3OD2A

E. coli nikr soaked with excess nickel ions
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of low-affinity nickel binding to the nickel-responsive transcription factor NikR from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
molecule keywords Nickel-responsive regulatory protein
total genus 41
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3od2A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3od2A02
1U9PA 1X93A 2BJ1A 2NZCA 2WVCA 3BKFA 1NLAA 2KELA 1BAZA 2RBFA 3QOQA 2JXIA 1ARQA 2JXGA 1Q5YA 2WVBA 1BDVA 1PARA 2HZAA 2GPEA 4FXEA 4HV0A 1EA4A 2BNWA 3VEBA 2Y3YA 4ME7E 2K1OA 2BJ7A 1ARRA 2CADA 2WVEA 2BA3A 2JXHA 3BKUA 2K5JA 2BJ3A 2F1FA 2K6LA 3FMTA 2AY0A 3VW4A 3FT7A 1Q5VA 1QTGA 3PHTA 3QSIA 2CAJA 2BJ9A 1B28A 1BDTA 1P94A 2WVFA 3LGHA 2CAXA 2BSQE 2CA9A 2K9IA 1MNTA 1MYKA 2WVDA 3GXQA 4D8JA 1B01A 2BNZA 3VEAA 2K29A 2PC6A 2H1OE 2BJ8A 1MYLA 3H87C 2CPGA 2FGCA 3BKTA 3OD2A 1IRQA 2HZVA
chains in the Genus database with same CATH superfamily
4HT5A 2CUYA 2KELA 2PE8A 3GB0A 3RB4A 1REVA 5F8NA 2OMOA 2AW0A 2D41A 2BNWA 4CT9A 1FK9A 4IH5A 3SFUA 1K1QA 1GEHA 4WFAQ 3FBEA 4DLEA 4ELTA 4TN2A 4QQBA 1AROP 3I31A 1O51A 5CYJA 5HBMA 1AUDA 1HNZF 4J9OA 2BJ3A 1MW7A 3L95X 5C24B 3TA2A 5C42A 1RHRB 2G0IA 3D2WA 3VAMA 4DR5F 1C0TB 1TL3A 2QFIA 2AN7A 3JB9k 3HHDA 3H90A 3DN9A 2LA6A 4B9MA 3KOAA 1KONA 3RUBL 2MJNA 1S4FA 4ED7A 3CMES 3HX9A 3ISNC 4Q8EA 1SI9A 3CD7A 5HMYA 1L3UA 3PTWA 1MNTA 2OPRA 1NDKA 4J9VA 2CPDA 2RH3A 1SL2A 2MZSA 8RUCA 2RHSB 2KJWA 4K4UA 2YWEA 4QU6A 4X62J 5ITHA 1V3RA 1SUQA 2NLWA 2A0FB 2HS3A 3DOMA 4LIRA 4MAKA 5B0GA 4WJBA 1H2VZ 3CO9A 4CO2A 2HZAA 2V50A 2XCPA 1CULB 3GYNA 2P9GA 1RADB 3JSRA 3ENQA 1REVB 1KSPA 1F3VA 1LW0A 3BGFA 1TQLA 4LRAA 2D3O1 3QGPA 3NG8A 3GV8B 1RTZA 3I4PA 1YTYA 3O5TB 2XMMA 2XMWA 2GVDA 3DRPA 4YQWA 4DX8H 3KLGB 1KEKA 3E2EA 2HW3A 3MPWA 1KQSR 2PIIA 3QMQA 5HBMB 4FVMA 1GXLA 4AXIA 2OAUA 3CIMA 1BHNA 5C42B 3DDIA 2U2FA 4ZVSB 3SQOP 1BE4A 5IFMA 2WBRA 3F56A 4JI0F 3CCMS 1W2IA 4KC5A 4IOCQ 5T7LA 2YKQA 3RB0A 1X4AA 3JSYA 3RBZA 3UCUP 2I38A 4QIEA 5LSLA 1C1CB 4B9TA 1HMVB 4UY8T 3A8JA 2NXJA 5L1KA 3GP9A 4I6WA 3GFXA 5J1PA 2QL5B 3NAIA 3W65A 2W9BB 4C8LA 5B7WA 2EVZA 2IFXA 3R5DA 2ZH2A 1T03B 2Y3YA 2F4FA 3DOMB 4NA1A 3HO1A 3QBCA 4DL4A 1JLCB 5E41A 3NOGA 1HARA 5G4DA 4FN5A 1RT1B 3A3OB 2FHJD 4WKYA 5FIIA 1LW0B 3G82A 1VK3A 2RQKA 3MR6A 2V4QA 1X4DA 1WDTA 4RL1A 2ZJPQ 1HNWF 4EFAC 4DQIA 1WSRA 4IYQA 2JJ4D 3KUGA 1EQ0A 1LOUA 4QR2A 4NZ6A 4YUDA 3TJ8A 2F4VF 2B7CB 2B4VA 2H9ZA 2XZWA 3IWXA 4NCGB 3A4TA 4ALZA 1T3NA 4N76A 3PIOQ 3OHBA 1H6KX 3J7YU 2EPIA 4Q0BA 2E7XA 2GZOA 2B6AB 4HI1A 2W7OA 1RAGB 1N34F 1M5OC 3THTA 4Y2CA 2VFRA 1UVMA 2W9BA 4ILMA 2FIUA 1RWNB 1C4AA 4Z7YA 2UP1A 1OMSA 3SQGB 3KKFA 1U1OA 4DV4F 1U2RA 4F4AA 2AEJA 2W2NP 5BR8J 3C2PA 3UVJA 1B64A 3G96A 5KOXA 5LMUF 2X1FA 2LQJA 1QVFR 4USKA 5ETPA 2CJAA 2W9CA 1NNDA 2VUGA 4FS1A 2I8EA 1KKHA 2J8AA 3R6LB 3K5MA 2PT0A 3HT0A 3QT6A 4NA2A 1PC4A 3IC1A 4DEZA 2XYGB 4M5DB 5J1NA 1IQZA 4U95A 3K0JA 2R7RA 2XMKA 4RUCA 2O66A 2HVZA 2V0NA 2FGOA 2KN4A 4X64F 1M5SA 1L3KA 4X4SA 2BANB 2BBEA 3HFVA 3KDNA 3KLIA 3PO5A 2JEJA 1AFIA 4JYAJ 4NCGA 1KS2A 2DKOB 1F6TA 2DYAA 2IRXA 4R25A 3VQSA 1JNZB 4HI2A 3TANA 3LA0A 3PKYA 4G1IA 3G8QA 1DTTA 4NLOA 5F8IA 4YDXA 4F4XA 1VQ4S 3IBFB 2E5LJ 1YQHA 4W4MA 2X3DA 2D74B 3GMGA 1WDDA 1EETB 3AAWB 1UVJA 4ELVA 4IG0B 3QIPA 2FJWA 2YKMB 4HEA9 3UVJB 4XPEA 3RU0A 3HT3A 1PILA 1YHQS 2LEBA 2RUGA 2BABA 4L74A 2WB1D 2H5IB 2CZ9A 1WF2A 1RBLA 2IM2A 4O4GA 5D77A 4OYWA 5KFZA 2CQ0A 3GWCA 1T8EA 2OFHX 2DGSA 5BYQA 4L75A 1HWKA 3ZFVA 3C14B 2OPQB 1S6UA 2A6MA 2YKOA 2YNGA 2ZH1A 4ECXA 2UXCJ 2BANA 1G2EA 1H2UX 2NR0A 3P49B 2RDDA 5HJXA 5K8NA 2J7WA 4OLOA 1A9NB 1S97A 5A8RA 4NXNF 1HI0P 1PC5A 3IRXB 3CCZA 5HROB 2OH2A 5KFLA 1RI7A 2KT2A 1Z2LA 3GSDA 5K9FA 1N33F 3JTPA 4O44A 4NX9A 1O6XA 2QEXS 2OTJS 5HVFA 2Q66A 5KOWA 1XC9A 1D1UA 1OJ4A 1FVSA 3AXMA 1T7PA 3HHLD 2OPPA 5ETLA 3K17A 5KFIA 4K4XA 4OJHA 1EETA 2JH3A 4UOHA 3BSOA 2DGQA 1TR0A 2GJ2A 2HEKA 3O6QA 3WIUA 2BYCA 2J76E 1RU1A 2NUUG 3ET6B 1GMUA 1T9TA 3M05A 3QIPB 5HQMA 3PIPQ 4OYXA 4C97A 3ZZOA 3VTIA 5DDRC 3CCJS 3TX8A 3RR7A 1SJFA 2I0XA 1RCOB 2BEFA 2G13A 1ACMB 2KO1A 2V5HG 3TARA 2DXDA 2GQ2A 4OZ3A 4WFBQ 4NA3A 3TQEA 3BGUA 4QWBA 2CJXB 2HQIA 2OPQA 4ES1A 1V5VA 2Z58B 1RGVA 3DI6A 2IIHA 2PEBA 1RHQB 2AIRB 4NMLA 4RKUC 1CG2A 4TYBA 4R5PA 2KFYA 4JI6J 1HD1A 4Y34A 5DQIA 1OS5A 1Y3KA 4NRUA 2QLWA 3M32B 4WFXA 4JV1A 3LW5C 5A8RB 2KG0A 3W9JA 2KG1A 4X2BA 4ZVHA 2EC2A 1NUEA 1RJJA 2CJYB 2G0CA 2ZVSA 3QAEA 5BXIA 3NWRA 2W9AA 4DR3F 3KTQA 2VC0A 3NMAA 1J5OB 4UF4A 5CCMA 1P94A 2G1HA 4TY8B 2JL9A 1C4CA 4WE1B 1RISA 4LFAF 2BNZA 4FF4A 5C25A 4B3OB 5GADI 1VBYA 3MPUB 8ATCB 4UQTA 4M5KA 1QLNA 3MHYA 4Q45A 3BSAA 3D5MA 1GT8A 4DUZJ 2ZUGA 4DR2J 1IKXB 3AA9A 3QOQA 2XM3A 2XMVA 2VFSA 1FEEA 2ASLA 3ONQA 3SSSA 4LRDA 4CLZA 5ETVA 2OMLA 1TL1A 1TUWA 3I82A 4R8UA 1SVDA 4PAAA 3W2VA 3KLHA 3GIMA 4DV3F 3KUEA 1WC0A 1EAYC 4WIIA 2A18A 4DUTA 1Z4UA 2HIYA 2WTFA 3BDPA 1OO0B 2M8HA 3N5FA 2DNRA 4P7TA 4ZPVR 2CQGA 5F41A 3T6BA 2V8DA 3TA0A 1I1GA 2KZZA 3CJKB 4J9PA 1TL4A 4ZVRB 5IZHA 2LDYA 1NK9A 3PYEA 4KGXB 1UVNA 3DOLA 3AB4B 2F9JA 5LMUJ 1V3SA 1S0NA 2ZH9A 4EUVA 5SZTA 4GC6A 2XHWA 3L4BC 1UEVA 4PQAA 1T02A 5KT5A 1R0AB 1TFWA 2Q1LA 2GIQA 4LMZA 3NWGA 2YKNA 3TP2A 1E6YB 3OHAA 4B3SJ 4HHUA 1DBDA 3KUHA 1KR4A 3D3BJ 3J7Z5 1SC1B 2EI5A 3PW4A 2YWKA 1NHVA 2J5AA 1IKXA 3SZ2A 2YX4A 1ZZNA 2PD1A 2KTQA 2AEFA 3ZZTA 2D7SA 2I9SA 3DGVA 4DX5A 2HRYA 1ZTWA 1YJNS 2ZC3A 2Y1LB 1JLBB 3LAMA 1SC6A 1QAIA 4IDKA 4OX8A 1TUGB 4LF4F 3NRBA 3I55S 1QAJA 2OEJA 4NLXA 1NBEB 3CJRA 3EX7B 1RSCA 2RSQA 1HI1A 1WJ9A 3HI9A 3IR6B 5D6GA 2W2PP 1HW8A 3S01A 2BKNA 2JLFA 2A2CA 3CJKA 3VV2B 2MSTA 2EG1A 2X1GA 2WB4A 1NU4A 3BR9A 2XMAA 2GHVC 1S57A 3DOLB 5K14B 3MFIA 2RVJA 2GMHA 1YKWA 1HWLA 2M9KA 1MLAA 4NPOA 1U26A 1K8AT 2GIFA 2FHKA 4RBVA 3HCXA 5EWGA 3M9NB 1NK5A 2HG4A 3H2VE 1N56A 1S1XA 2XY5A 4XTTA 1MSWD 1R27B 4N8OA 3TA1A 2HVDA 4D3HA 2JEGA 4USUA 4ZPDA 5E7OB 3NCPA 3GFZA 3O2IA 4E98A 5D0RA 1X9SA 1XR7A 3NMRA 2IRYA 2WRMA 2RQMA 2AYEA 2BACA 3C15B 3A12A 3UNGC 5CH7B 3A3PB 3MR2A 2OUGA 3GIKA 1VHFA 4PG7A 4O0NA 1CPZA 3DMJA 1NXIA 3IAM9 4U8YA 1VQLS 4B3RJ 2AJ0A 2R8IA 4ZJLA 2JFDA 2VFVA 4IDKB 2GW8A 5SUHA 4EYIB 2OEMA 4C3LA 2QSWA 4D3GA 3Q0AA 3DLKB 3ETOA 3FCWA 1TZ0A 3N6NA 2DNOA 3VEAA 4OI2A 4U8VA 3M1VA 3KLEB 2UUCJ 1JLGB 2N4DA 4LSNB 4HYKA 3FCHA 4CNYA 5A2QY 1RHMB 3BKFA 5KFAA 4DV6F 2W24A 1GMWD 1BAZA 1HBUB 4KB7A 5ETNA 2QMUB 2R7OA 5K14A 4A8MP 1BDVA 3P6YC 1APSA 4P52A 1HI8A 3QT5A 1M5HA 3NNHA 1U6FA 4EO8A 4J9SA 3V6DB 2HS4A 2C22A 4PABA 4ELUA 4ES2A 4F25A 2MPUA 3PXGa 2KT5A 3CSKA 2LQ5A 4KR0B 3A3NB 5ETSA 2MDAA 3D1HA 3MUMP 4RW4B 1NZAA 4DL5A 3D54A 3KK2B 3H2UB 3DHWC 3MAAA 3Q24A 1RTDA 3IR7B 3QFHA 4ZVEA 4TLRA 5KT7A 2FVCA 2B9YA 4Y28C 3OVAA 3GIJA 3N79A 1VIXA 1HHSA 4Y2KA 3N4WA 4ZPWR 3EPGA 4F4WA 1NKBA 1PJ5A 1IJEB 3M8SA 4RNMA 4F4KA 5FJ4A 5AE2A 4KTQA 4DFJA 1W26A 5J1EA 5RUBA 5F8GA 2UVUA 2ZZNA 2NQPA 3KLEA 2KDOA 3HJFA 5DM7Q 1ZETA 2XULA 3P96A 5G0RA 4HV0A 2BV3A 1S0OA 4LF5J 4NLSA 1HBUA 2K06A 3QYYA 5KFNA 4ED6A 1FFGB 1SXLA 1CQNA 2CJBA 3GZ7A 2QE5A 4NLGA 1HBOB 1DQ8A 1R8PA 3THPA 5KG5A 2UXDJ 3ULHA 1WTBA 2CIMA 2Z2ZA 5EUHA 4DV4J 5J2PA 4MFBA 4Y65A 3RZAA 4LF9J 3KK2A 3SYZA 1HIYA 3WDOA 3MAAB 1RTDB 5M2UA 1O5JA 4A8XA 2R2TA 5IWAJ 3P3DA 4CYUA 5LMNJ 4DR1J 1RWOB 1TKTA 2KI2A 3TZWA 2MTLA 5KFVA 2ZH5A 3IM9A 3M8QA 4DR7J 1PBUA 1NRKA 1VLYA 3D9BA 4KGVB 3EPIA 1DURA 4RU2A 1RT7B 5A76A 3TZYA 2NCKL 4X4NA 1SH3A 4OYIA 1CJUA 2YNHB 2W1BA 3U1LA 4NYPA 2B4PA 4JI8F 2XGQA 3W8PA 3M8ZA 4JI1J 2K1RA 3PX4A 2E5HA 4B3TF 1RP5A 1D8ZA 4OI0A 2ZNZA 5DGAA 1U6BA 4DSIA 2Q3PA 3MTKA 1WSVA 7AT1B 2ZH8A 1Q8KA 3I0SB 3E3XA 2ZZTA 1WORA 3HSDA 2CWKA 4P7VA 2HBRB 1VQYA 4TVAB 3H4DA 4KRWA 3OSNA 3LF0A 4C98A 4J90A 3LOUA 2PI4A 3I96A 3R2DJ 5EN1A 4CTAB 2C3UA 3RTVA 1PGZA 2F5GA 4I7FA 4IO1A 2G2ZA 3TAMB 3OJUA 1IBMJ 3MD1A 2AZ1A 5BYRA 1Y11A 4FXDA 1ARQA 3CE8A 5KFYA 2MKJA 2GJIA 3U27A 2RNEA 4MKVA 1AB8A 1TKTB 3RAXA 1UMJA 2DO0A 4ETXA 2ASDA 4RW9A 2FTRA 1DLOA 5B0EA 3MXHP 2GX8A 5KG6A 2XBPA 5F8MA 3PFOA 1T95A 2XMUA 1GTHA 1YK9A 4NEZA 1RT2A 4OL8A 2BMBA 4CLPA 1AYEA 3T41A 1NPPA 1S1VA 2HGNA 5KFEA 2A3JA 2V67A 4HTIA 2FLNA 2K1RB 1FDBA 1N5VA 1M5VC 4FYXB 4URSA 3P45B 5GAEU 3J7ZT 2DVIA 1CJTB 2CDRB 1MMNA 1XMQF 3RG6A 2XO7A 1RT3A 3I0SA 4IG3B 5DJBA 3CDAA 3HLUA 3KDOA 2HFVA 5D15A 2RS8A 2BA9A 3A13A 4I64A 3TNVA 5J2NB 2CPGA 3EVMA 2BXJA 2IBKA 4DPWA 1W7WA 5KFPA 4NEYA 1KLMB 3BM7A 4Q44A 3MR3A 4RW6B 4I7FB 3TAMA 2YQ1A 3AOBA 2OPSA 4C3KA 2HURA 4NLYA 2G2OA 4AYBD 4DX7A 2IY5B 2KKHA 4NLPA 2J6UA 1RB0A 2E7VA 1FXRA 3CJ2A 2FHJA 3MM8B 4RW9B 4DV1J 3IGVA 1ZYQA 3JQMA 3OW2R 2HRUA 2OGUA 1RT2B 5KFSA 3RGIA 2ILZA 3HM9A 1JLAB 2CQ1A 1VS3A 3CJ8A 4WBFA 3CCUS 4DFMA 5D4LA 2FHMA 2C3OA 2CQ2A 1BLUA 1ULRA 4M5GA 5DM6Q 3MEGA 3PFEA 2B8QA 4OHYA 3P8BB 3ZZPA 1WKLA 1WOSA 4PUOB 2P6SA 4RW8B 1GAOA 3HHEA 4UOGA 5EGYA 2M70A 1U8WA 2JVRA 3W5ZA 4YDDB 5J2NA 2RF2B 2XQCA 4DL7A 1NPKA 2IJFA 4GVBA 3GIRA 1HQEB 1NSAA 2RHQB 1TKZB 3J81Y 1XMOJ 2U1AA 3AJ1A 3BYRA 3P5BP 4RW6A 3VGSA 1QSYA 2Z2YB 2AJ1A 4P2MA 4O3PA 3HSZA 3GIIA 6FD1A 4DV5J 5KFTA 2QLXA 1FRHA 3DCAA 3GPAA 1U6ZA 4MYUA 4FF1A 4MIAA 3A8IA 2ZH6A 1I5OB 1OPIA 3MM8A 5KFFA 1WHYA 1LFWA 4B9VA 4OJ1A 4DSEA 4ZP7A 3NL0A 5L1JA 2EEYA 3LGMA 1YITS 4NE9C 3C6UA 1JLAA 1CSJA 4I4BA 4U96A 4FYDA 1QD1A 2CWXA 2M8DB 2UVVA 2IDLA 2W2MP 5FLXY 4A8WA 3GTYX 2W8KA 4NXNJ 2XNRA 1OSDA 1M90T 1Q86T 1DARA 1ZS6A 4M94A 2DH7A 4USHA 1WNEA 1VQNS 4CLYA 5CAAA 5KT6A 2LXIA 4DFKA 4IH6A 1C0UA 2QIFA 3UN2A 3G6XA 2XEXA 2RF2A 2D3OR 2K2PA 5F3ZA 1U2FA 2IA6A 3BJYA 1HQEA 3T1HF 2KL8A 3T5KA 3QWPA 4NYOA 4E8UA 1K47A 1SV5A 4WTYA 1FI4A 3CDWA 3JSBA 4RO0A 1S4EA 4G1PA 3KJNB 1IBMF 2ZOFA 1DRZA 3DLHA 2DK2A 2YH1A 5HSPA 5IT9U 4C8YA 5KAKA 1RABB 2KU7A 3T3FA 1JLFB 1AXQA 4DPXA 4TQRA 3C6UB 2QA2A 2O01C 3ELHA 1RA6A 2VQFF 3TUPA 1G6BA 1SQFA 3JS9A 3IO1A 1QSSA 4CH0S 1NK4A 2B4UA 2WSEC 4ECSA 1UA0A 1U24A 2G1DA 3A8KA 2D3ZA 3FQLA 3FQKA 2HS0A 1O8BA 4CM2A 2KXNB 4A8SA 1Q8LA 2OO4A 4DCJB 2HIQA 1B7FA 2GMJA 4WXWA 3QNWB 1VQ5S 2GAHC 2C2MB 2DB1A 1KP6A 1I51B 2F9DA 5CZVA 3NGRA 1U1KA 3I9ZA 2VG5B 2BQUA 3D0IE 3EICA 5IV3A 3DLEB 2IHR1 1UJ4A 3IM8A 4N5SA 5I42A 4ITSA 4LR7A 2H5JB 1HA1A 1OG7A 4OJGA 1FF2A 3T5JA 2MKHA 4CDIA 1QAYA 3NOCA 2M0GB 2DNZA 2IPOB 3M2UB 1JLFA 1VI7A 2J0WA 3GONA 2WVBA 2MZQA 3PEHA 4BHQA 4DHVA 4N56A 4USTA 5IM0B 2LECA 1NK8A 2AGOA 2UV8A 3VVUA 2PN6A 3KJQB 1HBMA 2VPYB 2IM3A 2C3PA 3LP1A 5CHCB 3MM7B 3BQ2A 4ED5A 2HAFA 4H4OA 2HAIA 2MY8A 2RQ4A 4ZCLA 2UUBJ 1HW9A 4J5OA 