3OCZA

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase complexed with the inhibitor adenosine 5-o-thiomonophosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
247
structure length
247
Chain Sequence
EEHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lipoprotein E
publication title Structural basis of the inhibition of class C acid phosphatases by adenosine 5'-phosphorothioate.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase/hydrolase inhibitor
total genus 95
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3oczA00
2YN4A 3A1EA 3A3YA 5AK6A 1WZCA 1Z4QA 2C88A 2B1QA 3EF0A 3M9LA 4NWIA 4C4SA 3U19A 3B8EA 2OBBA 2B30A 4JDPA 4F71A 5ALHA 1J8DA 5ALLA 5AKLA 4DW8A 2RB5A 4FE3A 3ONNA 4AS3A 4CNQA 2AGVA 4BBJA 2IOFA 1S8OA 3KOOA 1O08A 2G09A 4Y2JA 3BWVA 4CF3A 1T9ZA 2HDOA 4UW9A 3NANA 5ALIA 4IG4A 2PKEA 3WK7A 4XOUA 5AKKA 1J97A 2JGAA 5AESA 3W5CA 3U7GA 3IB6A 1F5SA 3FPSA 5A3RA 3WKEA 4XQ0A 3SKXA 2C8LA 5AI0A 4DCCA 4EZEA 3S6JA 3N1UA 4DFDA 1Q91A 5AKIA 4BX0A 2GHQA 5AIBA 2EAUA 3SMVA 2WF8A 3ZVMA 2FPXA 3QU2A 4GXTA 2YMPA 2Q5EA 1L7MA 5AK5A 2C9MA 2VKQA 3AR6A 5ALGA 3UMGA 2I6XA 4Y3UA 1NRWA 3E58A 2ZBEA 2YFYA 1EK1A 3OCVA 3QGMA 4EX6A 5AM3A 4RETA 1L7PA 2G0AA 4MUMA 5AKXA 1MH9A 3AR3A 4HGOA 3PDWA 3UMBA 3W5DA 2I33A 5ALQA 5AW7A 2PR7A 4BNDB 1RC8A 5IS2A 2WF5A 3FZQA 3QXGA 3MPOA 3KD3A 1RQLA 2FI1A 4O8CA 3OCXA 4IFTA 3SKYA 1XVIA 3PCTA 4UAVA 4OFZA 2IOFK 3QU9A 2RARA 2FPWA 1TJ3A 2FUCA 2HF2A 5AKYA 3K1ZA 1QQ7A 1EK2A 5ALNA 2GMWA 2HCFA 2YJ3A 5AW3A 3L1UA 3L8HA 1RRCA 3AR4A 2FEAA 4HYTA 3QUQA 4UU0A 1RKQA 1Z4MA 3B9RA 1XPJA 2HOQA 3L0YA 3L8EA 1LTQA 4I9GA 2JAUA 4EELA 5IT4A 3ZWDA 4EENA 1N8NA 2HO4A 3WK6A 3NRJA 3ZWKA 4YIKA 3SLRA 3FVVA 4CE6A 2ZOSA 3I28A 4OD0A 3ZU6A 3ED5A 5AVSA 5ALSA 3ESQA 2B82A 2W4MA 3U7FB 2BDUA 3E84A 2YJ6A 4RESA 2IYEA 3QX7A 1ZD4A 4KN8A 3WK4A 4KX3A 4L6AA 4AS2A 3HLTA 1CR6A 1L8OA 2R8EA 5AM1A 3R9KA 4JB3A 2MSNA 1RDFA 1WVIA 4NAVA 2CFTA 5ALOA 4ZEXA 4E88A 5AKZA 3QU4A 4CF4A 4BYGA 4UM5A 5AM0A 2JAOA 5ALDA 1U7PA 2AUTA 2YJ5A 2WM8A 3U26A 3SF0A 5AIAA 2CFRA 3D6JA 5AI9A 4BX3A 3FPBA 2ZBFA 4BKMA 3NALA 5AVTA 4AP9A 3CNHA 4L57A 4G9BA 4UATA 2IA5A 1U7OA 4BEWA 4B6JA 2FPRA 1O03A 2Q4RA 1YS9A 1QH9A 3N8GA 4UASA 1L8LA 1ZD5A 2R8XA 4F72A 5AVQA 3RF6A 2X4DA 3SHQA 4C4RA 5A3QA 1IWOA 2R8YA 3A1CA 1TJ4A 4BX2A 3UM9A 2WF7A 2QYHA 3E81A 3R4CA 3U13A 1NF2A 3WK9A 2OA0A 1QYIA 5AM4A 2IOHA 4NV0A 3N07A 3KZXA 1Z88A 1Z4OA 4HGNA 5ALXA 4XE5A 4ZEWA 1Z4PX 5AVVA 2O9JA 2YMQA 1RKUA 1AQ6A 4UMEA 5ALWA 5ALUA 4YCLA 3PGVA 5AKJA 3IRUA 1RQNA 1RPZA 1U02A 1RLOA 3UMCA 3MMZA 1YDFA 3NASA 3QLEA 4J03A 3OCZA 2NO4A 3NAMA 3RFUA 2EATA 1TE2A 4ZEVA 5AW4A 3I76A 1ZD3A 5ALRA 3IJ5A 4QQFA 2YY6A 4Y2XA 4Y2UA 2YBDA 3WGUA 3ZVLA 2D2VA 4Y2TA 3E8MA 5ALJA 4G63A 1Z4KA 5ALZA 3N5KA 1Q92A 5FP0A 1PW5A 3TLMA 4Y2RA 4Y2PA 3QU7A 2WF9A 3NIWA 2W43A 3AR5A 5ALKA 5AVWA 2B1RA 3DV9A 2O2XA 4YIHA 5ALFA 4QJBA 4CF5A 2ZBDA 5AHXA 3R09A 1SWWA 4EX7A 4KNWA 2I34A 2G07A 5AI4A 3AR8A 2I55A 5AVYA 4HAIA 5AM2A 1RMQA 3M1YA 4UM7A 3ET5A 5AM5A 3OPXA 3J7TA 2P27A 1QQ6A 3OCWA 2OM6A 3CZ4A 1T5SA 2BDEA 2JAWA 1WPGA 2P69A 5AW9A 1ZS9A 3EF1A 4NFLA 1Z5GA 3L0BA 2YMLA 3MC1A 5AW0A 2FPUA 4XPZA 3L8FA 2P9JA 4OHFA 5ALTA 3U7HB 3ZW7A 4C4TA 4Y2SA 3ZTYA 2HSZA 2I7DA 3AR7A 2B0CA 3N28A 3WKDA 4UARA 5ALMA 1L6RA 4YH1A 5ALVA 4GIBA 2FUEA 1QQ5A 3L1VA 3KDPA 5AVZA 3L7YA 4UMFA 1L7NA 1L7OA 4J2TA 4HGQA 1Y8AA 3BA6A 5AI8A 2WF6A 5AI6A 4NABA 4KNVA 2Q4TA 2NO5A 2QLTA 2B8JA 3WGVA 3KC2A 3FM9A 2G08A 1ZJJA 2RBKA 2YMMA 1U2SA 1Z5UA 2MU1A 4Y2QA 1S2OA 3ZTWA 2NYVA 3NUQA 2ZG6A 5AKGA 4BEVA 4HGPA 3L0CA 4UMVA 3ZX5A 2B8EA 4FYPA 2HEGA 3SD7A 2BY4A 2P11A 5AW1A 2FPSA 2DQSA 1VJ5A 1WR8A 1X42A 2YJ4A 1Z4IA 1ZRNA 3EPRA 2EARA 5AICA 1TJ5A 5AW8A 2AH5A 5ALPA 2WHEA 3WK8A 4DWOA 3DDHA 1YJ5A 3PGLA 3B9BA 1YNSA 1YMQA 3ZI4A 4BNDA 3ESRA 3I1YA 3EWIA 4UMDA 3W5AA 2HX1A 1SU4A 1ZD2P 3GYGA 1T5TA 3WKBA 2G80A 5T41A 3VAYA 5AK3A 2OYCA 1FEZA 5AVRA 5A3SA 3F9RA 3OCUA 1RLTA 4I9FA 2AMYA 1RKVA 3P96A 5AKEA 1KYTA 1N9KA 1YV9A 4OCZA 5AW6A 2HHLA 3HYCA 1SWVA 3WKAA 5AVXA 2HI0A 2C4NA 2R8ZA 3AR9A 1XP5A 2RAVA 3I6BA 5E0OA 5AW5A 3AR2A 4H1WA 4Y2VA 2G06A 3QNMA 4Y2YA 4MWOA 3ZVNA 3L5KA 1RLMA 3WK5A 2JARA 3MN1A 2G1AA 3QUBA 3QU5A 4KX5A 1Z4JA 4PNHA 4YGYA 3W5BA 3ZUPA 5AK4A 1K1EA 4EEKA 2C8KA 3DAOA 2WFAA 2W11A 1RMYA 2CFSA 2ZXEA 4FFDA 4HGRA 1VJRA 4YCNA 1CQZA 3ZX4A 3QUTA 3QYPA 4KYTA 1U2TA 5AVUA 1NNLA 2GO7A 3WKCA 1LVHA 1RMTA 5AKHA 3OCYA 3L8GA 2PQ0A 1TA0A 5ALYA 5AW2A 3U7EB 3KBBA 2ZBGA 3OTQA 2CN1A 5JJBA 2I54A 3ET4A 4YCMA 1ZRMA 1ZOLA 5AI5A 2HF7A 5ALEA 2FDRA 2ODAA 1VFPA 3DNPA 4L6CA 3QUCA 1JUDA 4UAUA 1Z4LA 3FGOA 4UU1A 5IT0A 1Z4NA 2GHTA 2GFHA 3A1DA
chains in the Genus database with same CATH superfamily
