75A 3GT0A 4Y2YA 2CJFA 4DLPA 2Y4OA 4Z3OA 1PUIA 1TCBA 3GL9A 4TM8A 1PFKA 1NJ2A 3OUZA 4HH3C 5G0SA 4XWOA 3QEOA 1XU4A 5IM4A 1V6CA 5E7MA 4FI3F 1V2GA 3CRVA 3MWJA 1KI4A 3SGLA 2YZMA 2IPNA 3BWEA 5ALHA 4KI7A 4UCXA 2EJTA 1SURA 2ZBQA 1SOMA 3MVEA 2NUPA 4X54A 3I9FA 4F4UA 2W37A 3INGA 3WZ2A 1G4AE 5BRNA 5IAGA 4EY6A 1ZAYA 4Q7MB 1FW8A 4QREA 5DTIA 1XXHA 1JQJC 5IJWA 4J91A 3LWNA 3IIKA 3FDXA 4AO6A 5BN1A 5F4ZA 1GWNA 2JCXA 2C2HA 2VNJA 3JQAA 3M6FA 3IQHX 4M6WB 4RXUA 1PZFA 4BJ1A 1TEZA 3EIHA 3TTTA 2M6KA 3G2IA 3PI7A 3M8KA 1X1TA 3BCSA 3F96A 4UBJA 4Y6OA 4MUBA 4QA9A 3K96A 3V4PB 2PYIA 3LUJA 3OTGA 3BEOA 4JITA 4URUR 4HL6A 5A4AA 2YRXA 2YMLA 4J1TA 1PJ2A 5E6UA 2O0MA 1GGVA 2GZ3A 3GJ8A 4TWJA 3BCUA 2IUUA 2HLDA 2RC6A 3TTVA 4CIBA 1OLUB 3LKDA 1W34A 2RB4A 4GX0A 5I9NA 1Q0RA 1POXA 5K0NA 1O96A 5AUOB 5U4QA 4B3DA 4IHJA 5EHIA 2X13A 4X1OA 1YT5A 4MGEA 1H2FA 2IPMA 3E7FA 3P5BA 3OIGA 5EE1A 3SIWA 1Y3IA 4EUSA 5AHXA 3RYTC 4R1PA 5DRYA 4KHPB 4CNQA 3BJZA 2YYZA 3RIHA 1MIOA 2PPLA 5EUQB 4G0UA 3CX3A 3IHKA 1DBWA 2ODPA 1PGJA 3LUKA 4D99A 1TQHA 4NU6A 3DJFA 1U1FA 3EQ6A 2H8KA 2I2CA 4CM5A 3SNKA 2J4FA 4NV3A 1N6IA 1ZI6A 1IM8A 4PZ0A 3E9NA 5FBKA 2VF2A 3DWGA 4OVKA 5ULLA 3OQVA 3NTQA 3CY6A 2VZEA 5L3QA 2XT9A 2F1RA 3AKCA 3SSNA 3MINB 5DBOA 1IIRA 2CHQA 4J8PA 1WVIA 4G0OA 3VDXA 5KZMB 1HNXB 4ETMA 2QRPA 1FFEA 1N2JA 1KY2A 2WU1A 3FZEA 2PRSA 4AB1A 4MXDA 3GJ0A 1J8QA 3SEZA 2VF4X 4IQ8A 3UFXA 1J0AA 1Q0PA 2DT8A 2HCJB 4JP3A 2OVBA 1G18A 2MSLA 3R5FA 1G60A 1V4VA 3B12A 5BYBA 4WLEA 3SX0A 3AY6A 4DJDC 1VJ0A 2JFVA 3O4GA 1RLIA 4MV1A 2IUYA 3EF1A 1N4AA 3SQLA 1RWPA 1CNMA 1E3TA 4QNMA 1SOVA 2HDNB 3BIJA 4MGHA 3UMMA 3M7IA 1LGYA 1B76A 1U9JA 1W5EA 3TLAA 1CUEA 5JAPA 2P0AA 3VSDA 3BE5A 3QOXA 3EFEA 4L07A 1JHXA 2DAPA 1NV8A 3HB0A 4RDCA 1N33B 2E2WA 2I5PO 3O8LA 1JAZA 1NX6A 5E0KB 3FNEA 1DFHA 1SPBS 4LGYA 1EX9A 5EZYF 1NUPA 3ZHYA 2ONYA 2PBFA 1P19A 1KRXA 1QIKA 1CULC 1JJIA 3BH0A 4GW3A 2SCUB 4J0DA 1KMNA 4ZYZA 5KOHA 3CA8A 2QUHA 3BICA 4JC8A 1K3UB 4ZMSA 4L7VA 2QRZA 3SQDA 4PCUA 1QVRA 2GEBA 2OEPA 2AC2A 2OGWA 5JZSA 4HMOA 5BWNA 1AUPA 4F3NA 3KOOA 1JWLA 1PR3A 1THTA 3LSTA 4YECA 3IH5A 5LLDA 3PXAA 3M6LA 4Y6LA 4HVAA 4MI6A 3DMRA 1GPDG 2WT4A 5ALFA 2OXIA 2HBQA 1L4MA 2H51A 3BCRA 3GJ3A 3PQDA 4JJIA 1NVMB 4Y7DA 3U0VA 4J07A 2FXIA 3TTYA 1KEEA 4YRGA 2WF5A 