3OCYA

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase complexed with inorganic phosphate
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
247
structure length
247
Chain Sequence
EEHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of nucleoside monophosphate substrates by Haemophilus influenzae class C acid phosphatase.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase
molecule keywords Lipoprotein E
total genus 94
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ocyA00
5IT0A 1T5TA 3ZWKA 5ALXA 3FPSA 4XE5A 5AVWA 1Q92A 1SU4A 1EK1A 2WF8A 2FPXA 2HX1A 5ALYA 1RPZA 3ESQA 2WF5A 1O03A 4E88A 4G63A 5AKYA 3QUQA 2HCFA 2R8XA 1AQ6A 4EEKA 3M1YA 4I9GA 2Q4TA 1TJ5A 1LVHA 4FFDA 3S6JA 2YMPA 1QQ6A 2HOQA 3QU7A 3B9BA 5ALHA 3NAMA 1TJ3A 2O9JA 3WKBA 5AESA 1F5SA 3ZVMA 5AKZA 3L0BA 1U2SA 2O2XA 3OCYA 1S8OA 2C88A 3SLRA 1XVIA 3OPXA 3W5DA 4UAUA 5AVVA 4EELA 4Y2XA 1J97A 2W4MA 2FUCA 2EAUA 3SMVA 3WGVA 1L8LA 2B8JA 3SHQA 2BDEA 5ALPA 4UASA 3AR7A 1K1EA 3L0YA 1CQZA 2ZBDA 3QU2A 4MWOA 3WKEA 1NRWA 3UMBA 5AW3A 1QH9A 1YS9A 2B1RA 4J03A 5AI4A 5A3SA 3EF1A 3OCWA 3KD3A 1U7OA 4EENA 3SKYA 2QLTA 4AS3A 1Z5GA 3R09A 3OCVA 5ALUA 5AK6A 2RBKA 2IOFA 1Y8AA 4Y2QA 2HF7A 5AKEA 3FVVA 4UU0A 1YV9A 3FZQA 3SKXA 5AI0A 1N9KA 2YJ3A 2EARA 1RLTA 3ET4A 4J2TA 5ALTA 4UM5A 1L8OA 1Q91A 1Z88A 3QU4A 4CE6A 5AM2A 4C4RA 2NO5A 1TE2A 1FEZA 1ZS9A 1NF2A 1RQLA 2WFAA 2NYVA 4UU1A 2AUTA 1XPJA 5A3QA 4KX3A 3QLEA 3ED5A 1L7NA 1RLOA 3E58A 3ESRA 5AW0A 3J7TA 3A1DA 3WKAA 2FDRA 2JGAA 1EK2A 2YY6A 3KOOA 4BNDA 3N8GA 1Z4KA 3L7YA 1VJ5A 3KZXA 5AW4A 5AI9A 1U02A 3AR8A 1Z4OA 2Q4RA 4FYPA 4GXTA 5AKIA 2C8KA 3U13A 5AW8A 5AKKA 5AM1A 4BKMA 3PCTA 1ZJJA 2NO4A 5ALGA 4FE3A 2GO7A 2JAWA 2AMYA 1O08A 3UMGA 1RDFA 1NNLA 5E0OA 3UM9A 1RQNA 1S2OA 2C4NA 2I7DA 2YMMA 2C8LA 2IA5A 2HO4A 1RKQA 4JB3A 1X42A 3NIWA 3ZX5A 2CFSA 5ALSA 3DNPA 4F72A 1TA0A 2FPUA 5AVRA 1YJ5A 1MH9A 4UARA 4DFDA 4BEWA 4JDPA 4UMVA 3WK7A 1Z4IA 1Z4PX 4UM7A 1RKVA 2YBDA 2WF7A 2WHEA 2MU1A 2R8ZA 3AR6A 3IB6A 3D6JA 5AVQA 5ALEA 1ZOLA 2YJ6A 3EF0A 1L7MA 3ZX4A 2ZBGA 4HGPA 4G9BA 2G06A 4O8CA 3U26A 3M9LA 5AW7A 4I9FA 3N07A 2B82A 4Y2VA 4HGOA 3QU5A 5AVUA 3L8FA 2G80A 3DV9A 2G08A 3MMZA 4Y2RA 2PR7A 3U7GA 5AW1A 2HDOA 3K1ZA 1ZD4A 3E84A 3N5KA 1Z5UA 2P69A 4BBJA 4BYGA 4BNDB 4EZEA 3IJ5A 4C4SA 4CF4A 4AS2A 4F71A 3QU9A 5AICA 3AR5A 3OCXA 3L8EA 4BEVA 1Z4LA 1SWWA 1VJRA 3EWIA 4Y2UA 5ALJA 3L8HA 1YNSA 4NFLA 3OCZA 4XQ0A 1IWOA 4L6AA 2ZBEA 3QXGA 3OTQA 5ALOA 1WPGA 4AP9A 4ZEVA 1ZD3A 2FPSA 4GIBA 5AKHA 2CFRA 2WF6A 4L57A 3ZUPA 3I6BA 2AGVA 4Y2PA 5AVXA 1RMTA 2D2VA 5AW9A 2P11A 3L1UA 1RKUA 5AM3A 2I54A 1J8DA 1L6RA 3BA6A 3QUBA 3FPBA 1CR6A 3MN1A 3N1UA 4RETA 4CF3A 5IT4A 2RAVA 1LTQA 4MUMA 5ALQA 3WK9A 3F9RA 2RARA 2FI1A 3A1EA 5FP0A 2GMWA 2I33A 2ZBFA 3NALA 2FPWA 3N28A 3QX7A 2FUEA 4Y2JA 5ALVA 1WR8A 3A3YA 2GFHA 4NABA 3KC2A 5AKGA 3SF0A 3ZTYA 1T9ZA 2YFYA 4QQFA 4UAVA 3SD7A 2IOHA 5AK3A 4ZEWA 2B1QA 2OYCA 3U19A 4HGRA 3ZVLA 3B8EA 4XOUA 2OM6A 3IRUA 5ALDA 2B8EA 5ALLA 2G07A 3UMCA 4H1WA 2BDUA 2B0CA 2W43A 3PGVA 3HYCA 2GHQA 4NV0A 2QYHA 4DWOA 2YMQA 1Z4JA 4IG4A 4KN8A 4KYTA 2WM8A 2IOFK 5AK5A 3U7EB 4KNVA 4NWIA 3TLMA 1ZRMA 1QQ7A 5AVSA 3RF6A 2JAOA 3R4CA 4OCZA 4Y2TA 2HSZA 3WKDA 4IFTA 4YCLA 2ZOSA 5ALMA 3E81A 2P9JA 3ONNA 5ALFA 4YGYA 3QUCA 2G09A 1XP5A 2HF2A 4UATA 4DCCA 1RMYA 2I34A 5AI5A 3NRJA 1N8NA 5AKJA 2Q5EA 3CNHA 5AI8A 1Z4NA 1ZD5A 5T41A 3I76A 5AVTA 4OHFA 3QNMA 5AIBA 3E8MA 3MPOA 4NAVA 5AI6A 3VAYA 1Z4MA 2RB5A 5ALKA 3PDWA 4QJBA 3NANA 2G0AA 1QYIA 2ZG6A 3FM9A 1U7PA 2BY4A 3RFUA 4Y2YA 4BX2A 3L0CA 2CFTA 3CZ4A 1KYTA 2C9MA 4EX6A 2YJ5A 2R8YA 5AW5A 4YCMA 2HEGA 5AM5A 3W5BA 4UMDA 2I6XA 4UW9A 3L1VA 2JARA 2HHLA 2JAUA 3W5AA 5AIAA 2AH5A 2YN4A 3NUQA 1QQ5A 5AHXA 3QUTA 4HGNA 1ZRNA 5ALWA 3WGUA 1JUDA 2PQ0A 2X4DA 3I1YA 2CN1A 3W5CA 2FPRA 5AW6A 2GHTA 1SWVA 2R8EA 2VKQA 3ZU6A 3WK5A 4CNQA 2ODAA 2W11A 3L5KA 1U2TA 4C4TA 4YH1A 2MSNA 4OD0A 1T5SA 4BX0A 4YIHA 3FGOA 3ZTWA 3A1CA 4EX7A 4KX5A 5ALZA 5ALIA 1TJ4A 3EPRA 3DDHA 1Z4QA 3WK8A 2WF9A 3QGMA 4OFZA 1L7PA 1ZD2P 3AR9A 3KBBA 3PGLA 5AKLA 5AM4A 2P27A 4XPZA 1L7OA 4L6CA 4ZEXA 5AM0A 3P96A 1YDFA 3I28A 5AKXA 5ALRA 3QYPA 1YMQA 2IYEA 2PKEA 3KDPA 5ALNA 3GYGA 1RMQA 2ZXEA 5IS2A 2YJ4A 3DAOA 3BWVA 4PNHA 4HGQA 5A3RA 4UMFA 4Y3UA 1PW5A 5JJBA 1RLMA 3ET5A 3WK4A 3B9RA 3ZI4A 3HLTA 1RRCA 5AVZA 4DW8A 1RC8A 1WVIA 4BX3A 3ZW7A 4YCNA 4Y2SA 2HI0A 5AVYA 3AR4A 5AW2A 1WZCA 2EATA 3NASA 4YIKA 3AR3A 3ZVNA 3L8GA 2DQSA 3AR2A 3R9KA 4RESA 2OA0A 3WK6A 4HAIA 2YMLA 4CF5A 4UMEA 2FEAA 4B6JA 2B30A 3MC1A 4KNWA 3U7FB 1VFPA 2G1AA 3U7HB 2I55A 3ZWDA 5AK4A 3WKCA 4HYTA 3OCUA 2OBBA
chains in the Genus database with same CATH superfamily