5K9ZA 1A88A 1CULC 2WM2A 5HPYB 3TQRA 1ZP6A 1WZCA 4MW1A 5IAAA 1PWEA 1E1CA 1ZI8A 4L0QA 4I9HA 2A0WA 3EA0A 1V9SA 5J43A 1CTQA 1Y3FE 1S5PA 1IATA 2VF2A 3OY7A 4UD2A 4FPXA 4KOEC 3RJTA 5JAHA 3IXQA 2LDBA 4X20A 3DWEX 1NE2A 5ALHA 2GHIA 4OREX 2I7XA 3GN1A 4GSKA 3CVJA 3K70D 5KSYA 4DV6B 3GC6A 1UDRA 2IYLD 2IU4A 1XUOA 4YDQA 1SIUA 5IKXA 3PR1A 4KI0A 2OD9A 2XJ4A 3LYAA 4XGRA 3ZI7A 4D6PA 4XWKA 2Y1DA 3KOOA 2FK8A 5GONF 1DKOA 1I7NA 3WICA 4ARCA 2GTPA 3C1OA 1M6YA 1F8GA 1T3LA 2AQKA 1GQYA 2ISSD 3N87A 2DWUA 3NFRA 3ICCA 4J29A 4TWRA 4XIYA 4DC9A 4DJ5X 2DY1A 3KYJB 3FPFA 4K3UA 3I2KA 3WK7A 3TZBA 4JJGA 2BKUA 3JR3A 1BDHA 2OP0A 3FOCA 3U56A 3DOCA 3GLUA 4YX9A 2R5WA 2QX4A 3GRRA 1P9LA 1CUIA 1XRRA 2V7XA 2JCYA 5G4KA 4W5NA 4LHVA 4WJZA 4V1CB 1Q1BA 3DBHA 2I1WA 2VZ0A 6NULA 4JLWA 2FEPA 1CYEA 5BWNA 4EI8A 1NR7A 2CNKA 5D3KA 3TZ6A 1LW7A 1A9PA 2QPOA 4I1IA 4F60A 4Y6QA 1G2PA 2FWAA 2R8OA 3MTBA 3PUZA 2NQ2C 1P5ZB 4QOJA 2QSZA 4AM8A 4KVFA 1HV8A 3MIIA 3LBIA 1GKKA 2QMZA 3I12A 3HI6A 3L46A 1YCFA 3LRXA 5E4FA 1VRCA 4PPYA 3V2UA 5KOHA 5TQ2B 2NO1A 2A9FA 4E5PA 5J1SB 2PGJA 1PWYE 3ZHSA 1UM8A 4C87A 2Z43A 3JD4A 4BKQA 1KIMA 5AJHA 5CLLA 3U17A 2V8BA 1R00A 2C8VA 3IVGA 1XDBA 1QGZA 5JCOA 3BS4A 2IYSA 5KWIA 4C7BA 3N8IA 1M6HA 3OO1A 2X9QA 4XVUA 5HVNA 2SHKA 4QQRA 3E22B 1T0JB 3HB9A 1H5QA 2I71A 3OA2A 4N8DA 5JVDF 1OXSC 2V59A 3GGPA 4YPVA 4BGEA 4BQOA 3TAUA 2PPVA 3L06A 2A57A 3HPRA 1L7PA 2G0AA 5F76A 2CNWD 2P77A 3IULA 3EODA 2YL2A 4FFPA 3S68A 421PA 1PJZA 2AK3A 5H9WA 2H2IA 2WHXA 1B8UA 5IPFA 4WLVA 2ZJZA 2QTLA 3FTDA 3ETCA 3IEXA 3M2PA 4W5OA 5FWDA 4ISCA 2QP3A 1U0HC 4D0LB 5IS2A 4WZAB 2HYIC 3VDQA 1K66A 3QZUA 4BDTA 1E1YA 2ZUFA 2FX3A 4DT1B 4ERXA 4JXZA 1EI9A 4BFVA 4DSUA 4NZ9A 2QRKA 1Y3AA 3QX8A 2X9NA 1O8BA 3AEUA 1P9OA 3WE7A 2E1PA 2XJ9A 3PS9A 4CNBA 2WVAA 3JAWB 1U7TA 4GMHA 4C3OB 4EUFA 2HV9A 4LF5B 2NUPB 2FUCA 4MV4A 3M6LA 4HZUB 4N0MA 4UAJA 3HJNA 3GDHA 3B52X 2NPIA 3T9FA 1RCTE 2O8NA 4D99A 4TKVA 4RCYA 4FDMA 4FFBA 1QQ7A 1IJKA 3PX7A 1GNRA 4FLMA 5ALNA 2QI9C 5IK2A 3RC3A 1D2RA 1B2LA 4LZLA 3L1UA 1CUAA 4AKSA 2YC2C 1INLA 2ZUWA 2GM9A 1CZHA 5D3MB 1SHZA 1SCQA 1L7RA 1ZISA 4RQTA 4Z49A 1OJLA 1N1DA 3IQFA 4R0VA 2QL5A 1VL5A 2B20A 1M6VA 2FDXA 4AFNA 1QO0A 2YKGA 4MLZA 5FR2A 1P8AA 3ON5A 5G41A 4HCJA 1M34B 2QB5A 1KSHA 5TNXA 3K70C 1DEHA 1C4OA 2QTGA 4DV1B 3HFJA 3JALA 5HDBB 3M4XA 1VHQA 3EVTA 3VH3A 3GLFA 1P2UA 2WMYA 4LHYA 4UHHA 3TOZA 5B2FA 2D1YA 4HTFB 3RYHA 3VBEA 2I6QA 3RU2A 5IYZF 3H5AA 4CQNA 1Y5IA 4FFVA 1CDZA 2JFGA 1WSBA 3QI2A 5IDVA 2ONKA 3BD6A 4C3ZA 1ISPA 2C03A 3W5JA 2VXBA 1K06A 3GLVA 3GH1A 5CT5A 3USES 4BZWA 1UBLS 2ZUEA 1P62B 1HLGA 2A3NA 3B1VA 4JMPA 1Q0TA 5HKBA 2HT1A 3R6GA 1UH5A 3WGHA 1S4MA 1HMYA 3NHWA 3FPCA 1DV2A 2GM4A 4UAGA 2QN1A 3A2MA 4MUXA 2AG8A 3P5SA 4BGUA 4W9MC 3LDGA 3O4HA 3ETEA 1NC3A 1QV6A 3BICA 3P2OA 4RKQA 1BW9A 2V03A 4BNNA 5IF3A 2FG5A 2JFXA 3KVVA 3E9DA 5F5NA 4DNOA 3RWOA 1G5TA 1XK6A 2BHSA 4DABA 4EBBA 5ITWA 1CZOA 2BGLA 3AL3A 3DBRB 4TL6A 4Z6KA 1U0JA 3DW1X 3KZ1E 4BKPA 4RTSA 2R62A 4ZIRB 1XKQA 1EFAA 3VYWA 2R79A 2X1LA 2C2KA 1L4HA 3K0FA 1DKQA 4FZ3A 4CCYA 2ZZKA 1KU6A 5ALOA 1GN8A 2V45A 2FW7A 2BD0A 1P17A 4MV8A 1W34A 5I9TA 5FPHA 4CV1A 1EE9A 2BI8A 4UM5A 1E3SA 2AK2A 1W47A 2C2OA 2JAOA 5BN5A 1VKOA 3UAXA 1FJGB 2J3EA 5JWOA 5LQJA 3C3AA 3LDAA 1L5WA 3G2OA 5AI9A 1JG1A 4H1UA 2COKA 3OX1A 5CDSA 4RMHA 1KI4A 1U2ZA 2J9XB 2WG1A 4G41A 3RIEA 2PMWB 3ZGOA 1H1TA 2ZIUB 3B2NA 3L4SO 4RQBA 4QM6A 1KO1A 4F1WA 4O59O 2YHUA 3BIOA 3G1TA 3HA3A 3GPCA 1BJRE 1MG0A 1ULSA 1VLHA 3NS7A 1P1FA 3OIGA 1TGYA 1KETA 3V1NA 4ZN6A 8GPBA 4BAUA 5AVQA 3O8CA 3V4SA 4X7BA 1TTTA 3UM9A 3H2GA 3A10A 2WF7A 3LVBA 3WFJA 4YRAA 3QVXA 1J4AA 5HKKA 5K0SA 4MKXA 5ENVA 2RGYA 5IUKC 5SY4A 1PHPA 1KWGA 4J0CA 4XWYA 2NSJA 3P9KA 3F73A 4YI5A 4RMGA 1MAVA 3X1XA 5KVVA 5LQRA 2HJ9A 1IB6A 1CC1S 3HVJA 1UXIA 3ZY4A 2GM3A 4TMXA 5ALXA 5AVVA 4TZ6A 4FYYA 1AQ6A 2P3QA 2M6LA 1E1RA 1P60A 3DBLA 3FNIA 5LA6B 3WLRA 2Q21A 5KAMA 2I3AA 2PS1A 3OOSA 4LXGA 3URMA 3CLVA 1MZPA 1BA2A 4R8KA 4YP5A 2YVQA 2O5CA 1XZIA 4ASUA 3ZGLA 2GCOB 3K2IA 3WLMA 1BTOA 4MQMA 5C34B 4UDYX 1EINA 2W2XA 2FPGB 2W48A 4Y2XA 1QRUA 2WIGA 3G6KA 4GPBA 4U7GA 3TLGA 1KJYA 2O2YA 3S70A 1NLYA 1GLVA 1N1MA 3PUKA 3WYCA 4DCJA 2C7RA 3JWPA 1D7OA 3CLUD 1H1DA 3EMBA 3IDAA 3TLMA 2RHTA 3FCCA 4BO1A 2DBRA 3QI7A 4HRYA 1PYOA 1JEDA 3MELA 4OKNA 4L5JA 4U6SA 3UBMA 1YL5A 4ZCTA 1MB9A 1VKHA 3KU1A 3MWJA 1NVTA 1YZHA 4EKNB 4HNAA 3TO5A 3HMQA 3HCEA 3C3CA 1E5DA 5H82A 1SWWA 3N2ZB 3IEUA 1ABEA 4R68A 5K0FA 2JZCA 5KYXA 3CR3C 3V97A 2I55A 4IIGA 4LMBA 5FFMA 1RMQA 1TEXA 1P0MA 2OV4A 3CKMA 4C04A 3P9XA 4CL3A 2Y0PA 3MGGA 1TUGA 5JXJA 5JYCA 4OJYA 4DA6A 2NO7A 1JG2A 1OLUA 1FS6A 1T3HA 2P69A 3DSRA 3FCYA 3BJEA 1HG0A 3QLVA 4LOAA 3TSWA 4UNPA 3T0IA 5BNWA 1BQ3A 2Z98A 5F9MA 5DTQA 4CG2A 2NU9A 1T3ZA 3DAGA 4ODIA 4EK9A 2J9FB 1GZ3A 1FYFA 2UVPA 5C4IA 2K2WA 3G5TA 4RPGA 1FSPA 2PVCA 2X15A 3NUGA 4JI4B 1V0JA 1G21E 1L5RA 2V6IA 4WBXC 5GGYA 5EMKA 3FRIA 1R27A 3SI7A 4PBTA 2YYSA 3QVWA 1DMSA 3WYGA 2P68A 2OBMA 3RT1A 3ZXSA 1C1DB 3RRXA 3ESYA 3PYMA 4RZHA 4YRCA 3UHOA 5BR8B 3IPCA 4Q4LA 3AUAA 1XRMA 2VIIA 3MRVA 2G8NA 4Y0AA 4EWLA 2YZMA 4N4AA 1XTTA 4L02A 1B74A 4F7DA 3EQZA 3THOA 1LNZA 3AVOA 1G8GA 4M1OA 1EWYA 4QUJA 4PLPA 4MV3A 4UVGA 5F1PA 5CYGA 4QOIA 1FTSA 1ULTA 5AI8A 5EZYF 1T1SA 3WL7A 4OHPA 1DG3A 1A5ZA 4GUDA 3HLYA 3FM9A 5FFNA 1TF2A 1Z9BA 2E37A 4XUGB 5A4IS 1GSHA 3ETLA 4BMVA 1J1IA 4MHOA 4Q4JB 1RXYA 4FDTA 5E0KB 2EGGA 1E0DA 5BSRA 1OOEA 3T3MB 1VLJA 5KU1A 2QR2A 3GP3A 4V0SA 3OM0A 4ITUA 3QV2A 3LGAA 3OQVA 3C7AA 2QRVA 3F6YA 4BQNA 4B4KA 1ZVVA 3MD0A 1E69A 4XQ9A 3P8ZA 3U3RA 3VOBA 4TSFD 4G5OA 3OOJA 1JPVA 3H97A 1X7XB 