4WXMA 1N2ZA 2RJ3A 4O4LB 4B75A 3AZOA 5IKMA 1UJBA 1L7EA 1M1YA 1KTVA 1ZZEA 5EWJB 2C3UA 1HLGA 1KMHA 2W93A 1QHHB 2O57A 3BHMA 1N2HA 4YAJA 4CF6A 2IHUA 2B98A 5IDXA 1R0XA 1U0NA 2FCAA 1N36B 2AZMA 1E5LA 3NHZA 5GONB 1L5GB 4MTCA 1UQUA 3FRJA 4KE7A 1MDFA 1VYHA 5FB3A 4CQJA 3OEED 3RWMB 1ZCAA 3SD7A 3FD8A 5A4IS 1WOMA 4TOIA 4IG4A 5TY0A 2P4HX 2PX8A 4QGAA 4QUDA 5ALKA 5H70A 1AA6A 1PBNA 3NFRA 1XJCA 5D5HA 3WLNA 1NYRA 2JJ8A 1BVHA 1UZNA 2V5UA 1CWUA 2VPTA 1Z56C 4F71A 4IEEA 2J5QA 5MF6A 3WP1B 3U4DA 4WLVA 4LHWA 1MFZA 4XGQA 5JZBA 1EE2A 3ZJVA 1F2UA 4IKEA 4B71A 5FPPA 4DJAA 5DM70 2B78A 1ZXXA 3RSZA 2REBA 3SQMA 2EAUA 1NBIA 3SZOA 3AHGA 1OXVA 1XXHE 3QHAA 4L57A 4XWAA 3KT8A 5CCXA 3FTEA 1U1GA 5EMKA 5FPSA 3T99A 3CRQA 3OQMA 5JAHA 4KYUA 1FOEB 1KZYC 1AS2A 4Y6SA 4IIHA 4E7OA 4G1MB 3KTOA 1ECJA 1ORHA 2LE0A 2OCAA 3ZJ4A 4OUDA 1GTZA 4TT8A 1J0EA 2HI0A 2MINA 2DE0X 3ZQ6A 1G8PA 2B7CA 4HP8A 1OLUA 1YDEA 4UXIA 3S8YA 1USKA 3FYUC 5DYWA 3D1LA 2FJUA 4HSGA 1CEQA 1MGPA 1P5FA 5FL7A 5EPOA 5A7GA 3TNLA 1LX7A 5DGXA 4BUCA 4ZOQI 1T8TA 5LMNB 4X45A 4YO8A 5HF6A 4MVJF 1MO3A 4YAUA 1T0JB 2EF0A 2B69A 3NB0A 5FFFA 1AQNA 2VTBA 3DO5A 1L1RA 1RPZA 3O1LA 2DHCA 4JI6B 2QT1A 4BZPA 2RGWA 2V7EA 2VYVD 4JEMA 4FDLA 4M22A 1U2RA 2OBYA 2WZCA 3N05A 3WLPA 5E9QA 5BMOA 4ZO8A 1CUCA 2WJIA 3HO1A 1VL2A 5EIFA 1FTSA 1OYVA 2BAGA 2P0EA 4NZOA 4D4GA 5KOIA 1IQPA 3SBDA 1W19A 2QZ4A 3DV0A 2X5XA 3A4LA 4G0YA 4PG7A 2DZDA 4Q0MA 4XSGA 3ZGZA 2FW6A 3SK0A 3W8EA 3NHFA 3F2IA 4M9QA 2X0EA 1NASA 4S1TA 1GQFA 4L4XA 5L40A 2AN4A 2CT8A 4NYMQ 2BGNA 4S1VA 3X1MA 1JEOA 1CZLA 5DHRA 2HU7A 2JFXA 1B1AA 1IY8A 1ZMRA 2V55B 1O97C 1H05A 1MB9A 2EEZA 4PHGA 4JJ8A 3M4XA 1D0IA 3NOOA 4YLYA 2DX7A 4YCSA 5BN4B 1FLVA 2R7NA 3ENQA 3GHHA 3CLHA 4AWAA 5H4GA 3MN1A 1ODLA 3NYQA 3HEMA 5I4BA 5C31A 2XBLA 5CDFE 3QEKA 2GS9A 2PGXA 1T2UA 4LBWA 3CNHA 3B6IA 3ITNA 1RXIA 1K8YB 2B99A 4L51A 4M3NA 2GO1A 1WMFA 4CGYA 1XTIA 1T3HA 1HM5A 1L5QA 3VSBA 1W2GA 3LW7A 4H0FA 1YIOA 4YP9A 4RVGA 1W6RA 3SQWA 1XCGB 4Y98A 5IJ0B 4PPYA 3UAZA 4IDPA 1VKOA 4A03A 1Z3CA 3CKYA 3TN7A 2FWNA 1E1DA 3PQFA 4NONA 3KQYA 1CQWA 4BMPB 1NNUA 2WUFA 4ISBA 1AXGA 4G24A 4ZT3A 4F92B 3U4QB 2WKWA 3E9ZA 4FQ5A 1IE3A 3Q6NA 2DWCA 4CMAA 1WBDA 4NNJA 2XD9A 4D8YA 5A2GA 1YUMA 3I1JA 1WCWA 1KDRA 1WY5A 3EPPA 1EXWA 1ABEA 3W34A 2GPYA 1ZGCA 