3OCZA

Structure of recombinant haemophilus influenzae e(p4) acid phosphatase complexed with the inhibitor adenosine 5-o-thiomonophosphate
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
247
structure length
247
Chain Sequence
EEHANMQLQQQAVLGLNWMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLDETMLDNSPYAGWQVQNNKPFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHNGKVFYVTNRKDSTEKSGTIDDMKRLGFNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGNTVYGKLNADRRAFVDQNQGKFGKTFIMLPNANYGGWEGGLAEGYFKKDTQGQIKARLDAVQAWDGKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the inhibition of class C acid phosphatases by adenosine 5'-phosphorothioate.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Lipoprotein E
total genus 95
structure length 247
sequence length 247
ec nomenclature ec 3.1.3.2: Acid phosphatase.
pdb deposition date 2010-08-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3oczA00
3EF0A 4C4RA 1QQ5A 2HF2A 2ZBGA 4YGYA 5IT0A 3FVVA 1RMYA 3N07A 1EK2A 3QXGA 4Y2JA 3ZWDA 2NYVA 2R8XA 2BDUA 2YBDA 5AW8A 1ZRMA 4O8CA 3J7TA 2YMPA 1F5SA 1TJ5A 3NIWA 3IJ5A 3MC1A 3WK7A 5AVZA 4HGPA 3OCXA 2HO4A 5AM0A 4KYTA 4Y2XA 3NANA 3FPBA 5AK3A 4DWOA 2GHQA 1Z4OA 2HF7A 3FZQA 3ONNA 3IB6A 2YMMA 4Y2RA 1VJ5A 3W5CA 4G63A 3QUBA 5AI8A 3ZU6A 2YMQA 2HEGA 4RESA 3BA6A 2B8JA 3ED5A 4XE5A 2GHTA 4UM5A 2P27A 3OCWA 3EWIA 3HYCA 3AR5A 1J8DA 5AKZA 3L1UA 3OCUA 2RARA 4BEVA 1YMQA 4BX0A 1S2OA 2HI0A 3W5DA 5IS2A 1U02A 3DNPA 3QU9A 2P11A 2QYHA 1WZCA 4YIHA 4H1WA 3QX7A 2CFSA 4NABA 4KN8A 4B6JA 5AI5A 2I55A 5AKXA 2C88A 3DDHA 2RB5A 3A1DA 2JAWA 3QYPA 3ESQA 4CNQA 1YV9A 5ALGA 3NALA 2GMWA 2FI1A 2HDOA 3SHQA 3ET4A 3I28A 1N8NA 5AKEA 5AW3A 4IG4A 2OYCA 3RFUA 3SLRA 4HGNA 5AW4A 2YN4A 3OCYA 2IYEA 3ESRA 1L8LA 5AW6A 2IOFK 3L8EA 5ALVA 2B30A 2WFAA 1K1EA 5ALSA 1RKVA 5ALJA 2MU1A 4YCLA 3ZTYA 3L1VA 1TJ4A 1YDFA 3NASA 1RKQA 3A1CA 3AR2A 2C9MA 1LTQA 5ALEA 3PCTA 3N1UA 3QU7A 1XVIA 2AH5A 2BDEA 3L0CA 2NO5A 5AKGA 2R8EA 1RDFA 4F71A 1NF2A 3N28A 3WK6A 4BX2A 2P69A 3M1YA 5AVWA 4DFDA 3U7FB 3ZVMA 3NAMA 1RMTA 1XPJA 1CR6A 3WK9A 3L8GA 4XPZA 3MMZA 2ZBDA 3P96A 4EX6A 2WF6A 1NRWA 1N9KA 5AW7A 4ZEXA 2O9JA 2ZBFA 2B82A 4UAVA 4CF4A 4HGOA 5ALKA 2VKQA 1L8OA 3KC2A 4YIKA 4J2TA 2I33A 5ALRA 4Y2SA 2WF7A 2RAVA 5ALMA 2ODAA 5ALTA 3UMBA 3R4CA 3CZ4A 3IRUA 2G08A 4UU0A 3N5KA 3ZVNA 2AUTA 3RF6A 3ZVLA 1RLOA 4QQFA 3QUCA 3U26A 2HHLA 4GIBA 4L6CA 4UU1A 5ALLA 2X4DA 3ZX5A 5AI0A 4Y2QA 1T5TA 2I6XA 5AICA 2YJ6A 4G9BA 2OM6A 3QU2A 4BX3A 5ALDA 1FEZA 2EATA 1QYIA 3ZUPA 2DQSA 3NUQA 5A3SA 2AMYA 3U7HB 5JJBA 3UMGA 5AKJA 3OTQA 4MUMA 2IA5A 2G06A 1O08A 3K1ZA 2OA0A 4KX3A 2OBBA 5AHXA 5ALWA 1SU4A 2PR7A 5ALOA 2B8EA 3QU4A 4I9FA 3SF0A 2YJ3A 1VJRA 2C8LA 1RPZA 4EZEA 2R8ZA 5AVQA 3NRJA 1RLTA 1RRCA 1ZD3A 2Q5EA 3AR8A 1CQZA 4UM7A 3KBBA 1ZD2P 4KNVA 4HYTA 4NAVA 5ALUA 2YFYA 4L6AA 3ET5A 3VAYA 1YS9A 3B9RA 3FM9A 1VFPA 1TA0A 3AR3A 5AM3A 2R8YA 1QH9A 1SWVA 4MWOA 1T9ZA 2QLTA 4CE6A 3MPOA 1Z5UA 1RC8A 3FGOA 5AK4A 4E88A 3AR4A 1Z4JA 3WGUA 5AVTA 4CF3A 4Y2TA 5AKKA 4BYGA 4BKMA 4UMEA 5IT4A 4BNDA 2FPXA 1AQ6A 1TJ3A 1RMQA 3QUQA 5AM2A 4HGRA 3OCVA 3EPRA 3KZXA 1L7PA 2Q4TA 2GO7A 3AR9A 3QU5A 4OCZA 4UAUA 2CFRA 5ALYA 1QQ6A 3ZWKA 2ZOSA 5ALPA 2YJ5A 2G09A 4AS3A 3WKEA 4FE3A 3UM9A 2WHEA 3E8MA 4NWIA 2EARA 5ALIA 2W43A 3R09A 1Z4IA 1RQLA 3I6BA 2FPRA 2ZBEA 5AVXA 1MH9A 1T5SA 3U7GA 1L7OA 4PNHA 2JARA 5AW0A 2YJ4A 4YCMA 2MSNA 2FPWA 2P9JA 4I9GA 5AI4A 5AW1A 1ZD4A 3WGVA 2WF9A 1QQ7A 4EX7A 5ALNA 4Y2UA 4EENA 5AM1A 3OCZA 1WVIA 4Y2PA 1Z4NA 5ALHA 3SD7A 5ALFA 2W11A 2FUCA 4NV0A 3U7EB 4DCCA 3E58A 3WK5A 5AK5A 2B0CA 2C8KA 3M9LA 1J97A 1U2TA 3AR6A 3WKAA 5AVUA 1Y8AA 2HSZA 3F9RA 3A1EA 2G07A 2G1AA 3UMCA 2WF8A 3D6JA 4UW9A 5AVSA 3L0YA 4NFLA 2HCFA 4XOUA 2FDRA 3WKDA 2Q4RA 4FYPA 3OPXA 2W4MA 3R9KA 4UMVA 3PGVA 3L8FA 2D2VA 3W5AA 4EELA 4Y2YA 5AKLA 1TE2A 4JB3A 4DW8A 2I34A 5T41A 1Z4MA 3B8EA 5A3QA 4F72A 1LVHA 3HLTA 2ZG6A 2BY4A 1YNSA 4BNDB 4AS2A 3KDPA 4HGQA 1XP5A 3KD3A 5AVRA 1IWOA 1ZD5A 2PKEA 4QJBA 3S6JA 4ZEWA 3B9BA 1U7PA 3U13A 4L57A 2B1QA 3N8GA 3SMVA 5AIAA 1Z4PX 1ZJJA 1X42A 2PQ0A 4Y2VA 3E81A 2NO4A 3SKXA 2YMLA 4ZEVA 4BBJA 4BEWA 2IOHA 3I1YA 1EK1A 2YY6A 4KX5A 3ZW7A 1RQNA 3CNHA 3PGLA 5AI9A 5AVYA 5E0OA 4IFTA 4UASA 5AKYA 5AESA 2B1RA 1WPGA 3U19A 2C4NA 5AM5A 3E84A 4HAIA 4YH1A 5AVVA 2GFHA 2HOQA 1Z5GA 1Z4QA 1Z4LA 2FUEA 1L6RA 4GXTA 2I54A 2O2XA 3L0BA 4FFDA 4J03A 2CFTA 5AI6A 1NNLA 3KOOA 5ALQA 1SWWA 3L7YA 5A3RA 4JDPA 2G80A 3ZTWA 4OFZA 1Q91A 2ZXEA 2WF5A 2JAOA 1JUDA 4C4SA 2AGVA 1Q92A 1ZOLA 4UMDA 3AR7A 3WK4A 3FPSA 4OHFA 3PDWA 3WKCA 2WM8A 4YCNA 3MN1A 3WKBA 3QNMA 4CF5A 4KNWA 3QLEA 5FP0A 3ZX4A 2HX1A 5AKHA 2JAUA 4UATA 2CN1A 1KYTA 1O03A 3QGMA 5AW2A 1RKUA 2IOFA 3TLMA 4OD0A 1PW5A 2I7DA 5AK6A 5AW5A 1S8OA 1RLMA 3L8HA 4XQ0A 1ZS9A 1ZRNA 1Z88A 5AKIA 1YJ5A 1U7OA 3L5KA 1L7NA 1U2SA 3BWVA 3I76A 4AP9A 4UMFA 4RETA 4Y3UA 4UARA 1L7MA 4EEKA 2FEAA 5ALZA 1WR8A 3WK8A 5ALXA 3GYGA 3DAOA 3EF1A 3ZI4A 2EAUA 3SKYA 5AM4A 5AW9A 5AIBA 3QUTA 4C4TA 2FPUA 3A3YA 3DV9A 2RBKA 1Z4KA 2FPSA 3W5BA 2G0AA 2JGAA
chains in the Genus database with same CATH superfamily
