3OD2A

E. coli nikr soaked with excess nickel ions
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
b'MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nickel-responsive regulatory protein
publication title Structural basis of low-affinity nickel binding to the nickel-responsive transcription factor NikR from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 41
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3od2A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3od2A02
1MYLA 1B28A 2CAXA 1BDTA 1IRQA 2RBFA 2NZCA 2Y3YA 2WVFA 3BKTA 2KELA 3BKUA 2CADA 3VEAA 3QSIA 2BNWA 2BJ3A 2GPEA 3FT7A 2BSQE 3QOQA 2WVDA 3OD2A 2K6LA 2JXIA 1QTGA 1ARRA 1MNTA 3BKFA 2BJ8A 1X93A 2PC6A 1Q5YA 3H87C 2BJ7A 1ARQA 2WVEA 2H1OE 4FXEA 4ME7E 2BJ9A 2CAJA 2AY0A 1U9PA 2BJ1A 4HV0A 2K5JA 2HZVA 3VW4A 2WVCA 2CA9A 2F1FA 2BNZA 2FGCA 2JXHA 4D8JA 2BA3A 1BAZA 3FMTA 1EA4A 2K9IA 3GXQA 2K29A 2K1OA 3LGHA 2HZAA 1NLAA 2WVBA 2CPGA 1P94A 1PARA 3PHTA 1MYKA 2JXGA 1Q5VA 1B01A 1BDVA 3VEBA
chains in the Genus database with same CATH superfamily
4X64F 5CYMB 2OUGA 2WZ1A 3QJLA 4WFAQ 1NDPA 2CAXA 1Z2ZA 4PEOA 4KE5A 3TEHB 1J5EF 2MGZA 1TMMA 5LJ5Y 4Q0BB 3R8YA 3D66A 3M6UA 2HWIA 4FF1A 1M0SA 3MM5A 4DCOB 2V2KA 1U2RA 1H2VZ 5HMZA 2LVWA 1HBUB 4Y3CA 2XYGB 3RB0A 2HNDA 3EGVA 3QNWB 1RB0A 1RP5A 3IBWA 1BUXA 2KFYA 4EUVA 2X3DA 2DPIA 1TVRA 4OZNA 3X1LB 1TFWA 3B82A 3NCQA 5KFOA 4N76A 1WJ9A 3MWBA 3W61A 2FD2A 2NYHA 1HWKA 1XNRJ 4RUCA 2JVRA 5ETQA 2Y1LB 2GW8A 3T1HJ 4ZN3A 3TP2A 3KUGA 3JQJA 3MMAB 4J9OA 4G3IA 4JI0F 4YDXA 5A2QY 1VRUB 1RT5B 2HWHA 1FO1A 1A7GE 1FRMA 1UVLA 3ONQA 3LP2B 4K4VA 5D78A 4ICLA 3OJSA 3S8SA 1J27A 3A8JA 2VG6A 5AE1A 1NM2A 1ZYQA 4B3SF 3QRPA 1D8YA 2QA4G 1UKUA 4CLUA 1FXLA 4X66J 3MMCA 4PUOA 2F7VA 4JV5J 3K5MA 4PQAA 5IXUA 1U02A 2R42A 5MLCV 5EWEA 1TL7A 4KGKA 2LU2A 4DV1F 2MKHA 2YNGA 5KG4A 5AT1B 2B9WA 2MQLA 4LQ3A 3FBCA 3EGZA 5F41A 3QAEA 3HKZD 2V2ZA 1UWAA 1WC1A 1S9GA 1WHYA 1S76D 2VC0A 4ME7E 3IXQA 1UW9A 2DXFA 4DUTA 2ZDOA 4KRWA 2Y8YA 4X4OA 3B78A 1B99A 4IO1A 1KRPA 2EVZA 2O67A 2MLZA 4DPTA 1RAAB 3ISND 1YIJS 3W60A 1U0SA 2Q6BA 2HW3A 1RE1B 2OTLS 2DT9A 5LMUF 4BC7A 1Y0HA 2GS8A 5C2GA 2DYAA 3HKWA 1VLYA 1QUPA 1TL3B 2AW0A 2CQCA 2DEIA 4ZP9A 3WX8A 1XMQJ 1M5VC 1EIYB 3D1QA 2ZZNA 3OUYA 2J0WA 3LWMA 1HNVA 4I6AA 2LDYA 2CJYB 2VJVA 1LFWA 5F8MA 4OLPA 1U2CA 3EDQB 1V5IB 3L95X 4F4YA 3UR3C 5HLFA 1VQ6S 2H48B 4TXSA 2HVEA 3H20A 3DLLQ 2Z56B 3E2EA 2VQEJ 2E5IA 2HHWA 2Z2LA 4O44B 5DDQC 4CTAB 2CA9A 4F3OA 4CIOA 2B8QA 3ENAA 3MXHP 2PMHA 2M0GB 1NO8A 3A3NB 3Q8QB 1XNRF 1T03B 1UJ6A 3I9V9 2AJ2A 2Z2YB 3T1HF 4F3QA 3K5NA 4NPOA 4ZP6A 1HIYA 1B01A 1TUWA 1VDHA 2HVHA 5LT5A 2FYXA 3W7BA 4U67Q 2FJBB 1S97A 5HVGA 4DSJA 1GK8A 2VJUA 3QGHA 2OELA 1RWVB 4YB5A 4RWXA 2E5JA 3ZZ0A 3IR6B 3H40A 2J76E 1CEZA 1JJCB 5GADI 2ACYA 3G87A 1FCAA 4I6WA 4X66F 1XQIA 3OL6A 1HQEB 4JV1A 5DG8A 2W4CA 1YTYA 2M3DA 1HBMA 2BACA 3CDUA 4XDCA 2DNOA 1Q5YA 3E01B 2DISA 5KFSA 5DQGA 1IKVB 1DHMA 2YVSA 2DXDA 1WELA 2QLJB 3LOUA 1SQEA 3BJYA 1P8GA 2V0NA 4UZCA 4PQUB 4ECVA 1UWBB 5KFGA 2IVYA 3ZTOA 4ZIVA 1RUSA 4IG0A 1FK9A 4F36A 3UN3A 1RT7B 3DHXA 5KFZA 1BXNA 2YWFA 1CG2A 4YHHJ 4RR5A 5GAEI 5EWFA 3D0GE 1XMOJ 1RAEB 3D1HA 5D77A 4OZ2A 4RBVA 3CSKA 3TRGA 3QZ8A 3HSGA 1XMQF 3R3TA 2L9DA 2E1PA 5D4PA 3PM9A 1F9FA 4JBCA 4DUZJ 3R5DA 1O8BA 3F0NA 3KJVB 3H2VE 2B3TB 4ECXA 5DM7Q 2MSSA 1REGX 4TKTA 2APOA 4QQBA 2IJRA 4A4JA 1TKZB 4RLEA 3GPAA 1B0TA 1R31A 1AZSA 4X2BA 2QC3A 2Q2KA 2D3O1 1XR5A 3PTWA 5J2MB 3NBPA 4O4RA 4TYBA 4HYKA 3H5UA 3HVAA 1FKOB 4ZLJA 1LWFB 1ZA2B 2VQEF 2J6SA 4WJBA 4LF5J 2D3UA 1OYDA 2K1RB 4NL5A 2R2TA 3GCXP 1WG5A 4RW6A 3NOGA 3MFIA 1FERA 2DY9A 1KOOA 3C19A 2A18A 4A8SA 3M8RA 5F8HA 2Z30B 2F4FA 1SC6A 1QSYA 2LQ8A 5J1EA 1OYEA 4JI6F 5L1KA 1U0HB 1OJ4A 5T41A 1PJ7A 2QSFA 2AX1A 2B5JB 4J9KA 1GMVA 3V4MA 3ILOA 3BPSP 3DRPA 3NGUA 1HMVA 3DHWC 3N5FA 3NAIA 4NZ7A 4TQRA 3FJ2A 3X3UA 4KY3A 4ZPWR 4OJGA 2CG8A 3J81U 2RKIB 3TVYA 2HAFA 2ZWPA 3HHNB 2XSJB 5I4MA 4B9TA 2DNRA 3OR2A 3BO3A 4KHMA 1T7PA 1RT2B 2NLWA 2QFIA 3HVRA 1SXLA 3KLIB 4I1TA 2RHSB 4Q43A 2N3OA 1IBLJ 5L1LA 1WKJA 2WVEA 