2R86A 1VKZA 4P08A 4ECAA 2BZ1A 1JHVA 4JX9A 2D62A 5AM0A 2XY4A 5H1YA 4S0ZA 2PZFA 1WNFA 1PN3A 2MSWA 1JDBC 3K5IA 1PUXA 3MCUA 4Q3EA 3ODPA 3UAXA 1HYQA 2QHXA 2RE8A 1TX4B 2D13A 5EXDA 4PWZA 2CXSA 2M1ZA 2X6TA 4NCIA 1CUXA 1KJYA 2VSYA 2W2TA 3MG9A 3GDHA 1QJ4A 1JQ3A 2ORYA 1GA1A 1K7SN 3OZUA 1S2MA 5J4HA 5ALEA 1KKUA 3LY9A 2H00A 4OQDA 5E1OA 4EHNA 4EITA 1MCZA 1WW3A 3FMVA 2VJMB 3H6KA 1I4LD 1VRCA 1DAEA 2B92A 2HRQA 2DQSA 3UWOA 2JA2A 3OMWA 4C7XA 2AW5A 1SQSA 4QGFA 1NG9A 4LV5B 2O7NA 3WBBA 1SHKA 3P9SA 2PKCA 1WAMA 2FWMX 1BQ3A 2WUEA 3TE6A 3K1TA 1GGKA 3MAAC 1T2AA 3VMFA 3K6SB 2QTCA 1JN0A 1KK3A 2BHLA 3RYHA 2AXEA 5G02A 2GEJA 4PGHA 3ZGXA 1QF6A 3F97A 3OPXA 3FWNA 2JBWA 2IHYA 2A1TR 3Q9UA 5KX5A 4A7PA 4ZPJA 1R4NA 3EVCA 4QVGA 4KP7A 2O0JA 3KTAB 1U8AA 5CT4A 2JHCA 1YUNA 2WVGA 3KU4A 4OJMX 3UOGA 5A2QA 2BGJA 4MWEA 4JI3B 2K7FA 2OQ2A 4R51A 3NALA 3M70A 2EERA 1J56A 1RJDA 4JNCA 3SOZA 1XDUA 1WKBA 2Q7DA 3IKVA 5L7TA 4K6HA 5MN4A 5CRIA 1QGZA 4H1TA 4G81A 2YWFA 2QIPA 2GFQA 3GFPA 4L5IA 1YGYA 3AQIA 1XXHB 4JQYA 3E6AA 3QNWA 3ZEIA 3RJ5A 5JSHA 4Y1GA 4MKZA 4PXSA 4I4TF 4K8OA 4MW4A 1H5NA 3UMYA 4X1KA 3KEMA 3QWAA 2C77A 3MERA 2WFLA 1YDGA 1DOAA 4GPIB 3R9IA 1WV1A 3H9UA 4NU5A 2C1ZA 3I2KA 5LQJA 1SXJE 3AGPA 4AK9A 1Z6PA 4PLVA 2X2FA 4AL4A 4B3RB 1E1RD 2WD8A 2W70A 4NZPA 4D3DA 1Z5VA 3OCWA 3PEWA 1KYZA 4MP8A 3W4KA 1KSHA 1J9GA 1A9YA 4C20A 5B7GA 4H4DA 1UJ5A 1WUJS 4AY2A 1OI7A 2CB0A 2WOJA 3CJTA 3HP7A 1L7QA 2FPOA 5F78A 5CH5A 2R1ZA 2XT0A 5DM60 4D9KA 2C5EA 1ZRHA 5LQUA 3D7LA 3UCEA 4MLDA 4QBIA 2WNHA 2C1EA 2FOXA 4UHDA 4Z2YA 1A82A 1ZKDA 3D6TB 3PTZA 3QBDA 4J0KA 3ECSA 3TZEA 1B16A 1SCUA 4MHSA 3ZY5A 3E5RA 1N2IA 1T34A 1MXFA 1UEJA 2N46A 3NFYA 1GZ5A 3WJ1A 5FI0B 5DNYB 4ZQHA 3W2GA 2GH1A 1FK8A 1EFPA 3X44A 2JKVA 2IYAA 3BG5A 1MEEA 3NBKA 5JO0A 1J2YA 2JF0A 4P4GA 3GJ6A 4P4TA 4NXNB 1AF4A 1J25A 2CFOA 4JGIA 2ISCA 1A9PA 1GPJA 3PNSA 5LQMA 2IPOA 3VISA 2I7XA 3RKUA 1E1QA 1EUYA 4PZEA 1E20A 5A04A 1G8KA 3RV3A 1EK2A 4S05A 2Q50A 1CUFA 2OBNA 3BWYA 1C1DA 3LQ2A 5CFQA 2EYUA 1QK3A 1X74A 4L78A 5DV9A 1C0EA 2J9FA 2Q0XA 4QJ3A 3KSZO 4P54A 5I3ZA 1JBEA 1TJYA 1UZAA 3HVIA 4UNRA 4JIGA 2G28A 4YYEA 4CKWA 4QU0A 1Y4UA 1YC5A 1T5DX 4DF3A 2VYND 2E6UX 2FE1A 1MC1A 3BHJA 4H7JA 3VX3A 3ZVLA 3KKPA 4BO1A 4RHUA 4V0QA 4Y1FA 5LWQA 4YUYA 4JELA 4MMXB 2FSVA 3MPOA 