5IAKA 1OB2A 2YR0A 1PW7A 1PZMA 1F17A 3WK8A 1VCOA 4HDAA 3IDOA 3PTZA 3LRPA 5CM2Z 4DWOA 5JQGB 4C7OA 2I67A 1YNSA 1SCBA 1YJ8A 3AY3A 4LRTB 4OBBA 3B6IA 3EVNA 3QXSA 3LPMA 2J6CA 2NZ2A 1JEJA 1WUHS 1WXIA 1KYQA 3ZDBA 3BBPA 3UFXA 1JQBA 4QEZA 3RC1A 4BB6A 3KT6A 1Z0AA 3FUUA 3ADDA 4C05A 1ZNQO 2IVFA 1KBZA 2MTBA 5L95A 5B1HA 2H1IA 1K97A 5SYNA 4DJFC 2OPHA 5BQOA 1ESDA 2GBIA 3R20A 4QUAA 5KNBD 2OPBA 1G0OA 1V6AA 3ODGA 1RIFA 3O83A 4Q1CA 1CQPA 4XSHA 4YMUA 1BMDA 5BY2A 3L79A 1H0RA 1JDTA 3L77A 2VP2A 2JS7A 1VSBA 2ZYVX 3MSCA 1S2MA 4IF4A 3H9JA 4G85A 1X2EA 1DWOA 5DN6D 3F98A 4CMCA 2EWMA 2OHOA 4RZIA 3JQFC 1ISHA 3SFZA 1ZESA 3BZBA 4WCDA 1ZM4A 5L4SA 5ICEA 1YR1A 2ZVDA 3FVTA 4BX9A 5CHYA 3TTVA 6CHYA 3T5PA 4G9GA 3TIVA 3QQPA 3VC7A 4TQUS 1QTNA 2WZQA 1OBHA 1PSWA 1HDRA 3D3QA 2OHFA 1DBVO 1W1IA 2C9DA 1TZCA 2WW8A 5BO5A 3ES9A 1RZRA 4CHGA 1ZGHA 2QE7D 3LCJA 2F1HA 1P7PA 4ZYLA 4YGYA 2EP5A 4UE3S 2DRIA 2CJXA 1Q3HA 4R8RA 2GAFA 1K1EA 2QU7A 2C8KA 2ZIZA 3C6QA 3F6EX 3TTUA 4EEKA 5HR5A 1EA5A 1F3OA 4UNSA 3PB3A 4E2FA 2ZXEA 2WIFA 4MI3A 1EUCA 5DBOA 4EVRA 4JB8A 3UO8B 4WQMA 1C2YA 3BG5A 4KYTA 4TYPA 4V38A 3MJCA 5E2IA 4D82A 5KOJB 3DGFC 2QQGA 3B89A 5K45A 2FZ4A 1Y6GA 2MSWA 2WLSA 4PC6A 2HF8A 3TIIA 5EJAA 3GJYA 1Z0DA 3BQ9A 3EGVA 3WB1A 1E2GA 2P62A 5EG5A 3BC1A 3PJDA 4PQEA 4EUHA 1IZ9A 4UBLA 1CSEE 3TSCA 4AIRA 5JCXA 5JH7B 3DAHA 3TDNA 3VOTA 4CTJA 1LNSA 5K2MA 1YGYA 5JZVA 1X92A 3U48A 4I81A 1FNDA 5HK8A 1W5TA 4ZK6A 3EDMA 4A27A 4DYDA 2NVOA 3O3NB 4RANA 3GHHA 4WKOA 4ZT2A 2IBSA 5CITA 1H22A 1W9MA 3BXHA 2HF7A 5HSGA 2QVCA 3QBEA 4R98A 5ALEA 1KAGA 1M6WA 3ND5A 1ILWA 1P1HA 1VCIA 4YRZA 4PFKA 1W76A 1Z4LA 3VSBA 1IQUA 3D43A 5LP6A 1JWLA 4QATA 5L3QA 3A1DA 2QN6A 1YKFA 3WS7A 3JW8A 1U9YA 2FP4A 1VI5A 2YHSA 1N3YA 4ZU6X 5LR6A 1RJFA 4H08A 3UCFA 1JHRA 1XA4A 4Q4HA 4R9VA 2O06A 3TIXB 1JAZA 3IT2A 4NICA 4EVIA 3NTRA 1MA0A 4AJ4A 5KJ1A 5LOVA 3UJBA 4NDZA 2VTBB 4M99A 3W9BA 1IOWA 4FR5A 4Z7QB 1KEWA 2H4XA 3MPUA 2Y8EA 2NVWA 2J0UB 1PBTA 1DS6A 4OXQA 2X6RA 3UTDA 5EKUA 5DLPA 3GFBA 4LC0A 1MENA 3O3OB 4G07A 3BQNB 3DDNA 4CF3A 2FFAA 1CQXA 1NONA 4U3JB 4TLAA 4AJEA 2ZWPA 5AKKA 1E66A 3PKZA 2ZYSA 1Q20A 3F5MA 1LI4A 1YKGA 3G9QA 3AI2A 3ESCA 1OQAA 4RZSA 4B85A 5BNZA 4ZRDA 4PYIA 2DC1A 4YVFA 5A5DA 3KYCB 3MFQA 2WZBA 1X0VA 4L8LA 5DO9A 2QUIA 1EZZA 4Z9FA 1ZLYA 1Y4DE 4ZOQI 3N1UA 3AP1A 4IWNA 4P9NA 3BORA 1GYPA 5EE1A 3TB4A 1GIAA 4PO3X 1A4XA 1BKDR 3L6OO 3AF0A 4KW7A 4MLCA 1IOVA 1HYBA 4NCKA 1TEVA 3AYZB 4RGYA 1ESEA 4XGIA 4ZHQF 1SN7A 3AHGA 2HZ7A 3D1LA 5AIBA 4J0QA 1ZGBA 2IVZA 1I0LA 4P80A 4BFWA 2GSDA 2HV8A 3DV0B 3CUTA 5HK9A 4GL2A 3L6BA 2FSUA 2F3UA 4Q7LA 3C24A 2WSMA 3GGJA 4GNKA 1GITA 4JUFA 3FI0A 4RKYA 3NHRA 2HRBA 4KC0A 1IXZA 3B36A 3PPYA 3HKCA 5E9JA 1UBJS 1BEZA 2K7ZA 2ZBPA 4UM8B 1SC6A 3AR6A 2J3IA 3P4UA 1VLMA 3AESB 3KQNA 1GR1A 2NG1A 3E35A 3AJ8A 2YNMD 4Y3UA 2LCIA 4CFSA 4CVNA 2ZFUA 1RM0A 4N0EA 3ZEIA 1JAXA 2RH9B 3IA7A 2HR1A 4X60A 5E7IA 5B64A 5BW8A 5C8XA 4CV2A 3PPVA 1MD9A 2O3SA 4FHZA 3E4CA 2RHMA 1L5GB 3NWEA 1YC5A 2Q6TA 3C4JA 5IFLA 1VJ0A 1K8YB 3LW7A 3BPSA 2IODA 4NDNE 4TXMA 4F9TA 1Z5VA 1ISSA 4ZAWA 5LYJB 1KZHA 2AWOA 3H9GA 1A9RA 5JEEA 3GCZA 5SZKB 1IVNA 3AR3A 3DD1A 4ENSA 4IGAA 2HNBA 3Q12A 3UMBA 2QYTA 3RRYA 2QUKA 2VNIA 4TN1A 4B7XA 1X15A 3DDWA 2CLCX 4XB2A 4DZTA 5FBWB 7MDHA 1GDHA 1T25A 3BKXA 1ZU5A 3DAYA 4Z9AA 1RC8A 4G8BA 3UV6A 3D4IA 9ATCA 4Q05A 1TL7C 2WF5A 4JR2A 4WGFA 1JZSA 4DSOA 3GRUA 2O3RA 2WSYB 1NFFA 4UVHA 2NO0A 3N0RA 1NVUQ 3T3NA 2D8MA 2FJUA 1DX9A 3FNFA 2X23A 3VYSB 5FA5A 4GD3Q 5K8UA 2IOFK 3G2KA 2YXEA 2FG7C 1DI0A 1OIVA 1PQYA 2BMDA 2QPTA 2OCBA 4U2GA 4OI4A 2CYAA 3CUUA 4ZQFA 4BV2A 4CKCB 4JKYA 4PU0A 5HQJA 2ILVA 5K3EA 2HHAA 1C1HA 1MCZA 3O8QB 1ESNA 4PLFA 5CTJA 1KS2A 4OO3A 2IZ6A 3DEHA 1I7QB 3NVDA 2FSIA 3OTGA 2CL6X 3Q87B 1R4NB 3U3OA 4C0BA 4D7AA 4DGSA 3L4KA 3ORQA 1BJKA 1O4VA 1MW9X 3AWDA 2FLVA 4Z7NB 1A7JA 1ZD8A 3EF3A 2CFOA 2OO7A 2HA0A 3N3AC 3NHZA 4NCIA 5FQOA 2G9RA 3ZBTA 4IZ6A 5FD8A 5LPNA 3MGCA 3AZOA 4C7MA 3UNXA 2UZAA 2YTZA 3O0DA 3B3JA 3BYZA 1YMUA 2WKSA 4EABA 4F2WA 2HK6A 4XI9A 5LDHA 2AQIA 2E6UX 4EOGA 3FYCA 4WCFA 1LLFA 5IG2A 1Z4MA 1VB3A 3D54D 1WF3A 3JATB 3IMKA 3B9QA 4I9GA 1IPFA 2YS6A 2GM5A 1AKQA 3KOYA 5F5XA 3AUYA 5GVRA 3SSNA 1Y7IA 4A10A 4MCJA 3NP9A 4JP5A 3KOWA 5TPWA 5DI3A 2HJGA 4JI3B 5ETJA 2IYTA 4IVPA 4A2PA 1ML4A 1W0KD 3MUOA 1QH1A 2KLBA 4YB8A 3FKJA 3F78A 3AF1A 1WHTA 3DOUA 5BN4B 4F8EA 2ATXA 3U62A 2IV3A 2PAFA 1UMCA 4N65A 3HB7A 5EP4A 2WQ7A 1X7GA 2EFEB 1R5OA 3GT3A 3RSHA 2ZVPX 1SKBA 2H00A 2BMWA 4RTQA 4ZZ0A 1I24A 1SM4A 2VAPA 3OJXA 3PGMA 4EY6A 2Z2IA 3F96A 4OFWA 1R4MB 1ODCA 5TXGA 3U7FB 2XXAB 4DLAA 1PX0A 1MOZA 2AFHA 4AMVA 2HPAA 5EXSA 3CURA 3CR8A 4K6GA 1ZD4A 2Y1XA 4FFSA 2WK1A 3CCCA 4R2HA 3W6OA 4L4RA 1ST3A 2RAPA 2ZCJA 2ZXFA 5JD6A 2NU6A 3OQOA 4ZYTA 1G42A 2Z83A 4WNCA 4NNJA 5JE8A 3RJ5A 4JB3A 5KYTA 2VHVA 5DNEA 4V39A 2H1WA 2E4VA 3AZPA 3F6RA 1KJZA 2ZSEA 2HTEA 1YF3A 3ILXA 1U28A 1TLTA 2ZBUA 3FYUA 3R0ZA 1IYZA 4QUHA 5M34A 3DH0A 1YQTA 3EXEB 4B3HA 1V16A 2FLWA 3PFBA 4PN7A 4ZZIA 4AMBA 1KEEB 1ZUNB 1H2ZA 2CLIB 4M1MA 1NVWQ 2WPDA 4AROA 4ENUA 5ALDA 2Q9BA 3P2KA 4AQ7A 1CJSA 3AEQB 4RHUA 3AUUA 2WM8A 4P82A 4H59A 5IM4A 4KWHA 5BN3A 4XZ3A 1Z6XA 2ZKLA 2A4KA 