5D78A 5A8KA 4M5NA 2VBWA 3MR7A 3C19A 3X1LB 2HGLA 3OUYA 2RQCA 3HHLB 5F3TA 4PQUA 4A8YA 4NLRA 2ABYA 2CQPA 2VQFJ 2DY1A 2ZD1A 1DAXA 3G71S 1KLNA 2H1OE 2CJ9A 2P9CA 2VG5A 2HWTA 3D0GE 1U1LA 1K9MT 2Z56B 3DLEA 4QJVA 4DZDA 5I42B 1KNZA 1GX5A 3PJXA 1X0FA 3DU5A 3BGLA 3M6WA 3CPWR 1LWCA 1IM4A 2EKNA 2LFVA 2LYVA 3KFWX 2BM0A 2UZAA 3M2UA 1PKUA 1EKRA 1KBRA 4ZMMA 4EYHB 2ACYA 3PY8A 2QYCA 1RT5A 4ZIWA 2JXHA 1IKVA 3BBFA 3NBPA 4EGLA 2E5JA 3AT1B 2FVRA 3VZIA 3NS7B 1S12A 2DNGA 1SIWB 3ZZ0A 2PI5A 4ECVA 1FVQA 1HBMB 3KMSA 2YWWA 4H4OB 3WC2A 1OPZA 3PNIA 4X65F 5KG3A 1FT8A 2VQEF 3B6BA 3TVYA 5HI7A 3V2UC 1FTRA 3L9ZA 4HHHA 2CA9A 2UVWA 2K7KA 3CJ4A 1JJCB 1IKYB 3T1YJ 2PMWA 3IS9B 3OXGA 5DDPC 2E1PA 3EGWB 1JLEA 2DNLA 1H7WA 2IJNA 3MCOA 1PAUB 2RDIA 5E0OA 3PR5B 3GQCA 1UWBB 5EDWA 1VC6A 2P5VA 2MLZA 5J2MB 1D3WA 4A46A 1ZZFA 2XC9A 4AUKA 4DG1A 4YFUA 3W64A 4DU7A 5F9LA 2AYGA 4LJMA 2W7PA 3MAHA 1IWAA 4FVCA 3L7UA 2W01A 3UDVA 2MQNA 4U7CA 2Z4PA 3OR1A 1F5AA 1LWCB 4ZLLA 3TZZA 2IYGA 3DLBA 4B3RF 3Q8YA 4C8OA 1FD8A 2NUHA 2GC8A 2YNFA 1RT5B 1SB6A 3DRXA 2VH7A 3MEEB 3NBPB 4WYWA 2F3JA 3GV5B 1NJXA 1IQTA 3I5CA 1XN9A 2ATLA 4NASA 1HWUA 4JV0A 1S9GB 4HT7A 1WD6A 2BRKA 1EQMA 3EZOA 4YY3F 5IS2A 1VRQC 2ILYA 2ZDPA 3W5YA 4TU9A 4DS5A 2ZUAA 3IFEA 2XSJA 5L9NA 3QATA 4HH0A 4ZLNA 2HGMA 4FXVA 2FJVA 3IS9A 1MWZA 3IG1B 3ISZA 1JLEB 4J9QA 1LW2B 1UKUA 3C16A 4ZHRA 4LRCA 2UUAJ 5DZ6A 1X7VA 4B08A 7FDRA 2FZKB 1N32F 3MMAA 5EWFA 4RBUA 2DNHA 1LWEB 2DGUA 2LKZA 2OFGX 3CB4A 3FSYA 3ICLA 4OX7A 4DG1B 2K6LA 3W63A 1PBAA 1PAEX 5I3PA 3OR1B 2B5JA 2NPFA 2GGPB 4ENOA 2W25A 1TMJA 4W92B 1FNOA 4ZVQB 1VIOA 4AL5A 3EGNA 1MWYA 1J27A 4CLKA 3I5BA 3W7BA 3JAMY 4YOEA 4BWJA 2F8EX 2WOMB 1KQGB 3R3TA 1WKKA 3BB5A 4ZP9A 3UDEA 2MKKA 5H9FK 4Z2XA 1Q7YT 3RYLA 2C2EA 1RAHB 2LEPA 2YWGA 5AXNA 5H1SV 4F7VA 4ECWA 1FDNA 2XSJB 3UR3C 1H73A 1VQOS 1RWXB 4NYZA 3H20A 2R3VA 2OSRA 1LW2A 2CPYA 4P75A 3MF5A 3UE2A 3C16B 4KH0B 4ZHRB 2CADA 2JLGA 1X60A 2CG4A 2WSFC 1IBLJ 3T1AA 2C2RA 5LT5A 4I69A 3ZZRA 3NNAA 4FS2A 2DGXA 2RJZA 4RBTA 5ETRA 5BJRA 4K8RA 4YY3J 2KM8B 3PJWA 3M8PA 4PYAA 3DLJA 2RE1A 1ZM4A 3BF4A 4LF7F 3T19A 4C3MA 3LUYA 2KFNA 1FE4A 4EBCA 4D8JA 3TAPA 4C8KA 1YBUA 4LVOP 3FBBA 3ISND 3FZ2A 1RT6B 4DV0F 2ATCB 1KD1T 1N88A 3C6TB 3RB3A 1U9PA 3ENVA 3K89A 1FRLA 4K4ZA 3K5OA 1RU2A 1KTVA 2JXIA 2J7KA 3IGNA 3MM5A 5BYSA 2JEFA 4UZCA 4DR5J 2RD5C 3HZGA 1YJRA 2OSQA 2WW4A 1IR1A 4K2XA 4RR5A 5IOLA 1DFDA 4QIFA 4ZLPA 4CO1A 5KFWA 2EFPA 1S5ZA 3TZXA 3HHKA 1GFWB 2K8GA 4CLLA 2HMIB 3EZUA 4DSKA 2B51A 1RA7A 3DGPB 2M5YA 3SMZA 3BPSP 3SFGA 4IOAQ 4QW8A 2CAXA 1ZPWX 1F9EB 2F40A 3AA8A 3M8PB 2WW8A 1FKOA 1LNQA 4YB5A 5IQQA 4CO0A 3J7YI 2DHHA 2HQDA 4I2QA 2KRBA 3LP2B 1YWXA 4FDFA 3WQPA 3IMQJ 2HZVA 4X84A 4JB8B 2DNYA 4C4WA 1NLAA 1X5OA 3NNCA 1P9QC 2GS8A 4MK8A 5ADZA 1M1KT 1ITPA 3B78A 3A1YG 1FKPB 3V81B 1OQ3A 3HVTA 2Q43A 1TK8A 1RTIB 2B7BB 1M5KC 2VL1A 4OHWA 4P6QA 1KQFB 4FNIA 2A1BA 2BW7A 2PMZD 3JQKA 2R2SA 3ZZZA 1S48A 2ZHBA 5CYQA 3MMCB 1MN7A 3MWBA 1WEYA 1V9OA 9ATCB 1IVZA 2CPXA 3DGPA 4WWSA 4DV7J 1AA1B 2N3OA 2FJXA 3AJDA 3V6HA 3MEKA 2ZZMA 2OEKA 1S6OA 4F8RA 2VQEJ 3MEDA 4RWWA 3JYTA 2CYYA 3X3UA 4X4VA 5D8HB 2OKQA 2V4JA 3QO9B 3UN5A 4HVZA 4I56A 5E5NA 1T9XA 1SQGA 2JX2A 4ED8A 4EBDA 4LF8J 2PA8D 3MM6A 2KHCA 2QMWA 1U4BA 4JV5F 4Q43A 1OIAA 3EVWA 3N5BA 3WZ0A 1RE1B 4IR9A 3R7SB 4NL5A 2KZMA 2HVEA 2ZJRQ 2V9KA 4DN9A 4J9NA 2CPEA 2M52A 5DG7A 2HFOA 1RTHB 3T5HA 2V9WA 3LJPA 3LP0B 1QAXA 1LV5A 1TU0B 2CPHA 1RTIA 2P9EA 3KG1A 4ANDA 5GAHI 2ALYB 4NCBA 1HNVB 2VOPA 2AJQA 1X5SA 2P6TA 2D1CA 1RAIB 1R43A 2R42A 5DS7A 1W2BR 3Q8SB 2BZ2A 4JV2A 4RNHA 2XS5A 1LQ9A 1IR0A 2KYZA 2PC6A 4JI2F 4DV2J 4O3QA 2R8JA 1JXLA 3KJVB 2HVIA 1BQNA 1XJWB 4MIBA 3G86A 3VQTA 3T1YF 4XIUA 1XNQF 3QIDA 1RWKB 1G1XA 1RLDA 2DEIA 2LU2A 1ZM2A 3FKBA 3JXOA 3MEDB 4ZVPB 4ETZA 4DV3J 1FK9B 4Y3CA 2HFUA 2UUCF 2FQQB 2QX0A 4CNZA 6FDRA 4J9MA 1S10A 4KQZA 4ZN1A 2Q79A 3LGNA 3GE9A 3G6ES 3MM6B 2GMLA 2CNNB 2CPFA 5HMZA 1TL3B 2V63A 3K8VA 4P9SA 2XGPA 3OSPA 3K5NA 3PW0A 4UOFA 2YWFA 5IV4A 1Q82T 1T05A 1QTGA 4MYTA 2ROEA 5DDQC 3SSRA 1RWWB 1Y7PA 1X5PA 2HHSA 4PG4A 2OPRB 4DI6A 2MZ1A 1OHNA 3RR8A 2AZ3A 1XWLA 1TL7B 3D6HB 4QOTA 1X31C 5AJ3F 5AE1A 1T9WA 2NPIA 2KM8C 1VQMS 2I1RA 2JVOA 2MKCA 4OMFG 3L09A 3PX0A 2CJKA 1U45A 4FKXA 1JMTA 4LT6A 3OL8A 1NSKL 2BW2A 4KO0B 1BQNB 4YMEA 3KJVA 2DCLA 1U1MA 5KFBA 1D0EA 2VHGA 2EKYA 2CRLA 2C2NA 1YBTA 2MLXA 2QYGA 4CLUA 3DM2B 1X4GA 2BE7D 3UWTA 4ZK7M 5HVGA 3UDCA 2BA3A 1IBLF 3I56S 4KE5A 5H9EJ 2DBBA 2H3EB 5KG2A 4YP3A 5KFQA 3G4SS 2ERRA 2XYHB 3VGVA 2DHAA 1KHWA 2XY7A 1M1GA 1WACA 3G8SA 2A2DA 1MWQA 2AT1B 2P8IA 2BQ3A 4E2FB 1VQ9S 4LUBA 5T7LB 2VOOA 1T05B 1B0VA 1WHVA 1N36J 1FESA 4XAKA 3HHLC 2NXUA 4AFFA 2V4RA 3RBDA 1HMVA 5D3GA 5CD4H 4OYAA 2BRLA 2FJDB 2JHEA 1MYLA 4HACA 4MH8A 4KBIA 5JXSA 4K4WA 2UUTA 3UQSA 4L72B 1YG0A 2NXCA 1LXJA 3H5XA 1G4CA 1KOOA 2GHPA 2MQLA 3G87A 5LOQA 3CCES 1IM6A 1KOHA 2LMIA 2ZWOA 1F9FA 1IBCB 3S8SA 1NK7A 2HLUA 2CPJA 2X7IA 3NS6A 1WC3A 1JLCA 2BJDA 1TV6A 2O1PA 3D4JA 4H54A 4NLDA 4U67Q 2SXLA 2HHPA 3PM9A 4TXSA 3CTRA 1EZZB 4KO0A 5C2GA 2HVHA 2FYXA 3VZHA 5HQ8A 1Q81T 1N5YB 3G82B 2R7UA 4YS2A 1U1NA 3UPFA 5GAEI 2W7AA 3QLHA 5E2QA 1H74A 2CXEA 2VG7B 3BZQA 3CCSS 2CAJA 5A0YB 1YSJA 4OYMA 3V6KA 3CC7S 4WP8A 2DPJA 2F8MA 1F5BA 1CEZA 4OI4A 3ZZYA 3KXDA 5K5MA 3S6EA 3LWMA 4FYYB 1YJ9S 4DUZF 1R8HA 4O4RA 4Q0BB 5IT4A 4EI2A 4ED0A 3R9LA 5D3GB 3ITHB 3GV7B 1CBKA 4UTGA 1JIHA 5D0EA 4HACB 5LM7E 3U1MA 2WONB 5L46A 4WU2A 5THWA 1RAAB 3G6VA 3Q23A 2C1EB 4QIVA 3W1YC 2MSSA 3B8HA 3E01B 4OZNA 2FUG9 4R0JA 5DO2A 3SQGA 7FD1A 2DGVA 2IMWP 3UI3A 2BOPA 2RMLA 1CC7A 2QA4S 1QM9A 1FA0A 2ZITA 2W9CB 1S1TB 1FWPA 3OL9A 4USJC 5HO4A 1WC1A 4X4OA 3H0PA 3HPOA 1N5YA 1R89A 3D67A 2HHUA 4YR2A 2KVQE 1UJ6A 1BDTA 4JI3F 3NKYA 3SCJE 4LFBJ 3T6JA 1XNQJ 2VG7A 5AXKA 4ZVTB 4KAIA 3D66A 1YLXA 4I6YA 4X65J 4OHXA 1NHKL 3KLIB 2GO8A 1RAFB 3R97A 4QBUA 3CDEA 2Y1JA 3AD8C 3U7JA 2BJ1A 3FEXB 4BWMA 3H5SA 1ZM9A 2LCWA 4ZPTR 3N6LA 4LRVA 3EUNA 1K73T 5CYMA 4DQRA 3UCZP 4K0KJ 1L3TA 3MZIA 2HYIB 1J5EJ 2WONA 2VBYA 1VGYA 1L3SA 2MMYA 1WI8A 2OD6A 1Y5IB 2BOAA 4MTPA 5IT0A 2B9EA 1NJYA 4IG0A 3CCRS 2IM0A 3D68A 4DN0A 2YKMA 1TFYA 1MNEA 3PJ9A 1WOOA 5L38A 4C48A 4O4GB 1NHUA 2AP6A 4V1Ak 1S9EA 1X4HA 1NK6A 2CZ4A 3MAQA 4USVA 1GH8A 4IR1A 2UXCF 3HVRA 4NI2B 4LFBF 2YNGB 1R6VA 2XWYA 4LSZB 3M8RA 2B56A 3TYTA 3CUNA 2FZGB 1PIEA 5IC4B 2AF6A 3NGUA 3AY0A 2FVPA 3AXKA 1Y5LB 3IRXA 3OFEA 5DETA 5HROA 2Z2MA 2YNIB 2CQCA 1NDPA 5J2QA 3CJ3A 3S7RA 2K3KA 4C11A 1ELOA 3UD3P 1S0MA 4F50A 2QLFB 5F9NA 3MMJA 3DKDA 1J5EF 3NAHA 2OPPB 1SL0A 4QWDA 3V81A 2BDPA 3EM1A 5IT9Y 3Q8PB 1B70B 4DMZA 1UAWA 3ET6A 3NCQA 3QJJA 3CMQA 2CNKB 5CCLA 2WVDA 1S1UA 2YQ0A 2X3GA 2UV8G 4DU8A 3RW7A 1WWHA 4FXWA 3VCDA 4DL3A 1N8RT 5KTQA 2UVRA 3VR1A 4QPTA 1FRXA 1K0TA 4U7UK 1R0CB 2EW9A 2UUWA 4R0EA 3FRYA 3MGJA 2VJUA 2CVIA 4NI2A 2QFJA 3DI6B 2XMTA 3RW6A 4IO9Q 1F60B 4R5PB 4HR2A 1VBKA 3RRKA 2RDJA 3JTOA 1UVLA 3QRRA 3OLBA 3M32A 2KXHA 5KT4A 3GR0A 3PX6A 1XQIA 2M88A 1RDRA 1U1RA 2YNIA 2CNLB 2GV1A 1PCAA 1J5OA 2N82B 2D3UA 4KFBB 1JQGA 3BO2A 3VALA 3ZTOA 3TAQA 1QVGR 4ED2A 4DS4A 5CXTA 4MT1A 4DXLA 1EB0A 1XR5A 2IMOA 4GMKA 4ANCA 3MECA 3BQ1A 2ZBQA 4H4KC 1H38A 2Y9HA 3V4IB 1VC0A 2RU9A 3DRRA 2RRBA 2UU9F 2PO4A 4AAIA 4MKBA 1VQKS 1FFSB 4ZIVA 4RU9A 2HHTA 1KVIA 1V3ZA 1SJ1A 3ZO7A 2WBMA 4R8UB 4X66J 3KLHB 2DH9A 4OZ0A 3PKMA 1EP4B 1T94A 3OT9A 2B3TB 2N4CA 3O8WA 2FC8A 1XNRF 4F26A 3QSYB 4KV8A 4S0MA 3SEOA 3D6MB 4Y0FA 4A8OA 1FNMA 2MXYA 3MPVA 2J0XA 3J81j 4K4SA 4WK3A 3QT7A 4TLQA 5F0UA 2HK2A 2HNYB 5BR8F 1JWWA 1H3DA 3OTCA 1OSCA 2JDJA 1Q53A 4OX9J 1HWJA 3HD2A 3RBEA 4KFBA 4MMOA 3ZTPA 4YR3A 3EGZA 2R2RA 3KNAA 1HR0F 3VAIA 1N0VC 5AT1B 1N34J 1KFSA 1R8BA 2ZWPA 4I67A 3T5LA 2HQCA 3G5OA 2ZBPA 1HWIA 4ILLA 1E6YA 2V94A 2X51A 3V4IA 2O3DA 2VKZG 4M95A 4FNHA 2K3IA 3Q2SC 4DV5F 3O44A 3TUJC 2QGFB 3CWJA 5ETMA 1X4BA 2HSEB 2ZEJA 4QZVB 4WFYA 4YB7A 4DPTA 3RAMA 1K0VA 4MKAA 1X0PA 3PYFA 2KKEA 2EBEA 2HQGA 3R1LA 4K7QA 2UUAF 3G9CA 1TKDA 1KVJA 3F41A 1OYDA 2RKIB 4O23A 3FT7A 3VF0B 5DG8A 4KV8B 4BS2A 4B3MF 1HYSB 2APOA 1RYRA 2WVFA 1GNKA 1HKAA 2EBGA 1VRTA 3FEZA 2DISA 5F8LA 4DSFA 2K9IA 2VJVA 2I2YA 3FGVA 5E3RA 3W62A 3ADAC 4L76A 2W8LA 4M1KA 3CXCR 1NK0A 4DR4J 1LXNA 1YZ7A 2HLTA 4URQU 3OQ2A 5B0FA 2MQMA 4USWA 2HQFA 3LPEA 4X4PA 1S1XB 2RIJA 3MOZA 2D9OA 4WPAA 1BMQB 2VG6B 4I2PB 1FRKA 1H2TZ 4P10A 2HBZB 3HDSA 3E51A 4A8QA 2R7XA 4KHMA 3BDEA 3NS5A 2UXDF 4DPYA 3MR5A 4X4UA 1GQEA 2QL7B 3UFCX 1JXVA 3IBCB 2VA2A 4WZQA 4KGMA 3GR1A 1VCTA 2GVZA 4IRKA 3FMTA 5L1LA 2QG9B 1XMQJ 5DG9A 3PHTA 3G8TA 3MD3A 4F3QA 3N6MA 3DLKA 2LA4A 1JJ4A 2CG8A 1P6TA 3Q2TC 1XK8A 2MKYA 2VASA 1QDUB 1RZMA 4NLUA 1XEZA 2JFKA 6AT1B 2FVQA 4QU7A 1R31A 2QTWA 1NAQA 5MAOA 5HL7Q 4F4ZA 3OBIA 2HWHA 1NJIT 2Y8YA 3J7A1 4N8NA 4G1QA 2XCAA 5D4OA 3DXSX 2H65B 2MJUA 2YH0A 3OR2A 1N6QA 1HHTP 3M4XA 3Q8UA 2BX6A 3SCIE 4LREA 4DR6F 3V6DA 3SBMA 1I6JA 4I2PA 2VG6A 4RJVA 4ZCKA 3BKUA 4UOCA 1LWFB 3EE3A 4KHRA 4IH7A 4NZ7A 4RW4A 1WG5A 4ERDA 1M0SA 3M6XA 4KIAA 5JVGQ 1JXEA 1WG1A 2DNMA 1RLCL 4LBIA 3ZTRA 2IVYA 3IR7A 5GAGU 1S99A 2R8HA 4B17A 2NZ4A 1HLWA 2VKRA 1VQ7S 1BWVA 3MMBB 3D28A 5DLFA 4QPXA 5M2RA 1PG5B 2QL9B 4M5LA 4ZDNA 1JKHB 2BQRA 4C0OC 4NWBA 2VU5A 3US5A 3DRSB 1KTQA 2OTLS 2KHDA 2YPYA 1FEHA 1YVFA 2FPHX 2ZOGA 4ID5B 5C2CA 1XNRJ 2JLEA 4GRSA 3FNNA 3K8WA 3NCRA 5G0RB 4WYLA 2J6TA 1TKXB 2VZ9A 2M7SA 4ZPAA 3ZZUA 3PZPA 2R8KA 1N6QB 3BYPA 4MK9A 2HZCA 2V2KA 1MU2B 1TP7A 3OFHA 4P2SA 2IC3B 4K5SA 2MLYA 4USIA 3PRDA 1HBNB 4DR7F 2R7SA 2MEWA 3J81U 3CMAS 3Q8QB 3QT8A 3QGHA 3CEDA 1JLQB 3EYZA 2C28A 4QIWD 1LWFA 1E6VA 4ID8A 5J2PB 1NLKL 4YB1P 1Q8IA 3K57A 3ENWA 2E1RA 2BSQE 4J7CA 5I4MA 2QT7A 5ETKA 2QA4G 5B0AA 4FPRA 1DQ9A 5DQHA 4UQGA 3E8OA 3I87A 2CQ3A 4GO5X 2HRTA 3CJTA 3DC2A 1B99A 3Q8VA 4CLFA 2HHQA 1AZSA 3LO3A 3ILIA 2CPIA 2GNKA 3M8QB 4H4MA 3FEYB 3UW1A 3MURP 1JKHA 1ZH5A 3HHNB 2V8GA 2ASYA 2IYIA 3DRSA 4JBCA 4HDHA 4NXMF 4KHPJ 1CJUB 2YNHA 4OLPA 5K8MA 4ID5A 4CQ1A 5B09A 1TL5A 3TJ9A 1CS4A 4I1TA 1OY9A 1TKXA 2E66A 4QR0A 3J80Y 2R7WA 2AYBA 4JI4F 1BQXA 1JNRB 4FF2A 4DUYF 2IC3A 3M2RB 2ZH3A 5C24A 4RNFA 1HBNA 1WI6A 1Y10A 5HANA 4RNOA 3QZ8A 1C0TA 2VF3A 3C46A 4GKJJ 4A48A 3HFKA 2R7TA 1UW4A 2RT3A 1Y0HA 2XWXA 2UXBF 3GSIA 5HMXA 1E6VB 4OYZA 3R6GB 4NZ0A 2I5JB 2F8HA 2J9CA 3LAKA 5DZ7A 4DZ6A 2ALZA 1D9FA 3QQCD 4CLTA 2KH9A 5LL6d 3VHQA 2MGZB 1WKJA 5E3PA 4JV5J 2WVCA 1YJ7A 1SBRA 4UT4A 3AB2B 1Q5YA 2L9DA 2JZ5A 4FXEA 4F0KA 1DLOB 4IRCA 2FDNA 4OYPA 4HDGA 3CCWA 3U02A 3D1OA 1SJ3P 1CULA 5LXRA 1URNA 3L7OA 3R5GA 3OL7A 5HJYA 1CS4B 4JI6F 1GXUA 3DRPB 