3O47A 3PUHA 2W43A 4LOIA 5FIUA 2F55A 4B33A 1CJTC 1U0HC 4OU4A 4Y2HA 1JLHA 5J47A 4PO3X 4Q48A 2ISSD 4OIMA 4O8ZA 3NWEA 1G16A 4WNCA 1F0KA 1FE8A 1N6RA 3OECA 1CB7A 2C97A 4JK3A 4CM9A 2P69A 3IKTA 3IUSA 3ABIA 3CLRD 4OHVA 2D4AA 3AY0A 4RJLA 2BCEA 4QHSA 3NAGA 4N3AA 3FFTA 4TS4A 1Z63A 3ZXUB 4GX1A 4LDNA 3T4PA 1IY1A 4LK3A 1Q3TA 3HN7A 1MX5A 2Q4TA 4PPQA 4PCAA 4CCAA 2AZ4A 4D0LB 4EMSA 2E0IA 4Q03A 2X9QA 4RWZA 3DKPA 1BOOA 1CZUA 1ZOLA 2PRZA 3IEXA 5EEGA 4BPBA 1NUHA 3O8BA 2F3PA 3K6RA 3RS7A 3W7AA 2CLIB 3BIFA 1EFRD 3NTRA 1U8ZA 5CURA 2HXYA 4CM3A 3WGTA 1NVFA 4NNPA 1R50A 3C3PA 1G17A 1G8JA 1IJEA 3BSWA 3FWPA 3IILA 1QIEA 5FLKA 4ZYVA 1VYVA 1MC5A 2CLHB 1NP6A 4QX6A 4LF5B 2O8FA 5DP1A 1PGOA 1C7QA 4Z2AA 2ODWA 3WIBA 2KE5A 4G5OA 2WFZA 1N2CA 4K0RA 4LTMA 2F17A 7ABPA 3GJTA 4PAQA 1CE8B 2RI0A 4ZT2A 1PWHA 2FEXA 2QTZA 2FZEA 5C35A 4UNNA 5JRJA 1B6GA 5FFMA 3C7KA 3QMPA 3QVLA 3OCJA 3OTWA 5FLYA 5TARA 3RR2A 3WWPA 5IF3A 1QPGA 3FSEA 5I4IA 3IUNA 2PY6A 5KU1A 2O14A 1LB1B 3VGPA 3BIOA 2CNDA 3ZTWA 3M1YA 4XPZA 1OTHA 3AQ4A 1QHFA 2QI9F 2XMQA 4OQ4A 4C4XA 1IHUA 2OLJA 1O77A 1VE3A 2ZVPX 3PSHA 3QU9A 4JLPA 5CUQA 5E0OA 1APBA 2YXPX 1KYXA 3G0OA 2OBBA 3S2EA 3R5KA 4FW8A 2QKYA 4M53A 2X58A 4QARA 3T8YA 3UG7A 4BLUA 4FWTA 3Q7IA 1O94A 2X8BA 3HKEB 3RAEC 1GVNB 4DLUA 3I5YA 5K3DA 2XRZA 2BGTA 5ADVA 1RS0A 2C4VA 2HJVA 2EVWX 4N0MA 4P3KA 4ZOBA 3E48A 1T9KA 3HCBA 1COZA 1XHEA 3R9XB 5IUNC 1RAHA 2QK4A 3WRYC 1OLSA 3SOPA 4Z4GA 3I6BA 2DQ4A 2QRVA 3C43A 3I72A 3HYSA 4BNHA 2OM2A 3O74A 3M6AA 4EHHA 1ZJ4A 1E2QA 1R74A 5DMXA 3WLTA 2W6PA 2PT9A 5HCNA 2ZFUA 3DB2A 1YB1A 3DFKA 3KOZA 3W77A 1HYGA 2I4MA 2XD4A 1KI6B 1L7XA 1XMSA 1E32A 4FHFA 2O2YA 3A6DA 3V9AA 1NXTA 1UR5A 2GBLC 3BHNA 3C5WP 4ANFA 4QXAA 4KSCA 1RCUA 2ZRBA 1JLLA 3HBMA 5FNZA 4DPKA 3JSXA 1FMJA 1USUA 1S2DA 2ZIVB 3B7WA 3BCHA 4QPPA 5A9TA 2Y71A 1QYWA 2PFGA 4CG1A 4ERXA 4MYTA 4X5OA 4RHTA 3S2UA 4A8JB 3HM9A 2E1PA 3JAWA 4AKIA 1IK6A 5EESA 3ONFA 5IW8A 3ZZMA 5HFNA 5FRDA 3V8EA 2HJ9A 1E61A 1NF2A 4DCTA 4EZEA 2IFTA 2VJAA 8ABPA 3IP3A 2O1EA 2QR2A 4IZOA 4A16A 4GOMD 1AXRA 2JAQA 2REQA 2PYDA 4ARZA 3JS5A 2UUCB 1KC1A 1EJ6A 3PITA 4A1OA 1PP4A 3BXHA 1KE2A 2DB3A 1Z6XA 2NZ8A 1XZLA 3I83A 2AE1A 2D1QA 4HY3A 1XAGA 4C4ZA 2IE0A 1EK1A 2N1MA 4KQCA 4GL4A 4DR5B 2PJDA 4LVCA 3AFGA 2XQKA 2E87A 1RYFA 2FUNB 