1ZGHA 4HYQA 3W6ZA 1NX6A 4Q66C 4OQFA 2ACWA 2AN1A 2H52A 3R1IA 5ECYA 1S6YA 4AUNA 3NHSA 2R8BA 3IEVA 5HOQA 4HCJA 2J1LA 1FFXA 1HA3A 4Q7QA 2P9ZA 3WLQA 1EE9A 3HCNA 4KG7A 4NFHA 2CHGA 4P0TA 4GI3A 4TV8B 4C29A 1PNVA 5M29A 1N33B 1P60A 2YMPA 1F5SA 1ODSA 3A28A 4A15A 5EESA 1NXTA 2PKRA 1CUCA 3AWIA 4C78A 2W6IA 4LXGA 3PCXA 2G1UA 2QVXX 1D8TA 1HZJA 2I2FA 4O2LA 1C9JA 4LYGA 3NANA 4GKAA 1MA3A 4Y2XA 1RWVA 3EBOA 4LECA 1Q22A 3EEQA 5AWFC 4B3RB 2YDXA 1KRHA 3KAQA 4P2GA 3G5MA 4Y2RA 1YZHA 1JDNA 2BGNA 2R87A 2QJFA 4DQLA 2OHGA 5FPTA 5DXFA 3H2JA 1E1RD 3MBOA 5KX5F 4RABA 3TKAA 5E6UB 3VZCA 1FLVA 4I5GA 2R7KA 4OLHA 3O6VA 4BQEA 3UGTA 4EJFA 1YR8A 2C92A 2BE9A 2C4TA 4F3KA 1B15A 1B8VA 1GSAA 1Z36A 2F9FA 4ZJZA 1NZJA 2Z8XA 3R77A 1GCIA 4RUKA 3CH7A 1T9DA 1G98A 1NU8A 2QM8A 3AYXB 4NNJA 1DKRA 3II6X 5BORA 2PMBA 2IP4A 3ASZA 5AYVA 4YUVA 3ZHQA 1XD2A 2FP3A 3B6MA 4LJLA 4YCAA 3WIDA 3C8DA 1ISPA 1NPTO 1WXFA 1XTQA 4G8BA 2RMKA 1BX3A 2YTZA 3DZFA 2PGAA 4RCYA 2G9ZA 1DEXA 1TIPA 2X8WA 5DT9A 4Y8VA 4H1WA 3GLIE 4RLQA 1QIIA 1BWRA 2CFSA 2Q6TA 4AXBA 2KYRA 2OV6A 3HYNA 4LOHA 2RGYA 1YVDA 3T12A 2E37A 2QP9X 4NI5A 1W2GA 4HQNA 1ZCJA 4P33A 1VYVA 1DBVO 1L7EA 3W5SA 3P0IA 2PZBA 4RF5A 3M6FA 3JD3A 3GPLA 1J6UA 2OHIA 4HGZA 4W8OA 5ARBA 2P4EA 1RXUA 4KODA 1K68A 1N5KA 1SCJA 2GCOB 3FYUA 1B00A 3O4VA 2ZUCA 4PZ9A 4Q12A 2XTZA 2NTNA 4NENB 4NOLA 3M9WA 1COWA 4CM3A 4B35A 2NZXA 3L7MA 4P3KA 1PJRA 4LSWA 1HMYA 4E5SA 1FIUA 4IIGA 5F52A 1X92A 2Y1FA 1P0MA 4R8SA 4PZDA 5HTKA 1UBOS 1B6RA 1VIAA 1YHZA 1ZU4A 4PLWA 4LY6A 1U2ZA 1ZSVA 3HNOA 3LBFA 3ZJTA 1GAWA 1RP1A 3TSYA 2VP5A 5KQRA 2XX3A 1FUUA 5EIWA 2J4FA 3SVLA 3MTDA 4EABA 5HZHA 2FJUA 1R8SA 4LCJA 4ALIA 4QDTA 5DLQC 3F6SA 3TL3A 1A27A 4LHYA 2WZQA 1KAOA 3A6FA 4LQCA 2W71A 4W7HA 5B1IA 5TNXA 1J0CA 2CCKA 3DKVA 1XI2A 3QKWA 5TF0A 4DYHA 1WD5A 3SXJA 4OHYA 5ALDA 1UEJA 1CWUA 1NHGA 4WE3A 1J2JA 3JQAD 1RHKA 4OI4A 5KSWB 3PZBA 3BXGA 2AH5A 3MTJA 4FDUA 3PIIA 4PFSA 1JL3A 3NUZA 4JJGA 3P2OA 4LE0A 1AK2A 5AKGA 2VDRB 4DUZB 4YPFA 2PT6A 3IAM6 4JJKA 1P91A 4PG6A 3VJMA 3HFJA 5CLFA 1U5AA 5DM0A 2HD4A 4Q6BA 2X0IA 4GBJA 1S7CA 3ZIAA 3M6MD 5HJ2A 2ONZA 4GEGA 2GEUA 4XJVA 2OGZA 3NUGA 1QE0A 1SBZA 4LRQA 3HSYA 1SHLA 1WMBA 2AN3A 3D7KA 5LMCA 2MYUA 3P96A 3ROTA 3VNUA 4FX2A 4I99A 5IDWA 2JDID 1H8EA 3VAZA 1X8LA 2Z5VA 4YRGA 2QM3A 1SVUA 3HHEA 1K4MA 4PGHA 1JJIA 3BEDA 1WMFA 4KIUA 1JR6A 1BEUB 5K3BA 5K3SA 5EIFA 4L5YA 4EG1A 5ALKA 1WX1A 1YUBA 1MQ8B 3ZVKA 5SYMA 4IGAA 3NXSA 4TXLA 5B1EA 3RRZA 2WILA 1FSZA 1CCWA 3FYSA 5DCLA 3F5SA 1AGYA 1TQ2A 2IEDA 4QGSA 2EX1A 1DBRA 1AUVA 4XDHA 2PFGA 2VTKA 3REGA 3OEED 1V6AA 3HY4A 3K09C 1RZUA 1NYTA 5FNVA 4EECA 4I4CA 1QK4A 1HG1A 2WIJA 1NLYA 3H1TA 4GIBA 4JR2A 2Y1KA 3VHXB 3TPZA 4N49A 3ZX5A 1XGKA 1O9GA 1UJMA 2YJ6A 3CEMA 1ZUD1 2YYZA 4G9BA 4JYPA 2RK4A 3EEFA 3NT5A 2GD6A 4G97A 4Z3DA 3U3KA 3FPJA 1PEKE 3L1KA 2GR9A 2VHYA 4WBXC 4BCBA 3RS5A 5ICMA 5AOBA 1U11A 3NT4A 3W1VA 4U3JB 2ET6A 3IKTA 3CWQA 4P08A 2J5QA 5CB8A 1PT7A 3HFGA 4UQLA 3UCEA 4MR8A 2P9BA 3LXUX 2OK8A 4JGIA 3FYCA 2ISSD 3LYAA 5AKJA 4RV4A 5TGTA 5E9QA 5FOXA 5B6PA 3WYFA 4I4IA 4RM2A 3V8QA 3E03A 1ZL2A 3NHWA 5K0CA 1BWPA 2GK3A 1QK3A 4GZ6A 5DBHX 4MRSA 3EZLA 1T5IA 4O5OA 4W82A 5CTAA 3NBYC 1IUKA 5LBUA 5CFOA 7GPBA 3N2GA 1ZIYA 2Z8YM 1B7GO 4YMWA 2H57A 1XJQA 2FKNA 1C29B 3FJOA 4AZ3B 1S2NA 2H1VA 2F43A 1VGRA 1PLJA 5SYAA 3EVBA 5EE0A 4BATA 4ZCSA 4JS0A 3DE4X 3WL5A 4CM9D 5J4HA 3FFWA 3A6JA 2QUJA 3NRJA 2LCQA 1EWVA 1Q11A 3E27A 1EFUA 5K3EA 1E2FA 2ZWIA 5I8PA 1OPXA 1N2BA 2J3QA 2VJLA 2X3FA 1QHFA 4GWLA 3O7WA 1E6EA 5GONB 5FBHA 2PJDA 3E7PA 4LFCB 2XE4A 3V42A 1SWVA 3H9GA 3JVVA 2ZM6B 3OPYA 1ECGA 2HHAA 1W87A 3O91A 3U09A 4CEHA 4CLRA 4HZUB 2I4LA 3MCAA 1LPPA 2BFEB 4OBXA 4E88A 3AR4A 3GL9A 4C4OA 4F2WA 4TLDA 1FTQA 1QPBA 2CUTA 3FH0A 5K0NA 1B0AA 1OBFO 1VL0A 3PRKE 4X1KB 1HEUA 4HLQB 4JL8A 2FFHA 3VGJA 2AFHB 3TGWA 1U28C 4JVSB 3O2QB 1RU3A 3VPCA 3HA3A 3OCVA 1HMPA 1V95A 3U4IA 5CM2Z 2GO7A 4DLLA 3NYQA 2EZUA 4TMFA 3LUPA 5TPWA 4KN6A 2ZYAA 2BFPA 4Z4GA 3O47A 1V4VA 1AY0A 4Z53A 1HLFA 2WB4A 1Z2AA 3H5AA 4AJOA 2NP7A 1QZUA 1GYPA 3FUVA 3CINA 3FWZA 3ORYA 5IHXA 4LSZA 4UQOA 1A95A 4OQNA 5A05A 4IZIA 3RAFC 1RADA 1XCGB 2HZ7A 4J1TC 1SXJA 2C97A 3IKMB 4DC0A 4Y6PA 2XTMA 5DISB 3QELB 2A9OA 2ZTLA 3NDRA 5F3WB 2JZOA 1E1QD 1G7CA 1Z5VA 3WGQA 4BN5A 2I87A 2WHQA 4M0DA 2XJ9A 1XRSB 3VR0A 1HE3A 1N4AA 4F2PA 4LMAA 4ZHQA 1NFRA 2FEKA 3N76A 4C7VA 2JJ8A 3LFHA 1FNBA 4W5HA 4QC2A 1JMKC 2CDNA 4BECA 3PQ8A 4JP3A 4GNKA 1BX1A 1XRRA 4RVGA 1EFPB 4L4YA 2GRUA 2VDUE 3CLUD 3LKZA 3IQIX 3TUZC 4A0FA 4X61A 4EZIA 3HGTA 2FPWA 2QTVA 4NCXA 5B36A 1NBOA 1PGNA 3JQGA 2B3DA 4R81A 3SS9X 4F86A 2IQ5A 5C81A 2J3IA 1FQJA 1IQRA 1ISJA 3TDMA 4CKEB 1S2LA 1FFGA 4J1SA 4LF9B 2V55B 4DT1B 1QRTA 4EX7A 3VDRA 1CUFA 2LR0A 3KJGA 3ADCA 5D5HA 1R15A 2BOVA 1UT6A 4UCWA 1AO0A 1Y9DA 1CE8B 5K51A 4KW7A 1JXQA 2V7VA 4IDQA 1SO8A 1IQ0A 4LF4B 1EVJA 3W90A 4JI7B 1E5TA 4DCCA 5JR3A 4DCPA 4WCDA 4HEHA 2FSHA 4W7SA 4WT7A 2PWBA 3WGLA 1LJ8A 5KWEA 3QOYA 2CMHA 1Y5MA 2IUEA 4FYJA 2QXYA 4LOIA 1NAIA 3B6ZA 3NC0C 1D1PA 1Z33A 2HSZA 3GCDA 4EI7A 2XCTB 1PF7E 2VLIA 4I1RA 3KVVA 1QZZA 3LC0A 5J2TB 2XMZA 1PBNA 4MTLA 2OCYC 1NXPA 4JP5A 1X6VA 3FAZA 3QTBA 1C3OA 4GS5A 2LNDA 3PRJA 1A97A 1G8HA 4HN4B 2G1AA 2WOJA 1FP1D 2Q7XA 3NH6A 3T9CA 3ZW8A 4JP2A 5IAGA 5I4IA 1GV0A 3NGMA 2H1SA 1N57A 1JFFB 2PA0A 2SKDA 5HKAA 