2HWWA 1NIJA 2WIKA 4OHCA 3C7TA 1AE1A 3EH2A 2WTAA 2E87A 3Q4GA 5EWLB 4G4SP 4B3JA 4ER3A 1OX5A 1ISFA 2WIDA 4OY3A 3WJ1A 4M7RA 1KXJA 3UCEA 4JLVA 2YCLA 1POXA 4RDCA 4PVCA 1TT5B 1U1GA 3CEMA 4XQGA 5CRIA 4F9GA 3W5AA 1YRLA 1TZJA 3M6IA 2GASA 1ETHA 4L72A 1DWUA 2WT4A 1AG9A 3K9BA 3LWZA 3EUEA 3GT4A 4W5JA 5FOTA 5FWXA 1S1MA 4QXQA 1E92A 3GVPA 2EC5A 1YQQA 3BXOA 3RGGA 4F45A 4G24A 4KXYA 3W5UA 2GZRA 1Y3BE 3AUFA 4GLOA 4AIIA 4C4RA 1KVSA 1P3Y1 1OAOC 2HMWA 4HB0A 4M9UA 4NEGA 5BXQC 1YB2A 2OA0A 1QYIA 1UXKA 3V8PA 1U6JA 2PEYA 4NV0A 5FPSA 4BQFA 2FHSA 4TUYB 4CM4A 2JIBA 4NKRA 4YV1A 2BFDB 2ZRCA 3KZXA 4XFKA 1RPJA 1I0IA 4LGCA 3AVVA 4YJFA 1EHYA 3GLTA 3ASZA 3G2JA 3N86A 5EZQA 4JZKA 2AMVA 2G4LA 4NYIQ 1J23A 4V0ME 1I6LA 4WY5A 5GADl 4MPTA 3A3NA 1Q6ZA 2WYIA 3TZHA 3FDXA 2WJ4A 1MV8A 3TM4A 4BNUA 5TDHA 1C3EA 1KC3A 1WW3A 1KOLA 3MLEA 1DAEA 2QDXA 1UPTA 1N6RA 3I76A 3P9PA 3EVEA 4EFKA 5AW4A 3I9V6 3IJ5A 5EJIA 4Y2UA 1E94E 1P7CA 1SUCA 3TRKA 5GTDA 2KJQA 4EUEA 3HCDA 4I1OA 3AF6A 2P9ZA 3L4BA 4GVPA 1G6KA 4ARZB 2J5QA 3CH7A 1I7SB 4JI6B 3F5SA 4FDLA 4D56A 5C2JB 1M7GA 1U0FA 1GVHA 2XKBA 2VAVA 1TFUA 4PCUA 3DMDA 3WLHA 3FF4A 3TE6A 4MGIR 1KO7A 2LIVA 4LY0A 3O3MB 3PL1A 1GTRA 4GGOA 4E15A 4E7OA 1UADA 1H69A 2FW0A 2BFFA 3F6BX 1TA4A 3T1YB 1ZC4A 3WL5A 3COPA 1HDIA 4BQPA 3TJMA 4MLPA 4O0LA 4FSDA 3LLCA 4AVYA 4EX7A 2Q8NA 2FU5C 1JA1A 3TFOA 2QRUA 4MA4A 1OREA 2P4UA 1PTJA 2OCAA 1QYRA 2I6TA 2PCJA 4UEKA 4B6PA 1EZ1A 2YINC 4UM7A 2VHWA 1JQLB 3OPXA 4E0BA 4Q3CA 1PT8A 4MVJE 1ZIYA 3MT7A 2VLIA 3ZDDA 1C7QA 2OZEA 3AXSA 4Q9LA 3SS9X 2P4EA 2J3QA 1P19A 3O93A 2IV7A 1Y63A 2AA3A 5A9RA 1UZLA 4HFNA 3TZLA 4E22A 2Q3LA 3MWDA 3CKKA 4M1ZA 4JV5B 1TF5A 2MT9A 2C59A 4PS0A 1YT5A 1T6XA 3L0BA 2FNAA 4R1MA 3G82C 3JVEA 4HRAA 5C1IA 4CDMA 4DIMA 4EM6A 1SXQA 1PFQA 4LWZA 4XPZA 2Y05A 2P9JA 5TMEA 4BE4A 3L43A 4B2PA 2OXTA 3SJBA 4IIJB 1DFIA 4X84A 1KYVA 1T1IA 2BTOA 2O8VA 3KJHA 3DLTA 2W2KB 3LKZA 2XMBA 3NNNA 3KE9A 3LY7A 4XDGA 4YTEA 2G5PA 4G8DA 4BMYA 3U4HA 3U09A 2XWPA 3N28A 3KOXA 3GBSA 4RVFA 1ZCZA 1KIFA 3LECA 4NXMB 3DVLA 2FUEA 4B8WA 1CR4A 2R0QC 5BYBA 3GQVA 1X1DA 5K0NA 4D9MA 1F06A 2QUZA 3V6LA 5T7BA 4GW3A 5JPDA 5DOZA 1ODSA 4EGQA 1N0UA 2GDJA 3IHWA 3IJRA 1N4AA 5TLSA 3GT0A 1XSEA 3DE7X 3VZRA 1CB0A 1QU3A 1VPDA 2HU7A 2WF6A 3BMXA 4ZWNA 1XMSA 5KNLA 1HDGO 1EFCA 5FTNA 3MCWA 3PGKA 3WGVA 1N2CE 4W6QA 4FR2A 2R5NA 3IP3A 4A3SA 4ZCRA 1IN8A 1W88A 1QIEA 3NPAA 4BYMA 3HBFA 2H9AA 4MR8A 1UJBA 2PQ2A 3QWHA 5SZIA 1NYRA 2GJ9A 1YZLA 1PS9A 2GVDC 4YRJA 1PR4A 1TQ2A 2MYTA 1I51A 3KLBA 3KQLA 2J7PD 4KWTA 1USKA 3EULA 4FYPA 4D1YA 2EXXA 2DPGA 1JJVA 3R0XA 1ZW1A 4FINA 3SD7A 5M04A 1TXGA 2NUTB 2VJBA 4EY5A 3JY6A 3LX8A 4LXUA 1HOXA 1R12A 2B35A 4IEEA 3JAMA 2ZZNA 1PFVA 1PRYA 5A6SB 1SKAA 3IHTA 1UZAA 3MINB 2N0SA 4ER7A 4PYMA 1ZM3A 2XQIA 4YUYA 2KM1A 4HNGA 4BZPA 3U4MA 3L1HA 4YS6A 4C6TB 4C5AA 3MBOA 3CH5A 2F3TA 3MGKA 1OUMA 3B9BA 4GWGA 2ERXA 5LKAA 2VOJA 3FMFA 4O2AA 4BNDA 1FB5A 4YJ2A 1P2VA 2V5VA 4YV0A 4QT0A 1NXTA 2X5XA 3BMOB 4GZ3A 3I4LA 1GPYA 4AECA 5H1YA 4C5CA 3EDQA 1XZHA 2AFIA 1ZL2A 3AFIA 4QPJC 5DHRA 5DHTA 5AK3A 1XXHE 4U2FA 1ONNA 4ESHA 4QGFA 2DPYA 3WXMA 1W96A 4AXBA 3PNBA 4J7UA 1E62A 1RLTA 2VYCA 3RYFB 1C9DB 3BXGA 3ZK9A 4GLBA 2J33A 2DUJA 3PYLA 2NNWB 1SC9A 4E2WA 1IZZA 2VXCA 1HF3A 4AF6A 2ST1A 1UKAA 4TWJA 2O2GA 3C1AA 2LNDA 1EUQA 2FUG1 4GOND 1WB4A 1EBBA 3U1BA 3QPWA 3ILSA 1LDNA 1N9ZA 2SCUA 1RLMA 1Y80A 4B3TB 4O25A 3KQSA 1UXGA 4LG1A 2QZJA 1AHHA 4WBNB 5REQA 1EJ6A 4UHBA 4W8GA 5JZOA 1CE8B 5FR1A 4H7HA 3LP8A 2VF7A 3VDXA 1HR0B 1Z0KA 3V8QA 1PSDA 5AO9A 1JIXA 4F56A 5ARCA 2FQ1A 4ZEOA 4YJGA 2JCVA 3RBXA 3WRYA 1G8HA 4DC0A 3ZV3A 1C9EA 1W8DA 4BIMA 3E23A 1T9BA 4FFDA 5L3SA 2OCKA 1II8A 1WHSB 1CQZA 5H5JA 3RK4A 4WUVA 3TKAA 4LDJA 2O20A 2WTXA 1CD5A 4MW2A 4RF4A 1F8FA 3PNMA 4RJLA 5DGHA 1AK1A 3B5EA 5CGQB 3QPAA 1NW4A 3FBTA 3JAKB 4R05A 221PA 3JPWA 3U7IA 4AJIA 1OU4A 4LW8A 2O8DA 5BSMA 2HBZA 1FFHA 4JLMA 1KKUA 1QBKC 4HDSB 3UYKA 1H6BA 3OJEA 4WESA 2RAUA 5EKDA 4IWXA 2EDAA 1A2QA 2H0AA 4UU8A 3WYEA 3AFMA 4KYIB 1LEHA 2ZWIA 2WNHA 4C78A 4CT0A 1EA7A 3KEOA 3TZCA 2HCBA 2IKSA 2XAAA 4PFJA 2QGFA 2V98A 3ZE9A 4YCMA 4B3GA 5LUBA 1F9EA 2FFJA 5C1DA 1K4MA 2SKDA 3L0DA 4ZZ3A 4KWEA 5ARDA 4X1YB 1E3LA 4Y7CA 2GETA 3S5JA 3ZDYB 1ULHA 4HWOA 4URVR 4NFSA 4ZI7A 1MHPA 3ORFA 2CNWA 1JKFA 3Q9SA 5AD1A 1T0HB 3HJTA 1W6UA 2XB8A 3PPXA 3AVXA 1M2HA 3L6CA 5B7GA 3X2FA 2B1QA 4CHTA 2Q1YA 1U0EA 2E18A 4LTNA 3W4KA 3UAWA 3COZA 3EFEA 3GB9A 3VGPA 2I2AA 1LQTA 4YYZA 4TMKA 3TIFA 1V3QE 3KCQA 4FNOA 3X44A 4ZKEA 4D81A 5A4AA 5CFNA 4IL5A 1CYDA 2JA2A 5CM9C 5DGXA 4W9NC 1F4PA 3T7SA 3L7JA 1AS3A 1GTVA 1JR4A 3U2QA 3NT5A 4OATA 1F3LA 3TGPA 3OP4A 4MCIA 1CIVA 1SXPA 2ZW9A 1YAJA 3Q5DA 2G5GX 4US1R 3LBNA 4E4YA 4JOSA 3ETHA 1AD2A 2H2DA 3BCRA 4KUGA 3ZJ5A 2I2FA 1II0A 2NPFA 1U3TA 3G8CA 2ILTA 3MS2A 1ISIA 2HDOA 3B1KA 4X9XA 4ZXFA 1Y48E 2GN1A 2NP6A 1U9IA 3IURA 3AM4A 3K15A 2JGAA 1Y5LA 2JNWA 1RCFA 2RKWA 1Q95A 3EW9A 3OFKA 1B76A 1KEPA 4KR0A 2WM9B 3O8DA 4TS3A 1TZKA 4E33A 4JLUA 3ROEA 2FWJA 4Q03A 1TCVA 2QOEA 3BK1A 2Y66A 4QULA 1E0SA 1U0RA 2I80A 1BS1A 5IHPA 1SZJG 4WVLA 5K09A 5A0TA 1GGKA 5BSVA 3WVNA 1KS9A 3KS9A 4MWDA 1C4WA 3CNOA 3KAJA 1X77A 3CUYA 1ZW6A 2H7VA 2YHIB 