3ID6C 5JMPA 3T4XA 3CZPA 3T94A 4F2WA 3TLKA 3EQ2A 5DLPA 3IDSA 2HYDA 4DW8A 3AVOA 1JDBB 1LY1A 3GIWA 4TWRA 4Q3BA 2XMCA 3A4MA 1QM5A 3PNQA 4EJMA 4TTIA 1Z28A 1CJKC 1FS5A 3AHFA 3D2BA 4UVEA 5LQCA 1IU9A 4M1TA 2PT5A 4M1KA 5KKNB 2EKBA 4E2XA 1W2HA 1QIMA 1POWA 1CXZA 1GARA 4JFAA 2XAAA 3DPUA 1G3RA 2O7VA 1WXWA 4MUFA 4F4CA 5C51B 1IBKB 4DHEA 1C9JA 1KAEA 2GKOA 4FD2A 2C8LA 5IP5A 5C52B 4KOEC 4AKHA 3BA6A 3W3AD 1K5DA 3I2GA 4RPJA 3E0XA 3N3BC 2C31A 1AGYA 5C8YA 2XYPA 5CCDA 2RCYA 1QE0A 4EWLA 3CB2A 2GEFA 4J2TA 1F1JA 4RZQA 1DWQA 3ZK9A 1S2GA 1CJSA 5AKZA 5JWHA 4Q7LA 4QXMA 4URFA 4DUYB 1G8HA 1RQPA 5HF9A 3VO9A 5PGMA 3URKA 3GLTA 4FFBA 1G1AA 5G2OA 1MOQA 2R9VA 2V7WA 3EUAA 4GI3A 1D09A 4JUCA 1GADO 1UXKA 2OZVA 4MVYA 4C6HA 1VLQA 2PX2A 1GGHA 3DOOA 4LWOA 5WRFA 1AF7A 2Y8EA 6REQA 3KAQA 4ZQFA 4JN6B 1KU6A 2QR5A 4V2IA 3OWXA 1XD2A 3RSLA 3E5MA 4JLOA 2CNLA 3RG2A 1VE7A 5EKTA 2ZJAA 1VLLA 1ACLA 5AJWA 2BH2A 3SU8A 1GFWA 2HSDA 1HGXA 3IGFA 2Y1KA 3Q7PA 4ND4A 3QX7A 4AJPA 4B84A 2EFHB 1MN6A 4IHAA 2IGTA 3DTVA 2IOFK 5G4KA 2GSDA 3KYCB 2AE2A 2XCRB 2WKSA 4Q19A 1ZN8A 3BGOS 3WAGA 5DHAA 4BAGA 4QGHA 5AUNB 1J39A 3HXOA 4S1OA 3IBFA 4DDVA 3VZBA 4RJTA 4G63A 1T2VA 2X0RA 4PSCA 3UYLA 2A1IA 1N6HA 5CYPA 2WW8A 1PEYA 3OZ7A 3BTOA 3CLRC 4X97A 2QX4A 3UMVA 4GI2A 2QRHA 1QS0A 3MXTA 4MWTA 2WB4A 1M9NA 1JG3A 1RZRA 4QQKA 4DMMA 1H0KA 1MPXA 2X42A 4QTXA 3RD5A 2ZZMA 1NHGA 4R1OA 1QCZA 4LZLA 2F7SA 1EX1A 2ZXEA 4BV3A 2JFGA 1E5DA 4OLAA 3TBFA 4A15A 4ZCTA 4M1WA 4UHJA 5JFTA 1AE1A 3F6EX 4FHCA 3HJNA 2DUNA 1M6WA 1ZRMA 4QATA 4YACA 4HDRB 2PR2A 1P6QA 1VXRA 4NBSA 4OLHA 1RM5A 1GZUA 4OHZA 3OTQA 2R65A 4KYIB 5CT6A 2F43B 3P9RA 1BVUA 1TU3A 1JYFA 2QTVA 1O6GA 4Y18A 3Q3VA 3AVPA 1RMTA 5KB3A 1RE1A 2FX5A 2X77A 5GP1A 4MROA 3R7SA 3IPAA 3HXLA 1SQ5A 1TVEA 1M2FA 4L73A 1E2HA 4PRYA 2XCLA 3MMXA 4QECA 2YASA 4I9FA 1WDKA 3D6AA 3EGOA 2P67A 4UOZA 2BE7A 1FX0A 1M2JA 1QBGA 1NMEA 2V0GA 3CM0A 1F6BA 3E9RA 3FB4A 4TMZA 2X86A 4UATA 2HRDA 3AMVA 3AOGA 3USCS 3HB5X 5E9WA 1PJAA 3OZEA 4O8CA 5JT1A 1II8B 3DQQA 4FTWA 4HB3A 4DVJA 4YUVA 4ABTA 2J5RA 1W93A 1WDLA 3WYFA 1I14A 3GH3A 4CM7A 2DBZA 4AUEA 3OJCA 4JH0A 1T5IA 3BS4A 2G3YA 1MBZA 4HVLA 4HNTA 3LTNC 3IQWA 1CY2A 4N8DA 2B8EA 3GJXC 3NP9A 4P38A 1WUTA 4RKWA 2QIOA 4HXEB 4DJTA 4HYQA 3U44B 2ANBA 3ZE6A 5BV8A 4AWBA 2GWRA 