4F84A 2LCFA 2Z9DA 3NP9A 4Y9RA 1I7QB 2ABWA 1N77A 3PICA 1R37A 3HRHA 1DRJA 3ZJYA 4DV4B 4MV6A 3RVDA 5ELLA 2UXBB 2W6NA 2ZRQA 3HDYA 4A27A 2H54A 3UXHA 1RXSA 2ZRJA 2O20A 4ZYXA 2WF5A 3GPLA 3ISTA 5AKYA 1FDRA 3PEUA 4GMXA 1JKFA 5DNDA 5I51A 3RSSA 5DT9A 1GWNA 4GH5A 4BU1A 1KMHA 4JK3A 1TGYA 5LKAA 4LOIA 1SCUB 3KU4A 1JSCA 1GCGA 1P45A 2FZ4A 5CK5A 4OVKA 5LA6A 1ZH0A 3EUEA 4E46A 3RVBA 4MEAA 3ZV3A 3PJRA 2AL7A 2DPYA 2I7CA 1Y1SA 4RD3A 1IN8A 1CDOA 1R4AA 1ORDA 3OZEA 3ZHQA 2VNKA 5AESA 1Z7BA 1F5SA 1T36A 4BVAA 3IAAA 5B3KA 5DPMA 1KR5A 1V8FA 6NULA 2WJJA 4KDRA 3SJCA 4YJHA 1O96B 4MP3A 4NDNE 4TXMA 3K72B 3WJ1A 4WY5A 1XWIA 4L5IA 1VYUA 5PGMA 4DN6A 4KR0A 1CD5A 1DOHA 2QHXA 4MVJE 1XJ0A 3GCZA 2PGJA 3IIIA 5KB3A 2XRZA 2OXCA 1K08A 2D59A 4FHCA 1V35A 5EJ9A 5ADWA 3OQJA 4P3YA 1NVTA 3K1JA 5A7GA 3R76A 5E3HA 4O08A 4OQXA 1HYHA 1JSXA 1DO2A 3QVTA 3PKZA 3GVIA 2OORC 3G2LA 1M8GA 3DE3X 1Z28A 1L4NA 1YOVB 4RCYA 4TYQA 3UAVA 2RH8A 1IYZA 4LSGA 2G88A 3G0OA 1SHKA 1NRWA 3HA2A 4O1IA 4X7PA 4JI4B 1KMMA 5AW3A 4O1MA 1JQDA 2R11A 4R01A 2WWIA 6ABPA 1E58A 4LGCA 4Y9UA 3KJIA 4DDUA 1DRWA 2CV1A 1MA0A 3OQVA 4JXKA 4AS3A 4ENTA 1GDDA 2IJGX 2AJBA 3KSUA 5IULC 4CLDA 1L2TA 4MWBA 4NCXA 2XWBF 1IATA 1YWGO 1NYQA 2HU2A 3M1IA 5GIPE 5IBCA 3K70B 1EGQA 1NUTA 3ZHUA 4AJOA 3ZE0B 4GLJA 1YHNA 2JJ8A 3CW9A 5J63A 3DLCA 3V34A 1EFAA 1DQZA 2AN1A 3DHNA 2NP7A 1GG8A 1B8OA 1V5FA 1XXHA 3OOHA 2QRNA 1BE0A 4WCFC 5GGYA 2CNWD 1PG2A 2A7XA 2VUUA 4PQRA 1IK6A 2VAWA 4CCYB 1X74A 4PXAA 2C31A 1NVBA 4MRAA 1GTRA 4MAAA 4QPCA 4PNZA 4EPYA 4KXWA 4UU1A 4L0CA 4P34A 3KWMA 1U0BB 3CPSA 5KYXA 4P53A 1JXMA 5K9ZA 1TFRA 4LW8A 2I6QA 4BO9A 1RKXA 3WWEA 3L8DA 2SKDA 3P5BA 3MRXA 3T38A 4FYIA 3D8HA 3J7TA 3TB4A 3WXBA 5MGBA 5K0SA 3GUHA 4HGZA 4XSVA 2YWBA 4RVGA 4BVHA 2E7ZA 4MUNA 3Q8WA 4CCYA 4NRDA 1UKZA 5BYBA 4KPEC 4U7TB 2QG4A 4RD2A 3L7YA 1JBKA 4YMTA 1VJ5A 3JQFC 3QV1A 4I6EA 4UPEA 3KO8A 1W47A 1TQ4A 1Q74A 2GLXA 4KU4A 4H7HA 2NUTA 4Q9JA 3JYOA 1U02A 1KXZA 1F8XA 4II7A 3TQQA 4F3KA 3PITA 3STXA 2JFPA 2A9RA 3QVGA 7YASA 1K7CA 3UB2A 3KVRA 5HRAA 4F06A 2VQSA 1F8YA 1GL9B 5C1IA 5AM1A 5ITWA 5KTRA 1ZM3A 3GJ0A 2X8AA 1L5FA 4WQMA 2DWQA 3W8RA 5GM2A 2CXOA 1OLSA 4Y0AA 2C03A 1WW2A 2CLHB 5E2IA 5J3JA 5JW6A 3GT4A 1YR8A 3KZCA 4RDXA 2A58A 2QDXA 1RDFA 4NP6A 2XEDA 3H65A 5A2QA 4TRRA 1Y6JA 4ZALA 3ZIAA 2VJNA 5BSFA 2WTMA 2ZJYA 4PIPA 2HD4A 3MTEA 3PIRA 4QLAA 3FOAA 3IMKA 4BO6A 1HC7A 1G0OA 2AMLA 1TCVA 3E9MA 2DR2A 1ABFA 1GUDA 5I9BA 4D57A 1E2LA 3ENNA 1W93A 3NS7A 5LXTA 1VXRA 1D03A 1LBHA 1RXEA 1YUNA 4UARA 1YJQA 4CVNA 4EKEA 1RVDA 4OI0A 4LY9A 4DADA 1T43A 2Y92A 2FN7A 4B6GA 4J1TA 1P8AA 2H06A 1B1CA 3C8MA 1SN7A 2A3RA 1MG0A 4UM7A 3VR6A 5A0VA 3VX3A 1ST2A 1LU9A 4EZIA 3U7QA 1B73A 1BA3A 1Y7TA 3K7EA 1NRXA 1I4EB 4WZBB 1OBOA 1LC0A 1GU0A 2D1FA 3LZCA 3Q9UA 4H7JA 4PX9A 4PXSA 5JT1A 3PCRB 1H2YA 3I2IA 5L9AA 4R0MA 1L4FA 1E3QA 3QMPA 3NCTA 2YZ7A 3LRPA 1S5PA 1RRVA 1UBSB 3PUHA 5C5DA 4YQYA 1T3ZA 1OUMA 2DPHA 3UB3A 1TW3A 1IEXA 1OZ0A 3QV2A 1KWKA 3ABIA 3OZWA 4EG1A 1E59A 1NW8A 2VCEA 3BQMB 3ITEA 1RHUA 4L7VA 2RKOA 1JR6A 2G77B 1H66A 2HUPA 3AETA 3CLRC 1CB0A 1X9HA 1MPXA 2B94A 2J0EA 3N87A 4B3HA 3B7WA 2V54A 3IT0A 3N07A 3DWGA 4XH9B 4IDGA 2P2LA 1OGYA 3D1JA 1TZCA 4ZOLB 4OX9B 1QVAA 2G80A 4OKSA 2VOJA 4UKDA 1B2RA 4EW3A 1RI3A 3D3WA 4GSLA 4QELA 4ML3A 4M83A 1NIJA 4X92A 3WYGA 2V59A 1JFTA 5AW1A 1IZZA 1AM4D 1IAQA 2DGDA 3LL7A 1E3WA 3ID6C 4K9LA 2FRVA 1Z5UA 4QOSA 1KJ8A 1CTQA 2QP9X 2WSIA 1ODFA 1UPCA 3LO5A 1GTSA 2OFWA 3DNMA 4BLWA 4F1JA 2VF8A 1GRNA 2VZ8A 4HEJA 1YD7A 2F1KA 4C2TA 1KJIA 1VCMA 5AICA 3QXSA 4HAVA 4QXPA 5FPHA 2FWJA 2F1HA 2PTGA 3FDZB 3D4LA 3K0KA 4A1OA 2JA2A 4UU7A 1YNSA 4OK5A 2QX8A 3EVNA 4NFLA 5B4VA 4C0QC 1NLFA 2R62A 1FP1D 3T3GA 1KI9A 3QXGA 3RI3A 3HR4A 5DYWA 1RHQA 4NAUA 1RADA 4W8HA 1SEVA 4WI1A 3TVYA 3A4NA 4AP9A 4C0KA 1UDBA 2PL1A 3CLUD 3GMIA 4GIBA 5C34B 3OJLA 4GNKA 3FVRA 4F6CA 4MW0A 4NX2A 4IHJF 1XMXA 5BUQA 1I1HA 4KI0A 2EQ5A 1YB2A 3R5FA 1RIFA 1REQB 5JD6A 3HI6A 5ITZB 3PWKA 3PXGA 5KNBA 1UZAA 4QUDA 3F7NA 2I54A 2JGEA 1DX4A 1H8HA 1OIVA 2QYSA 3BXHA 3OD1A 5LJLA 1HLFA 2R4QA 1JXQA 3S8YA 1MUUA 1YS6A 1YVRA 3QG5A 2G4VA 4QBHA 1XLVA 4ZHSA 4LRTB 2EKLA 3L4BC 1W4BA 3GA7A 1TT7A 3I9OA 4FLMA 5FA5A 5IC5A 2X40A 3SX0A 1XRRA 2EL9A 1OB5A 3WK9A 1W4AA 4B35A 3CXUA 4NICA 2FSPA 5EXTA 4BLTA 4UOZA 2ZKIA 2C0QA 1S0UA 2JH9A 4N49A 1V6AA 4G0ZA 3SXPA 4QDZA 1MEOA 1D5CA 1UEIA 2AJ8A 5CT9A 1E9DA 1T24A 3GEIA 3NYRA 4NHEA 4TWIA 1M2FA 3I09A 2WZCA 1JG1A 3B6IA 4FOOA 4PYIA 5CDFE 2J8ZA 5EL0A 2XZPA 1T2FA 4Z4HA 1MOZA 4MR9B 3PQ2A 4R05A 4ZEWA 2BR4A 4GP7A 3E7XA 4HN9A 3UTDA 5JMWA 4FE4A 1YBVA 3ZVLA 3OX4A 1IZ7A 4X62B 3O7MA 4YWJA 1AHIA 1NVEA 4DMGA 4Q4CA 1EH5A 3HWSA 2PXAA 1DS6A 1LPBB 1VLQA 3A4TA 3DDCA 2W42A 2SBTA 2QX4A 4MQ6A 2H1OA 2M1ZA 2VAXA 3CY6A 4EATA 3CUWA 1U28A 2QYHA 2M6LA 3NEAA 1WQ3A 1UKBA 3JRWA 1YZQA 4Y9SA 3RB8A 1P9OA 1V1JA 2ZTHA 1R9MA 2QRVA 4J07A 4M37A 4BIMA 2LWIA 4CM7A 1TYAE 1Z8DA 4PZEA 3CLSC 3HJBA 1IK4A 1EVZA 1TVMA 3GCGA 4BMNA 4NJEA 1DXHA 2CYAA 1J0CA 2QTCA 1R6TA 3VH1A 5L8VA 2VJPA 2J4CA 4HSEA 3L7IA 3HSKA 4D0LB 4E32A 2HT1A 3NG1A 1H0HA 4OI1A 3Q7PA 3GF4A 4AU1A 1WSAA 2P2CA 2ZKLA 2H31A 2CWWA 2ZOSA 3E81A 2ZT7A 4MDEA 1VKNA 4KFCA 1XQWA 1E7YA 3ZXYA 1RCTE 1RYYA 3S44A 3W2TA 1JSLA 4GO1A 1ISJA 2FXVA 1E6WA 5HM8A 4BNYA 4UATA 1ECFA 2ZSDA 4TKUB 2C54A 2P3SA 3ZQJA 5BR7A 3HYTA 4WV3A 3ZQ6A 3GLGB 3ESZA 3D2AA 4Z0NA 1R9JA 1DRKA 2QM7A 3CUUA 4TROA 4Q39A 1Z8FA 5DP1A 5FUXA 5JCJA 5F23A 3EGIA 3NBYC 4M0PA 2A0WA 3E7WA 1ODKA 3CONA 4ZRNA 1G66A 3LT0A 3I52A 5LPNA 3IPCA 4RV4A 4K87A 1VHLA 1W5TA 4Z8YA 2AJDA 1RJEA 2IHKA 3KB6A 4GRDA 4RIEA 2OZLA 5CCDA 2PCJA 4KR6A 4FQ5A 3N7TA 2AG5A 4YRDA 2QTWB 1WDTA 2B3DA 4ARAA 