4TS4A 4CETA 4XD7A 2FB9A 2Q4RA 1A50B 5GZ3A 5HZMA 3RHSA 3AKZA 1NPYA 2KE5A 3KPVA 3I5YA 4QOJA 4JBIA 1SCUA 3NYRA 3W4JA 1E3DA 1E2EA 5FPQA 3LGXA 2YINC 4BMZA 1H1TA 2Z5FA 2EC5A 2HU2A 3PZRA 4Q4LA 2CMGA 3A4LA 3PC2A 3RFFA 4MKGA 5I7SA 2MHCA 1NPDA 2C82A 4HXGA 1UJNA 3L3BA 1JAYA 2H65A 1JVSA 2EZ9A 3MWEB 5JANA 4O63O 3K70C 4D98A 4QDZA 5CCEA 2Y66A 2X1MA 4HNRA 5J4YA 5JYBA 1PW7A 4JJIA 5DT2A 3PITA 3DH0A 4K9KA 2WMDA 2WIDA 3ZXSA 1PKEA 1RRGA 1QVWA 4PPYA 1QS0B 1Z68A 4YALA 4OA5A 1EM6A 1H3NA 1GO2A 4XEUA 3O7MA 4IG9A 2CE7A 3F2VA 1CUJA 3LG2A 3T99A 4F5ZA 2VATA 5H4GA 3OQNA 2YWDA 5SY9A 1I13A 3CE9A 5CFMA 1NJSA 3K9HA 3T3DA 4HMPA 4F1KA 2AI3A 3TFWA 4E5PA 3H0KA 1FDTA 4HTFA 4QFCA 2J5RA 1JFTA 5KOHA 1T4DA 2OGSA 2WD8A 5IF9A 1KZ6A 2FKAA 2QKYA 1JHVA 2WYUA 1HTWA 3R5JA 1XRLA 4CR8A 1GQFA 3H1EA 2Z98A 3LDAA 4RTSA 4AYWA 2JLWA 5AVYA 2I6SA 5F9HA 2C3PA 3ERCA 3KAJA 4ENVA 3IQXA 3ADBA 3IYLW 3DBVO 2Z56A 2OG2A 4L51A 4H27A 3T5TA 2F3PA 4DYVA 2AB0A 3HKCA 3WLFA 3M4ZA 1HFJA 2HOQA 4DV1B 1TT5B 2B69A 3DNMA 1PR0A 1QCDA 1FRNA 1XNGA 1YVUA 3OM9A 3PKJA 5U4QA 4CPDA 4V2UA 2PRSA 3BHNA 4ZP1A 1NBMD 3CEPB 3O8DA 3QXSA 4J03A 1ORIA 1W96A 3ZV5A 4CF6A 5EEHA 3E2IA 2VYNA 1C9MA 1QVAA 3PP8A 1YKSA 4EB3A 1QP0A 2P62A 2IHUA 5B2FA 4JVMA 2ZRFA 3TN7A 3G8CA 4F9GA 3MWLA 1VQ1A 1NMZA 4MW0A 1RI2A 4LBYA 1U0OC 2QN1A 1OI2A 2ZUUA 3GK3A 4XJXA 3SE7A 3QNUA 2D00A 2VSXA 1ZOLA 4UMDA 1U8FO 2ONCA 1N0IA 2ECQA 5FOVA 1ZQ9A 4B2LA 5BMVF 1TO1E 3A3PA 2CJWA 2V65A 4MB0A 5EJEA 5LQRA 3ICOA 3VH1A 1DRWA 1XQ6A 2F8LA 3W05A 1DVRA 3ZX4A 1YSCA 1X19A 1GHTA 2QDKA 5LKRA 1VG0B 1IZ8A 2ZB8A 1V6CA 4JCCA 3A9CA 4O1MA 2Q8PA 4O4IB 4ED9A 5L51A 2X4GA 5EYPA 4EUHA 1ML4A 2CDCA 1FXWF 4RMGA 1UPUA 3OKCA 4JEIA 2A5GA 2XNHA 3EPJA 4G0MA 2PIDA 2GM4A 3EJ6A 5DEIA 4E3WA 3C6BA 3THRA 3L7BA 1CZHA 1KETA 1IJBA 1FRVA 1RLMA 3TOCA 3WIBA 5CCXA 4ZGBA 4IIEA 3OE4A 3L6EA 2Z6AA 2W9XA 2QMQA 2W8BA 3PX3A 3VPDA 2O19A 1T1GA 3I42A 4IAOA 1BD3A 1EB9A 4AP9A 4MWGA 3N7UA 4RKRA 2N75A 3BIJA 2DU8A 3OUTA 3WNCA 3IV6A 2C42A 1W85B 5EMLA 1IN7A 1KU0A 1NXVA 3L18A 4OBEA 3NOQA 2GNOA 1D2CA 1X70A 5J5VA 5A5DA 4QNRA 1N1MA 5F23A 3UXEA 4JK3A 4BNLA 5EE9A 4LYJA 4DMUB 16PKA 2BI8A 4JR1A 1VBFA 4D8XA 4RZXA 5BMVB 3ZGZA 1PUJA 1Y5RA 3G8AA 3QXXA 2RBKA 2J5XA 5C5DA 3P9PA 3CF2A 3BMQB 4WBNA 3W5BA 4EG6A 5K4HA 2ZUSA 1YCDA 1CUHA 1YOVA 4RPJA 3RFXA 4DV2B 1DC4A 5IWCA 4IHJA 3WLKX 4XCQA 3PHLA 1JVBA 3QEAZ 3GVXA 4N0QA 3ORFA 2BKVA 4QXPA 3CX7A 2O8VA 1GOTA 1Y9ZA 4TT3D 5DI3A 1KDZA 3V97A 3WWDA 4W9RA 4GFDA 4L4ZA 3HCCA 3WOHA 2Q2QA 4CG1A 4FHZA 1ZRMA 5JY6A 1U3WA 4KLNA 5LC1A 5K8LA 1FTGA 4DR1B 3FUUA 4TX1A 2FG5A 2ON6A 1H2BA 3MS2A 1TJ5A 4LTMA 1FUYB 3PDHA 5DHUA 5F35A 5AVZA 1I9CA 1VC2A 4EG0A 3KSRA 2HO4A 1YS4A 3VJRA 3E22B 4M9QA 2XNDA 2N9UA 4KQGA 2RHTA 2OV1A 4A6XA 2VZLA 2XMQA 4RVNA 5CX1B 2DMRA 4BO0A 3V8NA 3QXCA 1KSGA 4G1MB 3GO4A 4IIJB 4RKQA 2N42A 1THMA 5HIIA 1VJ5A 5GJWC 4X90A 5AUNB 4PHCA 1B2LA 1MGOA 4A16A 2YCLA 3IV7A 4C0JA 5BVHB 4YJGA 3TECE 1I6MA 4LNAA 1JHPA 3U1TA 4AXXA 4EPWA 1RSZA 1ZXLA 3CX8A 4RESA 4A6EA 1CERA 5KNDD 1D2EA 2BSQA 1KMCA 1VLLA 4PINA 3FGZA 4TLLB 4EEZA 2BIFA 2J3HA 5FA6A 4N8SA 5J5AA 4DIDA 2OD7A 1AO3A 4R8RA 1D4AA 3NBAA 4LZOA 3O5AA 2P79A 4D0NA 2A9RA 4J0GA 3EPLA 3GMTA 4QG3A 3PEUA 1VPVA 4N3AA 1TCBA 3U9SA 3ZR4B 2G3YA 4D4MA 3RBAA 3LRPA 2GQ0A 3M4YA 3O94A 3ONVA 4CDRA 2JIOA 2AFRA 1G19A 1S2OA 3S3TA 4FGJA 5FOQA 3RVJA 3O2NA 2QX7A 4LSMA 1DB3A 2V3VA 5EN4A 2PD4A 2HDWA 4LTDA 3WLRA 4RVSA 3B5EA 5KJEA 1WUTA 3BG5A 3I09A 1IEVA 4JOBA 2I80A 3ZV3A 4YUWA 4EPYA 1XZ8A 4IEFB 5ER9A 5DGDA 5I5EA 4BRSA 3V9PA 5JLJA 2OO5C 4RTQA 4QBGB 5JQGF 3UWOA 1KHHA 3HUUA 2DPYA 5IUJC 3AUFA 1FUIA 1I9GA 1MIOB 2Q49A 3EGVA 3L1JA 4BXOB 1Z6PA 4D43A 4DQXA 3PKIA 1T0IA 1ZO8A 2JC3A 2WUEA 5EWMA 1EG7A 1U4SA 5BVGA 2HPVA 5HE9A 2G72A 3C6ZA 4ZMBA 3GLHA 4W8GA 3IALA 3N7AA 4DIEA 4R41A 1SOWA 3SCZA 2OYCA 3RFUA 3VC1A 1TFUA 4BAGA 1GKIA 1RWQA 2ZS9A 2YN4A 4B74A 3U7RA 3FLAA 3JQFA 2IYEA 3VU9B 5AW6A 4H3VA 3Q7PA 5CA1B 2GN1A 2B30A 4YDQA 4QNNA 4E12A 2CNLA 2I9PA 1CPYA 2RDMA 4QELA 4MUJA 1XTKA 4J16A 1C9EA 1O89A 5AJZA 1WSBA 3ZN2A 2BBTA 1O6CA 3FCYA 3QG5A 1BS1A 1E98A 3IHWA 1AHNA 3IE0A 1LTQA 2WKPA 2IPXA 2O52A 2OV4A 4PAOA 4AP6A 2R1VB 1EFVB 5CVCA 3E9DA 3TM5A 5KVSA 3IPAA 5K2OA 4BP1A 1K8XB 3I8SA 1GITA 1QDUA 1VJDA 5JI2E 3Q12A 2V0NA 4G2TA 2AFIE 1Y81A 4HX5A 3UA3A 3VX4A 5K5EA 4RO0A 3KIPA 4PLZA 1TKCA 3OWOA 3COSA 4A0QA 2D6FA 3K0CA 4DNQA 2ZYHA 1IM2A 2M6RA 2PQ2A 4EMUA 1TCCA 5H81A 4LTNA 3WXMA 2ZUWA 4ALLA 3S1AA 1RYZA 3N9IA 3WK9A 3ZLVA 3EMDA 4QWWA 3L8GA 2IBMA 2ZAIA 4UE2A 3HKBB 4HR7A 5H4HA 5F5NA 2G7MC 4C6RA 3NGXA 3COVA 2FA9A 3T7EA 3MEQA 4GYKA 4Z2YA 4M54A 2DE0X 2XT9A 1ORRA 2VRWA 4NIMA 2JJ2D 1SXPA 1RJDA 3WSVA 1UBJS 3DO8A 1LDEA 2P90A 3MFYA 2QYSA 1GL6A 3AK4A 1F2UA 2R4QA 3SJCA 4R71A 1WQ4A 2DR0A 1V1MA 3EXFB 3ND6A 1CJMA 3ENQA 4GI2A 4EG4A 2HJHA 1BDIA 3KQUA 3VU1A 3TBHA 1P72A 4UVIA 4P93A 3PLAE 1KDRA 1OWPA 4FT2A 3LHKA 2XD4A 1RQXA 1SJ9A 3CN9A 4WMLA 2ZZNA 1RXCA 4AUMA 1PJTA 3EG9B 3VKHA 4MB2A 1A82A 1M2FA 1YMVA 3AU9A 3FDIA 1OFGA 5K05A 2I6XA 2I71A 3T4UA 2AJCA 5JATA 4ZCLA 1N7GA 4O8ZA 4GUDA 2C1ZA 2ZRKA 3REQA 3ITNA 3PGXA 4YDSA 5CM8B 2ZXFA 4BX3A 4E14A 2J0QA 5FNZA 2KB0A 1T8SA 1O96A 1RBQA 1HOXA 1M5UA 4D99A 3JQFC 1KYYA 3ANYB 2YHSA 