2GVDB 4J91A 4PYDA 3KLGA 2N7CA 4OZLA 3QSIA 3ZNUA 4ECZA 2O67A 2QZ8A 2G0JA 3AQOA 3M2RA 5KG0A 4RZRA 1FXDA 4DWIA 4YHHF 1JX4A 4IFVA 1GMWA 1S1WA 3R27A 3IR5B 1CC8A 2PEHA 2LQ9A 2I5JA 1SJRA 1C1CA 3H98A 1KLMA 3MDFA 4ED1A 5GADU 1TK0A 2EXUA 1TAUA 1AT1B 1QUPA 3H59A 3OPKA 2MGZA 3KK1A 2XSFA 1UFLA 3LPYA 2GO9A 3MPYA 4A8KA 3CDBA 2R8GA 2HFNA 2FLOA 1ARRA 3EVOA 3KLFB 1OYEA 3IRWP 2VD3A 5C25B 1VRUA 4C2MA 1RT1A 1FFWB 1UW9A 4QR1A 3ZTQA 1XTZA 1Y00A 2ZHOA 1PYTA 3LALA 3BR8A 3FCVA 3MEGB 3TVZA 1RCXB 3F44A 5ETTA 4Y2IA 3UO0A 2CQIA 2XO6A 1RHJB 2J9DE 3PHEA 5A2QU 3GFYA 3CDUA 2J8SA 5EX0A 4KKOB 3TJAA 1KC8T 4YR0A 2ADCA 4IFVB 3GCXP 3ILLA 1KFDA 1S1WB 5T41A 3NO7A 1TKZA 2B6AA 2AGQA 4WKRA 1GTEA 4FPIA 1RT4B 1UWAA 2K1OA 2VFUA 1EX8A 4OIXA 1N54B 1RK8A 2FY1A 4J9LA 2L9NA 2MQPA 4OYOA 3KK1B 4PXCA 3SDEB 3BN7A 3OFFA 2HHXA 2CZVC 3GG1A 3KLFA 3PCOB 4AL6A 2IBOA 4PWWA 4Q2LA 4PKDB 1VRUB 2E5LF 2V8PA 1VISA 1NCLA 4TQSA 1VFJA 1JB0C 2H4YB 5KFXA 3JTNA 1N48A 2VV5A 4M5DA 2DR9A 2HHHF 2VONA 1B7YB 4OYBA 2L3MA 3R5CA 3H40A 3BH7B 4OI3A 4ILRA 2MKIA 4OV1A 5F8HA 1YRUA 3EXYA 1NO8A 1PSDA 3EGVA 4JP8A 4KKOA 3TRGA 2X1AA 4X64J 5DGBA 2H51B 1HPZB 4FF3A 4OX6A 1Q7LB 4X62F 2W2OP 1DTTB 2DHGA 5HAOA 1RWPB 2ZE2A 1DZ5A 3NGKA 1RXOB 3CCQS 4WF9Q 4LBHA 5LJ5Y 1LK5A 3KMQA 1RT4A 4ZOSA 1X9MA 1YGYA 1NEEA 1SV5B 1UPMB 2L48A 2VBXA 3JAMU 4BDPA 1D9AA 3SDEA 1O0PA 4P74A 3CCVS 5LMNF 3M9OB 2BJEA 2IJRA 5I3UB 5IWAF 5DRKA 4IQMA 2AD9A 5EWEA 2WHOA 4CM0A 5CQGA 1FX4A 4ZS6A 1UEKA 2XLIA 1EHWA 4JI0J 2BJ8A 4DL6A 4FYWB 4UZBA 4ED3A 2XB2D 3RRGA 1VJWA 1NH7A 3C14A 3LWLA 2N3LA 3O1LA 2KYXA 1A7GE 5H9FJ 2E9RX 4JI1F 3L7PA 1SC4B 4PWUA 3SCKE 5B0CA 3Q86A 4M5IA 4URGA 5L9XA 4ZVGA 3I0RB 4QWEA 1HPZA 2YPZA 3D7SB 1NH8A 3MCSA 1I3OB 4FYVB 2ZKTA 2F1FA 1S7IA 2ZNYA 3GJTB 3GYGA 5HATA 4C7QA 1YI2S 2ZE2B 1PJ7A 3TEHB 1SJQA 2JRSA 3C66A 4O44B 3ILOA 3D3CJ 4DPOA 3BQ0A 4M5MA 4PEOA 2OLWA 3CJ5A 3LTOA 1S9FA 1REGX 2F65A 1T11A 1U8SA 4F3OA 2V8HA 2DGTA 1ZAWA 2QLJB 4F36A 1SH0A 2A2BA 3DU6A 4O0IA 2ZH7A 2BR0A 2XYPB 1KWMA 1EARA 4HL9A 4RUHA 3V6JA 1FHTA 4ZVUB 3IXQA 5AXMA 5I3UA 4DF4A 4ICLA 2AU0A 1FJGJ 3F0NA 5F8JA 3I9V9 3SCLE 2VC1A 4F0HA 4QW9A 3LH2S 3RB6A 1N33J 4DR4F 4OI1A 3SSQA 4F4YA 4J9UE 2HHVA 1XBWA 1MN9A 2ZVIA 5KT2A 4C8NA 2GQQA 1ZA1B 2GIRA 1W25A 3H5UA 1IBKF 2OIHA 4DX6A 3MOJB 4MJWA 1Y4ZB 3DFEA 2E9ZA 2G9OA 4LRFA 1P1LA 3I0RA 3HKWA 1SJ4P 2LXFA 4DLGA 1NDLA 2EK1A 4J9RA 1Q8BA 2BJ9A 3OUYB 2JEIA 3KG4A 1TMMA 4AQYJ 1WELA 2DHSA 5KG7A 2ZD1B 4TY8A 5IC6B 2W4CA 2ZC4A 2AX1A 3UDLA 4WE1A 5K8PA 1R8AA 3BPDA 2DPIA 1EIYB 2QO3A 2VB6A 3HJVA 4ZVOB 4F3MA 2DJWA 1YDLA 2BE9B 1N5SA 2AKWB 4DCPB 4MIWA 4ICLB 2WSCC 1UVKA 3NY0A 2HFZA 3KJFB 1U1QA 2DRDA 3CC2S 4JI7F 1D8YA 2RS2A 1P8GA 1PJ6A 2E29A 3S1TA 2Q6CA 1TL1B 3Q22A 5M2PA 3W2VB 2QA1A 3F73A 3WC0A 3R5JB 5L1IA 1TAQA 1RACB 2CJQA 2POKA 4HHJA 2VPWB 3WIVA 3FMWA 4K59A 4F67A 1HFEL 2FY8A 4JOUA 3MM9B 3AQPA 2KRRA 5E3QA 3OTOF 4OI6A 1TVRB 4NMXA 4YN3B 3UD4P 3OVBA 2HWIA 2Y1RI 4A4JA 3UCGA 1DY3A 2V6AA 1XR6A 5DDOC 1SPBP 4UUXA 1M5PC 2OD4A 4AXJA 2ZBCA 4WP3A 3BO4A 5J2MA 1R0AA 2H54B 1MG7A 3MUTP 3CCTA 3WX4A 2YKNB 5B0BA 2RRAA 2DR8A 2PDAA 1QJHA 2MZTA 2YX7A 3NEKA 3H2LA 3FK4A 9RUBA 5IXUA 2H5EA 2DRAA 5HLFA 4B3SF 1NDCA 2DITA 2XZTB 3R5AA 4PXEA 4ZP8A 4ZKAA 2YNFB 1OWXA 4B9SA 2GAGC 1MMDA 3HVWA 2WCXA 1UFKA 4PXBA 4CO3A 1JLBA 3RBXA 3SXLA 4DDFA 1U09A 4AQYF 1IUJA 5HP1B 1Z1ZA 1F9HA 1S9GA 3NGTA 1F3FA 1JK9B 2DD8S 2W4PA 3BSNA 3GJQB 2YWHA 2VFTA 4ZJOA 5B08A 3MM9A 1T03A 3W8GA 2IDEA 1TVRA 2MZJA 1CJVA 2RRNA 5GVQA 4NRTA 1PYOB 1UP1A 3IG1A 2XG8A 3CO0P 1NB2A 2B9XA 3HFZB 4X66F 2NS1B 4O3OA 1Y3JA 2VBZA 1L5UA 2JXGA 4LFCJ 2HK3A 3M30B 2RAQA 1R3NA 2GCFA 3AH6A 4K2JA 1LWEA 1DJ0A 4H4KA 3FSIA 4L3KA 4QYRA 4XDDA 2V34A 1IJFB 4HH1A 1Q1KA 3H8YA 2BUNA 4U7UD 3FC9A 3QPIA 3R7BB 3N28A 5KFMA 2GGPA 1Q95G 3OXLA 3C15A 5HLFB 1UJ5A 4QWAA 2DXEA 3CT9A 2EWHA 4DFPA 3DMJB 1HNIA 2QRRA 3TO8A 1GX6A 4Y6IA 4KJIA 3MCMA 3NXZA 5HP1A 3EWGA 2WOMA 4JUZA 1RKIA 4IQXA 3O3LA 5ETOA 2AWZA 2IAJB 2J9DA 2PGCA 4K4YA 4FP9A 1S76D 4Y00A 3M1VB 1N32J 2LDIA 2R4FA 4P72A 2F63A 3QGIA 4P2XA 1JLGA 2Z2LA 4LSNA 1VBXA 4HKQA 3U1NA 2C42A 2IA0A 1HNZJ 1CJVB 1NM2A 1XMBA 5KFHA 3VAHA 1PARA 4B9NA 4B3TJ 2AYMA 2VPXB 1H72C 2FLPA 1FRMA 3N0VA 1QY7A 3BS9A 1LK7A 1PYSB 2D9PA 2NYHA 4L6V3 4LRBA 2AHOB 5JUMA 4DL0C 1Y9OA 3QZ7A 1YJUA 3ETMA 1AW0A 3M30A 2AJ4A 4LF1A 1U2CA 1VBZA 5LSOA 3PEJA 3BSCA 1F2HA 4XK8C 3J80U 2DT9A 5EHHA 1RWVB 4K5RA 3MFHA 3D1QA 3Q83A 5E33A 2ASJA 4C0BA 3OLAA 5GAHU 1X9WA 1ZOTA 1B01A 1HNIB 2MQOA 3THVA 4IFYB 3G2XA 1RAOA 4KGKA 4K50A 2E9TA 3BO3A 3C6TA 1HNXJ 1NSQA 3DYAA 4G6VB 1IRQA 2ADLA 2EFOA 1UZHA 3BH6B 2FD2A 3CD5A 2IAJA 3HSGA 4HTJA 4YHHJ 5J1EB 3ILJA 1NJZA 1XERA 5FLXU 4P71A 4XPCA 1HQUA 1Q0NA 3FBFA 2XI3A 4LSLA 4I6AA 2B8PA 2R7QA 3QAUA 1ZBTA 1N5QA 1WF1A 2NXNA 4GC7A 4WXOA 2ZM6F 4MKYA 3OJSA 2LXUA 1S6PA 2HMIA 2YTCA 2BE2A 2W2QP 4LF5F 5A8WA 5KG4A 3QJPA 5KFKA 2LU1A 2VDHA 3ZNJ1 3I4HX 4F2RA 2XS2A 1HBOA 1S79A 1NPRA 2KT3A 3I5AA 1IBKJ 4F2SA 4Q2MA 3OL6A 2J0QD 2B0GA 5DLGA 2KXFA 1FKOB 3TOQA 3V4MA 4LF4J 4MFBB 4PG5A 3DNCA 3MUVP 4KPYA 3K5PA 2JOQA 4CH1A 2M4MA 5C7PA 2H3AA 2GJFA 4AT1B 4FBUA 4NLQA 3W61A 1D09B 2DNKA 2FGCA 2YXLA 3BEGB 4LF6J 4IFYA 4CYUB 4ED4A 2FJAB 4BLGA 4BC7A 1FJGF 3H7HB 1FJCA 3DYAB 1KVKA 2XLJA 3R7NB 3G6YA 3HVTB 4CO4A 2M2BA 4L3NA 3VEBA 4WP9A 4ME7E 2V8VA 2DR5A 1RT7A 3K58A 3Q8RB 1HQUB 3KHRA 3PO4A 4LSLB 2JC0A 2NYIA 4PPZA 3R8YA 1NZ8A 4EMDA 3K5LA 2E1CA 4Y2MA 2B43A 3TEGA 4BCAA 1F1BB 1SIZA 3PR4A 3DLLQ 2AY0A 2DR6A 3MMCA 1S6PB 3PYDA 4I0WA 2BE2B 4WCEQ 2ZM6J 1YIJS 5A8WB 3P4UB 1I94F 4LR9A 1ROFA 3KLVA 3FVYA 1LKZA 3H4BA 2NREA 1DQAA 2HBYB 2D69A 2XHCA 2RB7A 3V5RA 4OHVA 1ZAVA 4OJ3A 4OZ5A 4TYAA 3NGDA 2V4JB 3OD2A 1VR6A 4CTAA 2L41A 1UETA 3QO9A 1TUVA 5T14A 1FTCA 3DLGA 4CI0B 2B9WA 2HHWA 4USMA 4C8ZA 5HVHA 4QWCA 2UU9J 4I68A 1K1SA 3ZTSA 1H0HB 3UNYA 4LQ9A 2L9WA 2BKOA 1C2PA 5ETQA 2VIHA 4DV0J 4EZ9A 2HKEA 2ACMA 1RAJA 2HNDB 1RTHA 4Q5VA 1ZA2B 4M5HA 3LP0A 4NOHA 1MROB 2C2OB 4P73A 3TX0A 5K20B 3JSMA 4ZCIA 4JI5F 1S1VB 3UR0A 3BGRA 4A8FA 1FDAA 3AD9C 4DUYJ 4JI4J 2DIUA 2KVIA 4OV6A 5K8OA 4DR3J 1V5IB 1VQPS 4JYAF 5CZXA 1CJTA 3EJMA 1SKUB 4J37A 3OTOJ 3W60A 1RT3B 4IG3A 2KFZA 3IP0A 4A47A 3PW2A 3HXMA 1RBAA 1Q78A 2E44A 4ZA1A 2E7WA 2NZCA 1T9VA 3DHXA 5F0WA 2FLLA 3RRHA 3GILA 2ZOMA 2B4OA 3AOAA 3D6FB 3DLGB 4EWTA 2OPSB 4LFAJ 3J7AN 3VVTA 4DR2F 2EFNA 2E1AA 3TW0A 3I6PA 2K7JA 1SH2A 4KY3A 1YJVA 4DQQA 3FSXA 2G2YA 2FVSA 2UXBJ 5C5JA 2ZFHA 2MB0B 1P9YA 2HNDA 2KOEA 1VDHA 4KPCA 3CULA 5KFDA 5IQ6A 1MROA 4GKJF 1XIQA 5KFCA 3JSMB 3BBCA 4C6AA 3SI8A 2Y0BB 4W90B 4O3RA 1TL7A 4FZVA 3AFGA 1NKCA 3TWZA 5D0HA 3BGRB 3OFGA 4LIWA 1YRXA 4ZPBA 2MHNA 5GMKa 1FO1A 1FERA 4DSJA 2BM1A 2OELA 4ZCMA 2RILA 5JMNA 2MQQA 4ECYA 5A6PA 4PUOA 3B4DA 2QLBB 2DCUB 4RW8A 3QRPA 4DV7F 2RBFA 1BGXT 3RJMB 5DQGA 1G3OA 4V19X 1U25A 4U6PA 2QN6B 3B82A 3SV3A 3DM2A 4ZP6A 5U47A 5CA5A 4RUAA 2AJ2A 4GVBB 4BBYA 2G4BA 1SQEA 1VQSA 2JSXA 3PVXA 2AV5A 1UZDA 1QSLA 3AHPA 1JJHA 1YZ6A 3JQJA 1B3TA 3KWMA 4PCQA 1P27B 3T9NA 2H4WB 1FWKA 2DNQA 5AXLA 4B9UA 1S0VA 2YX1A 3IBWA 4PG6A 3TI0A 1BUXA 2MYFA 2EFGA 3AD7C 4HLBA 1CVJA 1VMBA 3W2WB 4ECTA 1YJWS 1N4LA 4LF6F 3CW2C 1WC6A 3IWLA 4X4TA 2A10A 1U49A 1J2VA 2RU3A 3GYXB 3K7RA 4DPUA 3GLJA 3KHGA 3Q89A 3FRZA 2K29A 3I32A 3MPDA 3FBCA 2MZRA 1XMOF 2AEMA 2JWNA 4TU8A 3BGOP 5HQLA 3C3LA 3FUYA 2FC9A 3L3CA 5KG1A 3VAGA 1ZM3A 2CQBA 2E5GA 1TV6B 3LQVA 3KYLA 1R8CA 2JBVA 1UTAA 3VAFA 1RAEB 3PW5A 1C0UB 1NKEA 1FWLA 5D0GA 2YY3A 3H25A 1GMVA 1OY6A 1VQ6S 5E3CA 2VDIA 4IUFA 3CD0A 3QLHB 1U47A 3QJLA 5LXYA 4QCLA 5A0YA 2MHEA 3H42A 3QFWA 1FRIA 4N77A 3OTDA 4TNOA 4W98A 4WU3A 5HK4A 4PG8A 2ZJQQ 2ZBIA 4X4QA 1L3VA 4EZ6A 2EC0A 3LGHA 2EK6A 4K4VA 4QYZJ 2Z8QA 2NSBA 4DV1F 3GG0A 3HF5A 3OTBA 3W2WA 3HP6A 1TK5A 3GJRB 3WHIA 4ES3A 2DGOA 1S49A 3ITHA 3D0HE 4Z37A 2WZ1A 2HNZB 1BC6A 4DR6J 3P5TL 1HR0J 3CCLS 4CLSA 2WAQD 4F04B 2ZBRA 4WFZA 3M8YA 3E01A 1Z2ZA 5H9EK 4Y2AA 1FCAA 2CPZA 2LEAA 4DV6J 1VK8A 2GFFA 2J9EA 2Q2KA 1DTQB 2DTJA 4ECUA 1S1TA 1FJEB 3B54A 3FFIA 4CT8A 2K5JA 1F5CA 1FJ7A 4DQSA 4LFCF 3QRQA 4ZN3A 1X4CA 2YVSA 3CJ0A 2NXEA 4BC9A 2XS7A 4DOZA 4PPDA 2ROGA 5E3AA 3CJQA 1WF0A 1R0BG 1MYKA 1QUVA 2VPZB 3HVAA 2Z0GA 1B4SA 2XZDB 4EO6A 2PA3A 3W3SA 3FDSA 1H98A 1C1BA 4N47A 4KT0C 4RPFA 1IWGA 1RQ0A 1A6LA 3HZEA 3NLCA 1N36F 3HKZD 1KHVA 4QIGA 1X4FA 5CYMB 2R7VA 2HNZA 3H5YA 2XMJA 4L73A 4RW7A 3VGTA 5JVHQ 3T9ZA 2JNJA 5IM0A 4YB6A 1VYAA 1FD2A 4RNNA 4O3SA 2DR7A 3POTA 1U0HB 1U7LA 3LP1B 2J0SD 3NNEA 3MM7A 4C9DA 1DTQA 3DXBA 3FFIB 5FDLB 1F0XA 2IM1A 5AE3A 2ZH4A 2DRBA 4O3NA 4M5JA 2VICA 2C2ZB 2CFXA 1S9EB 3D6TB 2QV6A 3PDNA 5A8KB 3GU0A 1I94J 2J6SA 2UUBF 1BD6A 4MJKA 2Z30B 3HHLA 4OZ2A 4PQUB 3W9IA 2AMCB 3BV8A 1TELA 4DSLA 4G3IA 4TY9A 4KHPF 2FHOB 2V69A 4CH7A 1HQ2A 1OY8A 1URRA 2DO4A 4IOBA 3TUZC 5CD4A 3IN5A 1VQ8S 2LQ8A 1YX2A 3M2VA 3IA0A 4ZLJA 1NB7A 1C1BB 3DDNA 4XDCA 1IKWB 1TTHB 3M8WA 4CZCA 5KFOA 3A8EA 2GHWA 4TU7A 5J2QB 1HNXF 4DR1F 4C11B 2BJ7A 2DH8A 4RW7B 2C3MA 1N0UA 4KSEB 3BREA 1IKVB 2BKPA 5B0DA 3HK2A 4RLEA 3AOCA 3HMJG 2QMXA 1WC5A 1SIWA 1M1HA 1Q5VA 3POTB 1P1TA 1U0HA 2IRUA 2IVMA 3CD6S 1WG4A 1QE1A 5KFGA 1B28A 3T1HJ 3DRYA 3R2CJ 1EJ7L 1NMEB 4GO7X 1AUSL 3B4MA 1S1UB 3OTEA 1HD0A 2MKSA 5FDLA 4CP5A 2ZDOA 4DBQA 2I6WA 3CJSA 1SC3B 3CGIA 1IN0A 3GFHA 4OFZA 2YKPA 4EK2A 2FJEB 1IKYA 4EBEA 1S72S 2DNNA 3PRBA 4OQJA 3KHHA 2HBQB 2V2ZA 4LQ3A 1R6YA 2CQDA 1RHKB 1U0SA 2DXFA 3DDKA 3EDRB 3TR5A 1VOMA 5JJBA 1UWBA 2V2VA 3KG0A 4CO5A 1SKRA 4OZJA 5HN0A 2HHHJ 3AODA 1VHIA 3DOKB 2H48B 5GMEA 2WK4A 4EEYA 1NJWA 3KK3A 3PRVA 3M2VB 1WTFA 3UN3A 5KFRA 1IKWA 3ENAA 3W66A 2DEJA 4CWBA 1LEOA 1RBOB 4JI7J 3KHLA 2GQCA 1Q16A 4EU0A 3M6UA 4IRDA 4E0DA 4F02A 3MEEA 4YEAA 4AL7A 1QTNB 1EKSA 3QGGA 3MECB 3BBBA 2N7YA 2QC3A 1WHWA 3VAKA 1AFJA 1X4EA 1QE1B 4DL2A 1UVIA 1RHUB 2JC1A 3DRRB 2E1MC 4WZMA 2VA3A 1KRPA 3TUIC 4LF8F 4B3OA 1YRTA 2M3DA 1UFWA 2AX0A 2YQ3A 3VWSA 4DV2F 1S6QB 4JI2J 5HMWA 3OXFA 4ECRA 2YKAA 1EP4A 2PMHA 4NLTA 4WIQA 5MLCV 1U1PA 3VAJA 3CIZA 1CQMA 3EXCX 3DOKA 4WTOB 3MMAB 2Y1IA 1B0PA 3TQ1A 1IXKA 2ADBA 1KDNA 1Q4RA 5L8RC 3KK3B 1HL6A 2Y8WA 4WK1A 1T0TV 3LANA 1BXNA 2MQ8A 3CNQP 3PACA 4LF2A 2HNYA 3TVKA 4CCHA 2CQHA 4PZVA 2B5JB 4ANEA 1Q16B 1WC4A 2PSZA 4PR6A 4ATNA 4DJBA 4NCAA 4ZITA 5LJ3Y 5KT3A 5L39A 2CQ4A 3AJ2A 4GKKF 1U02A 2X1BA 4QYZK 1RUSA 1NSPA 1FKAF 3BKTA 2OJ3A 3EZ5A 1U48A 5D4PA 2XI2A 2COLA 5GMDA 3N9UC 4DF8A 1X5TA 1ICEB 5GAGI 1QTMA 3GJSB 4U9RA 1T9UA 2LQBA 1EA4A 2XY6A 1BQMB 3PV8A 2CKWA 1Q79A 1S6QA 4M8LA 2CVEA 1RWUA 3W5XA 8AT1B 4ZVFA 4JI3J 2O5DA 3PYGA 2RKIA 