3GLIE 1D4ZA 1PBNA 4R3WA 1XQ9A 4M0CA 1VA4A 3BL8A 1W5BA 4M8IA 5FFNA 1QJCA 3QKWA 3D1LA 4ZQEA 1U5AA 3X43A 3HNOA 3WNCA 1YZNA 4QWMA 1OX6A 1OWNA 3TRIA 3LKDA 2EKQA 3C41J 3PFGA 4MEBA 3UQYS 1CU1A 3ONVA 1GUBA 3S2FA 1MB0A 3B3FA 1QKIA 2XXJA 2J7KA 2Q62A 1SOAA 3K05A 4PAQA 1OH8A 4L15A 1EFVB 1RW4A 2JAUA 3D31A 3LIPA 2X8BA 4C0SA 2Q2NA 4LYYA 1JR2A 2Y71A 3G5TA 4N0PA 2ETVA 4U2KA 3VM6A 2OSVA 4WK6A 5C32A 1QIHA 1DKLA 3R3ZA 4ZOAA 1OA1A 2VTKA 4IVQA 1C0PA 1USVA 1S4MA 1ZBQA 3H75A 5AJWA 3U49A 3MYYA 1K8RA 4EA7A 3DR5A 2FFRA 2X2EA 2H57A 2VYQA 3ZHZA 1PEKE 3D8UA 4FWIB 3UENA 4OSEA 4TM7A 4B7UA 3BIXA 3ZD6A 3OE7A 1SBTA 4DIMA 1SCNE 1UXHA 1WAMA 3GT7A 5DB4A 2YV2A 4OATA 3WWCA 2FPRA 2QN3A 4J6EA 3WQBA 1KBZA 5CH3A 2PHZA 4D4LA 4J75A 2BMWA 3OETA 1UPFA 3KKOA 1ZN2A 2VHTA 7GPBA 2DY0A 1FLNA 3QJGA 2AX3A 2R1VB 3O26A 4AF7A 5F2EA 1L8AA 3A0UA 4OSOA 5TQ0A 4UQLA 1DRUA 1EVYA 2LP4Y 1UBRS 2ZWAA 3P2YA 3K9WA 3JQCA 4POAA 1GGVA 3H5RA 4LXIA 1MNQA 3GLRA 4ZYLA 4KV9A 4WCFA 1ZVQA 3OTGA 3TIFA 5E2BA 4DAEA 3RC7A 4BYMA 3L6DA 4H3VA 2OHGA 2IXAA 5JRJA 3ZH2A 2YZMA 5CA1B 2A4KA 5EZYF 3QPVA 4D80A 5H3LA 4TZ0A 1A97A 5AMXA 1YS1X 5ALIA 1ZI9A 1TJ4A 2JBHA 2AN9A 1JB1A 1KGSA 1CUAA 1P3Y1 4BP9A 1XAIA 3HFJA 3QVXA 1DJMA 3NU1A 4NPHA 5FTMA 2GZAA 2NTEA 4H7KA 3PUVA 4RZIA 2C7VA 4XIGS 2GM4A 1AMOA 3Q6NA 3RROA 4A7PA 2XUPA 1L7OA 1WZEA 2BEJA 2ZI9A 3DBOB 3FBTA 3FRHA 4UAGA 3ZDXB 1CY6A 2OAQ1 1AGRA 3IPLA 4Q9KA 2OTCA 4E31A 2IU3A 1C8KA 1KAOA 4BE9A 1TL7C 1CUEA 5JSFA 2W2KA 1FNDA 2ERCA 1SVSA 3H5TA 4FBLA 4GMDA 4B82A 4F9GA 5HYVA 4EHBA 5DCWA 4O4IA 4ER6A 2VPTA 4ILKA 4MVYA 2RH5A 2ZSAA 4RTNA 5IAOA 2R5WA 1JSRA 1NBWB 4XRGA 2G8NA 4X63A 5HJEA 5L6LB 1L5ZA 5F7XA 4G07A 2ZETA 4AUNA 1Q21A 1BHJA 4K6KA 2Y1OA 4GC9A 1RRCA 2G36A 1NRIA 1JFFB 3KTFA 1ISHA 1HFJA 3O3CA 5LP6A 4I08A 8OHMA 3GLHA 2HBZA 2RHJA 4BFSA 4MR8B 4WUVA 1WPXA 3GVHA 1P1CA 3E1GA 4QYWA 5HJ7A 1UFVA 1CB7A 4DB2A 2DWUA 2D1SA 1LDGA 3C1TA 1A9XA 3WB9A 1MC1A 4RXMA 2Q3DA 4UDNA 1CT9A 2ZIGA 1L4YA 1ATIA 3IESA 3ER9A 1BE8A 1G5HA 3OLZA 1GCIA 2CD9A 2FEAA 1TD1A 5B3LA 3MCWA 5GONB 4PLYA 3D4BA 4TRJA 2CNKA 3VMFA 5FNVA 3GLHB 4DYVA 4QAQA 1CUSA 2C5GA 3I2HA 3LUKA 4ME6A 4P8RA 3R9XB 1Q0ZA 1WB5A 4JSYA 3RYCB 3H9UA 3DOUA 4R9RA 3HWX1 4ARIA 3NDPA 3BWBA 4DLXA 2JGDA 3V2HA 1KQPA 1E96A 2X5OA 4Q1CA 3DZGA 5I9LA 3F74A 1KRHA 4IQFA 4P7GA 5FLEX 3LU1A 4CMAA 4E08A 4HTFA 4WKBA 2CF5A 1H0SA 1NNUA 1SG0A 4KRGA 3EDOA 5EIWA 1YGYA 2VBIA 3LUPA 3L0PA 1SXIA 1A04A 4GPBA 4LRUA 1RCFA 1KJ9A 4PWYA 2NO1A 4AUMA 4BCBA 3PNMA 4FGKA 4EPVA 5KWVA 4Q7EA 3GGCA 4LF7B 1V3TA 1ADFA 5HCIA 2BGUA 3ZZMA 3BK7A 4Q7QA 4FLEA 3U4GA 1ZH6A 1GQYA 1R0LA 2JFHA 2O3TA 3CLTD 4EO4A 4TTAA 2RD2A 5JY1A 1YFLA 4YJ2A 2OZEA 3TD2A 5FL7A 1ZEJA 4G1EB 1JKJA 1V3UA 1V1MB 2JFNA 5B37A 4JI6B 4LYHA 3LP8A 5IN4A 2H4YA 3CZ9A 3AKCA 3H11A 4OK3A 1Q2XA 4PZLA 2Q3EA 1G18A 3ICWA 4MIYA 1R8YA 2XNDD 1IZ8A 3GFRA 2PKQO 3WHIA 1NQWA 2W6QA 4JJ7A 2XRFA 2H65A 2R4TA 3AHCA 3U6KA 4D3SA 4RENA 5HJ5A 1ECLA 1WZNA 3A4IA 4RH3A 1SURA 5C35A 5DTQA 4N41A 4HEA1 4IJ5A 2AQ8A 1OVMA 1II8B 2IUTA 2Q45A 1KRWA 3SMVA 4TRNA 2XYQA 2GPNA 4TS4A 1KEUA 4WNYA 4AZ0B 5BP7A 2CJPA 1OBFO 2ODPA 4MGZR 2CL6X 4J8PA 3MD0A 1AO3A 1OT5A 2ZBVA 1YCDA 5CA0B 1MDBA 1ULZA 3RFCA 5JXGA 3NX4A 1KQOA 1NRJB 3G3EA 5A03A 1XDZA 3N0VA 3FYUC 5IYZA 4OFBA 2O2SA 4OQFA 4X7RA 2ZYSA 1R15A 4EJMA 1CNMA 3M3PA 4B44A 3KZNA 1NF3A 3EY4A 4LDNA 1FQKA 5PNTA 3ETGA 3FPEA 3OM8A 5K4HA 1JV2B 2RGXA 1A72A 2GVNA 2WT8A 1IVYA 1JR3A 1YNOA 3OCVA 3OPYI 5G0SA 4W5NA 1IN6A 4DR2B 1WCV1 1XTQA 3BWDD 3X44A 4H31A 2Q3MA 4HJRA 3OICA 1Y1PA 2HF7A 4FW9A 1GZ6A 4Y2QA 1KK2A 3OZRA 3PC8C 1Z33A 1ZGJA 4HAXA 3TGPA 1KZGB 4K6HA 5CXQA 1X92A 4WZAE 3S2EA 1GCUA 3COSA 3PYXA 2F3UA 4HQLA 2VPWA 5AI0A 2BFAA 4DDKA 4JLJA 2NTJA 5AOBA 4QX6A 3V7UA 4ZVSA 4M7RA 5JS6A 3IA7A 2PLFA 1KEEA 2JJ1D 3WOHA 2QM8A 1EWVA 2ZCUA 1SCIA 4OMCA 2G25A 4TMWA 1W49A 3AHFA 3RFVA 4F8JA 5EJMA 4DXDA 4YBZA 3W3AD 3EMBA 1XVLA 4PLHA 2XKKA 3VSAA 2PRKA 1TM4E 1FFEA 1WA5A 2CCJA 3D3EA 1TAQA 4NV1A 1ZSNA 5CVJA 1GSOA 3C8DA 1I5EA 1CUDA 3LPNA 3N70A 2BMAA 2AX4A 5KTYA 1QWOA 3BE8A 1LKZA 1P5HA 4IIJB 1JDTA 4BVEA 3NTOA 1H3EA 2PPLA 4IDNA 2YY6A 1ENPA 3HU1A 2NM0A 1KOGA 2EWMA 1V1RA 3TQSA 2XGJA 2C3MA 2P9YA 2DQKA 1KO1A 4EO7A 1P4SA 3NP7A 3P20A 4UTPA 3LCVB 4BB0A 4YHHB 2IYRA 3I5UA 5LBIA 3FROA 4FYPA 6ADHA 4K3VA 1M2EA 3GOQA 1A27A 4L3OA 5FA6A 4JUBA 3CCBA 1AOXA 1ZW6A 3U13A 4CUJA 1LF0A 1QB8A 1T9HA 2FH5B 3PDCA 3ZIUA 3OZCA 4CQLB 3W2GA 4BKMA 1J1UA 3Q0EA 4AUEA 2P2NA 3ONEA 1DBQA 2JAWA 3OQOA 5JDIA 1CY7A 1JDUA 1SZCA 4IQ4A 1E2DA 2F8TA 1KZ1A 4TKZA 2GR9A 4L73A 3V4ZA 4PZDA 1OH5A 4Z4FA 1GZ5A 2FG7C 3O9ZA 2YOGA 3HJUA 4MI6A 5LP6C 2IA5A 2XTMA 3GGGA 3ONDA 5C8YA 4YAKA 5KYYB 1X9GA 1JXAA 2XNJA 3PZRA 4EOGA 4Q4LA 3EMVA 4Q6WA 3SYNA 5KWIA 2CFSA 1SXQA 1X3SA 4EBFA 4BX9A 2CE2X 2J3IA 4G41A 1ITZA 3U39A 1HYBA 4DLAA 4DUPA 1KQGA 1H8EA 1EVIA 5JH7A 1EDOA 1JEQA 1FPQA 1F38A 1G5FA 1GKLA 3LA8A 2DVMA 3QKSA 2X9LA 4AF6A 1QCZA 3BD9A 3I6MA 3FSJX 4J16A 4Y0VA 1PZMA 3SLKA 5BSTA 4EIWA 4F45A 4O2BA 4BNJA 5JZSA 3VPDA 2QBYB 1U1EA 4KR7A 3UHPA 3LDGA 1BMFA 2BUCA 4IIFA 4R1NA 2WKPA 3PQ4A 2VDNB 4MEJA 4UQOA 5EKUA 3EWNA 3T9BA 1B74A 4R2LA 1WEKA 1FBTA 5FX2A 3IB6A 