4NTZA 1SKQA 1USWA 2FLKA 3GB9A 3RTGA 3BKWA 4HB0A 1VLZA 4K2AA 4RXMA 3E7WA 1MH1A 3GARA 3KZOA 4PYIA 4CLDA 1HYEA 1O54A 4EGCB 2G06A 1SKYE 4MVJH 1EAYA 1GA1A 2XADA 4PAGA 3K1ZA 4J16C 3ND8A 2DWQA 2CZCA 3GJ3A 5AHXA 1J09A 4TLCA 4CT4B 5GOTA 4DGQA 1Y1RA 2P4UA 3JWJA 1EEHA 3WJAA 4DJDC 2PLAA 1GTMA 4ZFNA 3S2ZA 1R12A 2NSLA 5CJPA 1RM3A 2QRJA 3NORA 1LFAA 2ZIXB 4GPAA 2QSZA 2JGRA 3GAZA 4WLOA 4PSUA 3INRA 3PPWA 4NICA 2FR8A 1NXXA 2GARA 5D7BA 3ZQ6A 5JC1A 5KQMA 2O8FB 3ABRB 1MX1A 3FCOA 2IHKA 3AOEA 4N0DA 4OJMX 1VSUA 4Q37A 4BJ5A 5C7LO 1ULAA 3PHIA 3OMLA 4HUQB 1ELOA 3I2IA 1YC2A 4FDVA 2P9EA 4UUOA 3RTAA 4CHGA 5ICGA 3M5DA 1UC8A 1GTG1 2QRNA 4Y2YA 3QWFA 1T2DA 4TVBA 5AM3A 3K9FC 3NU1A 1QYRA 3CURA 1Z22A 3IVAA 3TZKA 1H6CA 1Q3HA 3N2GB 5LB4A 1Y7LA 1NM5C 3UHAA 3KYBA 3BRSA 1XMIA 2ZIZA 2O3RA 4HH0A 2EBFX 3PL5A 1YNOA 3BVPA 1L4YA 4Y2HA 1DO2A 3EYAA 2CXPA 2ATCA 3MAJA 5AK4A 1E32A 4OJTA 4YT4A 4FR0A 1T8YA 2ZDQA 2DFNA 3KEMA 5AKKA 4TGLA 3SC3A 1T1JA 2JGIA 1KWKA 1L3BA 4XGQA 4LJSA 4J07A 3X0DA 2I2WA 1KI6B 2QRQA 2RHBA 3F3MA 2QNBA 3P9KA 4HGRA 3G2KA 3HVHA 5GONA 5B1DA 4F96A 1DAMA 3VV3A 5C4MA 3PA6A 1D8AA 3D7RA 3K20A 4G23A 4RHUA 4PYOA 1GRCA 2H07A 4EOGA 2V6MA 2AOVA 4DIBA 2WU0A 3SNHA 4GPEA 4OCZA 1RD4A 1REQA 1V3TA 4JVNA 3TWOA 4CEIA 2CFRA 1FLDA 3H5VA 5HIKA 2NZWA 1EHYA 4Z9XA 5TARA 3E1GA 2GAFA 1PIWA 3JX9A 3GZTB 5FI0B 2FP4A 3WLMA 4JC8A 4WVLA 4Z1MD 4KGDA 2DFVA 2ZWMA 4GP9A 4OHUA 4BQNA 1FMJA 4WXRA 1ZRHA 1C4XA 1TMKA 5DN6A 3FTPA 4BLSA 2WHEA 1ZNQO 4IF6A 1F7VA 4JSRA 2EARA 4Y1GA 3KFXA 3CZ5A 3GBVA 521PA 1KIMA 4E07A 1RWOA 4J2OA 4XWTA 1PL8A 4JLWA 1KJWA 4UEQA 1KFKB 2REQB 4DR5B 3RJMA 4YECA 2HYDA 3I6BA 4NARA 1SM4A 3LHFA 2ZSBA 4O2AF 3EXHB 4EZBA 1OZGA 3QLVA 2F1IA 1PT8A 3NM6B 3P94A 3FHCB 5EKDA 2FAXA 1KVSA 3HK2A 2D54A 2Z1NA 3ITDA 2H0AA 2RGUA 4N5LA 3X2SA 3OZUA 1GILA 2VUTA 3UPDA 4YMVA 5JAZA 4E11A 2XD9A 2P9JA 4WGGA 1VJGA 4F7WA 1OX6A 4OHVA 2Q5HA 2NQTA 2VO1A 4B4DA 3STHA 1KBQA 1IHUA 4KPFC 4HH3C 2I7CA 4CQJA 3WGVA 2QD1A 4X6XA 1CY8A 3L6OO 4XYBA 2FZVA 4K1XA 4LOJA 4B6PA 2ANCA 2QPOA 3I1JA 3TIGA 2H2GA 4AX8A 4REMA 4DB2A 2VQ6A 1YJCA 3CMCO 1OY1A 1C0PA 4UHCA 3OCZA 1WPXA 4Y1FA 5F9FA 3L93A 5GJBA 1C1HA 4X8OA 2QPAA 4CMIA 4S2UA 1KORA 4WESA 5KTSA 3KTDA 1QGAA 2CYBA 2IHZA 2WU8A 1R4NA 2GETA 2WVJA 4KVAA 3GJ5A 1OTHA 4KQ2A 5F7OA 4MP3A 4ETNA 1J97A 4MUFA 3VTKA 4H4CA 2PT7A 5CA0A 5A5VA 1Y7HA 4UHEA 1GTJ1 3EVFA 3KYCA 4Q3BA 4B40A 2V6GA 4P8RA 5E7MA 3UA4A 1D0VA 2X2OA 1PJBA 5J9FA 4Y6GB 3RS4A 2FPGA 3E5HA 1DLIA 1RWXA 3WV5A 4KO4S 4M1TA 2LGJA 3M83A 4RADA 5T4BA 3L0YA 3L8YA 2BE7A 2BJHA 1X1SA 1E1DA 4LZPA 4B81A 5C8DA 1MXFA 1YRBA 2A3RA 1M1NB 3P4UA 2VJKA 3PHHA 3WIUA 2PT9A 3SBOA 5KWJA 3J80A 2XUDA 2W70A 3RUDA 1QV9A 3W5AA 2DSTA 1WXXA 3ZD8A 2DERA 5HEKA 3ELWA 1FB5A 3AU8A 5CYOA 3S27A 2DBVO 5GZ1A 1E2QA 2IXGA 4BU1A 4N8DA 3KQNA 2LDXA 3MWDA 1QHYA 2CL5A 1RZRD 4E70A 3N05A 3IP5A 3KWMA 1DQNA 1YR1A 3SEZA 4XJTA 2QPLA 2PH3A 2MJLA 2QRLA 2P0YA 4LSGA 1FW8A 1RAFA 5DHFA 4BQFA 4HGQA 1ZGZA 5KYWB 3U1BA 4MR9B 3JD0A 1C3LA 1SXJE 2Z57A 1CZOA 4FOSA 5BWBA 5CDFA 1QMGA 1OAOA 2I8LA 1ZD5A 2DP4E 1Q95A 2FK7A 1OHHA 3S6JA 4WFKA 1XL0A 5T4EA 4KI0A 5C7OO 4X93A 3JQ8A 2YWXA 5DTIA 5FH9A 2X8JB 1R6AA 1SUWA 1A8QA 3N8GA 2ODEA 2A0WA 3QLVC 1X7ZB 4QRDA 3RS3A 2CJXA 3UJ8A 1JRLA 4FTWA 3NW9A 1C3XA 5DM4A 3FPEA 1GXSA 2VBGA 3OIUA 5IW8A 4F11A 1XTSA 2UDPA 2QN3A 3MGBA 4G0XA 4GLFA 1TGYA 4UDNA 2J0UB 3VMFA 3BD6A 4RTNA 2ETVA 1PGOA 3NBZC 3UMJA 3KQYA 3H2GA 1ZOSA 4NONA 3OF3A 2JLZA 1HYGA 2Q9BA 1RVDA 3PGKA 2P5YA 4GSKA 4ZQHA 1ZEJA 2F9LA 1COZA 2GK4A 1HORA 2HJWA 4HDNB 4O2AA 4EYGA 4UKDA 2JCBA 1IJKA 1C7JA 2C61A 1UDAA 1P1BA 1P4HA 1DWOA 4OOEA 2I2BA 1HQDA 4ILEA 3RFTA 1XZJA 1QXSA 2VDVE 1ABFA 4JLNA 2Q7DA 4A0GA 4YMLA 4F84A 2JIZA 3RYCB 4BKRA 4G41A 2ZB2A 5LSAA 1EZ4A 4KBFA 4W6QA 2W37A 1ZGAA 5A3RA 3EEBA 4N1AA 1FDUA 1SQFA 3UENA 4RQBA 3T4PA 4G1EB 3UJDA 1OB2A 4AICA 3ZLUA 2V7WA 4LNHA 4FEGA 1UPFA 5JI3E 2K7ZA 3AR7A 4WEOA 2YFKA 2NO1A 5GJVC 3WNZA 2HRCA 3CC8A 4E5VA 4OU5A 3DF9A 1AK1A 1NG1A 3GPCA 3ZK7A 1Q1EA 1G64A 4YT5A 3EXEB 1Y63A 1Z2EA 1JT9A 4NCJA 4UDXX 2FFJA 4HXFB 1RRMA 1XZFA 1N25A 2MSKA 3F7OA 3WHLA 3ZWQA 1WCV1 5L7TA 2QBYB 3UPUA 3I6ZA 2Z3VA 4FYIA 4IL5A 3ENWA 1G60A 2V4UA 4Z9FA 4D1YA 4K26A 3SJ7A 1PFKA 1BW9B 2OY0A 4OGKA 4OD0A 4KEAA 4NZ9A 5TGZA 1EK0A 3D5TA 4MUGA 4YCSA 3GDWA 1AQLA 1M1YE 4GGPA 4C04A 4D0SA 1XPOA 1EWYA 1OAOC 5H9VA 10MHA 4MYHA 1ORHA 2WABA 1SG0A 3Q2OA 3QIVA 4OIFA 5J23A 4DY6A 3HBNA 4L5IA 1JE0A 2OCXA 3DW3X 5FTKA 3SLKA 2BZGA 1J90A 3AF3A 3DMTA 1PR5A 1S3FA 4UARA 5IC6A 5L3QA 1RXVA 1VGQA 2W6PA 4URHA 3VPXA 1DCMA 3BIFA 1BA3A 3O8LA 5CXSA 5A06A 2QUBA 2GYVA 1M54A 4JOCA 2ID7A 1FBTA 1WZUA 4MH0R 5DNDA 1G66A 3KPYA 2XZOA 2WSSA 3D8TA 3DWFA 4EB6B 4UUBA 1P1CA 2PCLA 3PFBA 2E4ZA 5MF6A 3D3NA 1VLVA 3MELA 2GX6A 4PQGA 5CFQA 3Q8XB 4ND5A 1R16A 2O6HA 1U63A 3BTSA 4LDRA 3PNPA 3I61A 2REXB 4DLKA 3Q6IA 4WPGA 1XFDA 2DGDA 4FFRA 2HHHB 4PZLA 2FPKA 2ABWA 2VYVA 4MW4A 3MTQA 3N07A 1XELA 1XWWA 2DTEA 2GBPA 2H4WA 3K96A 4I6JA 4MQUA 4H18A 5T4HA 2HPAA 1PHPA 2H2AA 2GRJA 3I8OA 3MUNA 2GEDA 3T38A 5AW8A 3GOQA 4JX9A 1Z63A 2Q3BA 2OLJA 3I9NA 2WY2D 3X1KA 4IXWA 2G9NA 3MC1A 4KK3A 3K0BA 3UH0A 2QY9A 3WGNA 3LT1A 4TKLA 1GL7A 4UBLA 4FJ2A 3R44A 4XX0A 4WK4B 3SWWA 