2BM0A 4L75A 3BPDA 2CAJA 2BE2A 2C1EB 3KLGB 3GE9A 2E66A 1RCXB 2J7WA 4DN0A 5D3GB 1IBCB 2P6TA 3ZZOA 3MM7B 3W5ZA 3MGJA 3KLHB 2JWNA 2R7UA 1RAIB 2ATCB 2ZKTA 3DU6A 5K8PA 3GILA 1MU2A 2PFDA 2PFFB 4RJVA 1Y00A 1BMQB 4MIAA 1MYLA 1ZPWX 4P71A 2IAJB 4YHHF 5A8WA 5FJ4A 2VKZG 1XMOF 3UPFA 5A8RB 4M1KA 3N9UC 4DL7A 3QIDA 5HATA 1NUEA 1XBWA 4CO2A 2C28A 4Q7AA 2JFKA 5EN1A 3DI6B 4YMEA 3HFVA 3FCHA 1HR0J 2ZH2A 3Q8SB 3W9IA 1QTGA 3D6HB 5KG3A 3WBZA 1RWMB 5CYQA 2ZDPA 2V69A 3TA1A 1YK9A 2B4VA 2PO4A 1S1VA 2HQFA 1RT6B 3VGTA 2VA3A 3I4HX 2BV3A 3OQ2A 1Q79A 1IN0A 1JLBA 2GMLA 2XNRA 2LYVA 3QQCD 4XAKA 4RW4B 4TY9A 2RVJA 2I2YA 2MXYA 1H6KX 1ZM4A 3CCRS 4MFBB 4LF5F 3K7RA 5FLXU 4LBPA 2XSFA 2AIRB 3SV3A 2GGPB 1U1MA 4PXDA 3Q83A 5AJ3J 1KQSR 3TUZC 1FKPB 2RRNA 3A8EA 3TAPA 4DV6J 1DTQB 1RTJA 2X3GA 5LSLA 3SV4A 2DXEA 1WC5A 1Q78A 2IJNA 3DLGA 3KMQA 4IG3A 5J2QA 2D1CA 2EK6A 4CYUB 4K5RA 1BY9A 4QR2A 3HSZA 1HWIA 4UOGA 2YQ0A 3HMJG 3CO0P 4QBUA 2HBQB 2LA4A 3OFEA 3D3BJ 3CDBA 4K4ZA 1IJFB 3ZNJ1 5H9FJ 4DSFA 1AROP 1HKAA 1HARA 1TQLA 4ED8A 1IKWA 1IBLF 1RXOB 2FVCA 4D3HA 2A6MA 1S0VA 2E7WA 3CB4A 5I3QA 3DDIA 2N4CA 2V6AA 4K2JA 2YKMA 3M30B 1O51A 1RI7A 1B7YB 3OL9A 3OR1A 1KD1T 4NCGA 1IQTA 1N5YA 1WC4A 3CCTA 2IM2A 1JLAB 5SZTA 1RTHB 2CQ2A 4HT7A 1WSRA 4I7FA 1CBKA 2DPJA 5E3QA 1HR0F 4K4WA 1XR7A 3L9ZA 1D09B 2W9AA 4ELUA 3P49B 3GFHA 2RH3A 5GAGI 3NO7A 4RUBA 4FXEA 1VRTA 1X4AA 3W2VA 1RWPB 2XI2A 1DLOA 2IRYA 4BWMA 2Q79A 2RDDA 1Q8KA 3HVTB 3MAAA 4EGLA 5LOQA 1FNMA 1IUJA 2R3VA 4R25A 3BSAA 4RNFA 1S6OA 2HLUA 2C3OA 4EK2A 2J5AA 2MTLA 2WOMA 1FESA 5KFKA 4RW7B 4KGMA 3LP1A 4YB6A 2Y8WA 2IRXA 2F9DA 4I4BA 3OJUA 3HK2A 1S7IA 4K4UA 1U2FA 1NU4A 3E8OA 4DV6F 2VC1A 3MDFA 3HT3A 3M2VB 4DL6A 3VR1A 4DOZA 1Y3JA 3POTB 3P5BP 1IQZA 4NRUA 1U1RA 3KHHA 4DX7A 3VAGA 3DRSB 2KXFA 1HHTP 2BW2A 3JSMB 3UQSA 4DV3J 2DEJA 4WFNQ 4PYDA 2D9OA 2LEPA 3D1OA 1TL3A 3U1MA 1SJ1A 3DLEB 2J7KA 2ERRA 2BUNA 5HVHA 1L3UA 2ZVIA 3PV8A 1BQMB 3I82A 1TR0A 5F3ZA 1ZTTA 1OPZA 1W7WA 2B56A 3R7SB 1PC5A 2GIFA 3D6TB 2LLZA 5L9NA 3OL8A 2XZTB 1NJYA 2CJKA 1Q5VA 2DGSA 1RT3A 3OTBA 4C9DA 2XMUA 2CPFA 3Q8YA 4UY85 4NLRA 4ZVEA 3H4BA 4CTAA 1IR2A 5C24A 2FJAB 4DPOA 2KHDA 2YH0A 3H90A 4ETZA 1SJ3P 2DO4A 3PCOB 2GPEA 1T03A 2M7SA 3GLJA 2VFSA 2C2DA 1X5OA 4LSLB 2FZGB 3W8PA 2V4QA 1G7CB 2B4OA 3GIKA 2DGTA 4ZJOA 1F2GA 5E41A 1R0AA 2XS2A 3PXGa 4L73A 1S6QB 3CJ3A 2CPDA 3M2RA 1N8RT 4LF7J 1IWAA 5E5NA 1WC3A 2QLXA 1TL4A 4Q8EA 5G0RA 3MR6A 3BDPA 2ZBRA 1UZHA 1VJWA 2OLWA 3WC0A 2RIJA 5E7OB 1MW7A 3P6YC 4CT9A 3KXDA 3MEEB 1NK9A 4CLZA 2K2PA 3K58A 1U1LA 3AJ2A 3CCMS 3M2UA 2HNYB 1GEHA 4LJMA 5EHHA 2RT3A 4M5IA 1NK6A 2VU5A 1LW2B 4USMA 2E9TA 2EBGA 1HL6A 3ZZPA 1JLFA 1LK5A 4G65A 5B0CA 4HEA9 3IWLA 1X4FA 1TK5A 3KKFA 3TO8A 3NCPA 1TKXA 1VMBA 4BLGA 3RR7A 2NS1B 4L3NA 1UWBA 4LVNP 2MHEA 4NLVA 2IHR1 2UUWA 3BGRB 3KK3A 4DV4F 2W7AA 3CCES 3KG1A 1M5SA 3W63A 4FN5A 1KFSA 4DV3F 3MPWA 5FDLA 2RQ4A 1WEYA 2M88A 3GU0A 1R27B 2BOAA 2FHKA 1IBMJ 3K5OA 4IRCA 4AD6A 1UA1A 1NZAA 2HQ3A 2IA6A 4GO7X 2HBYB 2KM8B 4GKKJ 1J5OA 2EFVA 1BAZA 3TYTA 2XHWA 3DLKA 4CLYA 1KHVA 2B7BB 2IFXA 1TFYA 4OYBA 1FDBA 2H54B 4H4OB 3NMRA 2FC8A 2P8IA 3KUHA 2F4VJ 1Y5NB 1S49A 2KJWA 1MROB 4R5PA 2BZ2A 3O6QA 5G4DA 1OSDA 4F50A 4P2XA 3CJKB 1K1SA 4B9UA 3HHLB 1NJXA 1FRKA 4PYAA 4TU9A 2YNIB 3DLJA 4O3NA 2ZOMA 4F3MA 1V5VA 1CJTB 3AD9C 2UU9J 3OD2A 4JI4J 1S7HA 1C0UB 2VG7A 4B9VA 3BKFA 2KRRA 4HHJA 4LQ9A 1I5OB 3L7PA 2F8EX 1Y10A 1EX8A 4ECUA 4K0KJ 5K8NA 1LW0B 4RW8A 1S1XA 4OZ1A 3TJ8A 4LF7F 2COLA 2MB0B 4WZQA 2GJ2A 1HA1A 4IFVB 1TV6B 2XMTA 2ILYA 1VOMA 4QIEA 3L09A 5HN0A 4K59A 4DR7J 2OPRB 3QO9A 1N56A 4AXJA 5KFMA 3G6ES 5A6WA 2EFPA 2JNJA 3KLIA 1WDDA 2GHWA 3FCVA 4YOEA 3F41A 3MOZA 2BA9A 4WIQA 3AAWB 3D28A 3M8QA 2HGNA 2QA4S 1XIQA 3QMQA 4X4VA 5T7LA 2HIQA 1DURA 3W9HA 2EG2A 4JOUA 5IQ6A 2ZITA 4ZP8A 2HLTA 1U49A 4WXWA 2J9DA 1NDLA 1M1GA 2E7XA 4QU6A 2GCFA 4F0HA 3DC2A 3CIZA 2W4DA 2L9NA 2V8HA 3KMSA 4LRFA 2BVZA 3IRXB 1EQ0A 5DDRC 1S1UA 3GG0A 1RWUA 3SBMA 4RUHA 2BJ1A 2CQ1A 1ZS6A 1IBMF 4IKAA 1DQ8A 3OVAA 2W2MP 2LXUA 4W4MA 3V2UC 4GKKF 1T05A 4IH7A 1S1WB 2W2QP 4HI1A 4U6PA 2LU1A 1YZ7A 3R97A 