3Q88A 4DR1B 2CMDA 4AECA 2QL7A 4H4CA 1HLPA 4FPXA 3S5UA 2CWDA 3TGLA 4INJA 4WERA 4D8UA 2J33A 1L5YA 1NQOA 2HJRA 3LFTA 1F6WA 1BKYA 5GQSA 2R2GA 4YUAA 3O3MB 3V4SA 2EZ4A 2BGGA 1BXRB 4Q3EA 4B79A 4BNVA 2ZATA 5CB6A 3PHCA 2NGRA 3M9WA 4LTDA 2ERXA 1WKCA 1K86A 1XMVA 1XTVA 3L49A 1A8HA 3F8WA 4G97A 2C92A 4NBVA 5HQTA 4TVKA 2JIMA 1F12A 4AVYA 4DTCA 3PXAA 1BNCA 5HOQA 4TTIA 3CGWA 3TQFA 2O4UX 2OB1A 4F1WA 4P7FA 2H4HA 4PU0A 3ZW8A 1GGFA 1QMGA 1VZ3A 3KYDB 4LHWA 4OLJA 2DBZA 4R8KA 4RD6A 2FMTA 2HF8A 1JDBB 1SZJG 2Y1LA 4H6XA 3AUAA 1U8TA 1YUMA 4H27A 3MAGA 4QGGA 1U3GA 3IP6A 1FMJA 4UNPA 1U8ZA 2XUAA 1E6UA 2DKFA 2NPOA 3F71A 2FHPA 2EKDA 4YAFA 1IDN1 1KH3A 1N5LA 2YHUA 4S2UA 3EFHA 5B64A 3Q8KA 1MV8A 1YQTA 4I55F 4Z54A 2QLMA 1D9ZA 2V8BA 2YJGA 1JWBB 1PL0A 3GNLA 2YXEA 1DDGA 3QA9A 4R8LA 4TGLA 4YNBA 5ALJA 4MTCA 3QE9Y 1TQ6A 4E2YA 5IM5A 3QVWA 3J80A 2PS1A 3OT1B 3DAYA 5ALOA 4LXTA 1Y6ZA 1KZ9A 2Q50A 3EQ2A 2C96A 3EUFA 4BTLA 4EPTA 1FJXA 4QRDA 5C4GB 2GCEA 3R9WA 3D7LA 2RHHA 2V1UA 3LHKA 1PEYA 2IHNA 3IMGA 4Z1MA 3AKDA 4DA6A 3JARB 4PFSA 1YMUA 3GNQA 3L1IA 5FAXA 1LLDA 3I9V6 1N4AA 4M87A 2JLYA 5ETJA 3AEKB 5EC8A 3MEQA 4MHTA 5DBFA 3N8KA 1XT6A 3AILA 3MGKA 4GZ6A 2C7BA 1FLVA 1TLLA 4Q9LA 2ZB3A 1GR1A 4MOWA 4HT3B 2BFBB 3AEUB 3LC2O 2Q5IA 4ER7A 1WMDA 5EVJA 1GARA 2C7GA 3R7LA 1Q2UA 3EASA 3TEFA 4DBVO 1RBYA 3IXLA 4HLUC 4EI2A 3PVCA 5CDTA 3ZDDA 1MRZA 1CEXA 4D98A 1PP4A 4U7GA 3ZV6A 3VKVA 3DBIA 3NGXA 1PE0A 1WLSA 1WR8A 3VC7A 3PF9A 3P9SA 1GOTA 4YPVA 4LOHA 2OEPA 4W1RA 1N8KA 5CB4B 1S3SA 3LKZA 2JBAA 4IDPA 4QQFA 4ZVVA 3MF4A 3MJ4A 5TR9A 1S9DA 3M2TA 1QQTA 1R6XA 1HQKA 1CVIA 1WUJS 4HB0A 4R1LA 3RVRA 4CL0A 4N1AA 3EOBI 4BBAA 3T9AA 5IF9A 3IRUA 4W7HA 1M10A 2EIHA 2FPGA 1YE8A 2POQX 4N01A 3FHLA 4F5DA 2FW6A 4YYZA 1SXJE 1Z38A 4CT5A 2IH2A 5CHYA 2ROQA 2VN8A 4ENPA 4QU9A 1JQAA 2PG3A 5DBGA 5LLSA 3TNLA 1MLDA 4Z0PA 2QN2A 2VDWB 1H4SA 2XOXA 1T8RA 3HMKA 2JLAA 1J1IA 2R6AA 3U7IA 4PC1A 4LGYA 1FDIA 3OI7A 1VL0A 3OEWA 1HPLA 1QH8B 2OKGA 1E1QD 2I2FA 2LCIA 4MPRA 2MOKA 4HFMA 3DDWA 5EVCA 3VHRA 3BJRA 3JTMA 1Q50A 5GADl 1HI9A 6GPBA 2Q07A 1N8TA 5JANA 2Q1YA 3G5AA 5DP2A 4BFVA 3TUJC 4P3KA 2WHXA 3JQ8B 2B4YA 2ORWA 4Y7DA 3V46A 3LXUX 4LKOA 4TTSA 3N0XA 3EA0A 4C3OB 2R6JA 4UPDA 5IKEA 4W1PA 1E3MA 1PVDA 1LQ2A 4DSZA 2V0NA 1THTA 4MIOA 3AY0A 3CJQA 3T99A 5F77A 4MKFA 3T0GA 1JZSA 4HS9A 3LSYA 3E7FA 2G1UA 2QRGA 5EPEA 5CDFA 2XUGA 1F4VA 4A5OA 2Q7XA 1HY3A 4K40A 2AMJA 2DUUA 1Y42X 2HA7A 2PH3A 1NDUA 2ZRDA 4LJ6A 2IF2A 1HEIA 2VSYA 1K7EB 3QE0A 4QEDA 4B8WA 5B1EA 3O73A 1RM3A 3OE7D 3TKAA 4GI1A 2B1IA 4OKNA 5LOVF 3KFLA 1FP6A 1NSYA 2WUGA 3GJXC 4C14A 1MB2A 4UTOA 1BE6A 3B12A 3C1UA 3ZBUA 1HKHA 1LV7A 4GI5A 4LZJA 4XFKA 4BFXA 3V6LA 3E61A 1M2VB 5DBOA 5F7JA 3LTEA 4Z0HO 2SKEA 5E3IA 1DE0A 2QTVA 3Q10A 5U4XA 4CM8A 4E2XA 1P2SA 2AI1A 2UKDA 3R5TA 1P9WA 1GTG1 1T0UA 1MJFA 1ZCFA 4GOKA 1V43A 4F6RA 4WBNB 4XB6B 3PXXA 3R5SA 4OP2A 1DIRA 1Z82A 4TQAA 2GBCA 1VIDA 4IV8A 4CTOA 1OYYA 2I67A 2JZNA 3LHSA 2BKUA 4RVNA 4Y6RA 3M5PA 4XVCA 2Z83A 3IP1A 4EI9A 3W5AA 2EWVA 3MW8A 5KJEA 4FMCF 2YN4A 1XMQB 1U9IC 1V39A 3IMFA 2C5SA 4DIBA 1LVGA 1JHMA 1PT8A 4P0QB 2Q6IA 5MN6A 2QN7A 1OXVA 5FBWB 3OWOA 1PVOA 1GT6A 2QLBA 1HLGA 2ZYAA 3ESDA 3L7JA 3KX2A 3DOCA 2VEOA 4N3NA 3F3KA 3KSBC 3JQEA 4CU5A 3D4OA 4WINA 2A0KA 2ZIXB 4CPDA 2FWRA 2GHTA 2HWKA 3AUUA 4XWTA 4CG3A 1N2CA 3PZBA 4OL9A 2DLNA 4UFNA 3WB1A 1UK8A 2IUFA 5JCJD 1XJCA 1N32B 1B15A 1VL1A 1PFGA 3RLIA 1G7CA 5C51B 2NZJA 3EQ9A 4EHDA 5A5VA 2G70A 1LX7A 3KZOA 2O23A 4X6LA 3NDIA 5LMNB 2QX9A 3VPXA 3RFTA 1E6KA 4JYMA 2F43A 5KU7A 5BT9A 2WJYA 4L02A 2JH3A 2IXGA 3IHKA 4G1BA 2NZ8A 4KX5A 3WA7A 1QQBA 4I4TB 2QMEA 3KJFA 3VZDA 3GMDA 3GGPA 1CRQA 3JWJA 4Q7KA 3DDHA 2I1WA 2PLAA 4YQZA 2B4RO 4FS3A 4ZOLF 4JOCA 4LJ8A 1NL3A 1W85A 2NUPB 4KLCA 3UANA 5HTOA 3V2IA 3CX6A 1K88A 3VOAA 4I6GA 2ZRCA 2FFJA 3GYBA 1ZIOA 3S81A 5BYKA 1OU0A 2PY6A 1GA1A 5FNVF 3ANNA 4KO3S 1PV1A 1W4ZA 4OL0A 1EM8A 3GYGA 3FAKA 4FZVA 2QG9A 5EIFA 4DRXB 3B9PA 2J4FA 3GL9A 3O82A 4P0TA 3BWVA 4EJ6A 1OYOA 1Y98A 4GMKA 4WBSA 3VU9B 1QGYA 3U7JA 3ROFA 2D5LA 5EJ4A 4X6XA 1PJRA 4DBLE 3CPEA 4RFVA 1YB7A 2FSIA 2ZSUA 3ZW7A 3HKBB 1BKSB 2XD4A 2ZUFA 1N6OA 1QZUA 2IYQA 3O5AA 3A4VA 4JBGA 3M4NA 3P27A 3FG9A 3I01M 4WKOA 3E5MA 1CYDA 2CMKA 2ZP1A 3AQIA 3L40A 4LJ9A 3RABA 1GFIA 3RYIB 3HB9A 3HO1A 4EFDA 1E77A 3EZYA 1PGQA 4LF4B 3QNWA 3A4YA 3P2OA 2BEWA 5IJAA 4N0EA 4L2IA 4DJFC 1G3QA 3HCAA 3C2QA 5BQFA 4ZOEA 3PNKA 5LU8A 1XDDA 1EP1B 1NURA 4B6JA 3J7AC 3KB2A 4IQ0A 2X8LA 5HVNA 3C7DB 5F1PA 4ZMSA 5KS2A 4RH1A 3GP5A 1UBTS 1J8MF 1Y4DE 4HFNA 3VTZA 4BFTA 1SVMA 1T5BA 1RJGA 3Q6MA 4FB4A 3MLAA 1VSBA 1H6CA 4Z7NB 1QS0B 4R69A 5CVVA 2RK3A 3IAS1 1I30A 3HCFA 3H2GA 4LNHA 3FPSA 4N7BA 5AJUA 4KOEC 5I8PA 3HVRA 3ES9A 2HK7A 2WB2A 3NBMA 4Q3NA 3BH6A 3GV0A 3RWMB 1NYRA 4BPRA 2QZJA 1JBQA 1RFLA 1UDCA 3I32A 4PRZA 3INNA 3STVA 2EF1A 3PNPA 2X86A 3T94A 4Q18A 5BVGA 5KOJB 2DETA 2R7LA 3B52X 1TJ5A 4JD5A 1LVHA 1P1RA 2VDQB 2WAXA 4RF3A 3UWKA 4ZI7A 4QVKA 1UC8A 4AY2A 2BMFA 3DXXA 4OI2A 3GXBA 5GVSA 1L5QA 2YZGA 4KUHA 5ALHA 1ZVVA 4INPA 3A05A 3NORA 2RE8A 2VF7A 1ZGAA 3JQAA 4TXHA 1T1SA 3LCUA 3A1WA 3GNSA 3WBBA 2PO7A 4WESB 5CVEA 4FR5A 3JPYA 2FG6C 2HPAA 3TPZA 4B33A 