5C1IA 3HZRA 5GIPE 1XJ0A 3INTA 1BE8A 1KQOA 1BJKA 1RYDA 2B0JA 3K0HA 5BYJA 3V4ZA 5IM4F 4MS4B 3HP4A 1UWVA 1F14A 3KQHA 4R2IA 3V2UA 1U7XA 2OKGA 1ULTA 2XGMA 3NIBA 4IUBS 3SYMA 1JI3A 2HXGA 4R9RA 4E13A 5B58C 1EVIA 3NBUA 3H99A 3K70D 3AM1A 2B8WA 2IYXA 3H1BA 2LKDA 2WLSA 3LZ6A 1Y3IA 3OT5A 5IFLA 1OMOA 4AX4A 4BQSA 4QSHA 1O6FA 3A9VA 4YP6A 3NHKA 1I7QB 4G65A 3BA6A 5EOVA 4OXIA 4V3CA 1VCIA 1SVSA 2O0JA 4MWTA 3C3PA 3DC2A 4YUAA 3ZJVA 2AXEA 3TW8A 4KO2S 1CKEA 4G6ZA 4WLFA 2VXBA 3AR5A 2IP2A 1N2GA 2V6BA 1NVWQ 1NL3A 4MZDA 4TV9B 4WKNA 3RADC 2AI1A 1I14A 4MMZB 3T7SA 4BKPA 2FZKA 1M8GA 4LFBB 3RRMA 5KKCA 2VUSA 3B3GA 2Q45A 2VNJA 1F6WA 1KFCB 3LYLA 4QTZA 5DYNA 4D80A 1OX4A 2FN8A 3HZOA 1T2CA 3OAAD 1BHO1 4HB2A 3DNPA 4EA8A 4X6UA 4Z8YA 4MVCA 1ISGA 2H1WA 3S0JA 3DA8A 1HNXB 1DFIA 1Z8FA 1DX4A 4F4DA 4H6WA 4GPBA 1NWCA 3VHXA 3GRCA 4DJ5X 1ISMA 4B4UA 2RB5A 1OXUA 1PZHA 3OQ1A 3F6YA 4DLNA 1W4RA 4I46A 2HREA 1LH0A 1J9GA 4HXEB 2FRVA 1E9FA 1DIRA 1N6HA 2C94A 3RSSA 4PC7A 1YRAA 3QA9A 3EAFA 3OU7A 1JAZA 3QFTA 4JJFA 2W2QA 5D8DA 2IU0A 1G1AA 3H8SA 1JA1A 2C9DA 1HFKA 5FPPA 1XCMA 2P6MA 2NQ2C 1XROA 2WD9A 3KXDA 4YB8A 1TX4B 4ARBA 4Q3NA 4HGNA 2PLWA 5ECWA 2EBUA 3PBKA 2QRKA 1NG9A 5JECA 1WA5A 3THWB 3L8EA 4DR6B 4MICA 3GMDA 1K4YA 3IP6A 2C2MA 5CD1A 4MEAA 1NQAO 3F6EX 1X7HA 2XNSA 5ALJA 1V16A 2QVZX 3GZNA 5C3MA 1G63A 1WB9A 1CU1A 5HKOA 3COZA 1RKQA 2IXDA 4M8NE 1TF7A 2VHTA 5ALEA 3F4LA 1KMHA 1RM5A 3MUOA 4UTNA 5SY6A 2ECOA 3P97A 1PK8A 5ENDA 4JI2B 1Y34E 2AJBA 3U44A 2O1EA 2QRUA 2BGMA 1CP2A 4UZEA 4LRUA 3VR5A 1KBZA 2Z2YA 3I9KA 3E3OA 4F71A 1U7UA 1K92A 4HQ6A 4R51A 3RIEA 5H80A 5MGNA 3SR4A 4IGIA 4JOSA 1GZSA 3WNVA 3I32A 4FD3A 3OF5A 4LEIA 1L3CA 2QB5A 2HCJB 4EW2A 2FMHA 2FYTA 1LBHA 1CR0A 1XPJA 3JQ9C 5J47A 1SKAA 4QBHA 1KOLA 3WLOA 4XPZA 1E9BA 1HY3A 1UBUS 3AW9A 4EX6A 3G3EA 1EDEA 1O6ZA 4QU0A 2VTEA 1MA0A 2CLKB 3EDRA 4UNPA 1WP4A 4PQRA 5HRCA 1Q3TA 4AMUA 2O48X 2JIDA 1AUQA 3QPAA 2ERYA 2JBWA 4HNAA 4II7A 1E5DA 1W5BA 1XIVA 2COKA 3A2NA 2BGIA 3E9RA 4WJLA 4XVHA 4NULA 4Y1EA 2HA6A 1K6JA 4MV8A 4ERNA 4MEJA 3K9QO 4Z4FA 1KAQA 4FPXA 5C53B 4CTKA 4WJZA 4TWBA 2Z2XA 2PFKA 1G6HA 1H4VB 3NOVA 3I5UA 4S1OA 1LLDA 1SUDA 1CJVC 2PIAA 4RDIA 3PV0A 4K9OA 3TOSA 2FUKA 1KNXA 2VPPA 4Y9UA 1Y6GA 2Y0CA 4NXNB 5U9CA 1NMSA 2OVBA 4A92A 1EQUA 1C1XA 2WWWA 4KQFA 1JQLB 3VOTA 4PXSA 1A5AB 3ELDA 3FPLA 4L9SA 2ODNA 4Q47A 4BHTA 1KWGA 4RSGA 1E2GA 4L4RA 3SM9A 5ED0A 1DCTA 3ZGLA 3ZCTA 4ZT6A 1JI0A 1T3SA 5ALLA 4I55A 2HK9A 1YR9A 3DEYX 3JZAA 3WJ1A 3NEPX 1JEDA 3OC6A 1NE2A 2ZJAA 1NE7A 4ITVA 5JJCA 4D8VA 4DA8A 1RVV1 1C9KA 1QIHA 1SELA 5K0ZA 3ZUPA 4XWAA 3FSGD 2XXAB 3TMKA 1KZGB 3AF5A 4YONB 5GJCA 4E46A 5JC8A 1JR3A 1V26A 3F6PA 1D2HA 1WHTB 2HMWA 5FUWA 4EW6A 1JWAB 2C3MA 1ESNA 2VF8A 3GBPA 5JRJA 1ZGGA 2X6RA 1JTVA 1YU6A 1JKXA 3GGSA 4MKHA 3JAKA 4ZVVA 4Y7DA 4B3JA 5IJ9B 4GKJB 1Q84A 1SHUX 3GP3A 5EMHA 1DCKA 2EERA 4LW8A 1X2EA 5AJXA 1DC3A 2C2YA 4PPNA 5KYVA 2G1PA 1KI9A 1QRAA 3F7MA 4MUBA 1POXA 2ZIEA 4QG7A 5HHTA 1CQIA 3MSXA 3QMMA 4ZT7A 1NVMB 3SDSA 4P34A 4BO2A 1EGAA 2PS9A 1DEHA 3G1WA 3WTCA 1A9XB 3RUIA 3OM1A 1EX6A 3GRYA 4Z5XA 5JVDA 5KMGB 1C4KA 1YI0A 2Y05A 4RWZA 1VL2A 3G2QA 4Q93A 2ZP1A 3L7AA 3LT0A 1MJNA 3PTLA 3NNNA 3IOCA 4HN2A 3VXKA 4U9HS 2XUQA 2HU8A 4FW9A 4OXQA 3PHJA 2O1XA 4WK0B 1H9BA 1ZCAA 3C7DB 1PJLA 4XXHA 4LXHA 1ULHA 2E7ZA 1DRUA 1Z73A 1I7DA 3CZCA 2BHSA 2Q5LA 4K6CA 5LP6A 1EBBA 1OA1A 1XVAA 1MW9X 2JA2A 2DZDA 2QMOA 3A4VA 4HD8A 1QH9A 1EM8B 4AZVA 4N7RA 3N2YA 1CUWA 3GMSA 3UZUA 1LV7A 3OLCX 4KFTA 5FQNA 5P21A 4QICA 1LC0A 1V96A 2EP7A 2GPSA 2WI8A 3G89A 5LOVF 1JQ3A 3LC7O 2JJQA 1MB4A 1T2VA 2XECA 2Z6VA 3HB5X 4O4JB 1E6KA 5AHOA 3LK7A 3PJFA 2B2XA 2GPJA 1K6IA 3ZY6A 1HDZA 2EDCA 3K5IA 3W7BA 2G9VA 4KXFB 3VH4A 2EP5A 4BFTA 3FOBA 2H3HA 5T57A 5SY4A 3GVHA 4O4HA 4TLAA 4AKHA 1U2PA 1RMQA 3I9OA 1R0RE 1AZWA 1Y4SA 4DRXB 1YF3A 1OC2A 2FGKA 3LIIA 2EKLA 4PZYA 2VOJA 5G1NA 5FUMA 2X2PA 1QX3A 4KQKA 2BFCB 4I08A 1UDCA 3BXOA 2HGZA 5FOWA 3BMNB 3E23A 3PI6A 1O9HA 3ED1A 3IOBA 1GNRA 4UAUA 5DYIA 3TJRA 4PZEA 4RNDB 3KYDB 2VSOA 4DC9A 4QUJA 3C85A 1SRQA 4QATA 1UAAA 5BN5B 2HA5A 2G09A 1FYDA 2H5EA 2QMYA 3AY6A 5KQPA 3DGEC 2AYYA 1NRXA 3UXYA 4TM8A 1NVEA 3K4PA 5FDFA 1JHYA 2B78A 3H17A 3OZXA 2H18A 4MI3A 1EJ6A 1RPTA 3AEKA 1CR4A 3EFHA 4QA9A 1CJSA 1OAAA 3B8HA 1HLPA 2RSLA 3T3MB 4BE7B 4WGFA 3CZQA 2QP3A 4M83A 1NNSA 3Q3VA 2ZRMA 1A5BB 1E9DA 1NASA 5G2OA 3V7FA 3VZPA 4TKVA 1W9HA 4YVFA 3L4KA 1L7OA 4PC6A 3OBBA 1Y8RA 3PC8A 4UFNA 4X1YA 4R9VA 4YMHA 5EJ7A 3KZNA 3VOSA 4QXQA 1KA9H 5TB5A 5KCZA 4GDMA 3HU3A 2BR5A 1QHIA 1QIDA 3CT6A 4Z0PA 1AQIA 3A9UA 2IW3A 1ZHHA 1LV8A 2VNIA 1C3VA 3UJCA 5D51S 3CSDA 1NBAA 1H69A 1M2NA 2OXEA 2QLJA 4R7TA 1CUEA 3DSRA 1GZ6A 4M86A 3ZHTA 3TAXA 5KDOA 1DC8A 3BHJA 5DM1A 2WFMA 4R68A 3SQXA 4TTVA 2H4HA 3U40A 4WKPA 4ZYVA 2NU8A 3C1TA 2HWXA 5IKOA 4JX8A 3IPXA 1ZM4A 1N34B 5F98A 2G28A 5DNWA 3CYFA 3EXG2 1VIMA 5IX8A 1HUQA 3T7DA 3P9NA 4BEBA 1YONA 2W7TA 3FWPA 4I50B 4YRPA 1YBVA 3EGXA 1CD5A 1JQJC 4Q03A 4XUCA 2EKBA 1QR2A 4CG0A 1V3UA 2I03A 5LXTA 3VKUA 5JYCA 2D13A 1SXIA 2CL6X 3GT3A 3KJZA 2QTWB 1J1UA 1M8JA 3DXXA 3IPRA 4YJKA 1CJTC 1U1EA 5B53A 1LW7A 2G67A 4NG4A 4C7KA 3Q2KA 4FN4A 4QFBA 1K06A 3IAAA 1BDMA 3HCOA 4FN5A 4J94A 2JIRA 4QO7A 3GQBB 2Q46A 1RHJA 2H1FA 