3MEKA 4GMKA 1HHSA 4OZ5A 3I87A 5EX3A 3V6JA 5IT4A 1P27B 1GXTA 2F4VF 1NK7A 1DTTA 4CO1A 4WF9Q 3BQ0A 4NXNF 1FJEB 2LDIA 3C46A 3KNAA 2W9BB 3LQVA 7AT1B 4DHVA 2AEJA 5E0OA 5HL7Q 2QIFA 4DZDA 1KP6A 3FSYA 4ILLA 3Q2TC 3AA8A 2UU9F 1RA6A 1JLQA 4JI4F 1U47A 2NREA 4JI3J 1UJ5A 2JDJA 3OXGA 4GC7A 4HR2A 4PR6A 1FD2A 1RISA 1SV5A 2RF2A 2YWHA 4K0KF 4LR9A 3TJ9A 3PW4A 3MURP 1GFWB 3CEDA 3PX0A 2CIMA 1VCTA 1ZM2A 1I1GA 2FHMA 4H54A 2R8IA 2VDHA 3W5YA 2FVPA 3EVMA 2F65A 3DRYA 4DR7F 1WOPA 3BGUA 3N0VA 5F0UA 2JXGA 4FPRA 1HD0A 2DITA 5J2NA 2XCPA 1RZMA 2WTFA 1CC8A 3MPDA 1UP1A 2UUBJ 2M8HA 1EHWA 1RLCL 3EWGA 3OTCA 4DR3J 4DWIA 2XLKA 3QRRA 3SSQA 1BQNA 8AT1B 1Y5IB 4HKQA 5IZHA 3G4SS 5DDOC 1GTEA 1S1TA 2UVWA 2E9RX 2H4YB 4DX8H 3CJRA 3VQTA 2PC6A 1FKAF 2HQIA 4JI2J 4WK3A 3CDAA 1YDLA 2XGPA 3GB0A 2DGQA 3KHRA 1JLAA 3MM9A 1QSLA 4CI0B 2F1FA 2K8GA 4EU0A 2W01A 1SKSA 2AEMA 3LGHA 3C6UB 1KLMB 4RU9A 2IYGA 2CPGA 3UNYA 2JSXA 2AQ4A 2AGPA 5SUHA 1N33J 1K47A 5A2QU 1RU2A 4DF8A 1BDVA 4MAKA 2YBVA 4KFBB 2VPYB 4LREA 3KJFB 4MMOA 4U95A 3HXMA 2KHCA 3Q22A 2MQMA 2DTJA 2V68A 3NMAA 1WG4A 5H9EJ 5KT4A 3IN5A 2M70A 1SIWA 1IR0A 2ZFHA 3CDEA 3PIPQ 2OH2A 2WB4A 2WHOA 1JX4A 9ATCB 3ICLA 1T11A 4JI3F 3B6BA 3DRRA 4FNIA 1T95A 2OSQA 2DB1A 4O3PA 1OS5A 3OV7A 2RUGA 2RILA 2G1DA 4EZ9A 2ASDA 4K50A 4ECQA 1M5HA 1Q53A 1PC4A 4N8NA 3PY8A 3C16B 4DPUA 5A8KA 1SH0A 1EARA 3J7YI 5ETLA 4BDPA 2XM3A 3AODA 3AFGA 1TKTA 1R8HA 2QLFB 2B9YA 4UTGA 2PE8A 4EFAC 3K5LA 5HBMB 5J2PA 1MMLA 3J81Y 3H0PA 3BGLA 4CO0A 1LQ9A 3LP0A 2JBVA 1K8AT 2UUBF 4JI1J 1VQNS 4D3GA 2J0XA 2CVIA 3GJTB 4DR3F 4F4WA 5IT9U 3SIPB 4O3SA 2VG5B 3FFIA 1KQFB 3ZO7A 4N41A 3IAS9 3G8QA 3F44A 1LXJA 2V9WA 2PA8D 1WEZA 2GVDB 2AX0A 2G9OA 5I3UA 2V2QA 4W90B 2EC0A 2VD3A 3GCWP 2IC3B 1RHMB 3SDEA 3C3LA 4JI2F 3QFHA 2IYIA 4HV0A 4QCLA 4A8QA 4U8VA 1HYSA 3GXQA 1XJWB 3DYAB 3V81A 4TU8A 1AUSL 1H98A 1RHRB 3UR0A 4NLPA 2UUAJ 4WTYA 2ZBIA 2HBRB 2H51B 2X7IA 1N33F 3V6DB 3LAMA 1M5PC 1X5TA 4WFXA 4AL6A 3GG1A 5IC4B 2R7WA 1YVFA 2NXJA 2CNLB 2HHVA 3FT7A 4YY3J 3VALA 2PT0A 1UVMA 2IM0A 3MEGB 4U7CA 5D0EA 1KQKA 1WOOA 4DXLA 2FVSA 4IOCQ 4IFYB 4UOHA 1E6YA 2KG1A 2J0SD 3ZFVA 3DM2B 3S01A 4C8KA 4ECWA 2YKNA 2Q3PA 3CJTA 5C42A 3FBFA 3SQGA 5LL6d 2HKEA 3ADAC 3GMGA 2IDLA 2V63A 1V9OA 3AB2B 4KHRA 4PWDB 4ED0A 2POKA 3CCUS 4ZKAA 4R0EA 3UO0A 3BGRA 1NLKL 1RKJA 4P6QA 2HGMA 1V3SA 4ZHRB 3PIOQ 1YBAA 2CUYA 3TAQA 3KYLA 5L1IA 1G6BA 2UUCF 1LWEA 1RBLA 1N88A 3MFHA 1RTZA 2B9EA 2KTQA 1Z4UA 3UFCX 1HQUA 3K0JA 1NNDA 1CS4B 1J2VA 4DL3A 4JI1F 3S7RA 4DCPB 1RT1A 3V5RA 4DQRA 1HW8A 3I56S 3NG8A 1C0TB 4C4WA 3U02A 3HHDA 2V9KA 3CCQS 3GIMA 1H7XA 1MROA 5HQLA 1N5VA 3FUYA 4ID8A 2CKWA 1TL5A 1UW4A 3H87C 3CJ5A 1VQ5S 1YJ7A 2G2YA 4JI5J 4OI4A 5LJ3Y 5GMEA 1R0BG 1NXIA 3MHYA 4ZVUB 4V19X 4Y00A 3OFGA 2CYYA 5CYJA 2XLJA 2FLNA 3NGTA 2YX1A 3RW7A 2CQDA 3CUNA 4USWA 2K29A 3MM8B 2I5JA 3FSXA 4FNHA 2WVBA 2VBZA 4ZS6A 2R8JA 4OX9J 3GR0A 4Z37A 2LXFA 2UUAF 2LP4A 3NWGA 4Z2XA 3UVJB 2YNFB 1SUQA 4PWUA 1T9TA 3VV2B 1WTBA 4X4PA 3MPYA 3M8PA 2YY3A 4KH1B 1YRUA 2ZBQA 2E1CA 3BN4A 3ILIA 2E5HA 1XERA 1O5JA 4QIGA 1FX2A 3U7JA 2UV8G 3I0RB 5F8GA 5ETSA 4YY3F 1S0NA 2B51A 2R9LA 1ARRA 2WSCC 2CDRB 4FXDA 3ZZZA 4F7VA 3GV7B 2EWHA 1VQYA 5DS7A 3ISZA 4K7QA 1Q8BA 4LF8J 4HACB 3QGPA 4QWAA 4A8FA 3BM7A 4HH0A 4FZVA 1JKHB 1OG7A 4W98A 1WC6A 4C2MA 2D74B 1Y7PA 4DBQA 1XMBA 2GQCA 5E33A 4NI2B 3VHQA 2AEFA 3AD7C 5F9NA 3DGPA 1YZ6A 1CJUB 2DCUB 2DCLA 2KKHA 3OVBA 4OJ1A 4G1IA 3ZNUA 1Z1ZA 4B3TJ 4DLEA 1X7VA 4I2PA 4C0OC 1HPZB 4C48A 5HP1A 3LJPA 2ZC3A 3R1HA 2ROPA 3TUIC 2DR7A 2FJVA 2AF6A 1NJWA 3GR1A 4B3OB 2KXNB 1S1WA 1D1UA 4Q5VA 2Z2ZA 2DHSA 5D0RA 2QTWA 3GJQB 3RYLA 5E2QA 3MUVP 1YJTA 1S59A 4K8RA 1D9DA 3VVTA 2DNLA 1VFJA 3BBFA 2W9BA 3OLAA 1YJRA 4JI5F 5KFTA 3CJQA 1Q16B 1QE1A 3IR7A 2K7JA 4G1QA 1RAHB 2OPPB 3UN5A 3V4IB 2BM1A 2I9SA 4PG7A 2XWYA 2KZMA 4MH8A 1AW0A 4OX9F 4L3KA 3H4DA 2DRAA 2N82B 3UDEA 1N34J 3GYNA 3JSRA 3RAQA 4IO9Q 2AZ1A 2Y1JA 2HRUA 4L6V3 3CMAS 4DPXA 4LVOP 3QIPA 5AXKA 4TLQA 3IP0A 5ETPA 2KT3A 1JLEA 3B54A 4YEAA 1FNXH 3EICA 3W2WA 5FIIA 1C4CA 3CCVS 1Q4RA 3G82A 2C2EA 1RWOB 3I5CA 3DXSX 5BYQA 5LXYA 