3AL3A 3EYWA 1PRYA 2C8VA 2H1HA 4QUBA 3MG9A 2FTKE 4Y9DA 4X7BA 3SIPA 4ARUA 1DDOA 4G5GA 1YR6A 1RP1A 1W0KD 1Z6PA 3IBGA 3MS7A 5HA5A 2BELA 1J97A 4B47A 1W2GA 2AYYA 3S0JA 4FFMA 2JK1A 3VQTA 3G9UA 2PJUA 3FGNA 4PFQA 3R6LA 1WF6A 1GU7A 3CM0A 1BN7A 2OHOA 2C3YA 2X9GA 1QONA 3I04M 4BY9E 3DBRA 3Q8XB 4KMSA 1FSZA 2AEMA 4DV0B 3KAKA 5DHPA 2YJTD 1HNXB 3EZFA 2XTZA 4BVGA 3BKWA 4E5SA 2NSHA 4KQCA 1CUBA 3LUDA 3UWOA 1BC5A 4EP1A 3ZDBA 2PZAA 3LPDA 3SLGA 1ONBA 2H1RA 2I29A 3BD7A 3LCCA 4LHXA 2YR0A 4G1VA 4KJXA 4TZKA 1N6HA 5CCBA 3RE1A 5ITSA 4CQMB 5BN5B 3TFOA 2WVHA 4JUIA 5JSUA 1CVRA 1LWOA 4P4TA 3V1YA 5LZ5A 5EIHA 2D54A 3CSUA 1E0SA 4QFDA 1FX0B 3QW4B 2GH1A 4GRIA 1Q15A 2QIOA 3JYHA 4IDOA 4Q4AA 4WKCA 4AG5A 3OUUA 4BZZA 5B6IA 2ZWIA 2I7TA 4GU5A 1E79D 2YXPX 4E03A 1QRUA 2YJ3A 3GFFA 4WXHA 1R7RA 3KETA 4UXHA 4P33A 1L8OA 5K8UA 1NMYA 4RPJA 1MPTA 2O4CA 4WZBE 5HDQA 1WETA 1M76A 2ZAMA 1JXOA 2ZYDA 3KEFA 4MAMA 3OX3A 4ISCA 3DMDA 3ZG6A 1IN4A 4BO8A 4FIDA 4IRUB 4HQ6A 2YIMA 1JHQA 3LQRA 1S9HA 3IXQA 3ED5A 3RVQA 3V7WA 1L7NA 4W1SA 5TT0A 3ZGNA 5FUVA 4LF6B 2P4HX 3K9LA 3HBJA 4P7KA 4B34A 3B9QA 4V02A 5AW0A 5IFKA 1V6SA 2EBUA 2AIRA 2WLSA 1Z2EA 2FDRA 3BREA 4G5XA 5EJIA 5GZ6A 4QTYA 5IAAA 5C7LO 2FPLA 1PZEA 1W88B 3CRMA 4JZKA 3RUPA 2ZJZA 4ZHQA 3C1AA 3DTNA 3KKNA 1KMHB 3TR6A 1VPDA 1VYVA 1OJ7A 4TV8B 5BNFA 3T0FA 1PR0A 3RSFA 3SN6A 3UQZA 1ZUWA 3UA4A 3MWEB 4QEZA 2EV9A 4L8VA 1QF7A 2FK8A 3VO9A 2QJTA 3EVFA 3ADKA 2PAFA 1PJAA 3OLQA 1MENA 1XD2B 3U4HA 1YMVA 2Z8YM 2J3HA 4PZAA 4D96A 1Q6YA 4DG9A 1MVLA 4PR0A 5DCUA 1VGVA 3K8YA 3BN3A 4U4AA 1M6HA 2DTXA 3B48A 4G5OA 3VNBA 1KOLA 5BSKA 1QE5A 3B36A 2D2FA 2H7XA 2O5CA 2NXJA 2OBFA 1J00A 4H0CA 4KO8A 1TEVA 1FFHA 3AB7A 1E2BA 3K5IA 1EB8A 4XCXA 4CDGA 4EBBA 1P7WA 3NXKA 3ZV4A 1DJOA 3FPHA 2QUIA 4KR2A 1I4DD 4HZUB 1JYSA 4RA9A 4CDRA 3C6XA 1NTRA 1IUKA 4Z2YA 2BEUB 4K9OA 3V4PB 1DEAA 4JBIA 4EY3A 1RLUA 2VHEA 3NHLA 4JDPA 5KDLA 4OF4A 2CC2A 3WK7A 4D9NA 3IL2A 3RG2A 1UAAA 3M82A 3SIXA 2YTZA 4D5EA 4KP7A 5C9ZA 1VG1A 1LSUA 4GPTA 3ZBPA 721PA 3ROXA 5TSDA 5FUMA 1X7DA 3HKBA 4TV8F 4F6RB 2XQIA 4TKVB 5EJ2A 1SKQA 1G8PA 1TYBE 3LGXA 3UJ6A 5IM4F 1S1CA 3EK2A 3IFSA 4UHCA 4D46A 4HB2A 2ID4A 4RHXA 2HMYB 1SG6A 2H2GA 1W4LA 5F7OA 1MP0A 1DJNA 3EGDA 5JHGB 3HSSA 3MTAA 4CV1A 4W5QA 3GUZA 4MR9A 3ZGVA 4D44A 4EJSA 1A96A 2ZBUA 2H5LA 2QL9A 1VJDA 3RFFA 3IP3A 1XCGB 2GYWA 4HGPA 1W59A 2E3JA 4AMZA 1FFYA 3E2MA 3NO4A 3L41A 3Q87B 3U7QB 3ZPXA 4QZVA 3NJ8A 4K9NA 2JI9A 1KGDA 4OQLA 2XOKA 2ZYWX 3UGTA 5D7BA 4C7OA 3ECSA 2W2VA 2LGJA 3VR3A 2YUIA 3HLYA 2B5OA 9ATCA 3D6TB 4CHGA 4GUDA 4I50F 5HBGA 3G0GA 4CCSA 4G1CA 3RNOA 5TARA 1IN5A 2JEYA 4ZWNA 1ACMA 3CZRA 5IKXA 3DBVO 3N5KA 1P3JA 1PAUA 3I3SR 2ZTSA 5B2EA 3THOA 1IHUA 3CUYA 3GP3A 1XZFA 4EZEA 1N5KA 4QHSA 3OE1A 4CKZA 4FWBA 5H4GA 5L3SB 4EGFA 3WSVA 2DAPA 4BQSA 3L8EA 3PE6A 4XVRA 2GK7A 2Y05A 2C97A 4EW1A 2Y9PB 1E5VA 3DVSX 2O7NA 3PXDA 4S1TA 3TQIA 4YR7A 1F0PA 1X15A 3OY2A 1SBYA 3ER8A 2MYNA 1U6IA 1O4VA 4NBTA 2IUEA 3N2KA 1W85B 1E9FA 2F3SA 4YLYA 1S2IA 4EEXA 2WDPA 4EFNA 1ZD3A 2C1EA 2ZE7A 4RQAA 2VRCA 4HYTA 3D4NA 2B34A 2AZDA 4GG1A 3I6BA 5DMXA 4U7FA 1RMTA 1HL3A 2REXB 3ZXIA 4CM4B 3MJDA 1YAJA 4TS3A 4UZFA 4YI5A 1WMBA 2E89A 5EJGA 1OQAA 1QIJA 4P2GA 2G5GX 4EYOA 4YT4A 6CHYA 5F98A 3OC6A 4KNYA 4F96A 1YR2A 2VK4A 4EFKA 2JD0A 3KEGA 1EFCA 3N2GA 5JZ9A 3K6JA 3R3JA 1G8HA 1WCWA 2UZ1A 3KXIA 4H18A 1NNEA 1F5NA 5JSYA 3UOWA 2O8EA 1LC3A 4C22A 4MRVA 1KORA 3BB3A 3FYSA 3DBHB 1DCFA 1HEYA 4DLWA 1RWKA 1K98A 1L3BA 1X1RA 4D8TA 2WIJA 3PDUA 2PGIA 1E1MA 1F3LA 3G82C 3CCCA 4NTZA 4GDFA 1AA6A 2FX5A 3UC5A 4RORA 2FRXA 2CLEB 3HADA 3A3YA 1TVKB 3D7SA 1OZHA 5JYDA 1W6UA 1ENZA 3KC2A 1L4GA 1O5TA 3JQGB 1KU6A 3PDIB 3W6ZA 1IEQA 3G0HA 1TYEB 2GCOA 2GTPA 3TLJA 3IUJA 2JASA 4Z1MD 1OGJA 5FOXA 5JSZB 1JMKC 1P33A 1OZGA 1QB7A 3FMOB 5HFNA 3O90A 4H0NA 4OFWA 4TYMA 4GM1A 2HSGA 4G25A 1U65A 4MMYB 1TVCA 3DEHA 3NBFA 5IANA 1YQGA 4EPWA 1DBPA 4PE5B 2KYRA 3F98A 5A05A 3RUHA 3U80A 4A6PA 3LDFA 3MT7A 4AQYB 2X7HA 3CRNA 1U8YA 4DQKA 2WJWA 4YMIA 3SQWA 2W43A 2PQMA 3AXSA 1JKMA 3PFIA 1A8IA 2G4LA 4LF9B 2WU1A 2V6IA 3ZGXA 4MDYA 3NTUA 3K0AB 3K53A 4PHCA 5FB3A 1EGVB 2RHTA 4QNNA 1DFGA 3FMIA 1G9SA 1PNVA 4QJ5A 1P5JA 5KOJA 1VA5A 4TQGA 1GU1A 1I36A 4IP0A 5LDGA 3TL2A 1D1SA 4GQBA 4ASUA 1RJ9B 3H5AA 5KTSA 4UOEA 1EVLA 5TS3A 4E1BA 2JKYA 1ISPA 2ZRLA 4R8VA 4E4TA 2PRZA 4R3NA 1JBEA 1VCOA 2PD4A 1ZCZA 3QBTA 4IX1A 1CFJA 1XG5A 2XMRA 4MINA 4QASA 1B16A 4UEKA 2ACWA 1OD6A 1T36B 2OXEA 2DHRA 4TMTA 5ALMA 3W90A 4YDQA 4MQUA 2PS9A 3U9LA 4CKEB 2ZRGA 2IQIA 3A25A 1A0OA 4KBGA 2DFKB 3O93A 4IO1A 1C3VA 2YDXA 4DCCA 5JSKA 4LSMA 5JZVA 4HDRA 3D3NA 3QXHA 1KJJA 4CKWA 4RU1A 1QE0A 1W4CA 4NQRA 1DEXA 1CY1A 3I8XA 1SH7A 3GBVA 3GRUA 4QXQA 3HB1A 5T41A 2WYWA 4BO1A 3MRSA 4N65A 1QWSA 4FHGA 1HOXA 2GWRA 2ZSHA 5K8LA 4JQZA 4PVDA 3T54A 2W6OA 3I6IA 5IABA 4BE7B 5E9JA 1ABBA 4WXPA 2ZRMA 3EZ7A 3CGGA 3F7MA 4CKEA 5ALKA 2HJSA 5CLLA 2Q6LA 3F6BX 4FONA 3WWYA 1B26A 4GYKA 3AGPA 3LUGA 2QAGB 3WLIA 4YVFA 1UH5A 4MGKR 1NN0A 5J59A 1JFFA 3K0SA 3UAGA 1U7PA 2VUIB 3V48A 3VVCA 1ZGCA 3NBKA 3JWEA 1DLIA 3HE3A 3DBLB 2CFTA 2Z5VA 3CZ4A 5SYMA 4PLGA 4PYNA 1E3IA 3M3DA 1YF3A 1GQFA 1XOIA 2VUHB 1LV8A 3UT6A 1BYIA 