1WUUA 1RYSA 2CDQA 3M9MB 3NP5A 2QJ3A 2R9LA 1WEXA 1HYSA 2FB0A 1ZPVA 3OVSA 1VJQA 1K44A 3K2YA 1VRTB 4NLVA 5KFUA 1HHQA 4Q8FA 3CVKA 1UCNA 1BWEA 3M6VA 2EFVA 2Y0SD 2AJFE 1LWXA 2EG2A 2OHDA 1CJKA 2XLKA 1T9YA 3MI7X 3H87C 4ZPCA 3ZC4A 5LSRA 2LVWA 2DNPA 2J7UA 1S59A 3HSJA 4XO0A 4K4TA 1R7IA 1RT6A 2AGPA 1GK8A 2LP4A 4CRJA 2VODA 3FJ2A 4F0MA 3NGSA 2C2KB 2XTJP 1WOPA 1D9DA 2GPEA 3MM5B 4PRFA 2V68A 5D4NA 2DIVA 2RUSA 2NSCA 4MK7A 3PW7A 1RTJA 2GVZB 1IR2A 4OX9F 5FD1A 1BQMA 3EMTA 3CC4S 4B9LA 2FJBB 2PFDA 3CF5Q 3VW4A 1SCJB 3IWNC 1S77D 2OP5A 1CLFA 4UY85 4ZJQA 4X4RA 1RKJA 4UW2A 4OHZA 4DCOB 5CABA 1OQ6A 3M7VA 2HFSA 2AQ4A 1FXLA 1ZAXA 4JI5J 1GXTA 3MTJA 2KB2A 2L08A 4NXMJ 5I3QA 1YJTA 4RUBA 5A6WA 3IAS9 4G1QB 4I2QB 1UA1A 3OR2B 1CJKB 1S7HA 3LP2A 2IVFB 3FZBA 3RAQA 1X93A 1SKSA 1F2GA 3UD5A 2Q6BA 3PG9A 2FZCB 3R5BA 4RX6A 2BVZA 4GVLA 4G65A 1B0TA 3ZXWA 1ZTTA 2A6OA 4AE5A 2HPUA 1FKPA 4KH1B 4WFNQ 2F7VA 4IKAA 4C0HA 2DGWA 4LBPA 2ZKUA 2YBVA 4RWXA 4PWDA 3SIPB 1KN6A 1FNXH 2OI2A 1RTJB 4LF9F 2E5IA 2F4VJ 1G7CB 1WEZA 3MCNA 2LLZA 3WBZA 1DHMA 2ROPA 4AD6A 2R2UA 1VC5A 4Q7AA 1UEUA 3C8YA 3MMBA 5CYQB 4B02A 3K59A 1YBAA 3GXQA 1N5TA 2KJVA 3KNGA 4M63A 4FBTA 2Z57B 3HD1A 3WX8A 4LVNP 1A0OB 4PXDA 4Z7CA 4UUWA 3OV7A 4CIOA 4B3MJ 4LF7J 4J9KA 2XNQA 4P2FA 4V19J 1HNWJ 3N01A 2C2DA 1VLOA 4KGZB 3W9HA 1LFPA 5EX3A 1FE0A 1H7XA 1UL3A 1Y5NB 1N52B 2MY7A 4KYZA 3JYTB 1PO6A 1JJ2R 4JI8J 2HQ3A 4FKYA 5AJ3J 1RWMB 3HULA 1MU2A 3VGUA 4DQPA 4CLWA 2ZHAA 3BN4A 2WVEA 1BY9A 2GA7A 2PFFB 1JLQA 3SV4A 4K0KF 1X8DA 4C8MA 2H1YA 1FRJA 4NLWA 2EFQA 4GKKJ 2W4DA 3EDQB 4PWDB 1V6HA 2CNOB 2DY9A 1WHXA 2QSFA 3QWUA 1HNVA 1T3OA 3FMBA 1MMLA 4N7TA 4N41A 2C3YA 1SL1A 2P2CB 4OZ1A 3R1HA 1SKWA 1SUQB 1FX2A 1UPPA 1AZSB 2DHXA 2V2QA 4H4MB 4TKTA 1FDDA 1KQKA 5KFJA 3GCWP 4ER8A 4ECQA 4LR8A
chains in the Genus database with same CATH topology
1U9PA 1X93A 2BJ1A 2NZCA 2WVCA 3BKFA 1NLAA 2KELA 1BAZA 2RBFA 3QOQA 2JXIA 1ARQA 2JXGA 1Q5YA 2WVBA 1BDVA 1PARA 2HZAA 2GPEA 4FXEA 4HV0A 1EA4A 2BNWA 3VEBA 2Y3YA 4ME7E 2K1OA 2BJ7A 1ARRA 2CADA 2WVEA 2BA3A 2JXHA 3BKUA 2K5JA 2BJ3A 2F1FA 2K6LA 3FMTA 2AY0A 3VW4A 3FT7A 1Q5VA 1QTGA 3PHTA 3QSIA 2CAJA 2BJ9A 1B28A 1BDTA 1P94A 2WVFA 3LGHA 2CAXA 2BSQE 2CA9A 2K9IA 1MNTA 1MYKA 2WVDA 3GXQA 4D8JA 1B01A 2BNZA 3VEAA 2K29A 2PC6A 2H1OE 2BJ8A 1MYLA 3H87C 2CPGA 2FGCA 3BKTA 3OD2A 1IRQA 2HZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U9P A;  1X93 A;  2BJ1 A;  2NZC A;  2WVC A;  3BKF A;  1NLA A;  2KEL A;  1BAZ A;  2RBF A;  3QOQ A;  2JXI A;  1ARQ A;  2JXG A;  1Q5Y A;  2WVB A;  1BDV A;  1PAR A;  2HZA A;  2GPE A;  4FXE A;  4HV0 A;  1EA4 A;  2BNW A;  3VEB A;  2Y3Y A;  4ME7 E;  2K1O A;  2BJ7 A;  1ARR A;  2CAD A;  2WVE A;  2BA3 A;  2JXH A;  3BKU A;  2K5J A;  2BJ3 A;  2F1F A;  2K6L A;  3FMT A;  2AY0 A;  3VW4 A;  3FT7 A;  1Q5V A;  1QTG A;  3PHT A;  3QSI A;  2CAJ A;  2BJ9 A;  1B28 A;  1BDT A;  1P94 A;  2WVF A;  3LGH A;  2CAX A;  2BSQ E;  2CA9 A;  2K9I A;  1MNT A;  1MYK A;  2WVD A;  3GXQ A;  4D8J A;  1B01 A;  2BNZ A;  3VEA A;  2K29 A;  2PC6 A;  2H1O E;  2BJ8 A;  1MYL A;  3H87 C;  2CPG A;  2FGC A;  3BKT A;  3OD2 A;  1IRQ A;  2HZV A; 
#chains in the Genus database with same CATH topology
 4HT5 A;  2CUY A;  2KEL A;  2PE8 A;  3GB0 A;  3RB4 A;  1REV A;  5F8N A;  2OMO A;  2AW0 A;  2D41 A;  2BNW A;  4CT9 A;  1FK9 A;  4IH5 A;  3SFU A;  1K1Q A;  1GEH A;  4WFA Q;  3FBE A;  4DLE A;  4ELT A;  4TN2 A;  4QQB A;  1ARO P;  3I31 A;  1O51 A;  5CYJ A;  5HBM A;  1AUD A;  1HNZ F;  4J9O A;  2BJ3 A;  1MW7 A;  3L95 X;  5C24 B;  3TA2 A;  5C42 A;  1RHR B;  2G0I A;  3D2W A;  3VAM A;  4DR5 F;  1C0T B;  1TL3 A;  2QFI A;  2AN7 A;  3JB9 k;  3HHD A;  3H90 A;  3DN9 A;  2LA6 A;  4B9M A;  3KOA A;  1KON A;  3RUB L;  2MJN A;  1S4F A;  4ED7 A;  3CME S;  3HX9 A;  3ISN C;  4Q8E A;  1SI9 A;  3CD7 A;  5HMY A;  1L3U A;  3PTW A;  1MNT A;  2OPR A;  1NDK A;  4J9V A;  2CPD A;  2RH3 A;  1SL2 A;  2MZS A;  8RUC A;  2RHS B;  2KJW A;  4K4U A;  2YWE A;  4QU6 A;  4X62 J;  5ITH A;  1V3R A;  1SUQ A;  2NLW A;  2A0F B;  2HS3 A;  3DOM A;  4LIR A;  4MAK A;  5B0G A;  4WJB A;  1H2V Z;  3CO9 A;  4CO2 A;  2HZA A;  2V50 A;  2XCP A;  1CUL B;  3GYN A;  2P9G A;  1RAD B;  3JSR A;  3ENQ A;  1REV B;  1KSP A;  1F3V A;  1LW0 A;  3BGF A;  1TQL A;  4LRA A;  2D3O 1;  3QGP A;  3NG8 A;  3GV8 B;  1RTZ A;  3I4P A;  1YTY A;  3O5T B;  2XMM A;  2XMW A;  2GVD A;  3DRP A;  4YQW A;  4DX8 H;  3KLG B;  1KEK A;  3E2E A;  2HW3 A;  3MPW A;  1KQS R;  2PII A;  3QMQ A;  5HBM B;  4FVM A;  1GXL A;  4AXI A;  2OAU A;  3CIM A;  1BHN A;  5C42 B;  3DDI A;  2U2F A;  4ZVS B;  3SQO P;  1BE4 A;  5IFM A;  2WBR A;  3F56 A;  4JI0 F;  3CCM S;  1W2I A;  4KC5 A;  4IOC Q;  5T7L A;  2YKQ A;  3RB0 A;  1X4A A;  3JSY A;  3RBZ A;  3UCU P;  2I38 A;  4QIE A;  5LSL A;  1C1C B;  4B9T A;  1HMV B;  4UY8 T;  3A8J A;  2NXJ A;  5L1K A;  3GP9 A;  4I6W A;  3GFX A;  5J1P A;  2QL5 B;  3NAI A;  3W65 A;  2W9B B;  4C8L A;  5B7W A;  2EVZ A;  2IFX A;  3R5D A;  2ZH2 A;  1T03 B;  2Y3Y A;  2F4F A;  3DOM B;  4NA1 A;  3HO1 A;  3QBC A;  4DL4 A;  1JLC B;  5E41 A;  3NOG A;  1HAR A;  5G4D A;  4FN5 A;  1RT1 B;  3A3O B;  2FHJ D;  4WKY A;  5FII A;  1LW0 B;  3G82 A;  1VK3 A;  2RQK A;  3MR6 A;  2V4Q A;  1X4D A;  1WDT A;  4RL1 A;  2ZJP Q;  1HNW F;  4EFA C;  4DQI A;  1WSR A;  4IYQ A;  2JJ4 D;  3KUG A;  1EQ0 A;  1LOU A;  4QR2 A;  4NZ6 A;  4YUD A;  3TJ8 A;  2F4V F;  2B7C B;  2B4V A;  2H9Z A;  2XZW A;  3IWX A;  4NCG B;  3A4T A;  4ALZ A;  1T3N A;  4N76 A;  3PIO Q;  3OHB A;  1H6K X;  3J7Y U;  2EPI A;  4Q0B A;  2E7X A;  2GZO A;  2B6A B;  4HI1 A;  2W7O A;  1RAG B;  1N34 F;  1M5O C;  3THT A;  4Y2C A;  2VFR A;  1UVM A;  2W9B A;  4ILM A;  2FIU A;  1RWN B;  1C4A A;  4Z7Y A;  2UP1 A;  1OMS A;  3SQG B;  3KKF A;  1U1O A;  4DV4 F;  1U2R A;  4F4A A;  2AEJ A;  2W2N P;  5BR8 J;  3C2P A;  3UVJ A;  1B64 A;  3G96 A;  5KOX A;  5LMU F;  2X1F A;  2LQJ A;  1QVF R;  4USK A;  5ETP A;  2CJA A;  2W9C A;  1NND A;  2VUG A;  4FS1 A;  2I8E A;  1KKH A;  2J8A A;  3R6L B;  3K5M A;  2PT0 A;  3HT0 A;  3QT6 A;  4NA2 A;  1PC4 A;  3IC1 A;  4DEZ A;  2XYG B;  4M5D B;  5J1N A;  1IQZ A;  4U95 A;  3K0J A;  2R7R A;  2XMK A;  4RUC A;  2O66 A;  2HVZ A;  2V0N A;  2FGO A;  2KN4 A;  4X64 F;  1M5S A;  1L3K A;  4X4S A;  2BAN B;  2BBE A;  3HFV A;  3KDN A;  3KLI A;  3PO5 A;  2JEJ A;  1AFI A;  4JYA J;  4NCG A;  1KS2 A;  2DKO B;  1F6T A;  2DYA A;  2IRX A;  4R25 A;  3VQS A;  1JNZ B;  4HI2 A;  3TAN A;  3LA0 A;  3PKY A;  4G1I A;  3G8Q A;  1DTT A;  4NLO A;  5F8I A;  4YDX A;  4F4X A;  1VQ4 S;  3IBF B;  2E5L J;  1YQH A;  4W4M A;  2X3D A;  2D74 B;  3GMG A;  1WDD A;  1EET B;  3AAW B;  1UVJ A;  4ELV A;  4IG0 B;  3QIP A;  2FJW A;  2YKM B;  4HEA 9;  3UVJ B;  4XPE A;  3RU0 A;  3HT3 A;  1PIL A;  1YHQ S;  2LEB A;  2RUG A;  2BAB A;  4L74 A;  2WB1 D;  2H5I B;  2CZ9 A;  1WF2 A;  1RBL A;  2IM2 A;  4O4G A;  5D77 A;  4OYW A;  5KFZ A;  2CQ0 A;  3GWC A;  1T8E A;  2OFH X;  2DGS A;  5BYQ A;  4L75 A;  1HWK A;  3ZFV A;  3C14 B;  2OPQ B;  1S6U A;  2A6M A;  2YKO A;  2YNG A;  2ZH1 A;  4ECX A;  2UXC J;  2BAN A;  1G2E A;  1H2U X;  2NR0 A;  3P49 B;  2RDD A;  5HJX A;  5K8N A;  2J7W A;  4OLO A;  1A9N B;  1S97 A;  5A8R A;  4NXN F;  1HI0 P;  1PC5 A;  3IRX B;  3CCZ A;  5HRO B;  2OH2 A;  5KFL A;  1RI7 A;  2KT2 A;  1Z2L A;  3GSD A;  5K9F A;  1N33 F;  3JTP A;  4O44 A;  4NX9 A;  1O6X A;  2QEX S;  2OTJ S;  5HVF A;  2Q66 A;  5KOW A;  1XC9 A;  1D1U A;  1OJ4 A;  1FVS A;  3AXM A;  1T7P A;  3HHL D;  2OPP A;  5ETL A;  3K17 A;  5KFI A;  4K4X A;  4OJH A;  1EET A;  2JH3 A;  4UOH A;  3BSO A;  2DGQ A;  1TR0 A;  2GJ2 A;  2HEK A;  3O6Q A;  3WIU A;  2BYC A;  2J76 E;  1RU1 A;  2NUU G;  3ET6 B;  1GMU A;  1T9T A;  3M05 A;  3QIP B;  5HQM A;  3PIP Q;  4OYX A;  4C97 A;  3ZZO A;  3VTI A;  5DDR C;  3CCJ S;  3TX8 A;  3RR7 A;  1SJF A;  2I0X A;  1RCO B;  2BEF A;  2G13 A;  1ACM B;  2KO1 A;  2V5H G;  3TAR A;  2DXD A;  2GQ2 A;  4OZ3 A;  4WFB Q;  4NA3 A;  3TQE A;  3BGU A;  4QWB A;  2CJX B;  2HQI A;  2OPQ A;  4ES1 A;  1V5V A;  2Z58 B;  1RGV A;  3DI6 A;  2IIH A;  2PEB A;  1RHQ B;  2AIR B;  4NML A;  4RKU C;  1CG2 A;  4TYB A;  4R5P A;  2KFY A;  4JI6 J;  1HD1 A;  4Y34 A;  5DQI A;  1OS5 A;  1Y3K A;  4NRU A;  2QLW A;  3M32 B;  4WFX A;  4JV1 A;  3LW5 C;  5A8R B;  2KG0 A;  3W9J A;  2KG1 A;  4X2B A;  4ZVH A;  2EC2 A;  1NUE A;  1RJJ A;  2CJY B;  2G0C A;  2ZVS A;  3QAE A;  5BXI A;  3NWR A;  2W9A A;  4DR3 F;  3KTQ A;  2VC0 A;  3NMA A;  1J5O B;  4UF4 A;  5CCM A;  1P94 A;  2G1H A;  4TY8 B;  2JL9 A;  1C4C A;  4WE1 B;  1RIS A;  4LFA F;  2BNZ A;  4FF4 A;  5C25 A;  4B3O B;  5GAD I;  1VBY A;  3MPU B;  8ATC B;  4UQT A;  4M5K A;  1QLN A;  3MHY A;  4Q45 A;  3BSA A;  3D5M A;  1GT8 A;  4DUZ J;  2ZUG A;  4DR2 J;  1IKX B;  3AA9 A;  3QOQ A;  2XM3 A;  2XMV A;  2VFS A;  1FEE A;  2ASL A;  3ONQ A;  3SSS A;  4LRD A;  4CLZ A;  5ETV A;  2OML A;  1TL1 A;  1TUW A;  3I82 A;  4R8U A;  1SVD A;  4PAA A;  3W2V A;  3KLH A;  3GIM A;  4DV3 F;  3KUE A;  1WC0 A;  1EAY C;  4WII A;  2A18 A;  4DUT A;  1Z4U A;  2HIY A;  2WTF A;  3BDP A;  1OO0 B;  2M8H A;  3N5F A;  2DNR A;  4P7T A;  4ZPV R;  2CQG A;  5F41 A;  3T6B A;  2V8D A;  3TA0 A;  1I1G A;  2KZZ A;  3CJK B;  4J9P A;  1TL4 A;  4ZVR B;  5IZH A;  2LDY A;  1NK9 A;  3PYE A;  4KGX B;  1UVN A;  3DOL A;  3AB4 B;  2F9J A;  5LMU J;  1V3S A;  1S0N A;  2ZH9 A;  4EUV A;  5SZT A;  4GC6 A;  2XHW A;  3L4B C;  1UEV A;  4PQA A;  1T02 A;  5KT5 A;  1R0A B;  1TFW A;  2Q1L A;  2GIQ A;  4LMZ A;  3NWG A;  2YKN A;  3TP2 A;  1E6Y B;  3OHA A;  4B3S J;  4HHU A;  1DBD A;  3KUH A;  1KR4 A;  3D3B J;  3J7Z 5;  1SC1 B;  2EI5 A;  3PW4 A;  2YWK A;  1NHV A;  2J5A A;  1IKX A;  3SZ2 A;  2YX4 A;  1ZZN A;  2PD1 A;  2KTQ A;  2AEF A;  3ZZT A;  2D7S A;  2I9S A;  3DGV A;  4DX5 A;  2HRY A;  1ZTW A;  1YJN S;  2ZC3 A;  2Y1L B;  1JLB B;  3LAM A;  1SC6 A;  1QAI A;  4IDK A;  4OX8 A;  1TUG B;  4LF4 F;  3NRB A;  3I55 S;  1QAJ A;  2OEJ A;  4NLX A;  1NBE B;  3CJR A;  3EX7 B;  1RSC A;  2RSQ A;  1HI1 A;  1WJ9 A;  3HI9 A;  3IR6 B;  5D6G A;  2W2P P;  1HW8 A;  3S01 A;  2BKN A;  2JLF A;  2A2C A;  3CJK A;  3VV2 B;  2MST A;  2EG1 A;  2X1G A;  2WB4 A;  1NU4 A;  3BR9 A;  2XMA A;  2GHV C;  1S57 A;  3DOL B;  5K14 B;  3MFI A;  2RVJ A;  2GMH A;  1YKW A;  1HWL A;  2M9K A;  1MLA A;  4NPO A;  1U26 A;  1K8A T;  2GIF A;  2FHK A;  4RBV A;  3HCX A;  5EWG A;  3M9N B;  1NK5 A;  2HG4 A;  3H2V