5J63A 1X7XA 1NVKA 2W8ZA 2G6BA 3VZSA 3DVAB 4Q15A 4MA4A 2XMPA 4HWPA 2P6PA 3TQQA 2KX7A 5FEUA 4KNYA 4CEJB 1YJCA 2D2EA 2K2WA 2IODA 4IBOA 2J8ZA 1T0HB 2NT4A 2X6RA 4OHBA 4TRJA 3ZVKA 1OLOA 4BNYA 5CVEA 1CDDA 1JKIA 2G72A 3PC4A 1UKEA 4LDRA 2B8NA 1N5IA 1RWMA 3JQGB 1Z2AA 2J0UA 4HAOA 4IYJA 1IHOA 4LPKA 1PUJA 3JCZA 4W7SA 1P4JA 4A82A 4HT3B 4MINA 1X8XA 1MJFA 4CMIA 2WWVD 3KV3O 2AOVA 4DR1B 3JSAA 2HA6A 2GEDA 1M34B 4WZZA 2MTBA 4FZ3A 3HACA 1P9LA 5BUCA 4W8OA 3I2FA 4BNZA 3PJDA 5I7WA 2WZBA 4RKFA 2HJGA 1OKKA 4Z8XA 1LLDA 2HLPA 4U8HA 1I01A 2P0YA 3L82B 4AKGA 4MI9A 2LPMA 3OJXA 5GJVC 1PT5A 2QQEA 1K4YA 2DBRA 1V96A 1VJTA 2F8LA 4I5IA 4GD3Q 4NMXB 4YJ2F 4AY3A 5A6SA 1U31A 3EIUA 2H16A 2PUBA 2PGIA 4ML3A 10MHA 1NF8A 5F21A 5L4SA 1SZPA 4LXHA 1JR4A 3R8FA 3JWEA 4ZKEA 1ZK0A 4CLRA 3ZK7A 3K9QO 2JH8A 2YX1A 4W5OA 1E1NA 4UTZA 1XN4A 4WKCA 1NJGA 1JHDA 5IBQA 5G41A 1QLHA 4IJ5A 1UMDA 2V7QA 5FTNA 3V6MA 3VNAA 5AVWA 3FMGA 4GXTA 4IG9A 1JDNA 4NMWA 4WLUA 1DC8A 2VJPA 2YXLA 3QLUA 3CVUA 1Y81A 2D5BA 1T3TA 2ROQA 3QK7A 3T15A 1PEAA 1X8KA 3G7NA 3UG6A 4YV2A 1WXDA 3JX9A 1FMCA 1HT0A 1MABB 1PS9A 4OL9A 3DF9A 2VXOA 5LOVF 1H5UA 4TMVA 2GZSA 5L95A 2QXTA 1XRSB 1OT5A 3EZLA 3O1HB 1AO0A 3KQHA 5CA1F 4XFJA 3FHLA 2XDQA 5FNVB 1RAEA 2NUBA 4LMBA 3QVKA 2FSIA 5I7HA 5M04A 2B9VA 3H99A 2G04A 1HWYA 3L8MA 1LSOA 5TVGA 4WNYA 1R8SA 3MCVA 2DWOA 3ZHOA 4RA6B 2FW8A 5TT0A 3UA4A 4AZ3B 3U16A 4LF6B 3USZA 1AMUA 4ERNA 3PXXA 4EYGA 4E5SA 1BWSA 2FZ5A 2NT3A 4MS3A 2CNNA 4EW6A 1C7EA 3LVBA 3V7YA 3DNPA 1H6CA 2O2SA 1LW6E 4FR5A 4N01A 1XFAA 2G0AA 4M1QA 4EJSC 5GIPE 1E8DA 2GM5A 4XWTA 3WYGA 1N9KA 4LECA 5HNKA 3P26A 5ICGA 1B4DA 3LLSA 3TSZA 3FFAA 4CKEB 3HUFA 1U1IA 1Z29A 5J2TF 4XPIB 2ZBVA 2VXCA 5E1BA 2WTAA 5FUMA 1LUAA 4C6SA 5KSZA 2XMSA 4NOMA 4OGWA 3M89A 3ZD8A 4DQ0A 3DVRX 3IVCA 1JSXA 1XELA 1MT0A 4V0KA 4L8FA 1QH9A 3ZWNA 4HF7A 2HU5A 1B3BA 1FNSA 4TTSA 5BVGB 4S3MA 1TCAA 3ORSA 3VDRA 2A1UA 1CW2B 2NZVG 4R7GA 4EJ6A 1PD0A 3DW1X 4G5SA 3DGEC 1QG2A 3CUKA 1AUXA 3IULA 3X1JA 4DC9A 3JD4A 5BPFA 4K28A 4DIBA 2PUTA 1DCFA 3L41A 4FCCA 2Y3IA 1C3LA 3L49A 5CDFA 2X0KA 1U2EA 3HXTA 1OV6A 3ICOA 3EW7A 4W1PA 3TZHA 4DEVA 4FDTA 1CR0A 1DVRA 4RVDA 3I9V1 4M89A 4TYWA 3WNQA 1OXBB 1CR2A 1XVAA 2DBQA 3FLEA 2ACKA 2EZTA 5ITZA 4IFEA 3B3QA 4LHEA 3HZHA 5LVAA 4G1VA 5HQTA 1XAIA 