3I5UA 4UEWA 5IVHA 3RC2A 3IKMB 4QFCA 3P0IA 1NXOA 1P0QA 4QYWA 4XVQA 4BQQA 5DDIP 1U94A 2G8LA 2JIZA 5CA1A 1XHFA 4W4TA 1KTVA 3LC1O 3TEMA 4HWTA 1U0LA 3ZVMA 4AURA 1AZWA 3T8YA 2DUNA 4P3XA 2QVZX 4P4GA 4IIHA 1W5SA 4MB0A 4EFDA 5JZ9A 2PANA 2MSKA 1YR6A 4YBRA 1RXEA 2PWPA 3BX1A 5TV2A 3SDSA 1T34A 2HLPA 3ZD8A 1MEOA 1E79D 2RK3A 5SYMA 1XFDA 2F7SA 2W71A 3HV0A 3JQ7A 2YFYA 4JJ6A 4QO8A 2CDAA 1G291 1VG9B 3CNQS 1QLJA 1ZM7A 2O2ZA 3H9UA 4M9CA 1KZ9A 4O4LF 2PZ8A 4OK5A 1D5WA 1EK1A 3FWZA 2MCFA 3PFFA 1YBVA 2WJGA 2JJ1D 3OQBA 2BISA 5HFNA 2C97A 3S1AA 2WFMA 3EPJA 3K31A 1JFSA 1PNTA 3ZV4A 2B7CA 3EDYA 3WBJA 4WN9B 4HSGA 1OLXA 3AF5A 1SCUA 4RVDA 5CNKA 5A4DA 3OOYA 2NTEA 5J2TF 2OXRA 2YYAA 1QO9A 3GLSA 4OUKX 4LXXA 2C2WA 1T5BA 1VJDA 3O4IA 5H9VA 2I33A 1HTWA 1ONBA 3BEOA 1VCNA 3ENQA 4GUAA 1GZHB 1UBMS 2VTDA 4J91A 4Q1FA 2IV2X 4YMGA 4HQOA 3TTXA 5BXYA 2DEUA 3IVAA 1I80A 4OB6A 5IC4A 2JAHA 4F6CA 3THYA 3QXGA 4YT5A 4ARUA 1PJLA 1M0TA 3T4EA 3VKWA 4CQLB 1NMEA 1QE0A 4X24A 5IMBA 4DDWA 1E5QA 4RA9A 2O48X 5IHXA 3SKYA 1PDVA 1YA4A 3KUUA 2FSHA 3GAFA 3JD3A 3PCTA 2IHTA 5H16A 3WGTA 2C3UA 2Z5GA 5HOQA 1DXHA 1QGUB 1COWD 1YH3A 4AQDA 1NBIA 3LPDA 4RHYA 2CE2X 2C5FA 1O0CA 5DX8A 4GZMA 1PYGA 4XFJA 4JBHA 1NVXQ 1YRYE 2HF2A 2JRCA 3E05A 3R5SA 5DI9A 1SVOA 2R00C 1PJCA 4F3KA 3PNPA 1A97A 1L5ZA 1Q7RA 1T9DA 4ZQHA 5FT9A 1I30A 1SQFA 5J23A 5FADA 2W4QA 2IXDA 4PRZA 3C5HA 3IUNA 2Z2XA 5BV0A 4P58A 4WFIA 5JECA 2E4UA 2CJYA 2VJCA 3B1XA 3R3SA 4DA7A 1AHNA 4EKGA 5A03A 4HN2A 3E7XA 3HSKA 3OZAA 3UB2A 2AR9A 1JIKA 1QAMA 2RHHA 3VPHA 1SIWA 5JNTA 1Z18A 3DT6A 3AR4A 4HMQA 4NENA 1Y8QA 1QBGA 1PT6A 1E9CA 2DKFA 3MJEA 5JCJD 4UOZA 1GO2A 5ELXA 3B9RA 3L8EA 1C3VA 3KM0A 3REQA 2PZKA 1JDJA 3C6MA 1FP7A 3UT0A 1UC8A 3MTQA 1XYVA 1H6DA 5EMHA 2HT6A 3UG7A 2PBRA 4HX5A 4UUOA 5T3UA 1R0YA 1Z26A 5GOTA 1YB5A 4FNMA 1RHRA 2D54A 4LRXA 2I03A 3D6HA 2DOKA 4YRGA 1P5HA 2ZAOA 3TMYA 3W2FA 2FUNB 5HRCA 1DKMA 1HKHA 4LKOA 1EP3B 1YFJA 3KSZO 4J3NA 4NBVA 2DR0A 4J3JA 4K1XA 4XYBA 1VM6A 5K0JA 1E7WA 3SZGA 1U0BB 1DUVG 4RAOA 3WL3A 4FSHA 4OAPA 3RHZA 2R1UA 4FOTA 3L6EA 3NBMA 2X3YA 1PQPA 1K7FB 3KT0A 3TVDA 1N9GA 2ZJBA 1XTPA 3BK7A 1XMOB 2O8EB 4R2WA 3UAGA 1TZMA 3NWJA 3U5ZB 5ICGA 1YQGA 1DBWA 2W70A 1FZTA 4ITRC 2J1LA 2IP2A 1EXWA 2B5WA 2MR6A 2FSVC 2TMKA 5J4LA 2XKKA 1K92A 1RI3A 3JQFA 1VHWA 2R8EA 1FFAA 4DR2B 3D7RA 2W2TA 3PE3A 4RKFA 1MJHA 2BW0A 4TYQA 2HMTA 3KSUA 5E6SB 3RSCA 1L7QA 5CXQA 1GAXA 3KD2A 3ZE2B 3ONWA 1L4YA 3CIOA 3G89A 4K9RA 3FDJA 5JNSA 1KO8A 1MNAA 3NETA 4CMKA 4F92B 1TQHA 4K9DA 3M4YA 2C82A 2H4WA 5TGTA 1JE1A 3AFNA 3VR5H 3BWXA 5DNVA 1IWBB 3TNFA 5DM0A 4A26A 2YJ5A 3HR7A 1L4BA 4YHBA 3PL5A 5L6MB 1KA9H 1WXEA 1CVLA 1W5BA 2AYXA 4IDFA 4NBNA 1NNI1 2IRWA 5COQA 2XCTB 1PQWA 3PJEA 4GI3A 3O7MA 4KXQA 1ZZGA 1TK9A 2VLBA 3BIJA 2XCQA 3FMPB 4B3IA 2CC2A 1J2UA 1VFNA 1GL6A 4MPDA 3MXTA 2CNLA 4PYNA 2XTMA 2ZJYA 1E4OA 4RD4A 2PGNA 1K0UA 3AT1A 4CM7A 2IYQA 4ZV9A 3GVCA 4IOJA 1WMEA 3HCBA 1AHIA 4UCWA 3B85A 1AKRA 1UWKA 1IY9A 1E2JA 1C0LA 1EH5A 3GN2A 2BFMA 4KEAA 5CVCA 3WMFA 2KBFA 1GZUA 2X0JA 4ZVTA 1RT9A 4QYMA 3W6NA 3I04M 1M7BA 3GO4A 1K9SA 3E1KA 3O9ZA 3OJOA 4MNTA 2ZUCA 4E46A 2FZEA 4YJDA 3I53A 1AURA 1L5VA 2RD2A 3RAFC 4NV1A 3TOVA 1HX7A 4DG5A 4KDFA 4PHFA 2RSLA 1O95C 2IIBA 3DYVA 3O7WA 4HLQB 1M6NA 1FDTA 3KWJA 3VR5D 3F1LA 3O2JA 3HACA 3K09A 3T7EA 1B6TA 2BAGA 2ZEJA 2BEUA 4A15A 3IV6A 4IP0A 4CM5A 2XUGA 4FLEA 5TGZA 1DAMA 3DGEC 3LWNA 1RYNA 1K8QA 3IVMA 3HGMA 4RK1A 5KDLA 3PGVA 1ZBDA 3ONVA 1YAHA 2OXIA 1ZMOA 2XDAA 3EA4A 2GOYA 3EHEA 4JITA 3ISVA 1UMBA 4RGVA 3P0RA 1K75A 5DB4A 1WLYA 3ASVA 1R0ZA 4BLPA 3R2JA 3CPSA 4GDFA 2ATEA 1X3SA 2YFHA 1TE2A 2REQB 2PT7A 2Y1GA 2YVLA 4HB4A 4MRRA 4ZCSA 3W2EA 3QVVA 1UJ6A 4QQFA 4ZD6A 3C6ZA 5GM2A 1KI1A 3Q2OA 2I3DA 1CQIA 1N6HA 4JI2B 5EPEA 1H3FA 4L3OA 2DAPA 4II3A 3X1MA 4Y2TA 3RUDA 3ZWMA 2D7JA 1E3JA 1QKKA 1J22A 4ME6A 1FUEA 3IQWA 4W7HA 7MHTA 4YJ3B 1F2TB 4RD3A 4Y2RA 4ENRA 2WIAA 1SG9A 4M38A 3R4VA 5FUMA 3KFXA 3ZBPA 3GVXA 1JSXA 1TPZA 4I9NA 3QWIA 2W43A 4WRRA 5FHQA 3W8EA 3ABOB 2VDKB 3MWLA 4HAVA 1F60A 3Q98A 1DAOA 4Q3NA 4QYIA 5EWJB 3DWGA 2PKQP 3KU4A 4G5YA 5J40A 5AR1A 2Z3ZA 3R09A 4OM8A 3I9JA 3SC2A 4DZZA 1KQGA 4N49A 1RZUA 5E6RA 1A5BB 2H51A 1NR1A 2OORC 2Z3VA 4EVQA 1XDUA 3V1MA 4YAOA 3HJAA 2B5OA 3OU7A 4HQ6A 2FSPA 1SNYA 1E8MA 5LQDA 3P0EA 3IVCA 2G28A 3JYPA 1XZCA 4CTOA 3EF1A 2BLLA 3IUQA 5HF8A 1VE3A 4R3NA 4EFMA 4MXDA 1XF9A 1YUMA 2QENA 4RPJA 5DN6A 1B2RA 2BE9A 3EWSA 5KSPA 4MWTA 3P9IA 3OZCA 2F55A 1K89A 2YOGA 2CYBA 3L8FA 1MB3A 2AFVA 4POOA 4N5MA 2OLJA 4XXHA 3IEMA 2DKOA 3NTXA 2JLSA 2JLQA 3IT0A 1H8HD 2GCNA 4G0YA 3VQTA 2I6GA 1M2GA 2OOKA 1ZMTA 4OJTA 1X2BA 4U5QA 4IDCA 2JCBA 1KEKA 3VR1A 4DR6B 2PZAA 4BUJA 1FMFA 3AR7A 2I7DA 3SSAA 2Z6AA 2GPYA 2XLBA 1PK9A 5A4JA 4LOKA 1VIMA 2NPOA 3I2HA 2ZKIA 4X64B 3TNLA 4FCWA 4BHTA 2GXUA 4DV3B 2QE7A 4C20A 2O23A 4CG0A 3GJSA 2ANBA 2G72A 3GJ4A 1PZEA 1Y4ZA 3SX0A 3NDRA 1HORA 2HL6A 1PJ2A 2EF1A 3GR6A 5I7OA 1GFIA 4AZ0A 3KETA 2IHYA 1DV1A 4L6IA 1QPZA 4Y9TA 1MNQA 5ENZA 3DE4X 4DY6A 3X2SA 2J59A 4R9SA 4XJVA 3K1AA 5E6UB 3DMTA 3TPFA 1HPLA 2RBKA 4FN4A 4LX0A 3VR6A 3NC0C 2FEXA 2UYYA 1CY6A 1NGSA 1P75A 2ZU0C 5AUPB 1FFSA 2A7XA 4D25A 4Q1EA 1VLQA 3PRJA 1ESCA 