2NOAA 2IYYA 2PFSA 1XAGA 3FBGA 3L0PA 3IX7A 1LC3A 1YRYE 2JFXA 5DYGA 2VR1A 3UBMA 1R9GA 2B9VA 3B3JA 4CM5A 3P20A 3WHIA 1DKNA 1VXOA 1K5PA 3AF4A 1F3OA 3BB1A 3QM1A 4JHLA 4OP1A 2W2LD 3E48A 3BFKA 5A3QA 4MULA 2IGTA 4YRSA 3SICE 2OL4A 4LWPA 1N0HA 2FPIB 2ZIFA 1G6OA 5B7PA 1V9LA 1SN7A 4C21A 5BOSA 1NI5A 2ZBUA 2Z1DA 4AULA 3EOAI 4LRYA 2ILVA 4UCFA 3UWKA 3WJ7A 2Q0XA 5C8YF 1T5LA 3NGLA 1G41A 2C5LA 4ZD6A 2COUA 1O77A 3M8KA 2JJYA 2JVKA 2XYVA 4KUHA 4D44A 4X66B 4NZYA 2IY9A 2JAHA 5AMXA 4OHXA 5LOVA 3PNOA 2H85A 4KCGA 3PC8C 3L79A 4E94A 2CCGA 3CLSD 4NRDA 4AKIA 2OFPA 5I7FA 4BBJA 3G7NA 4YASA 1VOTA 3FDXA 3IOMA 2VTVA 4QUDA 4AJPA 5L4SA 1EGQA 4BDTA 3IOEA 4KX5A 4WY5A 3UUEA 2GN8A 4GL4A 4N5HX 4IFTA 4P86A 4OYLA 3KUXA 4BDSA 4AVYA 2FUG1 1U7DA 3E84A 3M6AA 4HEA6 5GAJA 4GLOA 1G5IA 3LLCA 3IUMA 2CZQA 1RPJA 4YJHA 4IRMA 3V8RA 4E21A 1HQCA 3RJTA 1LLQA 1C9YA 5ITZB 3L6DA 3ZPXA 3KWJA 9ATCA 3D02A 5EIEA 5DI3B 2R86A 1PFUA 3H2IA 1ZKMA 2CFTA 2ZYDA 4MA5A 4IDPA 2R11A 4ZZIA 3CHYA 4BNVA 1XQ9A 4IIUA 5A4KA 1JDSA 4MIKA 1OXBB 1QRDA 4F4UA 1DQYA 1ZIPA 2PRIA 3F8WA 3VYUB 1EA5A 4O5AA 5ENZA 4QUEA 1DAFA 4TTAA 2WF5A 4I55B 1CZNA 4RF2A 3MD0A 3GJSA 1WDLA 1M6YA 3JQQA 2YVAA 3JYOA 4FNAA 4TMTA 5K8TA 5BT9A 1CQXA 2IZ5A 4HDNA 1M10A 4O2AB 2X0EA 3WK4A 1YR6A 2V4MA 3UJNA 1P0PA 3UHJA 2DUNA 3PDWA 1Z7WA 4CTNA 1TZBA 3GEIA 3U7QA 4K0KB 1R0YA 2YNMD 1UK6A 4K9NA 4RJIA 4KNWA 2RBEA 1SD1A 4NEQA 1P7CA 3AO0B 4QJIA 3NHBA 4MCAA 1TADA 5EUCA 1AXGA 3KOMA 2HY7A 3S40A 2VXCA 1T9GS 2M2IA 3R3UA 1NY6A 2ZIWB 3DWGA 1XCPA 3I3SR 4YBZA 5GVRA 3TE7A 3TOXA 3TLKA 4K5QA 3TLMA 3V80A 3DEJA 2I7DA 3OFJA 4OHRA 2Z5LA 2GTPA 4QQ8A 3P27A 4NYIR 1SKUA 2OPBA 2X19A 5JPIA 1CUZA 3H4IA 3H5OA 3IHKA 1WY5A 2PU7A 1X1DA 1XU9A 1W5SA 2C0QA 4MNTA 4JEHA 2B4KA 2BUCA 2XMRA 4G0YA 1R88A 2ZI5A 3JXEA 3FLEA 3O3NB 4XM2A 4KRFA 3M6WA 1KO7A 1L5VA 2WA1A 1FYWA 4XAQA 5LP6B 2QVGA 3FNGA 2FUG6 2QN7A 3T7TA 1OBOA 2JBHA 2AT1A 3FPFA 4DDWA 2C95A 4XASA 3LQQA 2LV8A 4CN9A 1E2JA 3SVZA 3T7CA 2VDLB 2ZI7A 3DBHA 3EUWA 3DV9A 3FDJA 3MS7A 4LI0A 4TTRA 3S8MA 1N3LA 4HNVA 1QYVA 4U2BA 1RI4A 1JIXA 1KXJA 3GWZA 1QQ5A 3HG7A 4YAWA 2QE7A 3Q11A 1E6CA 1F06A 4DMMA 1QE5A 2W6CX 1KKLA 5BWNA 5L3QB 4UEJA 2ZK7A 1KEEB 1M2GA 1Z7GA 3I9LA 1PR3A 2YBDA 1IBCA 3JRNA 3F1LA 3NBKA 4YAIA 5KDDA 4P81A 2QA5A 2Y92A 3HVIA 2G8LA 3EA0A 3FUXA 3PFWO 1GUDA 3H5WA 2V59A 1T3LA 1XVUA 3FWHA 3W79A 3LWZA 3OUUA 2W6ID 1CS4C 3QE0A 4RIFA 1A5SB 2IELA 1BRMA 3E9QA 4KPGA 5AM0A 4CL8A 3LU1A 3DXFA 2IW1A 5AK3A 4DWOA 2GS9A 2YFHA 3H3JA 2PUEA 3BJIC 4GBMA 1IXYA 1OYOA 2P91A 2OSVA 2ERCA 1ORWA 2QY6A 3BEOA 5JXGA 1RHMA 5HZGA 2JFHA 3KZMA 4Z0HO 1X9HA 1NUAA 3C3BA 5EQDA 3T5DA 2B92A 5LLSA 5EQJB 1S2DA 4R9SA 2HJRA 2ZRPA 5AI8A 5HPYB 1EX7A 3GPIA 1E1RA 1DLJA 3ZNPA 3V6MA 4KH1A 2ECPA 1K8RA 1Z0AA 3W0LB 1RXWA 3NHPA 1LPOA 1FFBA 2QRZA 1R18A 4JI1B 1P2DA 2RH5A 2Y1XA 3IMFA 1HQKA 1U3CA 4H7KA 4UM5A 3WL3A 4Q4CA 4ZZ0A 5L7WA 1LBQA 1D2NA 1OFUA 1UZNA 5CK5A 1WOMA 4D82A 1CRPA 4WOCA 1BH2A 1G8GA 6CHYA 1NIJA 2ATVA 3SQMA 3U60B 4QU5A 4R69A 1KU6A 4Q48A 4D0GA 2EJWA 3G2NA 2P4QA 4BMXA 5DULA 3W8DA 3UMMA 3I9MA 4X1YB 3D6NB 2ZYRA 4OXNA 3KJFA 5K6AC 1BE1A 3X1ZA 2JHFA 5IS2A 1G18A 1PJSA 1LSUA 1B93A 1VSQA 2BZ0A 3LVBA 4FI3F 3IMGA 4I5IA 4NFSA 1EK5A 1OGJA 3HWSA 4CMGA 3KSBC 4ESVA 4F4HA 2IX9A 3LLMA 3ZQJA 1AHIA 3PQ5A 4JCOA 5AKXA 1E9AA 2R2AA 1OXXK 2MSDB 4N65A 3SHFA 1HF3A 3GNLA 1TNDA 2E4AA 3LF2A 2ZROA 3QPDA 3VUEA 1BXKA 4MV0A 4XPIB 4O2RA 5AHKA 4FFVA 4KH0A 1SCNE 3SSNA 5ESDA 3E9CA 1KS2A 1CDDA 1II0A 1ZM9A 1COWD 2WYOA 4M3NA 3ZE6A 2RG1A 3S28A 4BE4A 1DIAA 1TTHA 1T1IA 3OCYA 4LGCA 3ZCUA 1PEYA 2WBLC 4UTVA 2IOFK 3DBLA 3NTXA 3BZBA 4X84A 1I0LA 4OSEA 2XVMA 2AEMA 3WDMA 1VKZA 4U39A 5TXGA 1ORTA 4OQQA 1X0VA 4J0EA 3KQQA 2YHBA 4NS4A 2I7XA 4CDGA 1A98A 4K28A 4RKWA 4YAGA 4JT4A 3F5QA 3BRCA 5CDHA 4FUQA 1H22A 4MQ4A 3KL4A 4N5NA 4YLEA 5GQSA 2XOKA 3O82A 3E9MA 3MCUA 1O5TA 1UPBA 1GA4A 2CMKA 3JQAA 5IC5A 1P77A 1OLSB 2ZQYA 1DPGA 4XM1A 3ZDXB 3U16A 3AT1A 4G67A 2JLUA 3I0ZA 2L19A 3OT4A 4OAQA 1LQ2A 2H9YA 2CMFA 4MS1B 3MB8A 1GNPA 5KVQA 3TZ6A 3ZQ4A 4ECAA 1GU1A 1NF2A 4R7GA 1GGFA 1XZEA 1D6JA 1VLMA 1W25A 4Q3DA 3UMSA 4CLOB 1KOFA 2I6UA 4M9UA 3U4HA 4B47A 1PN3A 3ZIAD 2FJPA 1CJUC 4DPMA 3NAMA 2NTJA 1C41A 2OO7A 4C0XA 2F3QA 1XZMA 2VQ3A 4JUIA 3AF6A 2CB0A 1I0IA 1E9VA 2GD1O 1FPMA 2ENUA 1H8ED 1QPGA 2NTVA 3FMVA 1WUKS 3N2IA 4LUCA 4LF8B 3KZCA 1Z0IA 4IPTA 2DHDA 4OAOA 1P80A 2WTBA 1Q3KA 2PL1A 1EDZA 1WV0A 3CZ9A 4PQYA 2YX1A 4CF4A 3VNBA 3Q9NA 3I1FA 1SC9A 3RROA 5JDIC 4FU0A 2VPXA 3A32A 2BHTA 3DYIA 3H97A 5DE3A 3SYLA 5LWHA 5JSYA 2WQ6A 1BGVA 2I29A 5CM9C 4DV3B 3HFRA 3N5KA 1YDMA 1Q83A 1XQWA 3RQIA 3L9WA 1MC8A 1GRQA 2F1HA 4W5RA 2FP4B 2A9PA 2QGFA 5JTUA 4IJQA 3BZUA 3OEEA 4GX5A 4ODIA 2R25B 2JZNA 2HR1A 3AGPA 3KFLA 3V8VA 1PD1A 2BL4A 2JI4A 1US8A 3WLPA 4IFBA 4HNAB 2IZ1A 3GEEA 4MVJD 4MAFA 1JG2A 2FGJA 1YAJA 3SC6A 3SKVA 3W9SA 1PDWA 3ACBA 1NZDA 2BM8A 3UMFA 3FCCA 1GSOA 1E2LA 3HBAA 2VHXA 1F6DA 3F0TA 5BMOA 5KAMA 4MQFB 3CY6A 3UOAB 2ISCA 1K6MA 2Z95A 4IXDA 5IJXA 3HDQA 2NSHA 3DDUA 3AESA 2H8GA 4PYQA 1HE8B 1IEXA 1R8XA 1IVYA 5A3VA 5EJ4A 1AVTA 2YWJA 4R84A 2PX8A 5GM2A 2JAPA 3TVDA 3PXXA 1X94A 1ENOA 2R84A 4U63A 1SU4A 1CB7A 2HK7A 3H5LA 4DG5A 1W88B 1KYXA 4IM7A 4CGZA 1EXDA 4Z8XA 