3ZQ4A 5JXHA 2I2AA 3CWQA 3CWZA 1KORA 1YRQA 3F7TA 4K9OA 1JDZA 4PC2A 4WGGA 4C4OA 1JNXX 5EJ8A 5I8WA 4FN4A 4F21A 1GNLA 5HJ5A 3W79A 2FKNA 2NZYA 1JP7A 2BE9A 1Z13A 2FSPA 1ATIA 4ZA2A 1AZLA 4JJKA 1YZQA 1YU6A 4D80A 1W1UA 3ESYA 3IUEA 4WERA 3HRIA 3DZFA 4Q7EA 3K1YA 3IALA 4UE6A 3D6FA 4DNOA 4RF4A 2G1KA 2ZJFA 4M0KA 4F93B 3Q7TA 5T8KC 4BVJA 5KNDH 1J1UA 1WU7A 4XH9B 3WIUA 5KVSA 3II6X 1O3YA 5AVTA 3FJOA 3ZWAA 1QTQA 1GG8A 1HORA 4CIYA 2OD9A 3LT5A 5HUHA 1I4OA 2ECPA 1F8GA 2R11A 2RGDA 1G8SA 4OK6A 3GN2A 5YASA 2BM8A 5AVSA 5DASA 3EE6A 4YCLA 2VOEA 3HU3A 3I2HA 2ZSJA 1KWGA 3HJBA 2RGCA 3FGOA 1W8DA 1ULBA 1E2PA 1RBQA 2YZ7A 3DM5A 3KBBA 5LOVB 2G88A 4MUJA 3QENA 3AFOA 1O6ZA 4DKJA 5D85A 2JS7A 1O9HA 3I6YA 4TV8A 3OX1A 1VFNA 4GRDA 4INPA 5G4KB 1WU8A 1GTG1 3GUYA 4DY4A 1XTRA 5FJIA 3RRXA 3CXRA 4ZANA 1AS3A 1T2NA 3E7DA 1KSFX 2Q6OA 5I4KA 2ZU6A 2B83A 3ZWVA 3PD7A 2IEAA 2RHRA 3E84A 2W4QA 2JL1A 4C7OB 4CETA 4YUWA 4DCVA 1RI2A 5REQB 2CMFA 3OWHA 1V8OA 4NS1A 2FUEA 1O58A 1AGNA 4XE5A 4ZWNA 1TT5A 2JLRA 2GFHA 4HDQB 1CZHA 3O93A 1KP2A 4NBUA 5FORA 3T95A 1SPXA 2Z8ZA 2XCOA 1ZKMA 3WOVA 2RGEA 4TUYF 1OFUX 5FL7D 5B1YA 2NMVA 4FBLA 4O5AA 2CFTA 3Q7EA 1GU7A 2PWZA 1Z74A 2IW3A 2YQ5A 2ZJ7A 3LQFA 1EFLA 5LUBA 1XZHA 4OHXA 2BFMA 4PZLA 4WT7A 2JGDB 4N7RA 1MF7A 3N7TA 5CA0A 4D98A 1Y8QB 3A9VA 2IYLD 3RF6A 1AKQA 3CUEF 4GMDA 4YT5A 5EZYB 2V6BA 5H81A 4E6PA 5FEMA 4R1SA 1JMVA 1YI8A 3A7DA 2AVDA 1ESEA 1G2IA 4KXNA 3WLAA 4DY6A 4E2ZA 1WP4A 4F06A 1KOFA 2HBYA 4PYOA 4G2NA 1Q2XA 1UBMS 1BCRA 4U2EA 4I5GA 5FHQA 2CYCA 2Z57A 4JVOA 1WO8A 2ZVJA 1JXOA 3EA0A 4PQFA 4EJFA 1HOTA 1AKTA 2D00A 1SH7A 1Z7GA 4HDNA 4L4ZA 2QX8A 2YJGA 2CXHA 2P2CA 2HJWA 1A77A 1V39A 1S96A 2YV1A 4GQAA 3BXGA 2UVPA 1GNVA 3I05A 2J59A 3M4NA 3TLXA 5K8JB 4MDEA 4LF7B 1TAGA 1XMXA 5HZMA 2PRYA 3BERA 1V0JA 1JIXA 4J90A 4UTOA 3PE4A 2GILA 4K9NA 2AEMA 3NDBB 4JBIA 3F71A 2HL6A 4F9FA 1G1MA 4F45A 5KNCH 3GRRA 3KDPA 4RU1A 1E4EB 4DV1B 2G5GX 2QDKA 4JT8A 3N86A 4K03A 3KJXA 3I64A 4K2AA 5CLIA 1BMQA 1N2BA 4GKVA 1KQNA 4X65B 3ANNA 1W1IA 4E46A 1N5KA 1EP3B 2NU8B 3DVSX 1M66A 1LTKA 5DI3B 2X2OA 3AR5A 3CSUA 2G6TA 3ETLA 3O8OB 2B6HA 2VP9A 4NCNA 4OJNA 3TZCA 4D9EA 1DAIA 4EO9A 5K3BA 2ZETA 1OAOC 3A11A 5SV2A 1NQWA 2EZ9A 3EIFA 1Q57A 1C1XB 2Y1EA 2ODEA 3O94A 1Z75A 4AJLA 3AX6A 2GCOB 3C3JA 1EI9A 