1UEKA 2BMBA 2HURA 4OZ0A 1YBTA 3JTPA 5E3PA 1WSVA 4NASA 3B8HA 1B0VA 4LF8F 1KTVA 2XQCA 5I42B 4QYRA 3Q8PB 4YR2A 4B3MJ 2J6UA 2HHXA 4ZA1A 2KZZA 3SYZA 2FHOB 3LUYA 3RUBL 1S6UA 4TY8B 3LA0A 3NS6A 1VRQC 2CNKB 5KG0A 4L74A 4ZPVR 1QTMA 4CLTA 4M5JA 3DRXA 4YR0A 4B3TF 3KLEA 2ZE2A 4C3LA 3M8SA 1ZM3A 5A0YA 5GAHU 1LNQA 4FDFA 3CJSA 3GSIA 3TZXA 1KLMA 1SQGA 4E2FB 2WVDA 1CULB 1S9EA 4HDGA 3NS5A 2B43A 2RDJA 4ANCA 3HLUA 1AA1B 1HBOB 3H25A 4MIBA 5IM0B 2AV5A 3FNNA 4G1PA 2VF3A 4J7CA 4OHXA 3R5GA 2A1BA 3ENVA 1U8WA 2FTRA 1VS3A 2XULA 2CJQA 2DD8S 3RBDA 2QGFB 2K7KA 5HROB 3K59A 1S12A 5KT3A 4WBFA 3JTOA 4DG1B 3QLHB 5K20B 1S5ZA 1RAJA 4A47A 2KKEA 1HHQA 4C8MA 4ZJQA 1BWEA 4X4NA 4EO6A 2C3YA 1N34F 4MT1A 5K14A 2NQPA 1U1NA 1WUUA 4DS5A 4KV8B 1H3DA 2P5VA 4M5HA 3MM6B 4WK1A 4OYMA 2NXUA 3CD5A 2VUGA 4M5DB 4WIIA 4EBEA 3PX4A 2BW7A 3PG9A 2OJ3A 1AB8A 2V34A 4NMXA 4ZN1A 3KLFA 5KFCA 1UAWA 1I3OB 3KK2B 4NWBA 2R2SA 3QAUA 3IGNA 2GHVC 1REVA 2ZH1A 3I0SB 1KC8T 1NDKA 2GQQA 1UFKA 2XMJA 2W7PA 4NA1A 2J9EA 1DY3A 3LALA 2WB1D 3N6LA 3FC9A 1IKYA 3O8WA 3IRWP 4EBDA 3GWCA 3VGSA 3IG1B 2FVRA 4CM2A 4NZ0A 1TL1A 4F4XA 1RSCA 2JEIA 5KG2A 1B0PA 3PRVA 5HVFA 4B3MF 4EMDA 4M63A 5C25B 4P75A 4CLFA 3R5CA 3FMWA 1JXLA 5BR8J 3MI7X 3IWNC 2X1GA 4NEYA 2HPUA 1ZZNA 4UF4A 2B8PA 3WHIA 4Y34A 1ZAXA 1GXUA 4J9NA 4IUFA 3SFUA 4ED6A 1KHWA 1KDNA 3I31A 1RT4A 2GHPA 2XMVA 2LQ9A 3JXOA 1HLWA 5M2PA 4GO5X 4A8YA 1RTDA 3AA9A 1ARQA 3FEYB 1CVJA 4ZLPA 3EYZA 4ELVA 4I0WA 4WFYA 2N7CA 4OI6A 2MZTA 4KO0B 3AJ1A 3IR5B 2VDIA 4LT6A 3DKDA 3SZ2A 2VOPA 3N4WA 3BB5A 4LR7A 2F3JA 1N5SA 2Q66A 2XC9A 1XEZA 4LF4J 2I38A 3BREA 1RHJB 1XR6A 2QLWA 1BE4A 1DRZA 4CLSA 1T9VA 2CPHA 3AH6A 2KFNA 5JMNA 3O1LA 3GFXA 2C2MB 4N47A 1GX6A 1MLAA 3ZC4A 3M9NB 3M9MB 1VQ8S 2KELA 2HIYA 4OV6A 3AB4B 2MZQA 3CW2C 3CCSS 1SKUB 4NA3A 1SKRA 4AAIA 1NKEA 3BH7B 3IS9A 2WBRA 1PJ6A 4HDHA 1OY8A 4EI2A 1S10A 3RBXA 1RACB 1RCOB 2FQQB 1VHIA 5DGAA 3T41A 3D67A 2A2DA 4YB7A 1TP7A 3HJFA 4AL5A 3N5BA 1JJ4A 3UWTA 4LF9J 3C15A 2BX6A 1S6PB 1L3SA 2BKOA 4IR1A 2G13A 4OHWA 3M32A 3LANA 4F02A 3HZGA 1PSDA 4ID5B 3TARA 2HMIA 1FFGB 2ZH3A 1FX4A 4AFFA 1ZZFA 4U9RA 2VPZB 2ZH6A 2XEXA 1X8DA 3UI3A 2DGXA 5T14A 3EZ5A 2LEBA 2BANB 2PMWA 5BR8F 2RBFA 2HVZA 4KHPJ 2W9CA 4I2QB 1SJFA 4NLWA 3VEAA 5DLFA 3J80U 2BJ3A 1GH8A 2ROEA 1WF1A 2B7CB 2RUSA 2CQBA 1XNQJ 8RUCA 4ELTA 2IRUA 2HRYA 4P10A 4ES2A 3QGIA 3FEZA 2EKNA 2FDNA 1HFEL 1ZAVA 3UVJA 4CWBA 2QRRA 2VV5A 3FBEA 4F4KA 4RBTA 1NK8A 5ETVA 5JUMA 4A8OA 1MSWD 2KB2A 8ATCB 3PR5B 3PRBA 1UPPA 3NY0A 1FTRA 2V50A 2G2OA 2R7RA 2CQ3A 4HH1A 2QSWA 3O3LA 2AT1B 5KT6A 1D9AA 4LF4F 4PCQA 4RL1A 3HHKA 4UOFA 1F3FA 1JNZB 3MECB 4FVCA 2RNEA 5JXSA 3C14A 2Z0GA 4EYIB 2KRBA 2O01C 3BR9A 4URQU 1HD1A 1IRQA 2XO7A 1FFSB 3W9JA 2RSQA 1JKHA 2ZM6J 1C1CA 1F3VA 3VWSA 4URGA 3RGIA 4C6AA 1PKUA 3Q8RB 4ES3A 4O0IA 1VQLS 2UV8A 1QAXA 3JQKA 1KWMA 2J8SA 1KS2A 2LKZA 1HNIB 4RX6A 4USJC 2ZD1A 1DBDA 3GJSB 2ZZMA 4DR5J 3U27A 2ZHOA 3EXCX 3IFEA 1HBNA 5DG7A 5D4LA 3OT9A 4OFZA 1KQGB 3CT9A 2VL1A 2RB7A 1TMJA 1AFIA 2DR8A 1UEVA 3DOMB 1IR1A 2OPSA 1JMTA 4RNMA 3IMQJ 1D0EA 4LF9F 4B9LA 5L38A 2WONA 3NLCA 2W2NP 3TNVA 2YH1A 5ITHA 4CQ1A 4CRJA 4WKYA 4ZLNA 4M95A 4KGZB 5IT9Y 1KNZA 1L3TA 4GVLA 3BH6B 2JOQA 2YNHB 1CPZA 2XMAA 4DLGA 2CXEA 3LPEA 4RUAA 2IY5B 3MEDA 4A8WA 2V94A 4KHPF 2MEWA 2H5JB 1EKSA 4OL8A 3JYTB 3W1YC 5C5JA 2AYBA 2QJ3A 1E6VB 1XNQF 4ZITA 4I6YA 1DZ5A 2F40A 4P7TA 2B0GA 1HI8A 3ETOA 5IC6B 4NLDA 4KPYA 1SB6A 2HFSA 1X5PA 4FYYB 2BJ7A 2B6AA 3M4XA 4O3OA 3C6TA 3TVKA 4MKBA 4WE1B 1NHUA 3Q23A 4YR3A 3OHAA 1EP4A 4O4GB 2DGOA 3EVOA 4PXEA 4A8XA 3FMTA 2L41A 4J91A 5HK4A 5CZVA 1LXNA 1Q1KA 3P3DA 5CZXA 4L76A 1UCNA 2CPZA 5K5MA 2ZOGA 2OPQA 2M2BA 2MGZB 1WI6A 2YPYA 4ILRA 1RYSA 1PGZA 3MCOA 4K4TA 1YJUA 3QBCA 4IOBA 4JV5F 1GX5A 1QY7A 1WHWA 4UZBA 3OXLA 3MM5B 1WD6A 4OX7A 3HD2A 2ZM6F 1DJ0A 3WIVA 4ZVTB 2HNDB 1A9NB 4FS2A 1VQ4S 3ITHA 3DDNA 4HL9A 3H8YA 2QFJA 2GX8A 9RUBA 1VYAA 1TVRB 1SI9A 1IXKA 3T5KA 4DR5F 1VGYA 4HTIA 3RAXA 5ETTA 5DG9A 2CQPA 3MD3A 2J6TA 4KGVB 1QSSA 3PNIA 1HI1A 1Y4ZB 2VFUA 2ZH7A 4DX5A 2KVQE 4Z7CA 1YLXA 3K8WA 1N6QA 2BQRA 3HHEA 4DQIA 2AZ3A 