4KQKA 4KIGA 5CRIA 2I2XB 2OORA 1MAWA 1SQ5A 3PQ7A 5ELMA 3ZGZA 2YRWA 2V7BA 4OJKA 1KI7A 1JHOA 3HMQA 3FI0A 4PNPA 4JMLA 5K8VA 1Z5NA 1ID8A 1ZM4A 3DBRB 3E5HA 3BERA 2H3HA 2IODA 4XJSA 3A11A 3LPLA 1WULS 2HM7A 1U9YA 4OTZA 4DJTA 1MO6A 3HU2A 4L5JA 2HREA 2MT9A 5TVGA 2E87A 1JPVA 2JGDB 3B7GA 3RYFB 5H1YA 3TBHA 3VPGA 5TQ2A 4LDAA 4C29A 1KOFA 4KMMA 1PJQA 1ZRNA 5DOZA 2C78A 4NBSA 4LMPA 2AEJA 4XGNA 3RREA 4YJFB 3T8YA 2PGNA 4TLEA 2PKXA 3IEPA 3SBEA 4F5YA 4B85A 3RBZA 3V2UA 1MABA 1KEPA 2WIAA 1W34A 2FHSA 4X1YB 3F5MA 1NLMA 1QP7A 3F67A 3KT6A 1F9AA 1XTTA 2W11A 3SHFA 2D6FA 3KELA 4L5BA 2QZSA 5BUSA 4FKBA 4OXRA 3QF7A 2MSNA 4R68A 3NEPX 1V2GA 3E9CA 4B3DA 1E4VA 4NYJQ 1KE2A 2PXXA 3GRFA 4HNVA 2OZPA 3FOZA 1E1YA 3F49S 4ROTA 1EM8B 3G2JA 2H1CA 2QRZA 3CO5A 1PK9A 3M9XA 4L76A 1EIWA 3T0IA 2A9KA 2RHLA 1HR0B 3WMGA 2ZI5A 5IDXA 4URZR 2CYBA 2Q2VA 5AM4A 3TLZA 2EHJA 3AVUA 1OKKA 1DIAA 1Y7HA 1XU7A 2H1VA 2W6IA 3KPUA 3LMKA 1XRNA 1FNNA 2FEKA 3E9QA 4JIMA 4I4CA 1A7AA 2GHRA 4EYKA 3LLVA 1XC7A 3KZKA 1BDHA 4HWKA 1O5OA 1VYTA 4Q01A 4BLQA 1WUHS 4ZHQB 2PCLA 3PP8A 3KDPA 2OPHA 4GX5A 1DIHA 1SUDA 3Q7QA 3CV3A 4RBNA 5FPTA 4CIBA 3FPLA 1AHNA 1T2UA 3UKDA 1PQ4A 2DB3A 4CKCA 3RTCA 1PT5A 2BEWB 2Q9BA 3EZXA 4R1OA 3CTPA 3ZI4A 3DPIA 3WRYC 2Y1DA 2W6MA 2P2GA 3DT6A 2H1FA 4YCNA 2OCIA 4IS2A 4Y2SA 3IAUA 4DMHA 4WWHA 4IIGA 3DOEA 3U4DA 1KL7A 3TLKA 4QVGA 1BJTA 4RKEA 3SY8A 3DVQX 1D7OA 3GFTA 2HJ9A 3NASA 2QRQA 3PFCA 2QJOA 5GAJA 2WM9B 5KOYA 4WFQA 2ONCA 4F2HA 1U2QA 2IZ0A 3OEED 1DTWB 2C5FA 2EGGA 4FJ2A 1RS0A 4E5PA 3ZQUA 3K0CA 1G64A 3DOHA 4HAIA 2XVAA 3ROKA 2YHSA 1HDIA 1ZWKA 1RRKA 2V65A 2I4MA 1O7JA 2J0SA 4QOIA 1Z2NX 3I23A 3G7SA 3V4OA 1ZJZA 2P77A 2WWFA 4POOA 3IVAA 2NUAA 2WSSA 2WSLA 4HAUA 5JATA 4X1OA 2D4AA 3OM0A 5TV2A 2NU8B 1MCZA 4D9JA 3MCVA 2I55A 1OJLA 1KNQA 1PZFA 2OB2A 1J07A 5BSRA 2X5JO 3NM6B 1KPGA 4KPFC 1S2GA 4HH4A 1GD1O 4BEJA 4UE2A 1G60A 3I5XA 3TSOA 2A9JA 4GBGA 3NATA 2G67A 4UHKA 1P91A 3ZU2A 1D6SA 4C30A 3RHTA 1RYDA 2ZJ8A 2XB2A 1G4UR 3PPYA 3EGDB 1OC4A 2GRUA 3IR7A 5C31A 3SBXA 2GJKA 1M2KA 3ESQA 1OTYA 2UZ3A 4U0JA 3EXG2 3RTAA 1BTOA 2VNAA 1X19A 2VPZA 3BF8A 3EXG1 3PJEA 3WSWA 4QPZA 4DJJA 1B4DA 2BHRA 2R8XA 2QK4A 2FEOA 4NU5A 4RJKA 1W1UA 5DBHX 1A82A 3SMQA 3WJAA 1LDBA 4I9GA 4RC9A 3T34A 4EEKA 5JMOA 3JR7A 3OUTA 1MBZA 2PGOA 2DQYA 3VA7A 2DT5A 1CETA 4L4XA 5CDYA 1R9NA 2YMPA 4HHEA 4TN5A 3N2EA 5A4FS 2C9CA 3AVQA 4RADA 2ZIFA 5IXSA 4N76A 4BNIA 3ASVA 4XUCA 1SKBA 3O4RA 2OAGA 2CL5A 3L0BA 4EMSA 1CPYA 4HXGA 3T3HA 4C7MA 3VOBA 4Q4HB 1A8QA 2BE7A 2XHZA 5TLSA 3M5DA 4IF6A 3PFHA 5GP1A 1NXQA 4BBPA 1TECE 2AKYA 3R20A 5K8CA 1HKUA 2GN4A 3GLTA 2XYRA 7ABPA 1MB9A 1G9TA 4Z3DA 2O0MA 3KZ1E 2Q9CA 3QA3E 3HCNA 2R1TA 4UEJA 1GSHA 3HVIA 4D97A 3KYBA 1IXYA 2B8JA 3AKYA 3DKIA 3EDRA 1Q22A 2PL3A 4YJKA 2OXIA 3UWPA 4A36A 1K1EA 2XE4A 4HLUA 4UBLA 5ARCA 1QOZA 1ZJWA 2P7HA 4Z9YA 3HFSA 3CUKA 1PFUA 1T6YA 3N6RA 3BWCA 1U8FO 1WZ2A 1ELOA 3FVQA 3K1AA 2NNLD 2B0JA 2WHQA 5EUCA 5EZ5A 1PDVA 3IUBA 3P94A 3UHFA 3EW7A 4I81A 7MDHA 4JVLA 2JK0A 4FJ0A 5C1PA 1Q1NA 2QLTA 1C1DB 4G0XA 4G8JA 4KQWA 1Z5GA 4WADA 2C9OA 5DHSA 2QRKA 4K05A 4F38A 1G20B 1Z06A 3FTQA 3R09A 3UV6A 1NQTA 3HNRA 1EDDA 3C70A 3F7OA 1ISGA 1RR6A 2M32A 3OPNA 3PDIA 4PIVA 3AUXA 3WLHA 5LN1A 2UUCB 3HY3A 4M9QA 3T1QA 4M0DA 2HK6A 2HPZA 2X23A 3LE8A 4JITA 3K6SA 4MSUA 5JO9A 4LHZA 1EP2B 2PBZA 5LZ7A 2OV8A 5EJ6A 5JXIA 4HNRA 4UC0A 1R5OA 5BQOA 2ACKA 1K6JA 1C9NA 2HLDD 2G5TA 2FMKA 2HAEA 3IGFA 2ON6A 1CUHA 3IP8A 1ZS9A 3KUKA 3CZPA 5DTIA 3ABRB 4CCAA 2JJ1A 1WUYA 3L04A 2FWIA 3IPXA 1FQJA 1SAYA 2F1OA 2IGBA 4DCVA 4D26A 5CX4A 1RI4A 1W30A 3FUVA 5L4SA 4QFCA 4X97A 1EK0A 2R65A 3TK1A 3E58A 4G5SA 1VJ0A 2EWWA 2V5VA 3SICE 4DNQA 4B6OA 1OAOA 1TEZA 4F2DA 1QFMA 3A6DA 3FDJA 5A04A 2C83A 3EODA 4N18A 4OJNA 1T1RA 5DWDA 2QWXA 1V11A 5HKOA 3OM9A 1OFTA 2FG5A 3RJ9A 4U7PB 4HJXA 2UVQA 4R9UC 1H1LA 1XZCA 2C59A 2VQ3A 3CBGA 3M6AA 4XDGA 1UOEA 1SD5A 1BRTA 3HDTA 5LQSA 3MUOA 2FPMA 3GPIA 5H5JA 1IAVA 3NH9A 2VKTA 2IIBA 4M99A 2GVZC 2VDRB 1N2IA 2R5FA 4RFLA 1CQIB 3O75A 1M6VA 4Y6PA 3PCTA 3RGGA 5KEIA 1VSQA 1O8CA 2PTHA 3FSEA 4AMGA 4BN0A 3BPSA 2BEKA 2XZTA 1FLAA 2WICA 3BILA 1JG4A 2DTDA 3CRRA 3H11B 1XDSA 3O4HA 3HCCA 4MR8A 1PGJA 5FWYB 2C29D 1TX4B 3DVLA 3Q9SA 4PYMA 1E9VA 1NQXA 1SVKA 4CU2A 2YWCA 1NATA 3A9RA 3A9TA 4OQNA 2JLCA 3AEKA 3F8SA 4M1WA 4WFJA 4I7EA 4LECA 2H48A 1T3HA 3I37X 4C0AC 3I01A 5LC1A 5CG1A 3DEKA 1C2TA 2X1HA 2TMGA 3CMCO 2FN9A 4IUYA 4UVDA 5DTJA 1DPFA 1OFIA 5H9VA 3TCNA 2DZDA 2TRSB 1VG9B 1UBHS 3DNPA 3C7AA 4X3PA 3TWOA 1R4MA 1G4AE 3A6GA 4MW4A 1EBBA 3IVCA 4O4IB 5CP8A 4DA0A 1NR1A 5IAJA 4IHAA 4ZT3A 4BEWA 3K9GA 4G4SP 2WIGA 1CW2B 2QI9F 5HZHA 2CEAA 3JASA 3RUAA 2NV6A 3S1SA 2P2YA 1E9RA 1UDXA 1DJLA 5HF6A 3OQHA 2XUIA 4RMHA 2WG2A 4N54A 4Q48A 3ZWAA 2OHFA 2A14A 4ACBA 3GZNA 1FJHA 1WV1A 4I3FA 1T6ZA 2CUZA 3RU2A 1V45E 2OVFA 3M1LA 5H59A 2IWHA 4JEMA 3AFOA 4PVCA 4NH4A 2Z2YA 3PJFA 5MN4A 5GINE 1A2OA 3AF4A 3HU5A 1QHFA 3K0EA 4NU8X 2JIDA 1DBVO 1NV8A 3O83A 4QOGA 3JRNA 2MSCB 3V42A 5KC9A 1DKQA 3BAZA 1ACJA 5FOWA 1H1TA 3I4CA 1M34E 2GO1A 4JYCA 5AXAA 2OBYA 3WYDA 5IDQA 1MT0A 1TM2A 2PLWA 2J07A 1K5HA 2PX6A 1JPJA 1HDOA 1YRYE 4M0MA 1QVZA 4Y2VA 1GRQA 4L51A 5IUNC 