E;  1N56 A;  1S1X A;  2XY5 A;  4XTT A;  1MSW D;  1R27 B;  4N8O A;  3TA1 A;  2HVD A;  4D3H A;  2JEG A;  4USU A;  4ZPD A;  5E7O B;  3NCP A;  3GFZ A;  3O2I A;  4E98 A;  5D0R A;  1X9S A;  1XR7 A;  3NMR A;  2IRY A;  2WRM A;  2RQM A;  2AYE A;  2BAC A;  3C15 B;  3A12 A;  3UNG C;  5CH7 B;  3A3P B;  3MR2 A;  2OUG A;  3GIK A;  1VHF A;  4PG7 A;  4O0N A;  1CPZ A;  3DMJ A;  1NXI A;  3IAM 9;  4U8Y A;  1VQL S;  4B3R J;  2AJ0 A;  2R8I A;  4ZJL A;  2JFD A;  2VFV A;  4IDK B;  2GW8 A;  5SUH A;  4EYI B;  2OEM A;  4C3L A;  2QSW A;  4D3G A;  3Q0A A;  3DLK B;  3ETO A;  3FCW A;  1TZ0 A;  3N6N A;  2DNO A;  3VEA A;  4OI2 A;  4U8V A;  3M1V A;  3KLE B;  2UUC J;  1JLG B;  2N4D A;  4LSN B;  4HYK A;  3FCH A;  4CNY A;  5A2Q Y;  1RHM B;  3BKF A;  5KFA A;  4DV6 F;  2W24 A;  1GMW D;  1BAZ A;  1HBU B;  4KB7 A;  5ETN A;  2QMU B;  2R7O A;  5K14 A;  4A8M P;  1BDV A;  3P6Y C;  1APS A;  4P52 A;  1HI8 A;  3QT5 A;  1M5H A;  3NNH A;  1U6F A;  4EO8 A;  4J9S A;  3V6D B;  2HS4 A;  2C22 A;  4PAB A;  4ELU A;  4ES2 A;  4F25 A;  2MPU A;  3PXG a;  2KT5 A;  3CSK A;  2LQ5 A;  4KR0 B;  3A3N B;  5ETS A;  2MDA A;  3D1H A;  3MUM P;  4RW4 B;  1NZA A;  4DL5 A;  3D54 A;  3KK2 B;  3H2U B;  3DHW C;  3MAA A;  3Q24 A;  1RTD A;  3IR7 B;  3QFH A;  4ZVE A;  4TLR A;  5KT7 A;  2FVC A;  2B9Y A;  4Y28 C;  3OVA A;  3GIJ A;  3N79 A;  1VIX A;  1HHS A;  4Y2K A;  3N4W A;  4ZPW R;  3EPG A;  4F4W A;  1NKB A;  1PJ5 A;  1IJE B;  3M8S A;  4RNM A;  4F4K A;  5FJ4 A;  5AE2 A;  4KTQ A;  4DFJ A;  1W26 A;  5J1E A;  5RUB A;  5F8G A;  2UVU A;  2ZZN A;  2NQP A;  3KLE A;  2KDO A;  3HJF A;  5DM7 Q;  1ZET A;  2XUL A;  3P96 A;  5G0R A;  4HV0 A;  2BV3 A;  1S0O A;  4LF5 J;  4NLS A;  1HBU A;  2K06 A;  3QYY A;  5KFN A;  4ED6 A;  1FFG B;  1SXL A;  1CQN A;  2CJB A;  3GZ7 A;  2QE5 A;  4NLG A;  1HBO B;  1DQ8 A;  1R8P A;  3THP A;  5KG5 A;  2UXD J;  3ULH A;  1WTB A;  2CIM A;  2Z2Z A;  5EUH A;  4DV4 J;  5J2P A;  4MFB A;  4Y65 A;  3RZA A;  4LF9 J;  3KK2 A;  3SYZ A;  1HIY A;  3WDO A;  3MAA B;  1RTD B;  5M2U A;  1O5J A;  4A8X A;  2R2T A;  5IWA J;  3P3D A;  4CYU A;  5LMN J;  4DR1 J;  1RWO B;  1TKT A;  2KI2 A;  3TZW A;  2MTL A;  5KFV A;  2ZH5 A;  3IM9 A;  3M8Q A;  4DR7 J;  1PBU A;  1NRK A;  1VLY A;  3D9B A;  4KGV B;  3EPI A;  1DUR A;  4RU2 A;  1RT7 B;  5A76 A;  3TZY A;  2NCK L;  4X4N A;  1SH3 A;  4OYI A;  1CJU A;  2YNH B;  2W1B A;  3U1L A;  4NYP A;  2B4P A;  4JI8 F;  2XGQ A;  3W8P A;  3M8Z A;  4JI1 J;  2K1R A;  3PX4 A;  2E5H A;  4B3T F;  1RP5 A;  1D8Z A;  4OI0 A;  2ZNZ A;  5DGA A;  1U6B A;  4DSI A;  2Q3P A;  3MTK A;  1WSV A;  7AT1 B;  2ZH8 A;  1Q8K A;  3I0S B;  3E3X A;  2ZZT A;  1WOR A;  3HSD A;  2CWK A;  4P7V A;  2HBR B;  1VQY A;  4TVA B;  3H4D A;  4KRW A;  3OSN A;  3LF0 A;  4C98 A;  4J90 A;  3LOU A;  2PI4 A;  3I96 A;  3R2D J;  5EN1 A;  4CTA B;  2C3U A;  3RTV A;  1PGZ A;  2F5G A;  4I7F A;  4IO1 A;  2G2Z A;  3TAM B;  3OJU A;  1IBM J;  3MD1 A;  2AZ1 A;  5BYR A;  1Y11 A;  4FXD A;  1ARQ A;  3CE8 A;  5KFY A;  2MKJ A;  2GJI A;  3U27 A;  2RNE A;  4MKV A;  1AB8 A;  1TKT B;  3RAX A;  1UMJ A;  2DO0 A;  4ETX A;  2ASD A;  4RW9 A;  2FTR A;  1DLO A;  5B0E A;  3MXH P;  2GX8 A;  5KG6 A;  2XBP A;  5F8M A;  3PFO A;  1T95 A;  2XMU A;  1GTH A;  1YK9 A;  4NEZ A;  1RT2 A;  4OL8 A;  2BMB A;  4CLP A;  1AYE A;  3T41 A;  1NPP A;  1S1V A;  2HGN A;  5KFE A;  2A3J A;  2V67 A;  4HTI A;  2FLN A;  2K1R B;  1FDB A;  1N5V A;  1M5V C;  4FYX B;  4URS A;  3P45 B;  5GAE U;  3J7Z T;  2DVI A;  1CJT B;  2CDR B;  1MMN A;  1XMQ F;  3RG6 A;  2XO7 A;  1RT3 A;  3I0S A;  4IG3 B;  5DJB A;  3CDA A;  3HLU A;  3KDO A;  2HFV A;  5D15 A;  2RS8 A;  2BA9 A;  3A13 A;  4I64 A;  3TNV A;  5J2N B;  2CPG A;  3EVM A;  2BXJ A;  2IBK A;  4DPW A;  1W7W A;  5KFP A;  4NEY A;  1KLM B;  3BM7 A;  4Q44 A;  3MR3 A;  4RW6 B;  4I7F B;  3TAM A;  2YQ1 A;  3AOB A;  2OPS A;  4C3K A;  2HUR A;  4NLY A;  2G2O A;  4AYB D;  4DX7 A;  2IY5 B;  2KKH A;  4NLP A;  2J6U A;  1RB0 A;  2E7V A;  1FXR A;  3CJ2 A;  2FHJ A;  3MM8 B;  4RW9 B;  4DV1 J;  3IGV A;  1ZYQ A;  3JQM A;  3OW2 R;  2HRU A;  2OGU A;  1RT2 B;  5KFS A;  3RGI A;  2ILZ A;  3HM9 A;  1JLA B;  2CQ1 A;  1VS3 A;  3CJ8 A;  4WBF A;  3CCU S;  4DFM A;  5D4L A;  2FHM A;  2C3O A;  2CQ2 A;  1BLU A;  1ULR A;  4M5G A;  5DM6 Q;  3MEG A;  3PFE A;  2B8Q A;  4OHY A;  3P8B B;  3ZZP A;  1WKL A;  1WOS A;  4PUO B;  2P6S A;  4RW8 B;  1GAO A;  3HHE A;  4UOG A;  5EGY A;  2M70 A;  1U8W A;  2JVR A;  3W5Z A;  4YDD B;  5J2N A;  2RF2 B;  2XQC A;  4DL7 A;  1NPK A;  2IJF A;  4GVB A;  3GIR A;  1HQE B;  1NSA A;  2RHQ B;  1TKZ B;  3J81 Y;  1XMO J;  2U1A A;  3AJ1 A;  3BYR A;  3P5B P;  4RW6 A;  3VGS A;  1QSY A;  2Z2Y B;  2AJ1 A;  4P2M A;  4O3P A;  3HSZ A;  3GII A;  6FD1 A;  4DV5 J;  5KFT A;  2QLX A;  1FRH A;  3DCA A;  3GPA A;  1U6Z A;  4MYU A;  4FF1 A;  4MIA A;  3A8I A;  2ZH6 A;  1I5O B;  1OPI A;  3MM8 A;  5KFF A;  1WHY A;  1LFW A;  4B9V A;  4OJ1 A;  4DSE A;  4ZP7 A;  3NL0 A;  5L1J A;  2EEY A;  3LGM A;  1YIT S;  4NE9 C;  3C6U A;  1JLA A;  1CSJ A;  4I4B A;  4U96 A;  4FYD A;  1QD1 A;  2CWX A;  2M8D B;  2UVV A;  2IDL A;  2W2M P;  5FLX Y;  4A8W A;  3GTY X;  2W8K A;  4NXN J;  2XNR A;  1OSD A;  1M90 T;  1Q86 T;  1DAR A;  1ZS6 A;  4M94 A;  2DH7 A;  4USH A;  1WNE A;  1VQN S;  4CLY A;  5CAA A;  5KT6 A;  2LXI A;  4DFK A;  4IH6 A;  1C0U A;  2QIF A;  3UN2 A;  3G6X A;  2XEX A;  2RF2 A;  2D3O R;  2K2P A;  5F3Z A;  1U2F A;  2IA6 A;  3BJY A;  1HQE A;  3T1H F;  2KL8 A;  3T5K A;  3QWP A;  4NYO A;  4E8U A;  1K47 A;  1SV5 A;  4WTY A;  1FI4 A;  3CDW A;  3JSB A;  4RO0 A;  1S4E A;  4G1P A;  3KJN B;  1IBM F;  2ZOF A;  1DRZ A;  3DLH A;  2DK2 A;  2YH1 A;  5HSP A;  5IT9 U;  4C8Y A;  5KAK A;  1RAB B;  2KU7 A;  3T3F A;  1JLF B;  1AXQ A;  4DPX A;  4TQR A;  3C6U B;  2QA2 A;  2O01 C;  3ELH A;  1RA6 A;  2VQF F;  3TUP A;  1G6B A;  1SQF A;  3JS9 A;  3IO1 A;  1QSS A;  4CH0 S;  1NK4 A;  2B4U A;  2WSE C;  4ECS A;  1UA0 A;  1U24 A;  2G1D A;  3A8K A;  2D3Z A;  3FQL A;  3FQK A;  2HS0 A;  1O8B A;  4CM2 A;  2KXN B;  4A8S A;  1Q8L A;  2OO4 A;  4DCJ B;  2HIQ A;  1B7F A;  2GMJ A;  4WXW A;  3QNW B;  1VQ5 S;  2GAH C;  2C2M B;  2DB1 A;  1KP6 A;  1I51 B;  2F9D A;  5CZV A;  3NGR A;  1U1K A;  3I9Z A;  2VG5 B;  2BQU A;  3D0I E;  3EIC A;  5IV3 A;  3DLE B;  2IHR 1;  1UJ4 A;  3IM8 A;  4N5S A;  5I42 A;  4ITS A;  4LR7 A;  2H5J B;  1HA1 A;  1OG7 A;  4OJG A;  1FF2 A;  3T5J A;  2MKH A;  4CDI A;  1QAY A;  3NOC A;  2M0G B;  2DNZ A;  2IPO B;  3M2U B;  1JLF A;  1VI7 A;  2J0W A;  3GON A;  2WVB A;  2MZQ A;  3PEH A;  4BHQ A;  4DHV A;  4N56 A;  4UST A;  5IM0 B;  2LEC A;  1NK8 A;  2AGO A;  2UV8 A;  3VVU A;  2PN6 A;  3KJQ B;  1HBM A;  2VPY B;  2IM3 A;  2C3P A;  3LP1 A;  5CHC B;  3MM7 B;  3BQ2 A;  4ED5 A;  2HAF A;  4H4O A;  2HAI A;  2MY8 A;  2RQ4 A;  4ZCL A;  2UUB J;  1HW9 A;  4J5O A;  5D78 A;  5A8K A;  4M5N A;  2VBW A;  3MR7 A;  3C19 A;  3X1L B;  2HGL A;  3OUY A;  2RQC A;  3HHL B;  5F3T A;  4PQU A;  4A8Y A;  4NLR A;  2ABY A;  2CQP A;  2VQF J;  2DY1 A;  2ZD1 A;  1DAX A;  3G71 S;  1KLN A;  2H1O E;  2CJ9 A;  2P9C A;  2VG5 A;  2HWT A;  3D0G E;  1U1L A;  1K9M T;  2Z56 B;  3DLE A;  4QJV A;  4DZD A;  5I42 B;  1KNZ A;  1GX5 A;  3PJX A;  1X0F A;  3DU5 A;  3BGL A;  3M6W A;  3CPW R;  1LWC A;  1IM4 A;  2EKN A;  2LFV A;  2LYV A;  3KFW X;  2BM0 A;  2UZA A;  3M2U A;  1PKU A;  1EKR A;  1KBR A;  4ZMM A;  4EYH B;  2ACY A;  3PY8 A;  2QYC A;  1RT5 A;  4ZIW A;  2JXH A;  1IKV A;  3BBF A;  3NBP A;  4EGL A;  2E5J A;  3AT1 B;  2FVR A;  3VZI A;  3NS7 B;  1S12 A;  2DNG A;  1SIW B;  3ZZ0 A;  2PI5 A;  4ECV A;  1FVQ A;  1HBM B;  3KMS A;  2YWW A;  4H4O B;  3WC2 A;  1OPZ A;  3PNI A;  4X65 F;  5KG3 A;  1FT8 A;  2VQE F;  3B6B A;  3TVY A;  5HI7 A;  3V2U C;  1FTR A;  3L9Z A;  4HHH A;  2CA9 A;  2UVW A;  2K7K A;  3CJ4 A;  1JJC B;  1IKY B;  3T1Y J;  2PMW A;  3IS9 B;  3OXG A;  5DDP C;  2E1P A;  3EGW B;  1JLE A;  2DNL A;  1H7W A;  2IJN A;  3MCO A;  1PAU B;  2RDI A;  5E0O A;  3PR5 B;  3GQC A;  1UWB B;  5EDW A;  1VC6 A;  2P5V A;  2MLZ A;  5J2M B;  1D3W A;  4A46 A;  1ZZF A;  2XC9 A;  4AUK A;  4DG1 A;  4YFU A;  3W64 A;  4DU7 A;  5F9L A;  2AYG A;  4LJM A;  2W7P A;  3MAH A;  1IWA A;  4FVC A;  3L7U A;  2W01 A;  3UDV A;  2MQN A;  4U7C A;  2Z4P A;  3OR1 A;  1F5A A;  1LWC B;  4ZLL A;  3TZZ A;  2IYG A;  3DLB A;  4B3R F;  3Q8Y A;  4C8O A;  1FD8 A;  2NUH A;  2GC8 A;  2YNF A;  1RT5 B;  1SB6 A;  3DRX A;  2VH7 A;  3MEE B;  3NBP B;  4WYW A;  2F3J A;  3GV5 B;  1NJX A;  1IQT A;  3I5C A;  1XN9 A;  2ATL A;  4NAS A;  1HWU A;  4JV0 A;  1S9G B;  4HT7 A;  1WD6 A;  2BRK A;  1EQM A;  3EZO A;  4YY3 F;  5IS2 A;  1VRQ C;  2ILY A;  2ZDP A;  3W5Y A;  4TU9 A;  4DS5 A;  2ZUA A;  3IFE A;  2XSJ A;  5L9N A;  3QAT A;  4HH0 A;  4ZLN A;  2HGM A;  4FXV A;  2FJV A;  3IS9 A;  1MWZ A;  3IG1 B;  3ISZ A;  1JLE B;  4J9Q A;  1LW2 B;  1UKU A;  3C16 A;  4ZHR A;  4LRC A;  2UUA J;  5DZ6 A;  1X7V A;  4B08 A;  7FDR A;  2FZK B;  1N32 F;  3MMA A;  5EWF A;  4RBU A;  2DNH A;  1LWE B;  2DGU A;  2LKZ A;  2OFG X;  3CB4 A;  3FSY A;  3ICL A;  4OX7 A;  4DG1 B;  2K6L A;  3W63 A;  1PBA A;  1PAE X;  5I3P A;  3OR1 B;  2B5J A;  2NPF A;  2GGP B;  4ENO A;  2W25 A;  1TMJ A;  4W92 B;  1FNO A;  4ZVQ B;  1VIO A;  4AL5 A;  3EGN A;  1MWY A;  1J27 A;  4CLK A;  3I5B A;  3W7B A;  3JAM Y;  4YOE A;  4BWJ A;  2F8E X;  2WOM B;  1KQG B;  3R3T A;  1WKK A;  3BB5 A;  4ZP9 A;  3UDE A;  2MKK A;  5H9F K;  4Z2X A;  1Q7Y T;  3RYL A;  2C2E A;  1RAH B;  2LEP A;  2YWG A;  5AXN A;  5H1S V;  4F7V A;  4ECW A;  1FDN A;  2XSJ B;  3UR3 C;  1H73 A;  1VQO S;  1RWX B;  4NYZ A;  3H20 A;  2R3V A;  2OSR A;  1LW2 A;  2CPY A;  4P75 A;  3MF5 A;  3UE2 A;  3C16 B;  4KH0 B;  4ZHR B;  2CAD A;  2JLG A;  1X60 A;  2CG4 A;  2WSF C;  1IBL J;  3T1A A;  2C2R A;  5LT5 A;  4I69 A;  3ZZR A;  3NNA A;  4FS2 A;  2DGX A;  2RJZ A;  4RBT A;  5ETR A;  5BJR A;  4K8R A;  4YY3 J;  2KM8 B;  3PJW A;  3M8P A;  4PYA A;  3DLJ A;  2RE1 A;  1ZM4 A;  3BF4 A;  4LF7 F;  3T19 A;  4C3M A;  3LUY A;  2KFN A;  1FE4 A;  4EBC A;  4D8J A;  3TAP A;  4C8K A;  1YBU A;  4LVO P;  3FBB A;  3ISN D;  3FZ2 A;  1RT6 B;  4DV0 F;  2ATC B;  1KD1 T;  1N88 A;  3C6T B;  3RB3 A;  1U9P A;  3ENV A;  3K89 A;  1FRL A;  4K4Z A;  3K5O A;  1RU2 A;  1KTV A;  2JXI A;  2J7K A;  3IGN A;  3MM5 A;  5BYS A;  2JEF A;  4UZC A;  4DR5 J;  2RD5 C;  3HZG A;  1YJR A;  2OSQ A;  