3PJWA 5IWAJ 2R7OA 1NMEB 4ICLB 4A8KA 4WXOA 1YG0A 2VG6B 1NSPA 2Z8QA 3HSDA 2KH9A 2Z2MA 4URSA 5J1NA 2L08A 4MIWA 1CQNA 1N36J 1DARA 1RTIA 3MMCB 3NRBA 1TL7B 3RG6A 4Q2LA 1T9UA 1OSCA 2YNGB 2VIHA 2CQGA 4CLPA 2ZH4A 4ETXA 1AFJA 5D4OA 1X0FA 1U4BA 2F8HA 4KKOB 1S9GB 3MPVA 3CIMA 2SXLA 3PEJA 2JZ5A 3O5TB 3BBCA 5KG6A 3MR7A 2MZ1A 1RQ0A 1RKIA 3GP9A 2AJ4A 4ZCIA 3CJ8A 2J0QD 2WW4A 3A12A 2HZVA 1F5AA 4PAAA 4Q8FA 1RA7A 3ELHA 4ECYA 1FF2A 1QUVA 3KK1A 1WNEA 2O3DA 4FYWB 1F5BA 3PW7A 2R7QA 4A8MP 5AE3A 4X65J 2FLPA 1S4FA 4FF3A 1R7IA 2DR9A 2RAQA 3DOLA 3OUYB 4ED1A 2CPXA 1HNVB 3QSYB 3IGVA 2UXDJ 1XK8A 2MYFA 2KO1A 5L8RC 3CGIA 4GVBA 2OO4A 2FIUA 3R5BA 3PW0A 5B0GA 3DMJA 2DKOB 5KT7A 4FKYA 4H4KA 2ZZTA 5CABA 2BQUA 2VKRA 4OZLA 3Q8VA 3G8SA 5LSOA 2NXEA 4LMZA 4C11A 1RABB 2QO3A 1SKWA 1K0TA 4NRTA 2ZVSA 2YXLA 2QG9B 2BJ9A 2XHCA 2FC9A 1SL1A 3DLBA 1TZ0A 4TLRA 3R5AA 1EB0A 1RADB 2ZJQQ 1XTZA 2XS5A 1FVSA 2Z4PA 2K1OA 1LWCA 4DFMA 7FD1A 1JLGA 3OTOJ 2EW9A 4PABA 2ALYB 5A6PA 3H42A 3ET6A 4DDFA 5IWAF 5H1SV 4TVAB 2C3UA 4DUZF 4ZCKA 4F2SA 2GVZB 3MMBA 2EPIA 4WFZA 4KQZA 3NEKA 3R2CJ 2JLFA 4W92B 1S0OA 1N36F 1RBOB 1OIAA 2JEGA 2BABA 5U47A 3I96A 1OMSA 2CJAA 3RBEA 4OYOA 4DSIA 5B0BA 3KG0A 4LRCA 3QT6A 1NPPA 2MKIA 3EGWB 2EBEA 3KWMA 1RYRA 3BS9A 1FJCA 1TUGB 1FK9B 2MSTA 2J8AA 4OYPA 2JXHA 2C2RA 4DZ6A 1AXQA 2ADBA 4NXMJ 5DQIA 5MAOA 2M5YA 2R7TA 2ZOFA 2MQPA 3BDEA 2XY6A 2HQCA 2VONA 3BZQA 3KUEA 4F8RA 4Y2KA 2NPFA 3GIIA 4KTQA 1CJKA 2Z58B 4IQXA 2YX4A 4X65F 3PO5A 1VQ9S 2ILZA 4PG8A 1IKXA 2MMYA 3PZPA 1NB2A 3KJQB 1FWPA 2WVFA 3D9BA 3QJJA 3US5A 4OYWA 5CYMA 1R8PA 5KFNA 3ISNC 1DQ9A 2CWXA 2UXDF 3SFGA 1AZSB 2HFNA 1KKHA 2FZKB 2XTJP 3NBPB 1H2UX 2VFVA 3PRDA 4Q0BA 1VK8A 5HAOA 4HTJA 3GONA 2P6SA 2FGOA 1GMWA 3EJMA 2HHUA 2HFZA 5ETKA 3T5HA 1HBUA 2H9ZA 2FPHX 4OV1A 2OIHA 2A6OA 1HI0P 5IFMA 2G4BA 4RW6B 4C3KA 3NNHA 3A1YG 1S9FA 4BCAA 2BXJA 1URRA 5KAKA 2HFVA 2DNQA 2YKQA 4QOTA 5J1EB 4OLOA 3RB6A 4GKJJ 5AE2A 3OTOF 5DDPC 3DRPB 5B0FA 3Q24A 4C8NA 1HMVB 2GFFA 3VEBA 4UT4A 2LCWA 1FRXA 2HGLA 3MMAA 4Y2CA 3QATA 1FRIA 2E29A 3BKTA 3CMES 1VRUA 4NE9C 3CO9A 1RT5A 3MAHA 3LW5C 3V6KA 4CLKA 4QWDA 1VC6A 3LP2A 2A10A 1Q86T 3G96A 4USVA 3HZEA 3RRKA 3GFZA 4RU2A 4ES1A 2LQBA 1N52B 2PSZA 3CDWA 3MECA 2MY8A 2IM3A 5HQMA 2BE2B 1JXEA 2ASYA 4OQJA 3D4JA 5IS2A 3KLVA 4ENOA 2ADLA 3W5XA 4WWSA 3AJDA 2DRDA 3BV8A 2AYEA 2F5GA 5C2CA 5KG5A 5AJ3F 4DR1J 1X4GA 3NL0A 4FVMA 2XWXA 2DHAA 3G71S 3AD8C 1X4EA 3E3XA 4NXMF 5ETOA 5A8WB 4P72A 1B7FA 2DGUA 3EX7B 1R8AA 4KH0B 3CNQP 3VGUA 1U24A 2GAHC 2HFOA 2QA1A 1W2BR 4F0MA 4OIXA 2MQNA 4JI0J 3UD5A 1R3NA 5ETMA 4DR2J 4NLYA 1LWXA 5CYQB 1EQMA 4Y2AA 3SI8A 1ZTWA 3SCLE 3QOQA 1S1VB 4DS4A 4JI7J 3MCMA 1YJ9S 3EXYA 1JLBB 4J90A 4EZ6A 1JB0C 2MKYA 2DJWA 5J1PA 2H4WB 3BN7A 3QT5A 4DSEA 2AJQA 5DZ6A 2XI3A 1RAGB 1CSJA 1PYOB 5K8MA 1E6VA 4B02A 3G6VA 2FLOA 2K9IA 1Y3KA 1N0VC 4OYXA 4O44A 3U1NA 1JLCB 3TI0A 3R6LB 1RTJB 1G1XA 5B0DA 1Z2LA 3CXCR 4J9SA 4GKJF 1QM9A 3O2IA 1T9XA 2V4RA 3JS9A 3T6BA 4Q45A 3LO3A 2CRLA 3DLGB 1VQKS 4WE1A 1P9YA 4USUA 4JV2A 1R0CB 4IG3B 5J2QB 1HNXJ 1FWKA 2MDAA 2XGQA 3MUMP 2IBKA 3QSIA 2F8MA 2JFDA 4QWCA 2P2CB 5GMKa 3PFEA 4AL7A 1KVIA 1RWNB 3SEOA 2HNZB 4NLQA 2P9CA 1FJGJ 2QYCA 4F0KA 3PJ9A 4DUYJ 4RWWA 1IKWB 1SIZA 4LIRA 2EFOA 3J7A1 1WI8A 1P9QC 2CNNB 1HQEA 3J7Z5 5IOLA 2HWTA 3KTQA 1LKZA 3TWZA 3L7UA 2G0JA 2VZ9A 1X9SA 1U7LA 2FVQA 2JEJA 2YKOA 2QV6A 3E01A 2H5IB 5DRKA 3R7NB 4DU8A 4KB7A 1X4HA 1F9EB 2AU0A 2YKMB 2KL8A 1IKVA 2UP1A 4DR1F 4I64A 3ZZTA 3OR1B 4LRDA 4K4YA 2J7UA 4NCGB 1N5YB 1ZH5A 2AHOB 4B08A 4PQUA 4OYZA 3UW1A 5CHCB 4XPCA 3CC2S 1VBKA 4CM0A 1RT7A 2DR6A 2BRKA 4LR8A 2ZBPA 3KOAA 1DAXA 4I7FB 1ZETA 1UL3A 3PX6A 2E5LJ 4B9SA 2BSQE 3WQPA 5JVHQ 4DR2F 3G5OA 1IVZA 1ZA1B 2HG4A 2V2VA 2MJUA 3GJRB 4OX8A 3GZ7A 5KOXA 1VRTB 4JI7F 2BJ8A 4X4TA 1NHKL 3LAKA 3OHBA 3W2VB 3KJVA 2ZWOA 1UFLA 4DL5A 1NPRA 1DLOB 4OX6A 3CPWR 2PEHA 2W24A 1TKZA 3MAAB 3FRYA 1YBUA 2FJXA 3VCDA 2ZNYA 6FD1A 5F8NA 5J2MA 4KPCA 5HI7A 1FKOA 5KT5A 2MLXA 1H73A 3BYRA 1LWFA 2WOMB 1A0OB 3PHEA 4KKOA 4USKA 3LP1B 1P94A 3GQCA 3J80Y 3BEGB 2ZJRQ 2V4JB 1VIOA 2K1RA 4DSKA 3FK4A 3W3SA 