1RM5A 1XTSA 2HQOA 3REQA 3MQFA 3QU5A 3LX4A 3F47A 1XJQA 5HMMA 1UP4A 3AM3A 3U4AA 3M6IA 1Z73A 4PSDA 3RYTC 5P8WA 2XUFA 1AE1A 3SSOA 1SKYE 2ZTMA 3EGOA 3QVKA 4D8XA 1N34B 1IONA 2I71A 1T10A 3EC1A 4KXUA 4DMKA 3U48A 2XD9A 1QH8A 3EXEA 4PFJA 3TDMA 1OCEA 1G8FA 1JH8A 1LDYA 4L9SA 1IBCA 3NVMB 4BYGA 4YRAA 5LWQA 1OXKB 3IBCA 4WOCA 3UMVA 2GJ8A 3AJ8A 4AS2A 4YRCA 1G2PA 4CLOB 2KB0A 3JV7A 4CM4A 3BVPA 4ZOLA 4BQFA 1SY7A 3CXRA 3IB3A 5LOVA 4AY4A 3IPAA 2UYCA 3EWIA 5F9MA 4JYAB 1FVOA 2K7ZA 3EEQA 1KO5A 3GFOA 4L6AA 4NR0A 4IWXA 4OJTA 3T7JA 1I8TA 2CGEA 1NUAA 3HPRA 4WNCA 5DXFA 4GWLA 3DF9A 3UK6A 4EJSC 3CBQA 1M0EA 2VT2A 5AJTA 5HXAA 3VSCA 4C1NA 4CBVA 2WF6A 3ZUPA 2FY8A 4KACA 4C78A 2L0XA 1YBFA 2HGZA 2IGTA 3WGGA 5ED4A 2QN8A 3KHKA 3WLMA 3P9NA 4L4UA 3HKCB 4EAQA 3OF3A 3JQRA 5ESXA 2H4ZA 3ODGA 1NXVA 4K81B 4OBWA 4Q02A 5CFMA 2ZSBA 3UW3A 2P9HA 4K9DA 5AUNB 1VE7A 5KC8A 1GLNA 1QGUB 4PW0A 4ITUA 3H2IA 3FPBA 3MN1A 3N1UA 4C6TB 1CQXA 2AUMA 3L6RA 4GKKB 5AUPB 3FPFA 2FZKA 2N1BA 2IYVA 2BTQB 2Y68A 3V8EA 2H16A 4MUIA 4M54A 4OHPA 2ZTUA 3OZAA 2VTBB 2ZEJA 2X3FA 4AI6A 5DYNA 1H94A 4QPDA 4CEIA 2FUEA 2ZSJA 1VL8A 4L16A 4CMIA 4ZT2A 2E2WA 4ZZ3A 3MRVA 3LZ6A 3Q15C 3HR8A 3IAHA 4GI3A 5LLTA 1XVUA 3WYEA 4IH1A 2A7QA 1DAMA 5BQ3A 2OUIA 2F8SA 4HQKA 2RGDA 2GF9A 3FUXA 4E7OA 2ZRBA 3PRHA 5BW8A 5L45A 3ANMA 4OXKA 4AW9A 5CFQA 2DPGA 2IX3A 3WS7A 3V5NA 4V0KA 4HGRA 1K4MA 5C52B 2KBFA 3LPAA 1MQ8B 4MIKA 5FL7D 1SHTX 5HKAA 2ZJ3A 5G02A 2F6RA 4DQLA 3A6HA 4NZ9A 1JHUA 3UMCA 2WR8A 2TECE 1CHDA 1WY5A 5IYZF 1R0BA 4MS1A 4MHOA 1PNQA 1MVOA 2XDYA 3H5WA 1ZUNB 4K1XA 2MSEB 4ENUA 2JIOA 1HE2A 4O5OA 2V9PA 1Z6XA 2KM1A 4IG4A 4WE3A 3A1TA 1Z16A 2BHNA 5DYYA 2P0AA 3BWMA 2BL4A 3EFBA 5E6UA 5SY9A 4PLZA 5BY2A 5CFPA 5CIYA 3NBXX 1J8VA 1V7ZA 3D02A 3EUAA 3I4LA 3J81k 1PW7A 2N75A 1S8FA 3PSHA 4OBXA 1SUBA 2HBRA 4MA4A 5IZCC 1UFKA 1FP4A 3OX1A 3RS7A 5C8YB 1OAKA 1OAOC 1NDHA 1OFHA 2J6CA 2OV4A 2ZI4A 4G5QA 3SGLA 4AKEA 3H1FA 1V1RB 1W7AA 2H4FA 5HPYB 1MRSA 1JIIA 1ULTA 4FFNA 4YCLA 5A4KA 2QUAA 1EFRA 1Z2DA 2IPLA 1FU7A 2C5EA 1JU4A 4US1R 3AHEA 3WLLA 4AZWA 1AKYA 1K6EA 2NYUA 5F2KA 2C9YA 2CVOA 5AHKA 5ULLA 4CDNA 4DRZA 1P74A 1FP4B 3CFYA 2GPAA 2G9RA 4WLFA 2PL5A 1MXHA 7REQA 1T1IA 5DM70 2HV9A 3P45A 4RGYA 2QJRA 5FI1B 1PR1A 2PMBA 2O2YA 3U4IA 2GZ2A 3CRZA 3IQIX 1FPMA 3E8MA 4YT8A 1ZXLA 4MA5A 4UVIA 1G2OA 1MFPA 3KR9A 5ICMA 2XLBA 4XQEA 1LEHA 2V6GA 4NAHA 5HBRA 4C1BA 2VDMB 4HQNA 4JVMA 2O57A 2VJOA 2CSXA 1ZFNA 5JOQA 3CVWA 5JROA 3ANYB 1MIHA 2TYSB 3HZHA 4BX2A 2WD9A 2C04A 5G40A 2XE7A 1FYFA 1EFPB 4Q1BA 3OMXA 5CLHA 3DXYA 2HZBA 3IAXA 3F6CA 3RYFA 4LCEA 4KWEA 2BLNA 1Z5OA 3PUZA 3KQWA 4PO9A 3WTCA 2FSSA 4D4MA 4BECA 2JFFA 4B0PA 5IPFA 2WT9A 4P6VF 1OAAA 1COWA 4BC0A 1TQDA 3OCCA 3W9BA 1QTIA 5C7YA 3KKZA 2JARA 3QTBA 4QTUB 3FYUA 4YJGB 1CQJB 2F7SA 2W7TA 5JLAA 4EG3A 5KJ6A 1XNRB 2VH2A 1EWQA 4MUJA 4EVIA 1P75A 1KF0A 3EIFA 5BSGA 1KH1A 1U7ZA 2EYQA 4D02A 3T7AA 4LOAA 2MSDB 3I83A 3NEJA 5A06A 2IEBA 5G4KB 4TTJA 1GPH1 4PAOA 5A6VA 4BJ6A 4HLNA 1RACA 2H1WA 5CTJA 4YAJA 1DEHA 1QLHA 4QULA 4RIHA 4W5HA 4W6QA 3S7ZA 3USZA 3IUSA 4O1HA 5LYJA 3OP4A 1KYIA 1I14A 1UPBA 3DFKA 3U31A 3VU8A 4W99A 3WGNA 1K66A 2X4DA 3NOXA 2PWBA 4M0KA 2AR7A 2EP5A 2YCLA 1Z7EA 1QM5A 4GR5A 3EPKA 3VPFA 1R9GA 3ZU6A 1X6VA 4GZ3A 1BWRA 1UBMS 4MVJM 1LXCA 4P3OA 2CLKB 4JJ8A 4BFUA 2VHYA 2FMXA 1P9LA 2HA4A 4RVCA 3B3JA 1YR9A 3I0MA 4BUJA 4AC9A 2I91A 1A9SA 3FPKA 2HV8A 3N59A 2EP8A 3LUAA 3O8LA 3KU1A 1VMIA 3SC2B 2R7NA 5CJPA 3SHOA 2B6HA 2WABA 1QNFA 2HMTA 2BFBA 2O3JA 3AEUA 3EJWA 3SM3A 4C2UA 3PFNA 1STOA 1ONNA 3LWBA 2GPBA 1LDNA 3T9FA 1UMBB 4U9IS 2C4VA 2ISQA 4OI4A 1UT6A 3TF5A 4OFZA 4WA7A 3FTDA 4BN4A 4PZYA 5BWNA 4G65A 2P27A 2PD3A 3DHWC 3I6YA 4FHZA 1G9XA 3MFQA 3HA3A 5J5CA 2GEDA 2QLJA 3FZGA 3K71B 1XZMA 3TIGA 521PA 1E1DA 3OIVA 1UC5B 1Z7GA 2XUQA 4GBMA 3D6VA 13PKA 1BHQ1 4YEDA 1T8PA 5ALRA 4PYQA 3S8MA 3MTJA 3G9ZA 3QJYA 4B4OA 2Q27A 1IOVA 1XDGA 3IP7A 4CIYA 1HL7A 4EARA 1YUBA 3O8OB 5LXTB 1JW9B 4ERXA 1YA8A 2YV5A 2A30A 2ALJA 3JQ9C 4RKYA 1QYCA 4JBLA 3U4QB 4IEEA 1M5TA 2MMGA 2X6QA 3SF8A 1PR4A 2VDKB 4ZP1A 2P40A 2DCUA 3NAQA 1YL5A 4DW8A 5TMDA 3GA5A 3UA3A 3CTMA 2JA1A 4MW6A 4LSZA 1UKCA 5B53A 3MWFA 5TS2A 3WGOA 2HA3A 1U4SA 4BIIA 2P5YA 4C0HA 2EATA 4ZGWA 5AQ1A 4O4LB 5HZGA 2PBFA 3WGJA 4PN3A 3ZCRA 1Q19A 1LSJA 4OXNA 3DOOA 2ZAIA 4YP0A 3BF7A 4IAOA 1XDBA 1IVSA 5FF9A 4JC0A 1DCMA 1L7RA 3D8RA 3JXEA 4WOKA 1UKVY 2FV8A 3S2YA 4A9AA 1IJKA 3FB1A 5HQ3B 1X8KA 4J16C 2VLIA 1NT2A 1U7UA 3FFAA 5HCUA 3E22B 1J0DA 5EESA 1F2UA 3KHUA 4FOLA 3JQDA 3UZUA 3IJPA 1FDTA 3TIVA 3BM5A 4MDHA 3L7KA 4BRSA 3VKHA 2CLFB 3RVJA 4J0KA 3SC6A 5BOSB 5ICGA 2J48A 2WHRA 2DWPA 2CDAA 4LOJA 4S05A 1KO7A 1LRLA 3LYAA 1VG0B 3TIXB 1I13A 1T8YA 1R0SA 2KW5A 5BSWA 5DNYB 3IX7A 1XCLA 2FPXA 2ONZA 1HURA 4JENA 1U7HA 4E88A 1V8OA 2R25B 3G2KA 3U3DA 1NXXA 2AG0A 2BFCA 2PMKA 2Z30A 3QFCA 5DE3A 1KDVA 1NBMA 1J4AA 1EJ2A 4YAGA 3ASYA 3M1YA 4MW2A 3FWNA 1PR5A 1D8AA 1QHYA 2J87A 4HFRA 5EMJA 2J9YB 1R10A 2X7JA 4TSFA 3V7NA 4BKPA 2NVWA 3ZEAA 3NAMA 1JDVA 3FDXA 2Y2VA 5EEHA 3L7LA 3JWIA 4A6DA 3RS8A 3OP1A 2MYPA 3IKJA 2IHBA 2D7JA 2YYSA 1E2GA 1U2GA 2V7WA 4RDHA 1QHXA 1XVIA 4U2FA 3BE6A 2WVJA 3W5DA 4K6MA 3HHEA 2HZ7A 