2WW4 A;  1IR1 A;  4K2X A;  4RR5 A;  5IOL A;  1DFD A;  4QIF A;  4ZLP A;  4CO1 A;  5KFW A;  2EFP A;  1S5Z A;  3TZX A;  3HHK A;  1GFW B;  2K8G A;  4CLL A;  2HMI B;  3EZU A;  4DSK A;  2B51 A;  1RA7 A;  3DGP B;  2M5Y A;  3SMZ A;  3BPS P;  3SFG A;  4IOA Q;  4QW8 A;  2CAX A;  1ZPW X;  1F9E B;  2F40 A;  3AA8 A;  3M8P B;  2WW8 A;  1FKO A;  1LNQ A;  4YB5 A;  5IQQ A;  4CO0 A;  3J7Y I;  2DHH A;  2HQD A;  4I2Q A;  2KRB A;  3LP2 B;  1YWX A;  4FDF A;  3WQP A;  3IMQ J;  2HZV A;  4X84 A;  4JB8 B;  2DNY A;  4C4W A;  1NLA A;  1X5O A;  3NNC A;  1P9Q C;  2GS8 A;  4MK8 A;  5ADZ A;  1M1K T;  1ITP A;  3B78 A;  3A1Y G;  1FKP B;  3V81 B;  1OQ3 A;  3HVT A;  2Q43 A;  1TK8 A;  1RTI B;  2B7B B;  1M5K C;  2VL1 A;  4OHW A;  4P6Q A;  1KQF B;  4FNI A;  2A1B A;  2BW7 A;  2PMZ D;  3JQK A;  2R2S A;  3ZZZ A;  1S48 A;  2ZHB A;  5CYQ A;  3MMC B;  1MN7 A;  3MWB A;  1WEY A;  1V9O A;  9ATC B;  1IVZ A;  2CPX A;  3DGP A;  4WWS A;  4DV7 J;  1AA1 B;  2N3O A;  2FJX A;  3AJD A;  3V6H A;  3MEK A;  2ZZM A;  2OEK A;  1S6O A;  4F8R A;  2VQE J;  3MED A;  4RWW A;  3JYT A;  2CYY A;  3X3U A;  4X4V A;  5D8H B;  2OKQ A;  2V4J A;  3QO9 B;  3UN5 A;  4HVZ A;  4I56 A;  5E5N A;  1T9X A;  1SQG A;  2JX2 A;  4ED8 A;  4EBD A;  4LF8 J;  2PA8 D;  3MM6 A;  2KHC A;  2QMW A;  1U4B A;  4JV5 F;  4Q43 A;  1OIA A;  3EVW A;  3N5B A;  3WZ0 A;  1RE1 B;  4IR9 A;  3R7S B;  4NL5 A;  2KZM A;  2HVE A;  2ZJR Q;  2V9K A;  4DN9 A;  4J9N A;  2CPE A;  2M52 A;  5DG7 A;  2HFO A;  1RTH B;  3T5H A;  2V9W A;  3LJP A;  3LP0 B;  1QAX A;  1LV5 A;  1TU0 B;  2CPH A;  1RTI A;  2P9E A;  3KG1 A;  4AND A;  5GAH I;  2ALY B;  4NCB A;  1HNV B;  2VOP A;  2AJQ A;  1X5S A;  2P6T A;  2D1C A;  1RAI B;  1R43 A;  2R42 A;  5DS7 A;  1W2B R;  3Q8S B;  2BZ2 A;  4JV2 A;  4RNH A;  2XS5 A;  1LQ9 A;  1IR0 A;  2KYZ A;  2PC6 A;  4JI2 F;  4DV2 J;  4O3Q A;  2R8J A;  1JXL A;  3KJV B;  2HVI A;  1BQN A;  1XJW B;  4MIB A;  3G86 A;  3VQT A;  3T1Y F;  4XIU A;  1XNQ F;  3QID A;  1RWK B;  1G1X A;  1RLD A;  2DEI A;  2LU2 A;  1ZM2 A;  3FKB A;  3JXO A;  3MED B;  4ZVP B;  4ETZ A;  4DV3 J;  1FK9 B;  4Y3C A;  2HFU A;  2UUC F;  2FQQ B;  2QX0 A;  4CNZ A;  6FDR A;  4J9M A;  1S10 A;  4KQZ A;  4ZN1 A;  2Q79 A;  3LGN A;  3GE9 A;  3G6E S;  3MM6 B;  2GML A;  2CNN B;  2CPF A;  5HMZ A;  1TL3 B;  2V63 A;  3K8V A;  4P9S A;  2XGP A;  3OSP A;  3K5N A;  3PW0 A;  4UOF A;  2YWF A;  5IV4 A;  1Q82 T;  1T05 A;  1QTG A;  4MYT A;  2ROE A;  5DDQ C;  3SSR A;  1RWW B;  1Y7P A;  1X5P A;  2HHS A;  4PG4 A;  2OPR B;  4DI6 A;  2MZ1 A;  1OHN A;  3RR8 A;  2AZ3 A;  1XWL A;  1TL7 B;  3D6H B;  4QOT A;  1X31 C;  5AJ3 F;  5AE1 A;  1T9W A;  2NPI A;  2KM8 C;  1VQM S;  2I1R A;  2JVO A;  2MKC A;  4OMF G;  3L09 A;  3PX0 A;  2CJK A;  1U45 A;  4FKX A;  1JMT A;  4LT6 A;  3OL8 A;  1NSK L;  2BW2 A;  4KO0 B;  1BQN B;  4YME A;  3KJV A;  2DCL A;  1U1M A;  5KFB A;  1D0E A;  2VHG A;  2EKY A;  2CRL A;  2C2N A;  1YBT A;  2MLX A;  2QYG A;  4CLU A;  3DM2 B;  1X4G A;  2BE7 D;  3UWT A;  4ZK7 M;  5HVG A;  3UDC A;  2BA3 A;  1IBL F;  3I56 S;  4KE5 A;  5H9E J;  2DBB A;  2H3E B;  5KG2 A;  4YP3 A;  5KFQ A;  3G4S S;  2ERR A;  2XYH B;  3VGV A;  2DHA A;  1KHW A;  2XY7 A;  1M1G A;  1WAC A;  3G8S A;  2A2D A;  1MWQ A;  2AT1 B;  2P8I A;  2BQ3 A;  4E2F B;  1VQ9 S;  4LUB A;  5T7L B;  2VOO A;  1T05 B;  1B0V A;  1WHV A;  1N36 J;  1FES A;  4XAK A;  3HHL C;  2NXU A;  4AFF A;  2V4R A;  3RBD A;  1HMV A;  5D3G A;  5CD4 H;  4OYA A;  2BRL A;  2FJD B;  2JHE A;  1MYL A;  4HAC A;  4MH8 A;  4KBI A;  5JXS A;  4K4W A;  2UUT A;  3UQS A;  4L72 B;  1YG0 A;  2NXC A;  1LXJ A;  3H5X A;  1G4C A;  1KOO A;  2GHP A;  2MQL A;  3G87 A;  5LOQ A;  3CCE S;  1IM6 A;  1KOH A;  2LMI A;  2ZWO A;  1F9F A;  1IBC B;  3S8S A;  1NK7 A;  2HLU A;  2CPJ A;  2X7I A;  3NS6 A;  1WC3 A;  1JLC A;  2BJD A;  1TV6 A;  2O1P A;  3D4J A;  4H54 A;  4NLD A;  4U67 Q;  2SXL A;  2HHP A;  3PM9 A;  4TXS A;  3CTR A;  1EZZ B;  4KO0 A;  5C2G A;  2HVH A;  2FYX A;  3VZH A;  5HQ8 A;  1Q81 T;  1N5Y B;  3G82 B;  2R7U A;  4YS2 A;  1U1N A;  3UPF A;  5GAE I;  2W7A A;  3QLH A;  5E2Q A;  1H74 A;  2CXE A;  2VG7 B;  3BZQ A;  3CCS S;  2CAJ A;  5A0Y B;  1YSJ A;  4OYM A;  3V6K A;  3CC7 S;  4WP8 A;  2DPJ A;  2F8M A;  1F5B A;  1CEZ A;  4OI4 A;  3ZZY A;  3KXD A;  5K5M A;  3S6E A;  3LWM A;  4FYY B;  1YJ9 S;  4DUZ F;  1R8H A;  4O4R A;  4Q0B B;  5IT4 A;  4EI2 A;  4ED0 A;  3R9L A;  5D3G B;  3ITH B;  3GV7 B;  1CBK A;  4UTG A;  1JIH A;  5D0E A;  4HAC B;  5LM7 E;  3U1M A;  2WON B;  5L46 A;  4WU2 A;  5THW A;  1RAA B;  3G6V A;  3Q23 A;  2C1E B;  4QIV A;  3W1Y C;  2MSS A;  3B8H A;  3E01 B;  4OZN A;  2FUG 9;  4R0J A;  5DO2 A;  3SQG A;  7FD1 A;  2DGV A;  2IMW P;  3UI3 A;  2BOP A;  2RML A;  1CC7 A;  2QA4 S;  1QM9 A;  1FA0 A;  2ZIT A;  2W9C B;  1S1T B;  1FWP A;  3OL9 A;  4USJ C;  5HO4 A;  1WC1 A;  4X4O A;  3H0P A;  3HPO A;  1N5Y A;  1R89 A;  3D67 A;  2HHU A;  4YR2 A;  2KVQ E;  1UJ6 A;  1BDT A;  4JI3 F;  3NKY A;  3SCJ E;  4LFB J;  3T6J A;  1XNQ J;  2VG7 A;  5AXK A;  4ZVT B;  4KAI A;  3D66 A;  1YLX A;  4I6Y A;  4X65 J;  4OHX A;  1NHK L;  3KLI B;  2GO8 A;  1RAF B;  3R97 A;  4QBU A;  3CDE A;  2Y1J A;  3AD8 C;  3U7J A;  2BJ1 A;  3FEX B;  4BWM A;  3H5S A;  1ZM9 A;  2LCW A;  4ZPT R;  3N6L A;  4LRV A;  3EUN A;  1K73 T;  5CYM A;  4DQR A;  3UCZ P;  4K0K J;  1L3T A;  3MZI A;  2HYI B;  1J5E J;  2WON A;  2VBY A;  1VGY A;  1L3S A;  2MMY A;  1WI8 A;  2OD6 A;  1Y5I B;  2BOA A;  4MTP A;  5IT0 A;  2B9E A;  1NJY A;  4IG0 A;  3CCR S;  2IM0 A;  3D68 A;  4DN0 A;  2YKM A;  1TFY A;  1MNE A;  3PJ9 A;  1WOO A;  5L38 A;  4C48 A;  4O4G B;  1NHU A;  2AP6 A;  4V1A k;  1S9E A;  1X4H A;  1NK6 A;  2CZ4 A;  3MAQ A;  4USV A;  1GH8 A;  4IR1 A;  2UXC F;  3HVR A;  4NI2 B;  4LFB F;  2YNG B;  1R6V A;  2XWY A;  4LSZ B;  3M8R A;  2B56 A;  3TYT A;  3CUN A;  2FZG B;  1PIE A;  5IC4 B;  2AF6 A;  3NGU A;  3AY0 A;  2FVP A;  3AXK A;  1Y5L B;  3IRX A;  3OFE A;  5DET A;  5HRO A;  2Z2M A;  2YNI B;  2CQC A;  1NDP A;  5J2Q A;  3CJ3 A;  3S7R A;  2K3K A;  4C11 A;  1ELO A;  3UD3 P;  1S0M A;  4F50 A;  2QLF B;  5F9N A;  3MMJ A;  3DKD A;  1J5E F;  3NAH A;  2OPP B;  1SL0 A;  4QWD A;  3V81 A;  2BDP A;  3EM1 A;  5IT9 Y;  3Q8P B;  1B70 B;  4DMZ A;  1UAW A;  3ET6 A;  3NCQ A;  3QJJ A;  3CMQ A;  2CNK B;  5CCL A;  2WVD A;  1S1U A;  2YQ0 A;  2X3G A;  2UV8 G;  4DU8 A;  3RW7 A;  1WWH A;  4FXW A;  3VCD A;  4DL3 A;  1N8R T;  5KTQ A;  2UVR A;  3VR1 A;  4QPT A;  1FRX A;  1K0T A;  4U7U K;  1R0C B;  2EW9 A;  2UUW A;  4R0E A;  3FRY A;  3MGJ A;  2VJU A;  2CVI A;  4NI2 A;  2QFJ A;  3DI6 B;  2XMT A;  3RW6 A;  4IO9 Q;  1F60 B;  4R5P B;  4HR2 A;  1VBK A;  3RRK A;  2RDJ A;  3JTO A;  1UVL A;  3QRR A;  3OLB A;  3M32 A;  2KXH A;  5KT4 A;  3GR0 A;  3PX6 A;  1XQI A;  2M88 A;  1RDR A;  1U1R A;  2YNI A;  2CNL B;  2GV1 A;  1PCA A;  1J5O A;  2N82 B;  2D3U A;  4KFB B;  1JQG A;  3BO2 A;  3VAL A;  3ZTO A;  3TAQ A;  1QVG R;  4ED2 A;  4DS4 A;  5CXT A;  4MT1 A;  4DXL A;  1EB0 A;  1XR5 A;  2IMO A;  4GMK A;  4ANC A;  3MEC A;  3BQ1 A;  2ZBQ A;  4H4K C;  1H38 A;  2Y9H A;  3V4I B;  1VC0 A;  2RU9 A;  3DRR A;  2RRB A;  2UU9 F;  2PO4 A;  4AAI A;  4MKB A;  1VQK S;  1FFS B;  4ZIV A;  4RU9 A;  2HHT A;  1KVI A;  1V3Z A;  1SJ1 A;  3ZO7 A;  2WBM A;  4R8U B;  4X66 J;  3KLH B;  2DH9 A;  4OZ0 A;  3PKM A;  1EP4 B;  1T94 A;  3OT9 A;  2B3T B;  2N4C A;  3O8W A;  2FC8 A;  1XNR F;  4F26 A;  3QSY B;  4KV8 A;  4S0M A;  3SEO A;  3D6M B;  4Y0F A;  4A8O A;  1FNM A;  2MXY A;  3MPV A;  2J0X A;  3J81 j;  4K4S A;  4WK3 A;  3QT7 A;  4TLQ A;  5F0U A;  2HK2 A;  2HNY B;  5BR8 F;  1JWW A;  1H3D A;  3OTC A;  1OSC A;  2JDJ A;  1Q53 A;  4OX9 J;  1HWJ A;  3HD2 A;  3RBE A;  4KFB A;  4MMO A;  3ZTP A;  4YR3 A;  3EGZ A;  2R2R A;  3KNA A;  1HR0 F;  3VAI A;  1N0V C;  5AT1 B;  1N34 J;  1KFS A;  1R8B A;  2ZWP A;  4I67 A;  3T5L A;  2HQC A;  3G5O A;  2ZBP A;  1HWI A;  4ILL A;  1E6Y A;  2V94 A;  2X51 A;  3V4I A;  2O3D A;  2VKZ G;  4M95 A;  4FNH A;  2K3I A;  3Q2S C;  4DV5 F;  3O44 A;  3TUJ C;  2QGF B;  3CWJ A;  5ETM A;  1X4B A;  2HSE B;  2ZEJ A;  4QZV B;  4WFY A;  4YB7 A;  4DPT A;  3RAM A;  1K0V A;  4MKA A;  1X0P A;  3PYF A;  2KKE A;  2EBE A;  2HQG A;  3R1L A;  4K7Q A;  2UUA F;  3G9C A;  1TKD A;  1KVJ A;  3F41 A;  1OYD A;  2RKI B;  4O23 A;  3FT7 A;  3VF0 B;  5DG8 A;  4KV8 B;  4BS2 A;  4B3M F;  1HYS B;  2APO A;  1RYR A;  2WVF A;  1GNK A;  1HKA A;  2EBG A;  1VRT A;  3FEZ A;  2DIS A;  5F8L A;  4DSF A;  2K9I A;  2VJV A;  2I2Y A;  3FGV A;  5E3R A;  3W62 A;  3ADA C;  4L76 A;  2W8L A;  4M1K A;  3CXC R;  1NK0 A;  4DR4 J;  1LXN A;  1YZ7 A;  2HLT A;  4URQ U;  3OQ2 A;  5B0F A;  2MQM A;  4USW A;  2HQF A;  3LPE A;  4X4P A;  1S1X B;  2RIJ A;  3MOZ A;  2D9O A;  4WPA A;  1BMQ B;  2VG6 B;  4I2P B;  1FRK A;  1H2T Z;  4P10 A;  2HBZ B;  3HDS A;  3E51 A;  4A8Q A;  2R7X A;  4KHM A;  3BDE A;  3NS5 A;  2UXD F;  4DPY A;  3MR5 A;  4X4U A;  1GQE A;  2QL7 B;  3UFC X;  1JXV A;  3IBC B;  2VA2 A;  4WZQ A;  4KGM A;  3GR1 A;  1VCT A;  2GVZ A;  4IRK A;  3FMT A;  5L1L A;  2QG9 B;  1XMQ J;  5DG9 A;  3PHT A;  3G8T A;  3MD3 A;  4F3Q A;  3N6M A;  3DLK A;  2LA4 A;  1JJ4 A;  2CG8 A;  1P6T A;  3Q2T C;  1XK8 A;  2MKY A;  2VAS A;  1QDU B;  1RZM A;  4NLU A;  1XEZ A;  2JFK A;  6AT1 B;  2FVQ A;  4QU7 A;  1R31 A;  2QTW A;  1NAQ A;  5MAO A;  5HL7 Q;  4F4Z A;  3OBI A;  2HWH A;  1NJI T;  2Y8Y A;  3J7A 1;  4N8N A;  4G1Q A;  2XCA A;  5D4O A;  3DXS X;  2H65 B;  2MJU A;  2YH0 A;  3OR2 A;  1N6Q A;  1HHT P;  3M4X A;  3Q8U A;  2BX6 A;  3SCI E;  4LRE A;  4DR6 F;  3V6D A;  3SBM A;  1I6J A;  4I2P A;  2VG6 A;  4RJV A;  4ZCK A;  3BKU A;  4UOC A;  1LWF B;  3EE3 A;  4KHR A;  4IH7 A;  4NZ7 A;  4RW4 A;  1WG5 A;  4ERD A;  1M0S A;  3M6X A;  4KIA A;  5JVG Q;  1JXE A;  1WG1 A;  2DNM A;  1RLC L;  4LBI A;  3ZTR A;  2IVY A;  3IR7 A;  5GAG U;  1S99 A;  2R8H A;  4B17 A;  2NZ4 A;  1HLW A;  2VKR A;  1VQ7 S;  1BWV A;  3MMB B;  3D28 A;  5DLF A;  4QPX A;  5M2R A;  1PG5 B;  2QL9 B;  4M5L A;  4ZDN A;  1JKH B;  2BQR A;  4C0O C;  4NWB A;  2VU5 A;  3US5 A;  3DRS B;  1KTQ A;  2OTL S;  2KHD A;  2YPY A;  1FEH A;  1YVF A;  2FPH X;  2ZOG A;  4ID5 B;  5C2C A;  1XNR J;  2JLE A;  4GRS A;  3FNN A;  3K8W A;  3NCR A;  5G0R B;  4WYL A;  2J6T A;  1TKX B;  2VZ9 A;  2M7S A;  4ZPA A;  3ZZU A;  3PZP A;  2R8K A;  1N6Q B;  3BYP A;  4MK9 A;  2HZC A;  2V2K A;  1MU2 