2OHDA 2CADA 2B4PA 1HNXF 3CCZA 1U0HA 2J9CA 4KGXB 2B5JA 3HJVA 4LSZB 2V5HG 3DXBA 2HFUA 4B9MA 2CJBA 3CF5Q 4KT0C 4ED7A 3I5AA 1URNA 3NOCA 1S99A 1FJGF 2RJZA 4DUYF 5KFYA 2RKIA 2EI5A 2YWEA 1JXVA 3HDSA 5EDWA 2XSJA 1R6VA 4ALZA 1FXRA 4PG6A 4FPIA 1CC7A 2JL9A 2BJEA 2GA7A 3G2XA 4K4SA 4DPWA 1RT2A 1PILA 2MHNA 4C8ZA 2YKAA 1U8SA 4EEYA 3D5MA 5KFUA 5HMXA 1DFDA 1BGXT 3KLGA 4OJHA 1RT3B 4ZMMA 5D3GA 3UDVA 3DLHA 2KDOA 4CH7A 3PDNA 2I1RA 3MM7A 2XYPB 2Q43A 5KT2A 4NYPA 2YPZA 1NCLA 3ILJA 4IDKB 4FF2A 5C24B 3GV5B 3KLHA 1RK8A 4LBIA 3MCNA 3N6MA 2W1BA 1P1LA 1A6LA 2MQQA 4PG5A 3B4DA 1MN7A 3PACA 2IAJA 4JI6J 3AHPA 4O0NA 4MKYA 5GMDA 3I5BA 2E5LF 1R0AB 1T8EA 4WPAA 2ASJA 5A8RA 1VQMS 4UY8T 4XDDA 2UZAA 2DNPA 4TNOA 3M2RB 3NNAA 4TYAA 3T5JA 1H2TZ 1GTHA 5CQGA 3I55S 3DI6A 4CP5A 1KLNA 3LH2S 5KFEA 5G0RB 2DIUA 2GVZA 3RBZA 2MPUA 5KFHA 4R0JA 2NSCA 3FQKA 2PDAA 2RS8A 2FLLA 2YWWA 4CDIA 3E51A 5C7PA 3SSSA 3M2UB 3G6YA 1RT6A 1KONA 4QJVA 2Y1RI 1TTHB 2WSFC 1X9MA 1RU1A 1VQSA 2DBBA 5HSPA 4RNHA 2GJFA 5B08A 4DFPA 5THWA 2QYGA 4RW4A 5KG1A 4TQSA 1JLFB 2UXCJ 2D69A 4S0MA 1XN9A 3MAQA 1W26A 1U25A 1S0MA 3TZWA 3Q8UA 4MFBA 4QPTA 1TKXB 2GGPA 2BR0A 1M5OC 3J7ZT 1R43A 3NGSA 1FKPA 4WU3A 2AGQA 3KK3B 4UUWA 1RHUB 5KFQA 1X4DA 1DTQA 4X62J 2W7OA 2QE5A 2OP5A 3UNGC 2UVUA 1MMDA 4MK8A 5ETNA 5FDLB 3CC4S 3MD1A 1SBRA 3PW5A 1JIHA 4OI3A 3MR3A 3OSPA 2D9PA 3IM9A 3W66A 2KJVA 3D6MB 3C8YA 3SMZA 4CYUA 1F60B 1F5CA 4XTTA 3NGDA 1KBRA 1F0XA 1F6TA 3Q89A 3VAJA 5E3RA 1J5OB 2OGUA 2JEFA 2JRSA 2QMWA 4FBUA 3DLKB 1S4EA 1FRHA 1NKBA 3Q86A 1X5SA 3SCIE 2VPXB 2E1MC 1QDUB 2HK3A 3BBBA 1AUDA 2F9JA 4R5PB 1V6HA 3NWRA 5BYRA 2DK2A 2ZEJA 4MKVA 2Z57B 4XO0A 2V67A 5L9XA 3UCUP 2R8GA 2VODA 3ENWA 4ZIWA 3M8YA 1Q8LA 1YJVA 3A3PB 3M30A 3UD4P 1LEOA 2OI2A 2QZ8A 2DH8A 3SCKE 3MZIA 2B9XA 3MMJA 3DOKB 3FZBA 3HULA 3N28A 2VG7B 3JSBA 2AD9A 4N5SA 2FY1A 5L46A 1FDNA 5IV4A 4F67A 2AKWB 4ZPBA 2RMLA 1BC6A 4OYIA 4FYXB 4RW8B 1RTHA 1S1XB 2PA3A 1IM4A 4KSEB 2XY5A 4OJ3A 4MJKA 3H5SA 1HW9A 2AGOA 2JHEA 4AXIA 3CCJS 4RW9B 3QO9B 3BYPA 1NEEA 1WWHA 1ZBTA 2OEKA 2D3OR 2HAIA 5FD1A 3TA0A 3QT8A 1I6JA 3G8TA 2DHHA 3HSJA 3WZ0A 1YX2A 4K4XA 4F26A 4NOHA 5CA5A 3HVTA 2UXCF 5HANA 3M8QB 3D3CJ 4B3RJ 3FRZA 4BBYA 4X84A 4C97A 5T7LB 1ZM9A 1BLUA 2JC1A 4H4MB 4RW7A 3RU0A 1RWWB 1QLNA 2WSEC 4ZVPB 3UDCA 3BO4A 3H98A 2IJFA 4X62F 2Q1LA 3M2VA 2QL9B 4A46A 4JI8J 5B0EA 5IV3A 4U96A 2LQJA 2IVFB 3POTA 4OHVA 4X4SA 1MNTA 2DGVA 1PBAA 3T3FA 1S1UB 2O66A 2AP6A 3DRSA 5LMNJ 3JQMA 2RD5C 4IH5A 5GAHI 2ZH9A 1JJHA 3JSMA 3OTEA 4DEZA 3HFKA 4JYAJ 2HRTA 4LF6J 1EJ7L 1AT1B 3NCRA 1T05B 2V8VA 3IM8A 3DLEA 3O44A 2OAUA 2DNMA 4DCJB 4QYZJ 1SVDA 2I6WA 1BQMA 2QX0A 2QA2A 2XZWA 3MPUB 3BQ2A 3G6XA 2LECA 5F8LA 1DTTB 3UD3P 1UFWA 1G3OA 2KG0A 1YJWS 4DV0J 3CC7S 4I56A 1KSPA 2X1AA 1LFPA 3FKBA 5EWGA 2MKCA 2OKQA 3F56A 3G86A 3VAHA 1BD6A 2RU9A 1T02A 2BOPA 1H72C 3D54A 1JLQB 3D7SB 1TAQA 1NKCA 1EKRA 5KFIA 1JLCA 2HS4A 1RAFB 3K17A 4QW8A 1SV5B 2RF2B 1EZZB 1IM6A 3ZXWA 2VPWB 4WZMA 4NYZA 2UXBJ 1X93A 1OO0B 4ZVSB 1WOSA 3Q0AA 4LSLA 4EYHB 4ILMA 3HFZB 4NLTA 3R1LA 6AT1B 3W62A 4N56A 4ED5A 1V3ZA 4LSNB 2U2FA 3OL7A 3KHLA 1T94A 4PXBA 2IMWP 1S6QA 3T9ZA 2HNZA 4E0DA 1NSKL 3QWPA 2A2BA 5HQ8A 2CQHA 2YX7A 1FFWB 5J2NB 5HMYA 1RHQB 3ETMA 1YRXA 5DQHA 3MEEA 1ITPA 1MG7A 3QWUA 4AYBD 5F3TA 2DIVA 3PYEA 5AXMA 2HNYA 3GSDA 1PJ5A 1H0HB 1H74A 4B3RF 3CD7A 1BQNB 3TW0A 1LW2A 4ZK7M 4OI1A 2YQ1A 3UCZP 2RU3A 4J5OA 1UEUA 2KI2A 4C7QA 2GJIA 1S1TB 2HVDA 4USTA 4J9LA 4UOCA 3PEHA 3QZ7A 4U7UD 5F9LA 4PPZA 3U1LA 3A13A 4JI8F 1FT8A 3L4BC 3TR5A 3OVSA 3MM9B 1GMWD 2FUG9 2UVVA 4GRSA 5DZ7A 5L39A 5LMNF 1ROFA 1M90T 1FRJA 4KIAA 2ZC4A 2AJ1A 1U09A 2OMLA 2W25A 4YFUA 4JYAF 1D8ZA 2K5JA 2MKJA 4LF6F 4DU7A 3BGFA 2XO6A 2W4PA 2XG8A 2HHPA 3P8BB 1EA4A 1TAUA 3IBFB 1P1TA 6FDRA 5L1JA 4Y2MA 4NCBA 2ZUAA 1MYKA 2EFQA 2MQOA 2YWKA 3HVWA 1B70B 3CJ4A 5AXNA 1S72S 3TUJC 4ECTA 4AUKA 1NZ8A 2YTCA 1Q95G 4H4OA 2D3ZA 4DV0F 1BDTA 1VIXA 3BKUA 1SIWB 3KJNB 4GC6A 3CJKA 1YSJA 2HZCA 4UQTA 4ED3A 3HHLA 4JP8A 3T5LA 1QVGR 2XCAA 2K6LA 2VBWA 2YNIA 3DRRB 2V4JA 3BF4A 3LF0A 1CJTA 4OHYA 3W64A 5K8OA 4KR0B 4F4AA 4WYLA 