4KZKA 5BT8A 3GCWA 4AROA 4KQXA 1TYDE 3H0CA 4CF7A 3IIKA 3R0VA 2BEUA 1N9GA 2XEDA 1IHPA 3AHGA 1DV1A 3NV9A 3DTYA 1X7XA 1WAMA 1UXGA 1Y5NA 5CBKA 2G9RA 5BOSB 1RPZA 1HDGO 2D5BA 4OQZA 2IZ0A 3OPMA 3RC2A 4CM9A 2Y27A 4HXYA 5AVQA 2AMVA 4MI1A 1R1DA 5I9TA 3GH3A 4ZO6A 3X3HA 5LNK6 3CM0A 3KTFA 4K9MA 2E18A 4HYTA 5DMXA 5EIBC 4BNWA 2YFYA 1EVEA 2ZCJA 3E9EA 3MUFA 3QKTA 1YS9A 3AHHA 3B9RA 1X86B 1OLXA 3OHSX 1K98A 4GVLA 4NESA 4EA9A 1TA0A 4XUDA 4AL4A 1YIOA 2IU4A 4BNUA 4HAUA 4IHQA 3RSLA 2P77A 2H1RA 5TJ9A 3NHRA 4M1EA 1PYDA 4Q9HA 3BL5A 5CDUA 1T9ZA 5EUMA 2C2GA 1C8KA 4CE6A 2R5WA 5B30A 1ORVA 1OUMA 3PUWA 1IN4A 4KREA 4D9MA 1ML3A 1U8YA 5FI3A 4EUEA 5F3DA 4XQGA 5EMJA 1OH5A 1BKYA 1SA0A 2OZKA 3B51X 3UK6A 4BYGA 5DSTA 1IOWA 1JA9A 1NVGA 1Y8CA 2Z8ZA 2YHIA 3TOZA 2PUGA 4MW1A 6REQB 3COJA 2GN2A 1Q1GA 1RXEA 2A5YB 5I7AA 4DLBA 2NO6A 1TJ3A 3B1WA 3GNSA 3OIVA 4EFNA 3GPBA 4OYRA 3S44A 3IA7A 2A94A 2B37A 3LCJA 4ON9A 4ZT3A 3KQKA 1PR2A 1UQRA 4HDMB 4AJHA 5EQTA 3E9ZA 3LY7A 4JXJA 1HL7A 1DIHA 3O8BA 1TKBA 2EV9A 4HH4A 3QLUC 1GQYA 2HWWA 2QQFA 1WXQA 4S1PA 5JMTA 5IVKA 1XZKA 1NNEA 3EUFA 1XEAA 4L0CA 4I4NA 3M1LA 4RTJA 1SR8A 3D31A 4LNUB 1XLWA 3I4FA 1YL7A 3N86A 4L0DA 5FEUA 4IY1A 2HT1A 2JFPA 3AJ8A 5CBPB 1SXJD 2VCYA 5B3JC 4YRDA 1P6XA 1Z5NA 4GAEA 4YAFA 1TC2A 5C52B 2GPYA 2R00C 4MOWA 1IBSA 1UODA 1GZHB 2XVYA 1NLMA 2XMBA 2ZEJA 3FIJA 1Z4IA 3BSWA 3H4MA 3P1JA 4DT1A 4F6RA 4WKOA 4F92B 3QHPA 1CBUA 1EB8A 2Z2ZA 2HUPA 3FZEA 3A1TA 1QR6A 3GBSA 1G5FA 4HNHA 4PS0A 3WGZA 1T6YA 2ZBEA 5I01A 1ZQ1A 3V2IA 5LJLA 2F55A 3K8OE 1BHQ1 2DVMA 4WOPA 1J70A 4AF8A 3LRXA 4CR6A 1I3KA 3OPQA 4PNHA 4KFRA 3HKDB 1CVRA 2HU5A 3BE5A 1G7TA 4QD3A 2XWBF 1DBWA 4PE5B 4HVLA 3RSOA 2PBFA 2B94A 1UBHS 3KEFA 4OUDA 3ZBTA 3F78A 1RYEA 2OAQ1 4R16A 3P0EA 1AXRA 3KEGA 4CBVA 5AI4A 2AZ4A 4E2WA 4ZYUA 1YJBA 4EPVA 3HN2A 4FHCA 1YMUA 2P5SA 3CJRA 4OMDA 5FFMA 4AM8A 3BB3A 5C34B 2FZCA 1QQ7A 3EVDA 3WGKA 1E7YA 4K87A 5JHHB 3S5JA 4BLVA 5JMWA 2ZW9A 1QRSA 4I36A 3LX8A 3C3DA 1LJLA 4JZYA 1R37A 3O31A 2EL7A 4PM4A 3IR7A 3S2IA 3TIFA 6GPBA 4N12A 2W6QA 1ZM3A 1GY8A 4QTYA 4CLHA 2WWTA 4GM1A 4BLTA 2OT3B 1F0KA 1SIUA 2GUGA 1EE2A 4KYIB 3ADKA 2Q21A 4YK7A 1KOJA 5EZ5A 4DLSA 2PE5A 3ZD7A 1WCYA 5KNDH 1AIPA 1XTVA 3DV2A 4Q7EA 5FUYA 4H1HA 3RYIA 4RAQA 2P2CA 5D2CA 3JRXA 3B2QA 1HYHA 2AMLA 2O1WA 2R7AA 2LZ0A 4P2BA 1LTHR 1P2BA 4Z49A 4KIFA 4UDYX 4XIIA 2O2CA 2RGNA 5SZIA 1QDLB 4IUCS 3U3ZA 4BFCA 3F8SA 4QL3A 2WG0A 1A7UA 4LZAA 3W6PA 1NKSA 4GF5A 3AB3A 2HCFA 1M74A 1R0SA 1V7PC 2FDRA 4XD7D 4MS3B 3NVAA 1QS0A 1AV7A 2GXUA 1CEQA 5J2UF 1UP4A 4B75A 1RP7A 1ZC3A 1KI6A 5EP3A 1JDBC 4GKKB 1YI1A 2ESRA 3Q41A 3AWDA 4MVXA 1C0LA 1UM9B 4QGFA 1II8A 1JQBA 2E87A 1A72A 1N5MA 4HQ0A 4RPLA 3W2TA 4EF4A 4EGSA 3ICQB 2QRVB 4X85A 2FN9A 1UIRA 4YDHB 1A71A 4TQGA 2OG1A 2ZG6A 3BMCA 4J4TA 1VSTA 1MC4A 2VJDA 2QMZA 1JSXA 1FVFA 3I72A 4MRRA 4ZCQA 2X5XA 1XG5A 3JU3A 4PLHA 1SB9A 3TR5A 2XDQB 2XPCA 2PS0A 1NKTA 1WF3A 5LP1A 1CYEA 4WI1A 3Q6MA 4EHKA 3ZHRA 1G38A 4D2IA 1M2EA 3OMWA 1ATZA 2A92A 2F7SA 4IIYA 1VRWA 2JH9A 4GX0A 4L8WB 5ECGC 3U49A 1XA4A 4H31A 3HGQA 1HFWA 4TZ6A 2BSXA 4Q39A 3Q3GE 3E5MA 1MJFA 1N2OA 4HZGA 2PQ0A 2GWRA 1UDRA 1I5OA 1H2AS 1BJRE 2JHPA 5AVOA 3IDFA 1XQYA 2C5SA 4JWTA 1T4CB 3IERA 4BIIA 4LF6B 4KE8A 4V0KA 3R7WA 3M4JA 2FZWA 3TAUA 2Q3FA 4MZXA 1LD3A 1Z06A 5DHPA 2C29D 2YY6A 1NHWA 4J4HA 2XMDA 3ZZ1A 4B7AA 2PMKA 3EZ9A 1RQNA 5JS1A 1U7HA 1V8DA 1W93A 3OQPA 4EKYA 4V1CI 4QE3A 1X80A 4IRUB 2XDWA 1K9VF 5F64A 2J9FB 3G68A 3H9BA 1DKMA 4HQFA 1VZ3A 1JQ5A 4PF1A 4TS3A 3EPHA 1NOJA 3OA2A 4FQ7A 2NU7A 4PCUA 3ZD6A 2QT9A 1MP0A 4YRIA 2QLMA 4WY2A 1XQ1A 3L5OA 3Q85A 1Z7YA 3HSKA 4NATA 4ID9A 3DVQX 3ZY2A 5H68A 4IDDA 4D6YA 5DDIP 5GTDA 2BFEA 2ZB3A 1VM6A 4K9PA 1Q2UA 4LC0A 3ZEAA 1G9XA 4ARZA 3ZWBA 2VYND 3FDZA 3TB6A 4S1TA 3K05A 3OQHA 4HDAA 4AWBA 5GZ6A 3IDZA 4ZRDA 5L9AA 2I99A 5IAKA 3MOGA 3EHDA 2G76A 1V5WA 2OAP1 4XUGB 3RV3A 4ZYTA 1WULS 2PZ8A 4G09A 1ZNWA 4D42A 1IZ7A 3DC7A 4U4AA 1PO7A 2QN6A 1OTXA 1GKYA 1D5WA 5I5GA 3RUEA 1DJLA 1XCOA 4MINA 3OG9A 4X54A 2E4UA 4K6KA 1DG3A 2IUSA 2RH4A 1C0KA 1JJBA 4UREA 1ARZA 2GEJA 3MN1A 3EFOA 3OJWA 4H3KB 3LTNC 5AHWA 4C05A 5FP0A 5HMMA 4U8GA 3R74A 5KJ6A 3KYIB 2VJBA 4DN6A 3CX3A 2R8PA 2FJ0A 2WHXA 1RKUA 3F9IA 3HNPA 3ICWA 4R9UC 1FMLA 5TS3A 3TCXB 3TR0A 1U0HC 3D7SA 3JQPA 4K6OA 2WHRA 4HVCA 4JGGA 4ER5A 1LFDB 4JXXA 4JBYA 5A9SB 4NMLA 1H0KA 2PS1A 1TMYA 5EINA 1WCIA 3AVYA 3FW1A 3OOHA 3VJLA 4TSFD 4UAJA 2FWRA 2D2IA 1VKHA 4N82A 3GFOA 2PBLA 4DRZA 3U2QA 1Q0RA 1WPQA 3PB3A 4KXNA 1XXHE 1EGHA 4C43A 4BBZA 1JIKA 2FEAA 1FNNA 1Z38A 4FMPA 5FA8A 3STXA 5ALXA 3G0HA 2QV0A 4J0KA 2R7MA 4QJ5A 3EF1A 3DBRA 2ZRAA 3C4VA 2P5TB 2RCNA 4PY2A 1PRYA 1PYOA 2CYCA 5LMUB 5AW9A 3QUTA 4WA7A 2ZQ5A 3HLYA 4TKZA 4K03A 3LDGA 4TZKA 1TRHA 1ZVKA 4ZQCB 5DYYA 4DG9A 3H9QA 3SK0A 5I6DA 2YC4C 4L07A 1A5ZA 1JQKA 4FOPA 3FKSD 3TQSA 1PZFA 1SA0B 3RRFA 3HXKA 4V39A 5TGDA 2DHCA 2NWQA 2YV1A 3HXLA 3TW4A 3PTZA 1MFPA 4GKVA 4MQ5A 2IY7A 2QG6A 1Z7BA 2V54A 1ZUNB 2VUUA 3D8NA 3OQ6A 3IHLA 5JUWA 1Q0UA 3HJUA 3RYFB 1Q1BA 2A84A 4AG3A 5JNSA 4RGVA 1EVQA 2H48A 4KE9A 2ZBQA 1GVNB 4QARA 1MRSA 1UKBA 3UFBA 4JFRA 2JAXA 1GG9A 4X41A 2SECE 2HNAA 1W8DA 3E8SA 4HSEA 4Q1DA 2IU6A 2BZSA 3DTVB 5EWJB 1GRRA 3ZLJA 1MORA 4LJKA 3DKKA 5CPBA 