B;  1TP7 A;  3OFH A;  4P2S A;  2IC3 B;  4K5S A;  2MLY A;  4USI A;  3PRD A;  1HBN B;  4DR7 F;  2R7S A;  2MEW A;  3J81 U;  3CMA S;  3Q8Q B;  3QT8 A;  3QGH A;  3CED A;  1JLQ B;  3EYZ A;  2C28 A;  4QIW D;  1LWF A;  1E6V A;  4ID8 A;  5J2P B;  1NLK L;  4YB1 P;  1Q8I A;  3K57 A;  3ENW A;  2E1R A;  2BSQ E;  4J7C A;  5I4M A;  2QT7 A;  5ETK A;  2QA4 G;  5B0A A;  4FPR A;  1DQ9 A;  5DQH A;  4UQG A;  3E8O A;  3I87 A;  2CQ3 A;  4GO5 X;  2HRT A;  3CJT A;  3DC2 A;  1B99 A;  3Q8V A;  4CLF A;  2HHQ A;  1AZS A;  3LO3 A;  3ILI A;  2CPI A;  2GNK A;  3M8Q B;  4H4M A;  3FEY B;  3UW1 A;  3MUR P;  1JKH A;  1ZH5 A;  3HHN B;  2V8G A;  2ASY A;  2IYI A;  3DRS A;  4JBC A;  4HDH A;  4NXM F;  4KHP J;  1CJU B;  2YNH A;  4OLP A;  5K8M A;  4ID5 A;  4CQ1 A;  5B09 A;  1TL5 A;  3TJ9 A;  1CS4 A;  4I1T A;  1OY9 A;  1TKX A;  2E66 A;  4QR0 A;  3J80 Y;  2R7W A;  2AYB A;  4JI4 F;  1BQX A;  1JNR B;  4FF2 A;  4DUY F;  2IC3 A;  3M2R B;  2ZH3 A;  5C24 A;  4RNF A;  1HBN A;  1WI6 A;  1Y10 A;  5HAN A;  4RNO A;  3QZ8 A;  1C0T A;  2VF3 A;  3C46 A;  4GKJ J;  4A48 A;  3HFK A;  2R7T A;  1UW4 A;  2RT3 A;  1Y0H A;  2XWX A;  2UXB F;  3GSI A;  5HMX A;  1E6V B;  4OYZ A;  3R6G B;  4NZ0 A;  2I5J B;  2F8H A;  2J9C A;  3LAK A;  5DZ7 A;  4DZ6 A;  2ALZ A;  1D9F A;  3QQC D;  4CLT A;  2KH9 A;  5LL6 d;  3VHQ A;  2MGZ B;  1WKJ A;  5E3P A;  4JV5 J;  2WVC A;  1YJ7 A;  1SBR A;  4UT4 A;  3AB2 B;  1Q5Y A;  2L9D A;  2JZ5 A;  4FXE A;  4F0K A;  1DLO B;  4IRC A;  2FDN A;  4OYP A;  4HDG A;  3CCW A;  3U02 A;  3D1O A;  1SJ3 P;  1CUL A;  5LXR A;  1URN A;  3L7O A;  3R5G A;  3OL7 A;  5HJY A;  1CS4 B;  4JI6 F;  1GXU A;  3DRP B;  2GVD B;  4J91 A;  4PYD A;  3KLG A;  2N7C A;  4OZL A;  3QSI A;  3ZNU A;  4ECZ A;  2O67 A;  2QZ8 A;  2G0J A;  3AQO A;  3M2R A;  5KG0 A;  4RZR A;  1FXD A;  4DWI A;  4YHH F;  1JX4 A;  4IFV A;  1GMW A;  1S1W A;  3R27 A;  3IR5 B;  1CC8 A;  2PEH A;  2LQ9 A;  2I5J A;  1SJR A;  1C1C A;  3H98 A;  1KLM A;  3MDF A;  4ED1 A;  5GAD U;  1TK0 A;  2EXU A;  1TAU A;  1AT1 B;  1QUP A;  3H59 A;  3OPK A;  2MGZ A;  3KK1 A;  2XSF A;  1UFL A;  3LPY A;  2GO9 A;  3MPY A;  4A8K A;  3CDB A;  2R8G A;  2HFN A;  2FLO A;  1ARR A;  3EVO A;  3KLF B;  1OYE A;  3IRW P;  2VD3 A;  5C25 B;  1VRU A;  4C2M A;  1RT1 A;  1FFW B;  1UW9 A;  4QR1 A;  3ZTQ A;  1XTZ A;  1Y00 A;  2ZHO A;  1PYT A;  3LAL A;  3BR8 A;  3FCV A;  3MEG B;  3TVZ A;  1RCX B;  3F44 A;  5ETT A;  4Y2I A;  3UO0 A;  2CQI A;  2XO6 A;  1RHJ B;  2J9D E;  3PHE A;  5A2Q U;  3GFY A;  3CDU A;  2J8S A;  5EX0 A;  4KKO B;  3TJA A;  1KC8 T;  4YR0 A;  2ADC A;  4IFV B;  3GCX P;  3ILL A;  1KFD A;  1S1W B;  5T41 A;  3NO7 A;  1TKZ A;  2B6A A;  2AGQ A;  4WKR A;  1GTE A;  4FPI A;  1RT4 B;  1UWA A;  2K1O A;  2VFU A;  1EX8 A;  4OIX A;  1N54 B;  1RK8 A;  2FY1 A;  4J9L A;  2L9N A;  2MQP A;  4OYO A;  3KK1 B;  4PXC A;  3SDE B;  3BN7 A;  3OFF A;  2HHX A;  2CZV C;  3GG1 A;  3KLF A;  3PCO B;  4AL6 A;  2IBO A;  4PWW A;  4Q2L A;  4PKD B;  1VRU B;  2E5L F;  2V8P A;  1VIS A;  1NCL A;  4TQS A;  1VFJ A;  1JB0 C;  2H4Y B;  5KFX A;  3JTN A;  1N48 A;  2VV5 A;  4M5D A;  2DR9 A;  2HHH F;  2VON A;  1B7Y B;  4OYB A;  2L3M A;  3R5C A;  3H40 A;  3BH7 B;  4OI3 A;  4ILR A;  2MKI A;  4OV1 A;  5F8H A;  1YRU A;  3EXY A;  1NO8 A;  1PSD A;  3EGV A;  4JP8 A;  4KKO A;  3TRG A;  2X1A A;  4X64 J;  5DGB A;  2H51 B;  1HPZ B;  4FF3 A;  4OX6 A;  1Q7L B;  4X62 F;  2W2O P;  1DTT B;  2DHG A;  5HAO A;  1RWP B;  2ZE2 A;  1DZ5 A;  3NGK A;  1RXO B;  3CCQ S;  4WF9 Q;  4LBH A;  5LJ5 Y;  1LK5 A;  3KMQ A;  1RT4 A;  4ZOS A;  1X9M A;  1YGY A;  1NEE A;  1SV5 B;  1UPM B;  2L48 A;  2VBX A;  3JAM U;  4BDP A;  1D9A A;  3SDE A;  1O0P A;  4P74 A;  3CCV S;  5LMN F;  3M9O B;  2BJE A;  2IJR A;  5I3U B;  5IWA F;  5DRK A;  4IQM A;  2AD9 A;  5EWE A;  2WHO A;  4CM0 A;  5CQG A;  1FX4 A;  4ZS6 A;  1UEK A;  2XLI A;  1EHW A;  4JI0 J;  2BJ8 A;  4DL6 A;  4FYW B;  4UZB A;  4ED3 A;  2XB2 D;  3RRG A;  1VJW A;  1NH7 A;  3C14 A;  3LWL A;  2N3L A;  3O1L A;  2KYX A;  1A7G E;  5H9F J;  2E9R X;  4JI1 F;  3L7P A;  1SC4 B;  4PWU A;  3SCK E;  5B0C A;  3Q86 A;  4M5I A;  4URG A;  5L9X A;  4ZVG A;  3I0R B;  4QWE A;  1HPZ A;  2YPZ A;  3D7S B;  1NH8 A;  3MCS A;  1I3O B;  4FYV B;  2ZKT A;  2F1F A;  1S7I A;  2ZNY A;  3GJT B;  3GYG A;  5HAT A;  4C7Q A;  1YI2 S;  2ZE2 B;  1PJ7 A;  3TEH B;  1SJQ A;  2JRS A;  3C66 A;  4O44 B;  3ILO A;  3D3C J;  4DPO A;  3BQ0 A;  4M5M A;  4PEO A;  2OLW A;  3CJ5 A;  3LTO A;  1S9F A;  1REG X;  2F65 A;  1T11 A;  1U8S A;  4F3O A;  2V8H A;  2DGT A;  1ZAW A;  2QLJ B;  4F36 A;  1SH0 A;  2A2B A;  3DU6 A;  4O0I A;  2ZH7 A;  2BR0 A;  2XYP B;  1KWM A;  1EAR A;  4HL9 A;  4RUH A;  3V6J A;  1FHT A;  4ZVU B;  3IXQ A;  5AXM A;  5I3U A;  4DF4 A;  4ICL A;  2AU0 A;  1FJG J;  3F0N A;  5F8J A;  3I9V 9;  3SCL E;  2VC1 A;  4F0H A;  4QW9 A;  3LH2 S;  3RB6 A;  1N33 J;  4DR4 F;  4OI1 A;  3SSQ A;  4F4Y A;  4J9U E;  2HHV A;  1XBW A;  1MN9 A;  2ZVI A;  5KT2 A;  4C8N A;  2GQQ A;  1ZA1 B;  2GIR A;  1W25 A;  3H5U A;  1IBK F;  2OIH A;  4DX6 A;  3MOJ B;  4MJW A;  1Y4Z B;  3DFE A;  2E9Z A;  2G9O A;  4LRF A;  1P1L A;  3I0R A;  3HKW A;  1SJ4 P;  2LXF A;  4DLG A;  1NDL A;  2EK1 A;  4J9R A;  1Q8B A;  2BJ9 A;  3OUY B;  2JEI A;  3KG4 A;  1TMM A;  4AQY J;  1WEL A;  2DHS A;  5KG7 A;  2ZD1 B;  4TY8 A;  5IC6 B;  2W4C A;  2ZC4 A;  2AX1 A;  3UDL A;  4WE1 A;  5K8P A;  1R8A A;  3BPD A;  2DPI A;  1EIY B;  2QO3 A;  2VB6 A;  3HJV A;  4ZVO B;  4F3M A;  2DJW A;  1YDL A;  2BE9 B;  1N5S A;  2AKW B;  4DCP B;  4MIW A;  4ICL B;  2WSC C;  1UVK A;  3NY0 A;  2HFZ A;  3KJF B;  1U1Q A;  2DRD A;  3CC2 S;  4JI7 F;  1D8Y A;  2RS2 A;  1P8G A;  1PJ6 A;  2E29 A;  3S1T A;  2Q6C A;  1TL1 B;  3Q22 A;  5M2P A;  3W2V B;  2QA1 A;  3F73 A;  3WC0 A;  3R5J B;  5L1I A;  1TAQ A;  1RAC B;  2CJQ A;  2POK A;  4HHJ A;  2VPW B;  3WIV A;  3FMW A;  4K59 A;  4F67 A;  1HFE L;  2FY8 A;  4JOU A;  3MM9 B;  3AQP A;  2KRR A;  5E3Q A;  3OTO F;  4OI6 A;  1TVR B;  4NMX A;  4YN3 B;  3UD4 P;  3OVB A;  2HWI A;  2Y1R I;  4A4J A;  3UCG A;  1DY3 A;  2V6A A;  1XR6 A;  5DDO C;  1SPB P;  4UUX A;  1M5P C;  2OD4 A;  4AXJ A;  2ZBC A;  4WP3 A;  3BO4 A;  5J2M A;  1R0A A;  2H54 B;  1MG7 A;  3MUT P;  3CCT A;  3WX4 A;  2YKN B;  5B0B A;  2RRA A;  2DR8 A;  2PDA A;  1QJH A;  2MZT A;  2YX7 A;  3NEK A;  3H2L A;  3FK4 A;  9RUB A;  5IXU A;  2H5E A;  2DRA A;  5HLF A;  4B3S F;  1NDC A;  2DIT A;  2XZT B;  3R5A A;  4PXE A;  4ZP8 A;  4ZKA A;  2YNF B;  1OWX A;  4B9S A;  2GAG C;  1MMD A;  3HVW A;  2WCX A;  1UFK A;  4PXB A;  4CO3 A;  1JLB A;  3RBX A;  3SXL A;  4DDF A;  1U09 A;  4AQY F;  1IUJ A;  5HP1 B;  1Z1Z A;  1F9H A;  1S9G A;  3NGT A;  1F3F A;  1JK9 B;  2DD8 S;  2W4P A;  3BSN A;  3GJQ B;  2YWH A;  2VFT A;  4ZJO A;  5B08 A;  3MM9 A;  1T03 A;  3W8G A;  2IDE A;  1TVR A;  2MZJ A;  1CJV A;  2RRN A;  5GVQ A;  4NRT A;  1PYO B;  1UP1 A;  3IG1 A;  2XG8 A;  3CO0 P;  1NB2 A;  2B9X A;  3HFZ B;  4X66 F;  2NS1 B;  4O3O A;  1Y3J A;  2VBZ A;  1L5U A;  2JXG A;  4LFC J;  2HK3 A;  3M30 B;  2RAQ A;  1R3N A;  2GCF A;  3AH6 A;  4K2J A;  1LWE A;  1DJ0 A;  4H4K A;  3FSI A;  4L3K A;  4QYR A;  4XDD A;  2V34 A;  1IJF B;  4HH1 A;  1Q1K A;  3H8Y A;  2BUN A;  4U7U D;  3FC9 A;  3QPI A;  3R7B B;  3N28 A;  5KFM A;  2GGP A;  1Q95 G;  3OXL A;  3C15 A;  5HLF B;  1UJ5 A;  4QWA A;  2DXE A;  3CT9 A;  2EWH A;  4DFP A;  3DMJ B;  1HNI A;  2QRR A;  3TO8 A;  1GX6 A;  4Y6I A;  4KJI A;  3MCM A;  3NXZ A;  5HP1 A;  3EWG A;  2WOM A;  4JUZ A;  1RKI A;  4IQX A;  3O3L A;  5ETO A;  2AWZ A;  2IAJ B;  2J9D A;  2PGC A;  4K4Y A;  4FP9 A;  1S76 D;  4Y00 A;  3M1V B;  1N32 J;  2LDI A;  2R4F A;  4P72 A;  2F63 A;  3QGI A;  4P2X A;  1JLG A;  2Z2L A;  4LSN A;  1VBX A;  4HKQ A;  3U1N A;  2C42 A;  2IA0 A;  1HNZ J;  1CJV B;  1NM2 A;  1XMB A;  5KFH A;  3VAH A;  1PAR A;  4B9N A;  4B3T J;  2AYM A;  2VPX B;  1H72 C;  2FLP A;  1FRM A;  3N0V A;  1QY7 A;  3BS9 A;  1LK7 A;  1PYS B;  2D9P A;  2NYH A;  4L6V 3;  4LRB A;  2AHO B;  5JUM A;  4DL0 C;  1Y9O A;  3QZ7 A;  1YJU A;  3ETM A;  1AW0 A;  3M30 A;  2AJ4 A;  4LF1 A;  1U2C A;  1VBZ A;  5LSO A;  3PEJ A;  3BSC A;  1F2H A;  4XK8 C;  3J80 U;  2DT9 A;  5EHH A;  1RWV B;  4K5R A;  3MFH A;  3D1Q A;  3Q83 A;  5E33 A;  2ASJ A;  4C0B A;  3OLA A;  5GAH U;  1X9W A;  1ZOT A;  1B01 A;  1HNI B;  2MQO A;  3THV A;  4IFY B;  3G2X A;  1RAO A;  4KGK A;  4K50 A;  2E9T A;  3BO3 A;  3C6T A;  1HNX J;  1NSQ A;  3DYA A;  4G6V B;  1IRQ A;  2ADL A;  2EFO A;  1UZH A;  3BH6 B;  2FD2 A;  3CD5 A;  2IAJ A;  3HSG A;  4HTJ A;  4YHH J;  5J1E B;  3ILJ A;  1NJZ A;  1XER A;  5FLX U;  4P71 A;  4XPC A;  1HQU A;  1Q0N A;  3FBF A;  2XI3 A;  4LSL A;  4I6A A;  2B8P A;  2R7Q A;  3QAU A;  1ZBT A;  1N5Q A;  1WF1 A;  2NXN A;  4GC7 A;  4WXO A;  2ZM6 F;  4MKY A;  3OJS A;  2LXU A;  1S6P A;  2HMI A;  2YTC A;  2BE2 A;  2W2Q P;  4LF5 F;  5A8W A;  5KG4 A;  3QJP A;  5KFK A;  2LU1 A;  2VDH A;  3ZNJ 1;  3I4H X;  4F2R A;  2XS2 A;  1HBO A;  1S79 A;  1NPR A;  2KT3 A;  3I5A A;  1IBK J;  4F2S A;  4Q2M A;  3OL6 A;  2J0Q D;  2B0G A;  5DLG A;  2KXF A;  1FKO B;  3TOQ A;  3V4M A;  4LF4 J;  4MFB B;  4PG5 A;  3DNC A;  3MUV P;  4KPY A;  3K5P A;  2JOQ A;  4CH1 A;  2M4M A;  5C7P A;  2H3A A;  2GJF A;  4AT1 B;  4FBU A;  4NLQ A;  3W61 A;  1D09 B;  2DNK A;  2FGC A;  2YXL A;  3BEG B;  4LF6 J;  4IFY A;  4CYU B;  4ED4 A;  2FJA B;  4BLG A;  4BC7 A;  1FJG F;  3H7H B;  1FJC A;  3DYA B;  1KVK A;  2XLJ A;  3R7N B;  3G6Y A;  3HVT B;  4CO4 A;  2M2B A;  4L3N A;  3VEB A;  4WP9 A;  4ME7 E;  2V8V A;  2DR5 A;  1RT7 A;  3K58 A;  3Q8R B;  1HQU B;  3KHR A;  3PO4 A;  4LSL B;  2JC0 A;  2NYI A;  4PPZ A;  3R8Y A;  1NZ8 A;  4EMD A;  3K5L A;  2E1C A;  4Y2M A;  2B43 A;  3TEG A;  4BCA A;  1F1B B;  1SIZ A;  3PR4 A;  3DLL Q;  2AY0 A;  2DR6 A;  3MMC A;  1S6P B;  3PYD A;  4I0W A;  2BE2 B;  4WCE Q;  2ZM6 J;  1YIJ S;  5A8W B;  3P4U B;  1I94 F;  4LR9 A;  1ROF A;  3KLV A;  3FVY A;  1LKZ A;  3H4B A;  2NRE A;  1DQA A;  2HBY B;  2D69 A;  2XHC A;  2RB7 A;  3V5R A;  4OHV A;  1ZAV A;  4OJ3 A;  4OZ5 A;  4TYA A;  3NGD A;  2V4J B;  3OD2 A;  1VR6 A;  4CTA A;  2L41 A;  1UET A;  3QO9 A;  1TUV A;  5T14 A;  1FTC A;  3DLG A;  4CI0 B;  2B9W A;  2HHW A;  4USM A;  4C8Z A;  5HVH A;  4QWC A;  2UU9 J;  4I68 A;  1K1S A;  3ZTS A;  1H0H B;  3UNY A;  4LQ9 A;  2L9W A;  2BKO A;  1C2P A;  5ETQ A;  2VIH A;  4DV0 J;  