5KG7A 1LV5A 5HMWA 2UXBF 3GIJA 1C0UA 4CO3A 4DV4J 5A8KB 3MCSA 1D3WA 2Q6CA 5D15A 2NYIA 4I68A 4C8OA 2IMOA 3VW4A 4MKAA 4I69A 1TKTB 2QEXS 1LW0A 2CNOB 4DQQA 4FF4A 2XMWA 1CJVB 5J2PB 3OFFA 4IFVA 1TV6A 5EGYA 3LP0B 2W2PP 1U6FA 1N32J 4FBTA 5GADU 1OY6A 2H5EA 2EXUA 4M8LA 2OPRA 3HCXA 2Y0BB 1LK7A 3FFIB 2RHQB 4IOAQ 1GXLA 1SL0A 1SC1B 3AQPA 1Y5LB 4PRFA 4M5LA 1EAYC 5KTQA 5I3UB 4ZPCA 2NPIA 4QR1A 3JAMY 4IDKA 3RRGA 5GVQA 5KFDA 2OMOA 4OZJA 3SDEB 2GIRA 2CJ9A 1C4AA 1UPMB 4IRKA 1QVFR 1HYSB 2OTJS 2M52A 1OY9A 3V81B 4RBUA 1UMJA 2MZRA 2DH9A 2IIHA 1S48A 5GAEU 1Q8IA 4QPXA 4QIVA 2WW8A 1L5UA 5EX0A 3IRXA 5F0WA 2BKNA 4BHQA 2N4DA 3R5JB 2NCKL 2HK2A 4E8UA 2VASA 1F1BB 1B3TA 3HF5A 1TK8A 1ACMB 3BSOA 2P9EA 4MYUA 4X4QA 1WHXA 2IPOB 3TZYA 1WTFA 3HP6A 3BO2A 2RDIA 1EETB 1NH7A 2KXHA 1KR4A 1U1PA 3DFEA 3WIUA 1E6YB 2FHJA 4MTPA 3GYXB 3DDKA 4LRVA 4DSLA 2YKNB 1FE0A 4IH6A 3PR4A 5C42B 1GMUA 2E1RA 3SQGB 4YP3A 4RNNA 3ENQA 1CQMA 1YQHA 3AOAA 4LF1A 3HD1A 1NB7A 3G9CA 4YQWA 3TAMB 3THVA 3GFYA 2R7SA 1VI7A 2ZH5A 5M2RA 2X1FA 1JWWA 4HVZA 4OHZA 5LM7E 3FCWA 1TUVA 3D6FB 2XY7A 4DL4A 1R8BA 5KFRA 1FNOA 1PAEX 2K3KA 3H5XA 3EE3A 1LWEB 4DI6A 3QT7A 4MK9A 1NK5A 5DLGA 4C98A 2V8PA 4WCEQ 2W8LA 3GV8B 1HQUB 1NJZA 1FHTA 5CH7B 4H4KC 1NDCA 2LXIA 4DR6J 1N32F 3EMTA 4J9MA 2FJDB 4C8LA 3GTYX 1RT1B 1HWUA 3NP5A 2NZCA 4F25A 5KFBA 3K2YA 2MZJA 1VQOS 2ABYA 3N6NA 4IRDA 3M8ZA 3VAFA 1LOUA 4NXNJ 2BE7D 2BE9B 1NAQA 2FB0A 3SCJE 1YHQS 1IBKJ 1PCAA 4DX6A 1U6ZA 2E5GA 1SQFA 1WACA 4YDDB 1U6BA 1TU0B 5H9FK 1OWXA 4NZ6A 1UVNA 4Z7YA 1I94J 4UW2A 2CPJA 3DOKA 1U45A 2BDPA 1NSAA 2KFZA 1VQ7S 2I5JB 2CQ0A 5HO4A 3UN2A 1X0PA 1FTCA 4QU7A 1JNRB 3DN9A 2DHGA 2DNGA 1VHFA 4PXCA 1SUQB 3T9NA 1FEHA 4P2FA 5DO2A 3M8PB 1N54B 2AYGA 1Y9OA 3ZTQA 1GNKA 4ITSA 3C6UA 1R6YA 2VFRA 2HEKA 1Q7YT 3IAM9 4RW9A 2LQ5A 2MKSA 4Y2IA 1VK3A 2R8HA 4RZRA 1NPKA 2JJ4D 3K57A 4NCAA 4KFBA 3EPGA 2U1AA 4DF4A 3TQ1A 1TK0A 2C3PA 1WKLA 3M1VB 1MNEA 2KYZA 1WF2A 3GYGA 3IA0A 2H65B 2GZOA 1DQAA 2DNKA 5BYSA 1QTNB 1VISA 1PYTA 1SH2A 4X4RA 4MK7A 3J81j 2ZHBA 2CPEA 5D4NA 1U1KA 3ILLA 4H4MA 2HHSA 4PPDA 4XK8C 2RRBA 4AE5A 4MJWA 1HWJA 3DGPB 1UVKA 3PYDA 4RNOA 2HQGA 3QPIA 4NYOA 3FMBA 2PGCA 1SJ4P 1YWXA 1O0PA 4ZCMA 5IT0A 3C16A 2GMHA 1OPIA 3R27A 5EUHA 5DJBA 4I67A 4I2PB 1D9FA 3THTA 4P2SA 2H3EB 1FEEA 5HP1B 2O5DA 5B09A 4DR6F 1NJIT 4IYQA 3TEGA 2DNNA 4ZVQB 1QD1A 3M6WA 5HBMA 3CVKA 1GAOA 4CO4A 4DFJA 3MR5A 1Q81T 4F04B 1F2HA 1FA0A 3KFWX 4C0BA 1Q0NA 4Q44A 1BWVA 4NLUA 2GV1A 2VG5A 2C22A 2N7YA 3TANA 1IBKF 2VH7A 1QE1B 3I32A 3IR7B 4CCHA 3W65A 1M1KT 1I94F 2GVDA 3K8VA 4G1QB 2BKPA 2V8GA 3SSRA 2LFVA 4A48A 3ULHA 1JK9B 1Q7LB 1VBXA 1VQPS 2UUTA 3VZIA 2XNQA 4ERDA 4P7VA 1M1HA 2IC3A 2CQ4A 3VAIA 2DNYA 1KTQA 1VBYA 5DETA 1BQXA 3D68A 3WDOA 4QWBA 3ZTPA 3P5TL 4J9QA 2PD1A 2C2ZB 3KG4A 3DYAA 2F63A 2AYMA 1RWKB 4LSNA 2LEAA 4Y28C 3CULA 3QIPB 1WKKA 5E3AA 2XMKA 3D2WA 1VJQA 2OEMA 2YWGA 4OYAA 1JLEB 4IQMA 2CPYA 3T1YJ 3V6DA 2EK1A 3W2WB 3RR8A 4ECZA 3G82B 5GAGU 2G1HA 5KFWA 1P6TA 4ZVHA 1F9HA 2BJDA 3AXMA 4DL0C 3H7HB 4AQYJ 2BRLA 4F2RA 2KT2A 2G2ZA 2I0XA 4J9VA 3EGNA 4ZJLA 3I4PA 4ZVOB 3OLBA 3MEGA 1ULRA 4M5MA 4OI2A 1KOHA 4OI0A 4LF2A 4IFYA 5KFPA 3MR2A 3DM2A 4CZCA 2A2CA 4C0HA 4CNZA 2FGCA 4EBCA 1FI4A 4ER8A 1N0UA 2JVOA 3AT1B 3IO1A 3NNCA 1NLAA 2K3IA 4XIUA 4WP3A 4PWDA 1X4BA 2IM1A 3VAMA 4NMLA 1UETA 4FYVB 1QAYA 3KLEB 4ECRA 2WRMA 3RRHA 2ZE2B 1TKDA 5I3PA 2G0IA 5A0YB 4NX9A 2CJXB 3NAHA 4ZHRA 1SL2A 4NEZA 2MY7A 4P73A 2M8DB 1B28A 2JLEA 1C1BB 3DCAA 1S9EB 3B4MA 4F4ZA 1MWYA 4ZCLA 1FDAA 5LSRA 4J9RA 4N7TA 1SC3B 2H1YA 3JSYA 4NLOA 3HI9A 4WP8A 1CS4A 4ZLLA 1T0TV 2NUHA 4M5KA 2EFGA 4Q2MA 3EZUA 2JC0A 1C0TA 3K5PA 2LMIA 2KOEA 3GIRA 3PVXA 1WG1A 2GIQA 2LA6A 1ZPVA 4JV0A 3ZZRA 5CD4H 1UVIA 3D0IE 3VGVA 2DGWA 2FZCB 2L9WA 2BNZA 2ZH8A 3RAMA 2RRAA 4O3QA 3AOCA 5CAAA 3C66A 2GNKA 3FZ2A 2OSRA 1MWZA 3PHTA 1R89A 4FKXA 1L3KA 1RAOA 1N48A 1QJHA 5AXLA 5K14B 1N5QA 4FP9A 2KVIA 2XS7A 3MM8A 2ROGA 3S1TA 1X9WA 3FGVA 2M4MA 3FSIA 3MOJB 2Y3YA 3ZTSA 2E1AA 2UUCJ 5D8HB 2YNFA 2B4UA 4WFBQ 1O6XA 1CJVA 3SQOP 3P96A 3M9OB 3T1YF 3KLFB 4QR0A 1REVB 1H38A 4HLBA 5A76A 4B17A 