1P44A 4MHSA 5IEBA 3ORHA 4R2LA 1UINA 1WLSA 3N75A 1FVXA 1VHTA 2E89A 4UMVA 1E1CB 3ZX5A 3TW8B 4U9UA 3PQ5A 5HTOA 4QGHA 2PGLA 1J8MF 2PNFA 5EE5B 1IQPA 2XCRB 3CG0A 5H83A 4MOWA 3L02A 4FD3A 1S8NA 5CT8A 4EGJA 2A5YB 2PMDA 2YVAA 1S2IA 1MQAA 4UC0A 3MA0A 1U04A 2E55A 2ID4A 2ES4A 1SQ0A 3ND6A 3F8SA 4MCAA 4JGGA 4LJ4A 2FWRA 5F73A 4PX9A 1FU7A 2IY9A 3W8FA 3ESRA 3HO8A 3VNVA 1OA1A 3QEMA 2OD7A 1JMKC 1Q1EA 2P78A 4MWCA 4DXDA 1DBIA 1VA4A 1YSCA 4FOPA 4YQZA 4MW7A 3V34A 3SBEA 4EPRA 2GZMA 5TIIA 5IJWA 4MEAA 4ZYZA 5I7EA 3AEYA 1GR0A 1ZKDA 5CR9A 2WT9A 4FQ8A 3PR3A 4K2HA 5KQRA 4TYNA 4J07A 1RCUA 5TC4A 3IA2A 4ALIA 3HFGA 4P1ZA 4MSUA 4AMUA 1QLWA 1UDXA 2AMYA 4DIUA 2D5AA 1SCAA 2BFBB 1X7YB 2D3WA 1J07A 2VYFA 2XV1A 1RWWA 4K6MA 1CUCA 1SWVA 2WE8A 2ZP1A 4W5QA 2R8ZA 3NTUA 1Q84A 4WDQA 4LVOA 4LF8B 2C92A 3HKBA 5AW5A 1D1PA 2J87A 2XEDA 4TXJA 1QOPB 3LK7A 3LZDA 4H1WA 2XVYA 1JMVA 2H7XA 2I4LA 2ZUBA 4Y2VA 4HX9A 5DTEA 5C7YA 3ZCSA 2H1CA 2A1TR 4EEZA 3ZPXA 2Y0CA 3WK5A 3H2IA 3UUFA 1PK7A 3NEJA 4MV1A 3PHGA 2R65A 3UKOA 2H2AA 2PXXA 4MARA 1NHWA 3NHUA 4U4AA 4H6VA 4PNHA 3W5BA 3DLPX 4BECA 3JQAA 2H0RA 5D85A 1EVLA 3FGZA 4RZ3A 2H3EA 4KRGA 4EA8A 2HWKA 1Q1QA 2PMCA 4CXMA 4RD0A 1FTYA 2OAGA 3PFHA 3FJOA 2YRFA 4YCNA 1QG6A 5KJFA 5LD2C 3RO7A 1T8TA 3PT9A 4OJMX 1EX9A 3LUJA 2BELA 4S35A 3HUUA 3IT1A 3LFHA 5HS6A 5JJKA 2ZUVA 3L0SA 1J20A 4U7WA 4HUTA 3BB4A 4LJKA 1J6UA 1ONOA 2G9UA 3N2GA 3OG9A 3WTBA 4M7WA 4B33A 4V02A 4ECEA 5DNAA 3QFTA 1L5HB 1E4YA 2XRFA 5F12A 1RZVA 4JOCA 5IASA 2Q5LA 1CUSA 3CNBA 2SNIE 3PEWA 1LK7A 3NOXA 1JIVA 2IYWA 4M9QA 3K5IA 3WB2A 4BN0A 4DKXA 4EPVA 3KBBA 4CKWA 3TRHA 1VLVA 1AA9A 3OEHD 4NCHA 3DFIA 2V6JA 2FZ5A 2L19A 2Q3JA 1QHNA 1WJGA 1W59A 3ZIUA 1RIIA 2YNMA 3KOMA 3ET4A 3GUHA 1ELOA 5LC1A 3VHXA 1ZRMA 2JBAB 2R7MA 1ZFNA 3IUEA 1T43A 3TKLA 3MD9A 3WY9A 4CM1A 5I6DA 3GY0A 3QJ5A 1HE1C 2GUGA 4MVWA 1ECBA 2RONA 3OQMA 1VL8A 2C94A 4OP3A 4JXJA 2AQ8A 5AWFC 2JZNA 1SD5A 3Q7QA 4KGVA 3IDQA 3K71B 5CX1A 5ADHA 5U4XA 4ZDWA 3DEIA 4FBMA 4DLPA 4EDHA 2D1FA 5IDXA 1ADBA 2BRUC 4MROA 3PF9A 4V0NA 1KL7A 3WLTA 3UMMA 3LTNC 5BP7A 1UDBA 1YQ9A 2P40A 5F1KA 1PAUA 1KYXA 2GNOA 2PUJA 3BMNB 3DQPA 4I1YA 2ZSFA 4ZAFA 3C3DA 2C00A 4OA5A 2F1IA 3L7IA 3LQ4A 5CCDA 4F71A 4XR4A 1J8DA 1CNEA 1K2WA 5TQ0A 1M6VB 4DW8A 3ZGVA 4NYJR 5I7SA 1MB0A 2FF7A 5LA6F 1I4LD 4DIOA 3DDOA 4DJEC 5CFLA 4K6CA 4D42A 3W34A 3JALB 4HQNA 3VTFA 3WGGA 4N5LA 1H2HA 1KK1A 2G83A 2OFFA 3WMRA 3HBLA 1V71A 1JG3A 3RYHB 4GQIA 4RHTA 1Y1TA 4NZYA 4ZEMA 3T1HB 4TTSA 2XE6A 3LI2A 3OUUA 4I4TB 5FYDA 1SCJA 4TYWA 1CRZA 1J97A 1QH8A 2PDAA 2GLUA 3AVYA 1WWKA 1G3UA 4YCDA 1QTIA 2FP3A 5A3RA 1XRNA 1NJ6A 1C30A 5AI0A 1SQ5A 2Z9CA 5AHKA 4B7CA 1NXVA 5JPCA 1X94A 3M5WA 5DTMA 5FB3A 2HIGA 1G7SA 5AJZA 1WPQA 2E4YA 4DLTA 1Q0RA 4WX2B 4CM8A 2P2GA 3TDKA 3K6SB 1Z0FA 3WA7A 4KO2S 3ROMA 1BW9B 4WNYA 5D1HA 4BX0A 2Z2JA 2P67A 2VYQA 3NU1A 1ZEJA 1SVIA 5TJ9A 1CUXA 4ZCLA 4PINA 5D8DA 4DKJA 1A9XB 4EB0A 3QKSB 4D9FA 4N40A 1XZLA 3UK0A 3GU3A 4IR7A 1XNHA 2ET6A 2QUJA 2YMPA 3CN7A 3DEJA 1W0KA 1Y8CA 4Y2GA 3GGSA 1R9JA 4DDKA 2GSWA 5HXAA 2ZAMA 5HA5A 2XUIA 1R0CA 1D07A 1ZR2A 1UXJA 3PGXA 3JRNA 4BB9A 1HT0A 1N2HA 2IP1A 4OQEA 1NRWA 3TX6A 3EIUA 5BN5B 4MI9A 3D2BA 4RDXA 5HUQA 2WJAA 2J5BA 4N5NA 1P0FA 4I08A 4EZIA 4A1OA 1Q5PA 2B98A 6AT1A 3JVIA 3MIZA 3HABA 2XRMA 2A33A 1PEDA 5BOSA 4LWQA 2YICA 4UEQA 4DMFA 4NEHB 1URPA 3L18A 4JP8A 2NZVG 1YDWA 5G0SA 4G6ZA 4ZOBA 5ILQA 3OE7D 5TARA 3WAKA 1T9GR 4PO9A 1L5SA 3ZJ4A 3VISA 2REBA 1QFSA 2Q99A 1XU7A 4GH5A 3RFXA 1LBTA 4CN9A 1IY0A 3SLGA 3W7BA 3L7CA 1D4ZA 1HL7A 2HUNA 4U9IS 1S3IA 4ZYWA 1E3WA 2JD1A 3W78A 3HK2A 1LDMA 4MP6A 4Z9XA 5F3DA 2HC9A 1G8YA 3QEOA 1WVMA 3W3AD 1U1IA 2LTAA 3GCGA 3R3XA 2CK3D 1PGPA 3T95A 1Q6YA 3AH8A 4YCCA 3TLJA 3V55A 4PC1A 3FPHA 4LJ6A 4U2CA 3V48A 3RM3A 2I8CA 5KS2A 1ZNZA 3ZJUA 2V96A 4E2YA 3ZW8A 2B25A 3ZIAA 4QQKA 4I6EA 1POWA 2CXTA 4EHKA 2FN8A 1ORHA 4OQPA 3EPLA 1GL7A 1SR8A 3HXKA 4DIKA 4BO9A 1CUUA 2XXJA 4LRUA 1ZINA 2PD6A 5LM3A 5D87A 2XTZA 3IBGA 4Q3AA 4FOSA 1QRDA 4XIGS 1A8PA 4LS3A 2VBGA 2Z6QA 1EWRA 3FY4A 4W5WA 1JHMA 2Q6OA 2XB9A 3FVWA 2G5CA 2PVPA 3HRHA 3ITEA 1OZFA 4C0LA 3T5GA 4MIOA 1G9TA 3A6EA 1M72A 1A2KC 1C3OB 4IFIA 4NPHA 4P34A 3TXAA 1WBBA 2BMEA 3ST7A 3ZHTA 1BE6A 2ZSJA 4AUNA 5I3CA 1B42A 1WSDA 4K7JA 5JQGF 2CDNA 2ONJA 1S2GA 1QAQA 2QQEA 2D13A 2W6JD 1RAHA 3AIOA 4FC6A 4LI0A 4UQLA 3LO8A 2E4AA 3EZLA 1O0BA 4TLLB 3TRIA 2IGTA 3U9SA 3OURA 3BT7A 3OIYA 4J2OA 5K6AA 5K3CA 2D62A 1N8NA 4Z4CA 5E2AA 1QG4A 4RVOA 5JDIC 4N3NA 4R4JA 4XD2A 1QIFA 2PU5A 5LZ7A 4PLCA 4QBHA 4ZQIA 2OBNA 2W0SA 3UT5B 3VC3A 3C8ZA 3MW8A 5B5SA 3N0XA 2RGBA 3ZCUA 5C81A 4TRMA 4DHWA 3LTEA 4PRYA 2HGZA 1A7UA 2J8ZA 4R1TA 1DQYA 1UWLA 4YP6A 1FY2A 3RSQA 2Q4BA 1YS4A 3KZKA 4F3RA 1X13A 3JQDA 4FMDB 4K3VA 5DWVA 5I8PA 5KYWA 1R0KA 1X19A 2KQUA 2PA0A 2JRLA 1UQUA 3QYAA 4I3GA 3INGA 2EP8A 4L6AA 3MAAC 1MLDA 4GX1A 4Y8VA 1XNJA 4R31A 8LDHA 4KDRA 2XYRA 2Y76A 3F7MA 4BGIA 2Z4RA 2D2FA 4DTCA 1YBAA 4RK5A 4M1KA 5AUNB 1WVIA 2WC1A 1AKVA 3AJRA 1KRHA 3AF4A 1Z7BA 1JB1A 2P2CA 2W2VA 4RA6A 5AKZA 2XB2A 3G9ZA 2WWRA 2AW5A 2FFBA 1IBSA 1WE2A 2QTTA 1U81A 3EBPA 3HQ4O 3O38A 4OXYA 2OXFA 1MOSA 4QEKA 1ENYA 5FORA 2EBWA 1WUYA 2OGWA 3GJ8A 1CRQA 