5D1NA 2EKPA 4F04A 5C2JB 1FFYA 3S5UA 1HYBA 4WA8A 4FGSA 3S55A 3W5CA 2ZT8A 2LXNA 2C54A 1PJZA 5FAKA 4PU0A 3LXRA 4DJEC 5E38A 3CT4A 1JHMA 2WC1A 4P53A 3DEFA 2HEGA 3LV8A 4CHTA 4LDJA 1I3OA 1PSDA 2HSJA 2P8SA 1IEWA 3DZHA 3LD9A 4IGKA 4UBOA 4XE5A 3MGAA 1QO0D 1ZK3A 3AL2A 5K0BA 1V7ZA 3ISJA 1T3HA 1N6RA 3KWFA 1JAXA 4OQMA 2WVAA 3WFIA 2QTLA 1ZK2A 4CCYB 1W0KD 4R1MA 1P1HA 2IXTA 3HYTA 1IJFA 3ONFA 3VYTB 2G4LA 2QTNA 2R1ZA 1SC3A 3LX6A 2YXEA 3DXZA 1J5PA 4KTVE 5EVCA 5DWDA 2Q3JA 5BRNA 1T10A 3IOYA 4BOYA 4EQ6B 1GP2A 1PFWA 1I80A 3AEUA 3U3XA 1D1SA 2Q4BA 3PC3A 4OTZA 1R5NA 3O84A 4IO1A 3KZKA 2FNAA 1BJTA 3R6WA 4J91A 3WK7A 4BB5A 1KJNA 3UAXA 1H1LB 3DBOB 1I3MA 2KLBA 4I8DA 3TLZA 1S96A 1AUOA 2XTNA 2PHZA 2YZ2A 5AK0A 3GFGA 5B6JA 2OFXA 1X14A 1WKBA 3JD1A 1Y4UA 4HS4A 2OMKA 3O2SB 2L82A 2X5JO 2DQ4A 2FQWA 3C5WP 4YQEA 5IKXA 1R7RA 1WXDA 3SZLA 3NALA 3QK7A 4FBGA 1WETA 2XKKA 4DXAA 1GUBA 3WYBA 5HRAA 4TN1A 3AONB 5D7NA 4WDRA 3K94A 3UK7A 4DDTA 4UDOA 3FRIA 1E63A 2GOYA 3K71B 1GUAA 4AS1A 3GRZA 2PUTA 5F2KA 1LI4A 5DFAA 2ZWOA 3RABA 2I91A 4TWIA 1N6KA 1TPYA 1UBTS 3FGPA 4GUAA 3TRDA 3KR9A 3AG6A 4WXEA 4EY4A 3W9BA 2WTNA 1I4TD 1KVRA 2PXCA 2EW1A 3S29A 2AOUB 5BURA 3J81k 1AURA 4TOIA 3QY9A 5T6MA 4JLKA 1W73A 2Y9MB 3DHNA 2VEOA 1UDXA 3A1CA 2Q62A 2RHLA 3OM0A 4EJMA 5C0OE 4OKIA 1GUZA 3ILVA 1BFDA 4FXPA 3FTEA 2XMSA 3ND5A 1KS9A 2P35A 2CFOA 1M2OB 4L7VA 1J00A 1XK7A 5IZCC 4O6VA 4XB6B 5LYYA 3C4QA 3L7OA 4BGDA 1V4NA 1A9XA 1ZR4A 3KK0A 2CXTA 2IXBA 1RXIA 1EFHA 3GDFA 2HYIC 3MT8A 1WTCA 2AHRA 4QULA 2VEDA 3IMKA 1UBFA 2WKQA 1VP3A 1W47A 5AR1A 2CXHA 2HUNA 1DKOA 4AF6A 1Q2XA 2Q5QA 2YWBA 3O8QB 1U0LA 1KK3A 3EG9A 4GQAA 2QI9F 1H8HA 2B4TO 3F71A 4I4TB 4DBVO 4IDNA 2G7ZA 3D2LA 2FQ1A 3R8CA 2JJ2A 3F67A 4Z4QA 4FC6A 5E2AA 5G0WA 1N77A 1JDUA 1IIRA 2X9QA 4KWEA 4M8SA 1YVRA 2R751 2VKQA 4XYEA 3OLYA 2YOFA 5LD2B 4RDHA 1FLNA 3REFA 4Z1OA 1U0TA 3N2EA 5ALMA 2VHZA 3A10A 3AUTA 3UMBA 2XUJA 4DJFC 1JW9B 5JS8A 1BU5A 2L42A 4K9LA 1WD7A 4D8TA 3K9BA 1XTZA 4GYWA 3RF6A 5JRZA 3ZVNA 6NULA 2UUAB 3KXKA 5DVZA 3T54A 4JV5B 3AVOA 1G59A 5L53A 3IH5A 2LWIA 1N75A 2A0FA 3K31A 3IVXA 3ODGA 5LPNA 1E5VA 1CY7A 3QBVA 3G6WA 3U26A 2RGWA 5JALA 2JANA 4YQZA 2X4DA 2VAXA 5AI0A 3P2EA 1YI8A 3AEKB 3O95A 2EW8A 4ZQIA 2OM6A 1DARA 1JDVA 4JJ8A 4Q7KA 4RY9A 4Z4EA 1ULSA 2VQDA 4OQYA 5FJIA 2IE8A 5DP2A 1ZSNA 1BEEA 1ONOA 4ZOLA 2WU4A 3VR4H 4BWGA 3KXIA 3PIDA 3A6GA 4G0OA 4OHCA 5BN5A 3S8EA 1AHHA 4ENQA 3D8HA 1HL3A 1RC0A 2JFVA 5B57C 4KJXA 1JWBB 3EQ2A 1E1KA 4NCKA 3MG9A 3ZWVA 2CDAA 1A9RA 2VP4A 1URPA 5ILGA 4BNZA 4OGGA 3OQVA 3D3WA 1XTRA 3G2LA 2UYOA 1MLDA 4XLLA 2FPIA 3JAMA 2W2OA 1E18A 3FETA 2CVOA 5AOAA 5AH0A 5FLYA 3RTCA 2AF4C 4I9FA 4YQFA 2PPVA 5FBVB 2NO9A 3UK2A 5KTKA 4H0CA 1J20A 1BCSB 1O94C 3JYLA 4LBZA 5EP1A 4BRWA 3G2HA 1GPYA 5EXDA 3WL8A 5E4JA 1W1WA 4LFAB 2O2DA 4WNAA 2GN0A 3NM5A 1OB5A 2WR8A 3MJDA 1PQPA 5JAHA 1TM3E 2G0NA 3DOHA 1YUNA 3JASA 1RCFA 3K9WA 3CMMA 1K5DA 3L8ZA 4YAEA 1B41A 1PFYA 1SIOA 5IVIA 2QR3A 1IY9A 2CL7X 2X9LA 5EC8A 2WU3A 4IKPA 4PFKA 4REQB 3WDKA 1DJPA 1AV6A 1KYQA 4AIIA 1JPJA 3ZHYA 4C0KA 2WTAA 4E3ZA 1X1CA 1MC5A 2CLHB 4LJ8A 2C7OA 2WSLA 4IWXA 4ZZ3A 2FFBA 3SF8B 2PUAA 3LGAA 2O2EA 4CF3A 5DNYB 4HQOA 5F4BA 5JVDF 3SYRA 2RJNA 2WWGA 3H8VA 3PNQA 5K9ZA 3EZXA 1A2OA 4YJHB 4YTEA 4UASA 1I7SB 3RS2A 1MV5A 5JYEA 1QTNA 3QI2A 3NBXX 1NAHA 4OBBA 3BWYA 5IDVA 2OZPA 5AM2A 5D3QA 2ACEA 3Q8LA 1QYDA 2OUIA 4F97A 5C5IA 5IJ0A 3D3JA 4MGEA 1N8SA 2REQA 1K0UA 3GUCA 1T2EA 3I45A 3M7IA 4AKEA 1NFFA 3OO1A 4PZAA 5DGCA 2H5JA 4YWHA 5BV8A 3AUAA 2RGRA 4MTCA 1VMKA 2FOLA 4R54A 1YS7A 3T9DA 1O6GA 2C4VA 4Z1MA 3WMWA 2PVCA 4BIMA 3TLGB 3M1AA 3ML1A 1EUZA 4G5HA 4RTOA 1DX9A 3MJCA 4C01A 5DN6D 4MI9A 1NGSA 4Q0MA 1AN0A 3MMXA 1KK0A 4G5SA 3OO0A 5INTA 2IHNA 2J87A 1PTJC 1P1RA 2F9MA 2W43A 4EG7A 3RM3A 4QLBA 3C39A 4E5KA 2GVZC 3BICA 1JFLA 4LMBA 3E0QA 4HDMA 1KOGA 1RRFA 2X3UA 5FBWB 2FPRA 5KB3A 4U6NA 1DUIA 1J42A 3L7CA 4Z9AA 4OXRA 5KVAA 5HKBA 4QHYA 3B6EA 4C0HA 1WVGA 5AVXA 1I2AA 2KBEA 3LNCA 1GL3A 1G42A 1UFRA 2JARA 4PLPA 1Y6ZA 1U7ZA 2RHGB 3KSMA 2H1IA 3LY9A 4JQOA 1P4AA 3B78A 1QHHB 4TYPA 4KQIA 1QB7A 5I7HA 4DCVA 2JJ1D 5LDGA 5YASA 2R4TA 3ZK8A 2D2EA 3OY7A 4RHXA 3NB0A 4JSTA 3T1TA 1Z18A 2XUAA 1ZX1A 3CFYA 1KERA 4UQPA 4PO8A 2XV1A 2J0VA 2OLEA 2I1QA 5TF4A 2J67A 1E0JA 3MERA 4QPZA 3N0TA 4Y2UA 1BMTA 4FFNA 3VVBA 3PFFA 5CXUA 4EKIA 5DW0A 3HKBA 3IP7A 2DY0A 5MN6A 2AJDA 1IN5A 2XSZA 1J0XO 5FFFA 4HLDA 4PLVA 2JEOA 3UK0A 3FOEC 2AIRA 3DBRB 1E2BA 3WLJA 3LH5A 3HI4A 4KIJA 3O8RA 4BFZA 1CUDA 3BS4A 2AJLI 3UANA 3VYRB 1YKGA 4TKMA 3Q7EA 1U8CB 1B16A 2P41A 4MYUA 2HRRA 2BV3A 2ID4A 1NJFA 1ONBA 2DG2A 3BDVA 3HEMA 3ZQKA 4B3FX 4U7FA 1RTKA 2BLNA 3OTGA 5FQOA 1KQFA 1JEQB 1W4AA 2EDAA 3LDUA 3C7KA 3BWCA 2P0AA 3HH8A 3HZZA 4W99A 3I37X 3ZTTA 5CLGA 5H3CA 2W4MA 2XUHA 9LDBA 2GF9A 3OX2A 2BKLA 3EOZA 3QWBA 2QAJA 1MF7A 5K3FA 3VMMA 4HV4A 2Q27A 3T3EA 2Z04A 2WM9B 3EA5A 4I1SA 3TNJA 1TEXA 1MTOA 1W5TA 2AD1A 2NT3A 4ESOA 4G5OA 1NW9B 5JD5A 1AKEA 1KO5A 4HWKA 3B8EA 5F1OA 1RZRA 5T67A 1XMSA 2ZJOA 3D54D 3EVCA 2A35A 4ARAA 2JFQA 2XOEA 3DFMA 3KQPA 3RGGA 3I5MA 1T9KA 3EZYA 3R41A 4AN1A 4QPPA 2QTVB 3OF2A 4NV1A 1WKCA 3AERB 4CFZA 1BQEA 3LYHA 2ZE8A 1BXRB 3R40A 1F4LA 1OHHD 2V3CC 4EQZA 3MUEA 4QAJA 3FIUA 1H1LA 2NZYA