1T9GS 1LS6A 3I34X 3IBYA 1GRCA 5D01A 2FWAA 1SD1A 1KE1A 1XR3A 1TKBA 2VP3A 1KO4A 4RKWA 4TVSA 1LTKA 2FUCA 3BMQA 4MYDA 1SXHA 3RC9A 3FI9A 3B1FA 4IHJB 1PEDA 1UQTA 1YA4A 4OAOA 3W5IA 1D4OA 2RFLA 4NXMB 2VP2A 1F8GA 4LZAA 3JWGA 2QNRA 3L0YA 5A2GA 4N5DA 2CLMB 1TUGA 2ZBDA 5AVKA 1M8JA 5F51A 4ZI2A 3G8BA 4QM6A 2J6IA 4URXR 5I7EA 5FFFA 2W0MA 1KJWA 1NY6A 1XZHA 2HHJA 3CNNA 1N5DA 3R5HA 5FADA 4AMVA 1JTFA 1OV4A 2ZI6A 1FS5A 2JEOA 5DYGA 1NPTO 1CUXA 3CLHA 3V1TC 5J2TB 2IBTA 2GN0A 4BGEA 1S8AA 2GYUA 4EENA 1XZPA 3PL1A 4MVXA 2VCYA 5JAPA 4YCSA 4JXZA 4ESVA 2J9FA 2ZU6A 3WFZA 5HIAA 3B1WA 2WINI 2IV7A 1FNCA 2FGKA 2VVTA 3M3HA 2RBKA 3P2EA 4OREX 4R1MA 3WDSA 1FFGA 1HDXA 2GEVA 1L4EA 3GEBA 3NM4A 1N2CB 4I8XA 4COOA 3KKMA 3MCZA 3VH2A 4RMJA 3Q3JB 1QFYA 2PIAA 4NFYA 1UFOA 3QPDA 3K20A 5EZYA 3NUGA 3V80A 1FFCA 3V00A 2W83A 5H68A 5CG2A 5FBVB 2VI5A 4UAJA 3SXUA 4MVJG 2ZB7A 1GKKA 1B1AA 3PGMA 4X1KA 3MAJA 2UZAA 2VJYA 3IOMA 1RWOA 2ADFA 3DTYA 4ZIRB 3WOVA 2J3MA 3HJTA 4JT2A 4BUCA 1K7YA 4IPTA 4RLHA 2NUTB 4MITA 5KNLA 1PWHA 1P1KA 4XZ3A 3LFHA 3HBLA 1GKYA 4PPFA 3OSUA 2AQKA 1XV5A 2XUZA 2Z2KA 2UAGA 3FR8A 4K5QA 4HRVA 2W2LA 4QSMA 1Y1QA 2EVWX 4WFKA 5KMGB 1JWLA 5FPYA 4PSVA 3EXAA 3MMNA 1XU9A 3BD6A 4G36A 4JS0A 3L01A 4CDMA 5EN4A 3IQWA 2CUTA 4RSGA 2W8BA 2NVOA 3NNSA 1SC1A 2DWOA 3MMSA 2JFVA 2W58A 3RUEA 3JQ8A 2POCA 4JEIA 3JVUA 1PI3A 3V3KA 4OBEA 1FFWA 3N6XA 4GXTA 4YONB 2ONJA 1KYYA 2AFHB 3WLSA 1JSZA 2JLZA 4L4RA 3HUUA 2HRRA 1Z36A 1JAXA 4FEAA 2LCQA 3N8HA 4CMGA 4ZZ1A 3UPTA 1ABEA 3PT9A 2AMYA 1YZ3A 5TE9A 1R8SA 4UCWA 4EPXA 2VUTA 2EP7A 2A5GA 4DVJA 1MV5A 4R2IA 1RQNA 1KYWA 2V7TA 4RAOA 2REQB 2GAOA 4M55A 1Y4AE 4TV9B 2PJZA 3L8YA 4XD7D 3UXYA 5FBKA 4LF5B 1RABA 5IBPA 1ADYA 3ND6A 1WKBA 2YINC 2A1UA 3H17A 2X9QA 4O3MA 3P2JA 3NDJA 2B7CA 1J1ZA 1RWMA 2CSUA 5HK9A 4FYMA 3SE0A 3BBPA 3L5OA 3W06A 3QPAA 1BJKA 1WXGA 2Q4OA 3ZCXA 4DDMA 1XDWA 4DARA 1YQWA 3BE4A 3BYZA 4YTEA 3WRWA 4LE2A 5FBHA 2OCXA 3GUVA 4M8NE 4ZVRA 121PA 3HCOA 3EQZA 4S0ZA 5BQ5A 4L9RA 4XUEA 5KNCD 1L7AA 4M36A 1IEVA 2OKCA 4K2AA 4U6SA 2QG6A 4ZREA 1I6KA 3DL0A 3G9TA 1BAPA 3HJGA 4DCJA 2PUTA 2VBGA 2YYYA 4G5RA 3H04A 5JRZA 5A1TA 2QVLA 4BVKA 1T3GA 2I80A 2HF9A 4OM8A 3F78A 4JX9A 3LUBA 4Q93A 1T13A 1TI7A 2WW8A 3DDUA 5IJZA 3K09A 4HD8A 3SJ7A 3ZX4A 3F6SA 2WWYA 2DFDA 2H00A 1Z6GA 4FDAA 5CLIA 4Q47A 4DY6A 2O8CB 3DZFA 1AG9A 1AIPA 3WG9A 2WWGA 3U26A 4EUFA 5LP1A 5BPFA 1N0IA 3H8VA 3UMSA 4JI5B 1DEOA 2KPOA 4CLOA 1D6JA 3C6BA 4I9UA 1WX1A 5B7GA 3BXEA 4YJ3B 2QP4A 1P2UA 3QQ5A 1K75A 5J40A 3RASA 4HUJA 4KR3A 2XOEA 1PS0A 5DLDA 3VJMA 4TLBA 1M2WA 1IZ9A 3USES 3GBPA 4NBKA 2X0JA 2Q9UA 4RYDA 2BFOA 1P77A 4URYR 2P65A 3PCXA 4QHYA 3KKEA 3OZIA 4EG8A 4X1IA 3O2NA 5G0WA 1AN0A 3R7SA 4C4SA 1EU1A 2GTIA 2WC1A 4N0MA 2I62A 4QC2A 1HQCA 4PSUA 1ZJYA 2C2YA 2Z58A 2X3YA 3HBMA 3LW7A 3B6EA 1XCPA 1IVNA 3GU3A 3I04A 3KQTA 2ISSD 1JTEA 1PF7E 1HT2E 2AMFA 1NVVQ 3ANTA 4U6QA 4GE0A 5EMHA 1LNZA 2XDQB 2G71A 3U5TA 2PKWA 4RQBA 1EPUA 1QANA 4PYRA 1PLJA 2Y1WA 3KWLA 1R12A 4BNLA 4II3A 3H2KA 5FA8A 4E5YA 2XF2A 1NDQA 3FWHA 2HPHA 3DSRA 1LH0A 4NOMA 2HQSA 4DSUA 1W96A 1XMJA 4BRWA 2I2BA 2IRWA 2P4QA 4BLPA 2JDIA 1Q0QA 3WA6A 2Y0EA 3GDWA 5JO0A 2OHJA 3ZJ4A 1YC5A 3W77A 2XMBA 4DMLA 3NKVA 5JVDB 3T3OA 1TM1E 1JA9A 1YT5A 1O0BA 1Z39A 3AVYA 3BL5A 3O84A 1E6LA 3TAUA 2WLTA 3M5WA 2CCKA 3DV0B 3A9CA 2FYTA 2ZGVA 4PR3A 2YNMA 4RETA 4XWWA 4G0WA 2AOUB 4RHUA 3RR2A 2HHAA 3PDHA 4ND2A 2J5KA 2CL0X 3C5HA 4AM8A 4Q3CA 3W3ZB 4ALMA 3OFSA 5FP0A 3FNHA 4H08A 2GJ9A 2FPWA 2ZBPA 4IV0A 3BTUA 3FUCA 1Z0JA 3KQSA 2RGCA 1QHGA 3H3FA 4LWPA 4EEZA 3EJ6A 4R41A 1KDZA 2JGFA 4EM6A 2P3LA 4ZJUA 4DLNA 2E82A 3FR7A 5A6SB 4MCJA 3PPVA 2OBLA 6REQB 3E22A 3URMA 3NC4A 2WJZB 2YFYA 1Y1TA 3C1OA 5BQPA 2CUNA 2DR0A 2AI3A 1OX4A 2QX6A 3RS3A 1H4VB 4N6NA 4RANA 4EKDA 1O77A 3DUWA 4IIUA 3BXFA 4EGQA 1ODJA 2NPIA 1Z07A 2NTVA 3O0TA 5IK2D 4KW7A 1EXWA 3E9RA 1D3AA 4IIYA 3QPUA 4M21A 4D9GA 4LNAA 2B8NA 4JJIA 4BNZA 1I2BA 5HMLA 2H9IA 4HDQB 2X8JA 1E2MA 1LF5A 1M1YA 3BBLA 3EIWA 4IX9A 1WTAA 4P31A 1XIVA 5MDHA 1R8XA 4QQ8A 5JLJA 2AZXA 1EBUA 1T9BA 4WK0B 5JDIC 1EHIA 3DL4A 4C7JA 5EY5B 2QQEA 2I4LA 2B2CA 1ADCA 4D0NA 2IKSA 1U8CB 1U0RA 2JAOA 3TBFA 2HSZA 9MHTA 1OSNA 2B5VA 2DJIA 4CF7A 3WKDA 1JGTA 3CUTA 2J0VA 1PD1A 2G83A 3HCRA 1RM0A 4QU0A 3KR0A 2XUDA 3L05A 1NBAA 2Q4DA 4KE9A 3U0BA 2H17A 4F8YA 5KNDH 1UZNA 1CULC 3BSWA 3IVMA 3KJHA 3I2KA 4OQDA 1VHTA 2D62A 1RXWA 1PDWA 1RMYA 2G17A 3H6KA 4O2AF 3ZOZA 1BEZA 1S02A 3FMPB 4TTTS 1RYNA 1YB5A 3EXIA 2GNPA 4QPNA 4E1VA 4IUCS 4F3TA 2I8AA 3AF1A 3L8CA 4H7PA 4MGYR 2HN9A 3AIMA 5K3FA 4WT7A 5F5XA 4ZKEA 4W7SA 5AVTA 4N6OA 1CJBA 1NKTA 2Q5FA 4PFKA 3VGPA 3VI4B 3OTIA 3QSGA 1ZLXA 3JSXA 3WDKA 1DUVG 1YIOA 5AIBA 2BGJA 4CKYA 3H4IA 4MLDA 3RS2A 2VT6A 2J9GA 1RWNA 4B3FX 1R74A 2R6CA 2R751 2JI8A 3NJ4A 1N1MA 3M83A 1PS9A 4PG8A 1C5KA 3H9EO 2NVUB 2V4MA 4BNTA 3LQYA 2H51A 4Z86A 4PC7A 5TJHA 3SQMA 3RFUA 5J23A 3ESCA 1OVGA 1YQUA 3KYJB 3R0VA 4NCAA 4XX0A 4NIMA 1L5OA 4XSHA 3P71T 2Z4RA 3TLAA 2GM5A 3M0EA 4J0EA 4Y1RA 1UIRA 2XDWA 1KYTA 1H2FA 2WPDA 5BWOA 4EX6A 2OGTA 4DSNA 4RJIA 4ETNA 1XUOA 2CXNA 2J0UB 4EQZA 2XX3A 1NBME 4IXNA 4TKVA 3W5BA 3GHYA 4RY9A 3ZKWB 1IWPB 4E13A 4EGSA 4HQRA 1TVKA