4EZ9 A;  2HKE A;  2ACM A;  1RAJ A;  2HND B;  1RTH A;  4Q5V A;  1ZA2 B;  4M5H A;  3LP0 A;  4NOH A;  1MRO B;  2C2O B;  4P73 A;  3TX0 A;  5K20 B;  3JSM A;  4ZCI A;  4JI5 F;  1S1V B;  3UR0 A;  3BGR A;  4A8F A;  1FDA A;  3AD9 C;  4DUY J;  4JI4 J;  2DIU A;  2KVI A;  4OV6 A;  5K8O A;  4DR3 J;  1V5I B;  1VQP S;  4JYA F;  5CZX A;  1CJT A;  3EJM A;  1SKU B;  4J37 A;  3OTO J;  3W60 A;  1RT3 B;  4IG3 A;  2KFZ A;  3IP0 A;  4A47 A;  3PW2 A;  3HXM A;  1RBA A;  1Q78 A;  2E44 A;  4ZA1 A;  2E7W A;  2NZC A;  1T9V A;  3DHX A;  5F0W A;  2FLL A;  3RRH A;  3GIL A;  2ZOM A;  2B4O A;  3AOA A;  3D6F B;  3DLG B;  4EWT A;  2OPS B;  4LFA J;  3J7A N;  3VVT A;  4DR2 F;  2EFN A;  2E1A A;  3TW0 A;  3I6P A;  2K7J A;  1SH2 A;  4KY3 A;  1YJV A;  4DQQ A;  3FSX A;  2G2Y A;  2FVS A;  2UXB J;  5C5J A;  2ZFH A;  2MB0 B;  1P9Y A;  2HND A;  2KOE A;  1VDH A;  4KPC A;  3CUL A;  5KFD A;  5IQ6 A;  1MRO A;  4GKJ F;  1XIQ A;  5KFC A;  3JSM B;  3BBC A;  4C6A A;  3SI8 A;  2Y0B B;  4W90 B;  4O3R A;  1TL7 A;  4FZV A;  3AFG A;  1NKC A;  3TWZ A;  5D0H A;  3BGR B;  3OFG A;  4LIW A;  1YRX A;  4ZPB A;  2MHN A;  5GMK a;  1FO1 A;  1FER A;  4DSJ A;  2BM1 A;  2OEL A;  4ZCM A;  2RIL A;  5JMN A;  2MQQ A;  4ECY A;  5A6P A;  4PUO A;  3B4D A;  2QLB B;  2DCU B;  4RW8 A;  3QRP A;  4DV7 F;  2RBF A;  1BGX T;  3RJM B;  5DQG A;  1G3O A;  4V19 X;  1U25 A;  4U6P A;  2QN6 B;  3B82 A;  3SV3 A;  3DM2 A;  4ZP6 A;  5U47 A;  5CA5 A;  4RUA A;  2AJ2 A;  4GVB B;  4BBY A;  2G4B A;  1SQE A;  1VQS A;  2JSX A;  3PVX A;  2AV5 A;  1UZD A;  1QSL A;  3AHP A;  1JJH A;  1YZ6 A;  3JQJ A;  1B3T A;  3KWM A;  4PCQ A;  1P27 B;  3T9N A;  2H4W B;  1FWK A;  2DNQ A;  5AXL A;  4B9U A;  1S0V A;  2YX1 A;  3IBW A;  4PG6 A;  3TI0 A;  1BUX A;  2MYF A;  2EFG A;  3AD7 C;  4HLB A;  1CVJ A;  1VMB A;  3W2W B;  4ECT A;  1YJW S;  1N4L A;  4LF6 F;  3CW2 C;  1WC6 A;  3IWL A;  4X4T A;  2A10 A;  1U49 A;  1J2V A;  2RU3 A;  3GYX B;  3K7R A;  4DPU A;  3GLJ A;  3KHG A;  3Q89 A;  3FRZ A;  2K29 A;  3I32 A;  3MPD A;  3FBC A;  2MZR A;  1XMO F;  2AEM A;  2JWN A;  4TU8 A;  3BGO P;  5HQL A;  3C3L A;  3FUY A;  2FC9 A;  3L3C A;  5KG1 A;  3VAG A;  1ZM3 A;  2CQB A;  2E5G A;  1TV6 B;  3LQV A;  3KYL A;  1R8C A;  2JBV A;  1UTA A;  3VAF A;  1RAE B;  3PW5 A;  1C0U B;  1NKE A;  1FWL A;  5D0G A;  2YY3 A;  3H25 A;  1GMV A;  1OY6 A;  1VQ6 S;  5E3C A;  2VDI A;  4IUF A;  3CD0 A;  3QLH B;  1U47 A;  3QJL A;  5LXY A;  4QCL A;  5A0Y A;  2MHE A;  3H42 A;  3QFW A;  1FRI A;  4N77 A;  3OTD A;  4TNO A;  4W98 A;  4WU3 A;  5HK4 A;  4PG8 A;  2ZJQ Q;  2ZBI A;  4X4Q A;  1L3V A;  4EZ6 A;  2EC0 A;  3LGH A;  2EK6 A;  4K4V A;  4QYZ J;  2Z8Q A;  2NSB A;  4DV1 F;  3GG0 A;  3HF5 A;  3OTB A;  3W2W A;  3HP6 A;  1TK5 A;  3GJR B;  3WHI A;  4ES3 A;  2DGO A;  1S49 A;  3ITH A;  3D0H E;  4Z37 A;  2WZ1 A;  2HNZ B;  1BC6 A;  4DR6 J;  3P5T L;  1HR0 J;  3CCL S;  4CLS A;  2WAQ D;  4F04 B;  2ZBR A;  4WFZ A;  3M8Y A;  3E01 A;  1Z2Z A;  5H9E K;  4Y2A A;  1FCA A;  2CPZ A;  2LEA A;  4DV6 J;  1VK8 A;  2GFF A;  2J9E A;  2Q2K A;  1DTQ B;  2DTJ A;  4ECU A;  1S1T A;  1FJE B;  3B54 A;  3FFI A;  4CT8 A;  2K5J A;  1F5C A;  1FJ7 A;  4DQS A;  4LFC F;  3QRQ A;  4ZN3 A;  1X4C A;  2YVS A;  3CJ0 A;  2NXE A;  4BC9 A;  2XS7 A;  4DOZ A;  4PPD A;  2ROG A;  5E3A A;  3CJQ A;  1WF0 A;  1R0B G;  1MYK A;  1QUV A;  2VPZ B;  3HVA A;  2Z0G A;  1B4S A;  2XZD B;  4EO6 A;  2PA3 A;  3W3S A;  3FDS A;  1H98 A;  1C1B A;  4N47 A;  4KT0 C;  4RPF A;  1IWG A;  1RQ0 A;  1A6L A;  3HZE A;  3NLC A;  1N36 F;  3HKZ D;  1KHV A;  4QIG A;  1X4F A;  5CYM B;  2R7V A;  2HNZ A;  3H5Y A;  2XMJ A;  4L73 A;  4RW7 A;  3VGT A;  5JVH Q;  3T9Z A;  2JNJ A;  5IM0 A;  4YB6 A;  1VYA A;  1FD2 A;  4RNN A;  4O3S A;  2DR7 A;  3POT A;  1U0H B;  1U7L A;  3LP1 B;  2J0S D;  3NNE A;  3MM7 A;  4C9D A;  1DTQ A;  3DXB A;  3FFI B;  5FDL B;  1F0X A;  2IM1 A;  5AE3 A;  2ZH4 A;  2DRB A;  4O3N A;  4M5J A;  2VIC A;  2C2Z B;  2CFX A;  1S9E B;  3D6T B;  2QV6 A;  3PDN A;  5A8K B;  3GU0 A;  1I94 J;  2J6S A;  2UUB F;  1BD6 A;  4MJK A;  2Z30 B;  3HHL A;  4OZ2 A;  4PQU B;  3W9I A;  2AMC B;  3BV8 A;  1TEL A;  4DSL A;  4G3I A;  4TY9 A;  4KHP F;  2FHO B;  2V69 A;  4CH7 A;  1HQ2 A;  1OY8 A;  1URR A;  2DO4 A;  4IOB A;  3TUZ C;  5CD4 A;  3IN5 A;  1VQ8 S;  2LQ8 A;  1YX2 A;  3M2V A;  3IA0 A;  4ZLJ A;  1NB7 A;  1C1B B;  3DDN A;  4XDC A;  1IKW B;  1TTH B;  3M8W A;  4CZC A;  5KFO A;  3A8E A;  2GHW A;  4TU7 A;  5J2Q B;  1HNX F;  4DR1 F;  4C11 B;  2BJ7 A;  2DH8 A;  4RW7 B;  2C3M A;  1N0U A;  4KSE B;  3BRE A;  1IKV B;  2BKP A;  5B0D A;  3HK2 A;  4RLE A;  3AOC A;  3HMJ G;  2QMX A;  1WC5 A;  1SIW A;  1M1H A;  1Q5V A;  3POT B;  1P1T A;  1U0H A;  2IRU A;  2IVM A;  3CD6 S;  1WG4 A;  1QE1 A;  5KFG A;  1B28 A;  3T1H J;  3DRY A;  3R2C J;  1EJ7 L;  1NME B;  4GO7 X;  1AUS L;  3B4M A;  1S1U B;  3OTE A;  1HD0 A;  2MKS A;  5FDL A;  4CP5 A;  2ZDO A;  4DBQ A;  2I6W A;  3CJS A;  1SC3 B;  3CGI A;  1IN0 A;  3GFH A;  4OFZ A;  2YKP A;  4EK2 A;  2FJE B;  1IKY A;  4EBE A;  1S72 S;  2DNN A;  3PRB A;  4OQJ A;  3KHH A;  2HBQ B;  2V2Z A;  4LQ3 A;  1R6Y A;  2CQD A;  1RHK B;  1U0S A;  2DXF A;  3DDK A;  3EDR B;  3TR5 A;  1VOM A;  5JJB A;  1UWB A;  2V2V A;  3KG0 A;  4CO5 A;  1SKR A;  4OZJ A;  5HN0 A;  2HHH J;  3AOD A;  1VHI A;  3DOK B;  2H48 B;  5GME A;  2WK4 A;  4EEY A;  1NJW A;  3KK3 A;  3PRV A;  3M2V B;  1WTF A;  3UN3 A;  5KFR A;  1IKW A;  3ENA A;  3W66 A;  2DEJ A;  4CWB A;  1LEO A;  1RBO B;  4JI7 J;  3KHL A;  2GQC A;  1Q16 A;  4EU0 A;  3M6U A;  4IRD A;  4E0D A;  4F02 A;  3MEE A;  4YEA A;  4AL7 A;  1QTN B;  1EKS A;  3QGG A;  3MEC B;  3BBB A;  2N7Y A;  2QC3 A;  1WHW A;  3VAK A;  1AFJ A;  1X4E A;  1QE1 B;  4DL2 A;  1UVI A;  1RHU B;  2JC1 A;  3DRR B;  2E1M C;  4WZM A;  2VA3 A;  1KRP A;  3TUI C;  4LF8 F;  4B3O A;  1YRT A;  2M3D A;  1UFW A;  2AX0 A;  2YQ3 A;  3VWS A;  4DV2 F;  1S6Q B;  4JI2 J;  5HMW A;  3OXF A;  4ECR A;  2YKA A;  1EP4 A;  2PMH A;  4NLT A;  4WIQ A;  5MLC V;  1U1P A;  3VAJ A;  3CIZ A;  1CQM A;  3EXC X;  3DOK A;  4WTO B;  3MMA B;  2Y1I A;  1B0P A;  3TQ1 A;  1IXK A;  2ADB A;  1KDN A;  1Q4R A;  5L8R C;  3KK3 B;  1HL6 A;  2Y8W A;  4WK1 A;  1T0T V;  3LAN A;  1BXN A;  2MQ8 A;  3CNQ P;  3PAC A;  4LF2 A;  2HNY A;  3TVK A;  4CCH A;  2CQH A;  4PZV A;  2B5J B;  4ANE A;  1Q16 B;  1WC4 A;  2PSZ A;  4PR6 A;  4ATN A;  4DJB A;  4NCA A;  4ZIT A;  5LJ3 Y;  5KT3 A;  5L39 A;  2CQ4 A;  3AJ2 A;  4GKK F;  1U02 A;  2X1B A;  4QYZ K;  1RUS A;  1NSP A;  1FKA F;  3BKT A;  2OJ3 A;  3EZ5 A;  1U48 A;  5D4P A;  2XI2 A;  2COL A;  5GMD A;  3N9U C;  4DF8 A;  1X5T A;  1ICE B;  5GAG I;  1QTM A;  3GJS B;  4U9R A;  1T9U A;  2LQB A;  1EA4 A;  2XY6 A;  1BQM B;  3PV8 A;  2CKW A;  1Q79 A;  1S6Q A;  4M8L A;  2CVE A;  1RWU A;  3W5X A;  8AT1 B;  4ZVF A;  4JI3 J;  2O5D A;  3PYG A;  2RKI A;  1WUU A;  1RYS A;  2CDQ A;  3M9M B;  3NP5 A;  2QJ3 A;  2R9L A;  1WEX A;  1HYS A;  2FB0 A;  1ZPV A;  3OVS A;  1VJQ A;  1K44 A;  3K2Y A;  1VRT B;  4NLV A;  5KFU A;  1HHQ A;  4Q8F A;  3CVK A;  1UCN A;  1BWE A;  3M6V A;  2EFV A;  2Y0S D;  2AJF E;  1LWX A;  2EG2 A;  2OHD A;  1CJK A;  2XLK A;  1T9Y A;  3MI7 X;  3H87 C;  4ZPC A;  3ZC4 A;  5LSR A;  2LVW A;  2DNP A;  2J7U A;  1S59 A;  3HSJ A;  4XO0 A;  4K4T A;  1R7I A;  1RT6 A;  2AGP A;  1GK8 A;  2LP4 A;  4CRJ A;  2VOD A;  3FJ2 A;  4F0M A;  3NGS A;  2C2K B;  2XTJ P;  1WOP A;  1D9D A;  2GPE A;  3MM5 B;  4PRF A;  2V68 A;  5D4N A;  2DIV A;  2RUS A;  2NSC A;  4MK7 A;  3PW7 A;  1RTJ A;  2GVZ B;  1IR2 A;  4OX9 F;  5FD1 A;  1BQM A;  3EMT A;  3CC4 S;  4B9L A;  2FJB B;  2PFD A;  3CF5 Q;  3VW4 A;  1SCJ B;  3IWN C;  1S77 D;  2OP5 A;  1CLF A;  4UY8 5;  4ZJQ A;  4X4R A;  1RKJ A;  4UW2 A;  4OHZ A;  4DCO B;  5CAB A;  1OQ6 A;  3M7V A;  2HFS A;  2AQ4 A;  1FXL A;  1ZAX A;  4JI5 J;  1GXT A;  3MTJ A;  2KB2 A;  2L08 A;  4NXM J;  5I3Q A;  1YJT A;  4RUB A;  5A6W A;  3IAS 9;  4G1Q B;  4I2Q B;  1UA1 A;  3OR2 B;  1CJK B;  1S7H A;  3LP2 A;  2IVF B;  3FZB A;  3RAQ A;  1X93 A;  1SKS A;  1F2G A;  3UD5 A;  2Q6B A;  3PG9 A;  2FZC B;  3R5B A;  4RX6 A;  2BVZ A;  4GVL A;  4G65 A;  1B0T A;  3ZXW A;  1ZTT A;  2A6O A;  4AE5 A;  2HPU A;  1FKP A;  4KH1 B;  4WFN Q;  2F7V A;  4IKA A;  4C0H A;  2DGW A;  4LBP A;  2ZKU A;  2YBV A;  4RWX A;  4PWD A;  3SIP B;  1KN6 A;  1FNX H;  2OI2 A;  1RTJ B;  4LF9 F;  2E5I A;  2F4V J;  1G7C B;  1WEZ A;  3MCN A;  2LLZ A;  3WBZ A;  1DHM A;  2ROP A;  4AD6 A;  2R2U A;  1VC5 A;  4Q7A A;  1UEU A;  3C8Y A;  3MMB A;  5CYQ B;  4B02 A;  3K59 A;  1YBA A;  3GXQ A;  1N5T A;  2KJV A;  3KNG A;  4M63 A;  4FBT A;  2Z57 B;  3HD1 A;  3WX8 A;  4LVN P;  1A0O B;  4PXD A;  4Z7C A;  4UUW A;  3OV7 A;  4CIO A;  4B3M J;  4LF7 J;  4J9K A;  2XNQ A;  4P2F A;  4V19 J;  1HNW J;  3N01 A;  2C2D A;  1VLO A;  4KGZ B;  3W9H A;  1LFP A;  5EX3 A;  1FE0 A;  1H7X A;  1UL3 A;  1Y5N B;  1N52 B;  2MY7 A;  4KYZ A;  3JYT B;  1PO6 A;  1JJ2 R;  4JI8 J;  2HQ3 A;  4FKY A;  5AJ3 J;  1RWM B;  3HUL A;  1MU2 A;  3VGU A;  4DQP A;  4CLW A;  2ZHA A;  3BN4 A;  2WVE A;  1BY9 A;  2GA7 A;  2PFF B;  1JLQ A;  3SV4 A;  4K0K F;  1X8D A;  4C8M A;  2H1Y A;  1FRJ A;  4NLW A;  2EFQ A;  4GKK J;  2W4D A;  3EDQ B;  4PWD B;  1V6H A;  2CNO B;  2DY9 A;  1WHX A;  2QSF A;  3QWU A;  1HNV A;  1T3O A;  3FMB A;  1MML A;  4N7T A;  4N41 A;  2C3Y A;  1SL1 A;  2P2C B;  4OZ1 A;  3R1H A;  1SKW A;  1SUQ B;  1FX2 A;  1UPP A;  1AZS B;  2DHX A;  2V2Q A;  4H4M B;  4TKT A;  1FDD A;  1KQK A;  5KFJ A;  3GCW P;  4ER8 A;  4ECQ A;  4LR8 A; 
#chains in the Genus database with same CATH homology
 1U9P A;  1X93 A;  2BJ1 A;  2NZC A;  2WVC A;  3BKF A;  1NLA A;  2KEL A;  1BAZ A;  2RBF A;  3QOQ A;  2JXI A;  1ARQ A;  2JXG A;  1Q5Y A;  2WVB A;  1BDV A;  1PAR A;  2HZA A;  2GPE A;  4FXE A;  4HV0 A;  1EA4 A;  2BNW A;  3VEB A;  2Y3Y A;  4ME7 E;  2K1O A;  2BJ7 A;  1ARR A;  2CAD A;  2WVE A;  2BA3 A;  2JXH A;  3BKU A;  2K5J A;  2BJ3 A;  2F1F A;  2K6L A;  3FMT A;  2AY0 A;  3VW4 A;  3FT7 A;  1Q5V A;  1QTG A;  3PHT A;  3QSI A;  2CAJ A;  2BJ9 A;  1B28 A;  1BDT A;  1P94 A;  2WVF A;  3LGH A;  2CAX A;  2BSQ E;  2CA9 A;  2K9I A;  1MNT A;  1MYK A;  2WVD A;  3GXQ A;  4D8J A;  1B01 A;  2BNZ A;  3VEA A;  2K29 A;  2PC6 A;  2H1O E;  2BJ8 A;  1MYL A;  3H87 C;  2CPG A;  2FGC A;  3BKT A;  3OD2 A;  1IRQ A;  2HZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...