1H2HA 1NYLA 3FN4A 1V3VA 3T7CA 3FFXA 4B3CA 3QJGA 1B41A 4RZSA 4WA8A 4LWQA 2DFPA 5E4FA 4WKOA 3DPSA 2ZJ3A 2ZJ5A 2OMEA 4CMKA 2Z9DA 1L5MA 2IIQA 3JAKA 2PD6A 3KYIB 3MWLA 5ER9A 2BKEA 3T9FA 4WK6A 4H7FA 1HNWB 1EVKA 5FA6A 3AZQA 3WQBA 5BSHA 5AI8A 1HE4A 3GU3A 4GMGA 1JPJA 4PV7A 3ZU4A 2ZT8A 4UM5A 1ZEJA 1GSOA 1FS4A 2B5OA 2BDEA 2QD2A 2Y67A 3CV3A 4ZO7A 3EEBA 3SG0A 5J3JA 3JPWA 3WLSA 1OGIA 1JMKC 2FCRA 4GX2A 4HV4A 1D7OA 3K35A 1G9TA 1X7DA 4BECA 1OW3B 1QX4A 3D0KA 4GICA 4EGCB 1CCWA 3L6BA 4US2R 1UKVY 3AY3A 3P9QA 4X8OA 4B40A 5CA1B 2CJWA 4HN2A 4EVRA 2WWWA 4ZP1A 1UH5A 5IX8A 3RC8A 4BLRA 1QLJA 4R9RA 1G20E 3M5DA 2WHPA 2HA4A 4IIYA 4WECA 5DU2A 4DNPA 5CEEA 2NNLD 5EP3A 4B8YA 2QOEA 4IEIA 2JFNA 2F64A 4NOLA 5FOXA 4XYLA 4EHAA 1JEQA 5HRUA 3RTBA 3R24A 2JGEA 1SXJD 2BM1A 1WY7A 3MAGA 3GLIB 2JFOA 3T1QA 4F6CA 3W2HA 5LA6A 4MRPA 2OR3A 1WMSA 2C4KA 2VYCA 4N5DA 3SSAA 1Y42X 4Q7QA 1RAAA 3GBPA 4PQGA 4UJ3A 2JHAA 2UZ4A 3WGIA 2J08A 3ZWMA 4DMHA 2YHSA 3ILXA 3KFXA 3TOVA 2C7GA 3MLAA 2W2KA 3L0DA 3L6OO 2FUCA 1YGPA 2WF6A 4DLAA 2O8NA 3FI9A 3FZGA 5FWDA 2Q7OE 2F9FA 4R41A 3LJKA 3LPAA 5F1PA 4BX9A 4OXQA 4XA8A 5AJUA 1Q84A 2VQ6A 3NHYA 5I9LA 1VPLA 2DULA 5CD1A 3K0SA 4GDFA 4KPYA 3IDOA 4AX8A 1GPNA 3H2JA 1VB5A 3FDJA 3NKLA 4IWXA 4P5DA 3PDCA 4P7FA 4PG4A 4H1VA 1MB4A 3B13B 4RZXA 5AI6A 3G1UA 2NG1A 3KSRA 4G5QA 4IQ4A 3CX7A 3FHCB 5NULA 4B8WA 2YZ2A 3SX4A 2J1LA 1E1LA 1N2XA 1Q74A 4P4UA 1TUBA 5CDUA 4I8XA 2VUSA 1HEUA 2VQDA 2JD2A 2QN6A 4N5MA 1QF9A 3D2CA 1BQEA 4DUGA 1ZUWA 1RKQA 4CUKA 1PJZA 5C5CA 3HN2A 5D6OA 2HWYA 2C20A 4RPLA 1EIWA 4MUIA 5DN6A 3UCFA 5LBTA 1FTNA 1XZEA 4IQ0A 1H65A 1P1JA 4JXKA 4KNVA 3HGTA 4HNVA 2PK3A 1GZ6A 4FFLA 3ZHQA 4AJHA 1SVIA 3AILA 1KBQA 1WVGA 2FPUA 4RCZA 2L69A 3CBGA 4GUAA 1J20A 1EGMB 3O83A 5JCOC 3LA6A 3N0XA 3MB5A 1A8SA 2P4UA 1SUIA 2BEKA 4WACA 1OA1A 4ARCA 1YO6A 4AUMA 3LLMA 2GF2A 2A5LA 3PUZA 2EJUA 2YWGA 4NBNA 1L3CA 4FXPA 3OOWA 4P0QB 5C5EA 5IC4A 2EWVA 4GKAA 5H3HA 2N75A 5JAUA 5MFPA 1DMSA 2CLCX 2IU6A 3LOQA 3PP8A 1AQLA 3CZ9A 2EDAA 3QF4B 1JFRA 3AY7A 3EFOA 2HR1A 4RGYA 1RT9A 5J23A 2WC1A 2ZVQX 4WKPA 3PF9A 3V7NA 3FNFA 4PE5B 3WI7A 2IZ1A 4HEA1 5A06A 3BGSA 3PDJA 1K5GA 1LW7A 1FNMA 1EDZA 1LDYA 3HXKA 4JB3A 1GPYA 1UAYA 4JP2A 1ZMTA 1J23A 2RK6A 5C1DA 4QLBA 4EO4A 1RTKA 1LS6A 1U2PA 5DOZA 3ESDA 5D84A