5DLEA 3DXZA 3NAGA 3HZOA 1R0SA 5BUZA 1RJEA 2Y99A 2W6PA 4N39A 1D3AA 1KI9A 5EUCA 3KZVA 2FY8A 3PGJA 4IIYA 4MO9A 2ZI5A 4H3VA 3T7RA 4DF3A 1PG2A 1A1VA 1PK8A 1G3MA 1OFIA 1VMKA 2DLNA 5CTAA 4F6RB 3J80A 1RD4A 2KBEA 4EFLA 4OX9Y 1RWPA 2FWMX 4KH0A 3IOCA 3UV7A 2XHZA 3ZOZA 3ZWOA 5JH7F 2A8YA 4BPRA 7REQA 3ZLJA 3HM2A 3LHFA 4IDOA 1NF3A 2VXYA 5JS2A 2FPRA 1XRJA 2W4IA 2X3UA 2Q4RA 1GVNB 5EA2A 2H1HA 4HXFB 1LBEA 3QE0A 4MWSA 4TMTA 4UASA 2PRZA 2IHVA 1L8LA 2LPMA 4JNKA 4NBTA 5I01A 3Q6NA 3NT2A 4F38A 2JKVA 4XUCA 4E07A 4YEDA 1KI7A 2FW6A 3IP7A 2IXGA 2WHQA 3AWIA 3O4VA 4JT9A 2CUKA 4HFMA 1SA0A 3C7CB 3Q7PA 4WZBE 3LNTA 1U2PA 3EARA 5GOZA 1U8ZA 1M74A 2I2XB 2XMGA 3U13A 1FSFA 2O0HA 2JFVA 4WVFA 3ERCA 1FBTA 3K3PA 5AM4A 3USZA 1IM8A 4MQEB 3VPGA 1B00A 2IHZA 4CIWA 1GPDG 3TPCA 3SX2A 3SHFA 1UOPA 2Q1SA 3MJDA 1OPRA 2JAQA 4OL0A 3QW2A 1EIWA 1T6NA 4PQFA 3WQRA 1WCV1 5B3AA 1JKXA 5TEWA 3RGWS 3V9AA 4P83A 2NAFA 8ADHA 3U7QA 1CP2A 4H7FA 1L7VC 3TJRA 1WDMA 4DCGA 5DHUA 4OXXA 3DUWA 3NASA 2FMIA 3GBVA 2IHJA 3CPEA 4KZKA 3B6MA 4AJHA 1NQUA 1XZPA 4BVAA 1YU6A 2BZSA 2P9HA 4IBOA 4BKOA 5IT5A 2UXCB 2YJTD 2XOKD 1OXKB 1RJGA 1I2BA 2BUCA 3OESA 1LDEA 4MAFA 1H05A 2V6BA 4J9VA 2ISQA 1T6ZA 4XARA 3GQBA 4G63A 1Z4KA 3SFVA 3N5KA 1FDWA 2BFOA 3V4LA 1IDOA 1O2DA 2W2OA 4KQHA 4C5BA 4JBXA 2EFGA 1FJHA 3DE3X 3L6RA 3LQ2A 2H65A 4NMHA 5GMOA 4MS1A 1OH7A 2A9KA 2B1IA 4JI8B 1KK0A 4Q4DA 4WZZA 4YRMA 2NMVA 3AM1A 5CH5A 1WDLA 4X61A 3CZCA 5CMLA 1G5FA 1EX7A 1M1XB 4LZWA 4TLBA 5FA6A 2OT3B 1P1KA 3OPVA 1YZGA 4JT4A 3JU3A 1FFWA 2GS9A 3LBHA 4RENA 4CV0A 1D9XA 1BXKA 1CZKA 1HE8B 1IEWA 3AR8A 2HZBA 1P0IA 3PU6A 5GV8A 3CEJA 3QWBA 4PHCA 2ZETA 3AU8A 1GGMA 3H2SA 3B1WA 4OQ4A 3AY0A 1O6ZA 5FAKA 2VP0A 4J90A 4FVTA 5DGCA 2ROQA 2JFQA 3IAAA 1WPGA 2C4WA 1U3CA 2HDHA 1C9MA 2WKWA 3MVEA 1WVGA 3MEQA 1PFWA 1W93A 4QT4A 1V1MB 2XCIA 2ZJ3A 1YOVA 3H13A 3I2FA 4G26A 1QIMA 3FYDA 1K68A 1RWVA 2OZLB 4Y1RA 3DZIA 3KEMA 3PQEA 3V7NA 3B12A 4B40A 4MS4B 1QX3A 5TE9A 2Y6UA 3RKSA 4KB5A 3R23A 3ENNA 4ES6A 5BMVB 3UN1A 5KZMB 3DKVA 3EYWA 4R1UA 5L3VA 3KKMA 2B3DA 2G63A 2Y9MB 3QKRB 4GKBA 2FMKA 3TUJC 3WKDA 2WFLA 1QVZA 3INRA 3RJZA 3UENA 3ZTTA 3JQBC 5ESWA 1ZO8A 4LNUA 2CXSA 3KDPA 4C4AA 5LYJF 2I99A 2QJFA 1GAWA 1GHTA 2XZDA 3C5VA 3PD0A 3KXLA 4JKOA 4D3ZA 5JYBA 3AZQA 4Q6WA 3X1DA 3PUYA 4NCXA 4PSUA 4B84A 4C07A 1YOBA 2WJHA 3B7PA 2GD1O 3H3XA 4IRMA 1RVV1 2NSHA 2QIOA 2A9QA 2QY9A 1YGPA 2NUAB 3G0BA 5JAQA 1OI7A 4KNVA 1A9YA 3U9LA 2Q4TA 3OT1A 3IP6A 4QTZA 5KHAA 2SKEA 2GKOA 3BJMA 3UAVA 3FCSB 4C4YA 1U2SA 3FFTA 4AP6A 2WNIA 1U2GC 3A37A 1YD7A 2HBQA 1BH6A 2X5OA 3HU2A 4YMVA 4C7KA 3ZDZB 5T4BA 1QHFA 1C3LA 1S02A 3MJFA 2D7CA 4X7PA 2ADOA 2DJ5A 4JEHA 4RIIA 5I48A 5EIEA 5KNBH 1Z7WA 4DWWA 2VP6A 4FXOA 1KH3A 3RROA 3EBLA 5JRZA 4PLGA 5L40A 1RAAA 3G0GA 5LIPA 1WR8A 3EMDA 1YK1A 1IOZA 3H11A 2UYQA 3NAZA 3QG5A 1Z37A 4HQFA 3QJGA 5IJAA 5K8JB 1W0JA 2XWSA 3HCOA 3I05A 3B82A 5BYKA 1JJFA 2IE8A 4EMUA 2ODEA 4TN5A 1ZOOA 1EDBA 2G3YA 2HIHA 2IUEA 4GECA 2ZIEA 1E6WA 4RZ2A 2FN7A 1PKXA 4ZO9A 1YMQA 2GN9A 2PIAA 2D1RA 3CLTD 5GWXA 3JQCA 1Z62A 3DHYA 1AV7A 1QMPA 2CCKA 2PIDA 3GUYA 1O96B 3AEZA 3LDUA 4OBEA 1D4AA 4UMDA 5J4VA 3WKBA 1T5TA 2CNDA 2PR2A 3VKFA 1EP9A 2FETA 4OMCA 4AWAA 3ZJVA 1RHQA 1RRVA 2ZPAA 5G3ZA 1MO5A 2AN9A 4Q3LA 2P9EA 2A30A 1XCBA 3PNLA 1OT5A 4L78A 1DFHA 3EXFB 4P4NA 2H11A 6PFKA 2VRBA 3NDJA 2A5DA 4YCAA 1V39A 1X9HA 1W85A 3CXUA 4Y6GB 4M0FA 3WB0A 2VSXA 3BRSA 2EP7A 4N7RA 1I94B 2Q0HA 1PLJA 1YV9A 4OCZA 1G2QA 2Y4OA 5AP9A 4BMNA 2VYVA 4PLYA 3FYSA 1MH1A 4C89A 3I42A 3U4DA 4RXUA 5TJHA 2HI0A 1XCPA 3C5WP 2FV8A 3CZQA 3D8BA 4LBWA 4TKUB 3I6BA 2JEYA 2H5IA 1JDZA 2QL6A 3HBMA 4BEJA 1CEEA 1JFVA 4DR4B 1ECPA 4EFNA 4ZOAA 1F2UA 1SXJD 1RRPA 2C3OA 1GV0A 1UM9A 2ETVA 2QD1A 1KY4A 4TTIA 3F3MA 4DDHA 4CLOA 2QTNA 3ADCA 1Z2NX 1M2WA 3LBFA 3ZVNA 2BMAA 1QB8A 4YAWA 1WKVA 2JFHA 4R81A 9ABPA 1DOHA 5CD1A 4WA7A 1TIBA 3HXOA 1RQ7A 2ECFA 2AUNA 1XU9A 5JPIA 1D2EA 3QOFA 3IPAA 2B37A 4X44A 1WEKA 2GZ2A 3HDQA 4HQKA 4EG4A 1U5BA 5K8LA 3ICEA 4X94A 3H2YA 4JC8A 2ZJ7A 2HSDA 4YMHA 3A27A 4AZTA 2VH1A 3R6LA 3K6JA 3GXBA 4Q02A 4LE2A 3EGIA 4QHTA 1O94C 3IQDB 2CZCA 1WIWA 2OHXA 1Y8RA 3BWBA 1V2GA 4EGSA 1R8SA 1ULUA 4JUAA 3TNDA 1GG9A 3GZNB 3WLNA 2MHCA 1HYGA 1H5NA 3I01M 4RLHA 3RS0A 2VWPA 1TTQB 2PM8A 4U1RA 4KR6A 5EQFA 1UJMA 4YQFA 1PDWA 2ZSHA 1Q12A 2Z57A 2A67A 3WAJA 3JD2A 4PYKA 5JXIA 4PSKA 4E5MA 2ZSKA 1RQXA 4DL9A 2ZQZA 1NWCA 4DMLA 4QREA 3E7DA 4PNEA 3K8YA 1RYHA 3OTQA 4X6LA 1VSTA 1CERA 4GRIA 4O4HA 3AVWA 2R1ZA 3IDSA 5JJBA 3DOJA 1GKYA 1BWSA 3OECA 2YJGA 3MYRA 3DTVA 4Y1FA 5KQMA 3SJZA 5BWMA 4ND4A 5I8ZA 2PGOA 1DO0A 3H42B 4P3KA 1VFPA 4K8OA 3HO6A 1AGRA 3KNZA 4YC7A 4PG5A 4CUKA 3ETJA 4UTPA 2ASEA 4MQFA 2RG7A 3A9VA 3T7TA 2E7ZA 4U2DA 4X66B 2I1LA 3M4ZA 1W2GA 4BUZA 3HEAA 4YAUA 1UJCA 4UU1A 3SF8A 4Z4EA 3LZ6A 3DDCA 2X8WA 3RTAA 5IJ0B 4YALA 3RU3A 3WGYA 4E4RA 2CYCA 2FWBA 2JLYA 2RHWA 3FLAA 3Q1LA 4BRZA 3M1IA 2ZJ0A 1W4RA 3E8XA 4FHDA 2XECA 4MPPA 1YBHA 5TSDA 4CMEA 5A9SA 3S1SA 4TUYF 4BCCA 1QIGA 1Y34E 2EKPA 4FIDA 5LJLA 1I3OA 1ZWLA 2FZLA 1QDEA 4TRJA 3UGKA 2FYTA 1KBQA 1WBJB 4V0MA 4WCFB 4KIJA 2RB5A 3IQEA 3EIXA 5DM1A 5J5AA 1BX3A 1E2DA 3LJKA 1L9KA 4AS3A 1W5FA 5CXSA 3ZG6A 1COWA 1ADCA 4LC1A 1D2NA 1YHNA 5TPWB 4AJNA 5SY9A 4TSKA 1EUDB 1S2NA 3BWVA 2D4AA 3M1AA 5AOCA 3ZR4B 4P4LA 4YNBA 2WAYA 2R25B 2IYNA 3KLOA 1MO3A 1QWOA 3W8DA 2PLAA 4WPGA 3W06A 4RTJA 4W1QA 1JTFA 3RT7A 3MWEB 4B6RA 1QFMA 4DBLC 2P41A 5HWSA 4NU0A 4U39A 1M1ZA 3U44B 3ZWVA 2ACEA 5DHAA 2NVUB 2PLFA 1IAQA 1IFXA 3L1JA 4TLMB 3OZBA 1BGXT 1QP8A 2GN4A 1SC1A 3CISA 2MDTA 4N8SA 2B9EA 4D74A 1JG6A 2AFHB 2TYSB 3TRFA 3IR5A 2GH1A 4CR6A 3D02A 4O2BA 4KPEC 3VHLB 3IT3A 3F0TA 4XYMA 1PNVA 4LTMA 1PVDA 4A2QA 4Q9NA 2WF8A 4N12A 4YRFA 5K8VA 2XUOA 1IL0A 2XT6A 1NMZA 3NATA 2O05A 4AU1A 5GONA 3A6PC 2X2FA 3EGOA 3R76A 4D46A 1SXJC 4CKEB 2IYRA 1EVJA 2X8AA 4W5HA 3FPJA 2Y4NA 2Z5VA 3AJ9A 2POQX 3OFND 4P3NA 2F9LA 3D3EA 5K3AA 4PQGA 2H06A 3S55A 4G8CA 2C2GA 3FFAA 1U9JA 3O2NA 4GOXA 5E7QA 3I8OA 4M89A 5JSQA 4Q4CA 4Z3KA 3BD7A 4IXMA 2R1VB 2ZJFA 3C3KA 2YDXA 1KE2A 3FCUB 4QU0A 2E9SA 4BLQA 2FJPA 3B6JA 1P29A 1E1DA 3DL0A 4IIJF 3JQ8B 2JJ2A 4P4UA 4HNVA 4F3YA 2IBTA 1Y81A 3RASA 1LDGA 1EUYA 2W83A 5KX5A 2WLTA 2WUDA 3DUFA 3IBYA 4IX1A 2AMJA 4DB4A 4ISBA 1C7ZA 5E8RA 3SWWA 3IESA 4FOOA 4B6FA 1IBMB 4L85A 1XF1A 3P32A 3TR0A 3TOCA 2ETXA 4X3CA 1IHYA 1SQ6A 3BXFA 3FTPA 3H04A 1Y33E 3M6FA 2O1EA 4O4JA 4ZP1A 3UWDA 3JYQA 1MJFA 2FOLA 3H16A 1M1NA 2P9YA 1RRFA 2DCUA 2YS7A 2AZTA 3D2AA 2DWCA 3O84A 1X7HA 2FRXA 2D0DA 2XUKA 3DE1X 3IILA 2VDWA 1FL9A 2ZRKA 3MPOA 5FPKA 3KD3A 2QRNA 2C4KA 2AW3A 5CW1A 2QRLA 3RT9A 4EPYA 3A06A 2OR3A 2WB4A 4IKEA 4V03A 3C6BA 4Q9HA 5EIBC 3VJRA 2FWPA 1RW4A 1BFKA 2WJ6A 2AN1A 3C8HA 4CUZA 5JVDA 1RE1A 4V0KA 1Q7GA 4MW0A 3RAJA 5BVHA 1TKBA 2E2WA 2DT5A 3QELB 4FYJA 5BNIA 1A9ZA 4IW3B 2C0PA 2IYZA 1E2BA 1O6GA 2P0YA 3ABIA 3NYIA 2UZ0A 3DZCA 5ILOA 1JU9A 1IHDA 1V9LA 3NEYA 2PSEA 4KJXA 5L7YA 2PSHA 3K5WA 1R2QA 4I55F 1QF9A 3L92A 4WACA 1YS7A 4QRDA 1VLLA 3HJRA 1NP7A 2BGRA 3LA8A 5KVQA 1ID8A 2XWBF 4GRAA 1ZVKA 4EATA 1Q3KA 4WZAE 1N5JA 3RJMA 4YDHB 1H1LB 1WMBA 2C9OA 4UHKA 5ERXA 1DX6A 3F1KA 4FDVA 3NKVA 1EWTA 1QYXA 2PKWA 2YZ7A 3LV8A 1C29B 2GX6A 3DE0X 3GEMA 4EZBA 4G5HA 3TLEA 5JHHB 5CIYA 2PS3A 3NHJA 3OIDA 2UYCA 3DT9A 4EMTA 1U98A 2F00A 2YC4C 1L4MA 1D2MA 3OBIA 4I1PA 3EUWA 3VR5A 2FR0A 2H57A 3I9V1 4QVIA 3DZJA 3U3JA 3WK6A 4BLVA 2DHQA 4M46A 3OE5A 3NEAA 3OIFA 4IQGA 3ZCRA 2IX3A 3A6KA 1PUXA 3UJ9A 1XLTA 2XITA 2G6TA 3N7UA 4YBZA 4EUSA 4O4IB 2WKQA 2AWNA 1LH0A 2BEWB 2MMCA 1T9GS 4HP8A 4KL8S 5HRAA 1U2QA 4FB5A 2ZJ4A 3FZGA 1TT7A 2C77A 2FUKA 4BV3A 1J7KA 3WMEA 2AOTB 3KQWA 3C15C 1SBTA 2BDUA 3EOBI 2J9GA 2Y2VA 5FOVA 4BZQA 1GQOA 2G36A 4B76A 2GFIA 4KN8A 1M34E 1N3BA 2GESA 2XVMA 3R40A 1YCHA 2RI0A 3DCJA 4RL6A 1O54A 4WBNF 2D3TA 4YRKA 1T5LA 4HN4B 1ID1A 1Z15A 2XD9A 1U99A 2BGIA 2VJMA 1W35A 5IYZA 1MP0A 1XTQA 5LXTF 3VH1A 4CMGA 2VDNB 3QU4A 2JFZA 3EHDA 3K0SA 2H8GA 1ZYUA 3I5AA 5FBRB 4D96A 4NX2A 1RWMA 4MO2A 4OGKA 4ZCMA 2IH2A 3JYNA 4RULA 4JXKA 1NMQA 4JI1B 4G0UA 5AIAA 3OC6A 2JBWA 1M33A 3SQNA 5BR7A 1RXIA 1B26A 5IAJA 4MQLA 3NALA 4BKMA 3O91A 2ZZMA 3MFYA 3TDMA 4Z4QA 4MUBA 1AF7A 2VF8A 3BSFA 4RFSB 1F6BA 5H7XA 3QOYA 3FSGA 2AJCA 3QVGA 1T6YA 4O08A 2DXIA 2ZUTA 5EJ6A 3GWGA 4LV5B 1W88B 5CK5A 3SVTA 2ZE8A 3P2IA 3DZKA 3CO5A 4WWHA 1CPYA 1CEYA 3KSRA 1QS0A 4HYYA 2EJTA 1H8HA 2P4SA 1HFKA 2ZTMA 3EVAA 4DRYA 2R8XA 4MQ5A 1X80A 1HOTA 1KY5A 3D8SA 3FR8A 5IANA 5EL0A 5DX1A 1VGVA 5K3FA 1A4IA 1C41A 1U1EA 3G8YA 1U1DA 1B8NA 1KAHA 1XN4A 3NHKA 4HDMA 4TQAA 5B4VA 3GLFE 1YDMA 3OETA 2ZSAA 4PXSA 2X2OA 1Z6GA 2QLFA 2JATA 2HJHA 1EU1A 2FF5A 2NLOA 3E81A 3G6WA 3BRWA 1N2XA 1Z08A 1YJQA 2V5UA 2A2ZA 4J7XA 4DREA 2C5BA 2VEOA 4XJTA 3TW4A 2YQ4A 4LVCA 2CCGA 1G66A 1L4UA 3IFSA 4Q4AA 2WYOA 3C3XA 3DL4A 3H4MA 4YJ2B 1WDTA 2HRDA 5C31A 4EAQA 1N2IA 4QOSA 2JFFA 4C2BA 3OSZA 4IDNA 2JFYA 4M1SA 4D3YA 1XEXB 1IQRA 4XEHA 4JVOA 2AFIB 5HM6A 2W58A 4H4EA 4YAFA 4UTNA 2C2YA 1E9BA 3S8YA 4ZQBA 4HEJA 4DJDC 5CFRA 4EG6A 3H1GA 1VPEA 4I14A 5B1YA 4N01A 2ZDQA 2D2VA 4M86A 1CUGA 2CLEB 1WUTA 2Q5OA 3OHMA 4Z7JA 4I1UA 5KWJA 1P5FA 4FM9A 3KZNA 5EFOA 3QF7A 1NZDA 3C4QA 3F2IA 4QICA 1MG5A 3ROGA 1PZHA 5CB4B 2VPPA 2G76A 2ZYTX 4LFCB 3SE7A 5JMOA 1GAJA 3STXA 1SOVA 4NMLA 3DL2A 2MMGA 5KHOC 2XZLA 3ZHQA 1Q19A 2P1RA 3GP8A 4KH1A 1QIIA 3VJKA 4UHCA 4KNWA 5KKAA 3DZGA 3EGXB 1FNCA 3EEYA 3FW1A 3NZEA 1DKLA 2EG9A 4G4IA 2IUTA 3PFGA 2OSBA 3SYMA 3FRHA 3ZLTA 3PJGA 5FTWA 1QVRA 4JI7B 3J7TA 3G2MA 2VBFA 2A9JA 2QVXX 2BMVA 1OT3A 3OAAD 2OM6A 2AXQA 3CZ4A 4NL4H 3KHUA 2JAWA 3GJQA 4KKVA 4YJGB 4KVZA 1ULBA 5L3SB 2E0IA 1HNZB 3HHPA 3ILHA 1AQUA 3RG2A 1RBMA 1PFUA 2FX5A 3AM5A 3PE6A 3HP1A 1Z5GA 2BE7A 4M1EA 4ZCIA 4I8XA 4B17A 2HJRA 3DP7A 3MOSA 1A27A 1JFLA 2GZ3A 5ER9A 1GRRA 1K0FA 3ELWA 1WRBA 2VUUA 1Q1GA 2FPIA 4LQDA 1NW8A 2R96A 4B46A 4JJIA 4G4JA 2O8DB 3IP5A 1ODIA 1NNUA 3FI9A 4PLVA 1R6BX 4OBXA 2XSZD 3U7HB 2A5GA 3NTVA 2EKZA 1M8JA 5B6IA 2GJ4A 1CUFA 1OXVA 2RHCA 1IWPB 3DEZA 3ITNA 4GMDA 4OSOA 4R9RA 3STVA 1JHPA 5EERA 4J1TC 4QJIA 3EWNA 1J9EA 1EM8B 3BJZA 3K4PA 2C7PA 3A4YA 5HJ7A 4G86A 1VL1A 1JW9B 3W1VA 1IQ0A 1M76A 1XD2A 2GPJA 2H2HA 4UOQA 1LVGA 4D3SA 2JVJA 3QEAZ 1A82A 2HMVA 2VJOA 2OV1A 1ZN7A 3CE6A 2B8JA 4G1CA 3KC2A 4GLFA 4KFSA 4UJ5A 3ZCTA 3T9DA 4TWAA 4JB0A 1W2WB 1CP3A 3RTDA 2MU1A 3H4IA 1QK3A 1ARZA 2Q62A 3L4JA 3NUQA 3ZE0B 2BTQB 5EMLA 2V4MA 1TKRA