4AQYF 4DFKA 1VBZA 4QZVB 2R7VA 3I0RA 3VF0B 3TA2A 1ELOA 1HQ2A 2FJWA 3LGNA 4IR9A 2MQ8A 1IKYB 4NLGA 3TOQA 3I9ZA 1TL1B 1U9PA 3H59A 1ZOTA 3M7VA 1WF0A 2CPIA 2C2KB 5KFAA 4CT8A 2NXNA 3CJ0A 4HACA 4J9UE 5D6GA 1R8CA 5M2UA 2WCXA 1NK0A 1RBAA 3EZOA 3TX0A 2NR0A 4ZPDA 3MTKA 2YKPA 5KFXA 1PAUB 3NNEA 4NI2A 2GMJA 4R8UB 1PYSB 1RGVA 5KFLA 4WKRA 1CJUA 3LGMA 2VA2A 3JTNA 4LRAA 4HHHA 4TN2A 4KAIA 2FY8A 3AY0A 4DR4J 3VAKA 1PIEA 3NS7B 1RT4B 2JLGA 4YN3B 3C2PA 4DQPA 1HPZA 1RTDB 3SXLA 4USHA 2O1PA 3KDOA 2HQDA 4LIWA 4FYDA 4B3OA 3FVYA 3ZTRA 5BJRA 4DPYA 3OPKA 2AWZA 2WBMA 2R2RA 3VQSA 2HS0A 4ZDNA 1EETA 2X1BA 2VFTA 2RE1A 3A8KA 2V8DA 4ED2A 2I8EA 3TUPA 3Q2SC 2R8KA 3FEXB 4ZVGA 2PN6A 2ASLA 5FLXY 1Q82T 2M9KA 3NKYA 5LXRA 2YQ3A 2DHXA 2R2UA 1Q16A 3PYFA 4Y65A 4JB8B 1OQ6A 1T9YA 2DRBA 1UA0A 3TAMA 4DMZA 2OPPA 1SJQA 3V4IA 4DJBA 1ZAWA 3I6PA 2IBOA 2JX2A 1KVKA 4L72B 3LWLA 3IS9B 2WK4A 2BNWA 1JJ2R 2QT7A 2EKYA 4CLWA 3DGVA 1NRKA 3W8GA 4ED4A 3P4UB 2OFHX 3NGKA 1QAIA 5HJXA 2Y0SD 2QMUB 2DNHA 3DNCA 1ICEB 3ZZUA 3N01A 4YS2A 3C15B 1UVJA 3FQLA 3OW2R 3IBCB 3M32B 1L3VA 1FXDA 3RZAA 2E9ZA 1SCJB 2R7XA 1I51B 4CH1A 2MLYA 2A3JA 2HMIB 1K44A 4CLLA 1AYEA 4WTOB 2J9DE 3N79A 2HZAA 5I42A 1OQ3A 3MF5A 3OBIA 1K0VA 2W9CB 2VOOA 4KYZA 2AMCB 3PYGA 4N8OA 3CD6S 3PW2A 2MJNA 3R9LA 2CZVC 2XB2D 1UTAA 3PKMA 2ZKUA 4TY8A 1APSA 3VVUA 1W2IA 3CCLS 4PG4A 4DR4F 3TZZA 3HPOA 3HHLD 4E98A 3D0HE 1TELA 3HO1A 1U26A 1FWLA 2XMMA 3FBBA 1CULA 3MTJA 4LFBJ 4NA2A 3AQOA 1MN9A 4WYWA 1NSQA 3BSNA 1HBOA 2VQFJ 1VC0A 5CCLA 4M5NA 3M6VA 5IM0A 3IWXA 3RB4A 2C3MA 3M1VA 2Y9HA 1UZDA 4BC9A 1B64A 3C14B 3H2UB 4V19J 2X51A 1MWQA 5HROA 4PUOB 2PEBA 4JUZA 3RB3A 4DG1A 1C1CB 3QLHA 3A8IA 3J7AN 2ACMA 3QYYA 4ZVRB 2VICA 4LBHA 3PKYA 2ALZA 1NBEB 1S57A 2ZD1B 3HX9A 4ATNA 3UCGA 5CD4A 2JH3A 1FDDA 1N5TA 1HNWJ 1HBNB 4LFAJ 4KJIA 1SPBP 2GO8A 4LFCJ 1U1QA 1K9MT 1RLDA 4KV8A 5H9EK 2OD4A 3MM6A 4EWTA 2BQ3A 2ATLA 3A4TA 4BS2A 4USIA 2QMXA 4HI2A 2OPSB 4M5DA 4DV5J 5CCMA 3KNGA 3M6XA 4KC5A 1X60A 4QWEA 2EFNA 2H1OE 4U8YA 4BWJA 3CTRA 3KK2A 2CFXA 2WONB 1PG5B 2ZNZA 2VBYA 3FDSA 4TU7A 4M5GA 2N3LA 3BSCA 3I0SA 1YRTA 2BEFA 3HT0A 2KU7A 1FJ7A 5K9FA 4ZPTR 1UJ4A 2D41A 4C3MA 2PI5A 3RW6A 3L7OA 4FXWA 4HHUA 4P52A 5JVGQ 1U1OA 1X31C 3IG1A 3HM9A 3KHGA 1GQEA 2GC8A 3MEDB 2P9GA 3VZHA 1KFDA 4Y0FA 4PKDB 5HLFB 2DY1A 4CH0S 5C25A 2NSBA 4CO5A 2D7SA 4QYZK 1KEKA 5D0HA 1IJEB 2GAGC 2PMZD 1VR6A 1T9WA 2CVEA 2IVMA 2CDQA 2FHJD 4QIFA 2RQCA 2ZUGA 1WHVA 5E3CA 1V3RA 4M94A 2B6AB 4DN9A 4DV7J 3C6TB 4XPEA 1YITS 2AN7A 4DV2J 2H3AA 2HHQA 1EP4B 4LFBF 3OFHA 2HSEB 1SC4B 2WAQD 2AY0A 3NGRA 2VQFF 4FXVA 3PO4A 1GT8A 2C2OB 5IQQA 3R6GB 2BA3A 2VBXA 4LRBA 2OPQB 4G6VB 3UE2A 1KN6A 2KT5A 4KO0A 2HHHJ 1KVJA 3AXKA 4RKUC 3CCWA 3TJAA 2RS2A 2L48A 2HVIA 4V1Ak 1HBMB 4J37A 1T3NA 1K73T 3VTIA 1FVQA 2CZ9A 4C8YA 3OTDA 3QGGA 3ITHB 1WEXA 4P74A 4P2MA 2AJFE 2CWKA 2ZBCA 2DVIA 2W8KA 4KBIA 1C2PA 3OXFA 4P9SA 4QW9A 2MZSA 4HT5A 1HNWF 1QAJA 1CLFA 2C2NA 2KN4A 3OSNA 4LFAF 4K2XA 2IDEA 4LFCF 1WORA 2W2OP 2XZDB 4IG0B 3J7YU 3CWJA 1VLOA 3THPA 1PBUA 4DV5F 2EG1A 2PIIA 1C1BA 1N6QB 1X4CA 3AOBA 4RPFA 1XC9A 1NK4A 4B9NA 3M05A 3V6HA 4J9PA 1BHNA 1N4LA 2HBZB 4D8JA 2EC2A 2NXCA 2QL7B 2KYXA 1B4SA 5KFJA 2CG4A 1S6PA 4Y6IA 4YB1P 3LTOA 2R4FA 4YUDA 1RTIB 4ID5A 1OHNA 4NLSA 3PJXA 4ANDA 4NLXA 3EM1A 5D0GA 2EEYA 1IWGA 1MMNA 1SJRA 1YGYA 4FS1A 3H5YA 4DQSA 2NZ4A 2GO9A 4OMFG 2E44A 4O23A 2BANA 4I2QA 2CQIA 1HNZJ 1PO6A 3F73A 2MKKA 1XWLA 1WDTA 4DV7F 4QIWD 3EVWA 4ZP7A 2XYHB 4DV2F 3H2LA 1WC0A 3KK1B 1S79A 4K5SA 2HHTA 5RUBA 1RJJA 4WP9A 1RDRA 4AT1B 3P45B 3CMQA 4RO0A 1FE4A 3CD0A 5BXIA 3EDRB 2BYCA 2FJEB 2DR5A 3JB9k 3DOLB 1U48A 2HHHF 3PFOA 2Y1IA 4X64J 3OR2B 1VC5A 4UUXA 1HWLA 4GVBB 5KOWA 4ZPAA 1J5EJ 5F8IA 2VHGA 3DMJB 2ADCA 7FDRA 1G2EA 2K06A 3NXZA 2NUUG 3T6JA 4X4UA 4U7UK 4C11B 1YI2S 4ZOSA 3EPIA 3JAMU 4OZ3A 4WU2A 3IC1A 4EO8A 3QJPA 4R8UA 3EUNA 3S6EA 1HNIA 1MU2B 2QN6B 5CXTA 4DL2A 2KM8C 3R2DJ 3K89A 1LWCB 2OEJA 1JLGB 2WVCA 2CZ4A 2OD6A 2HS3A 3CJ2A 3DOMA 3BGOP 3ET6B 3M8WA 1M5KC 5JJBA 4MYTA 3CE8A 3TX8A 1SH3A 3HHLC 3MMBB 2C42A 5KFFA 3RTVA 5F8JA 5DGBA 2DNZA 1RHKB 3ZZYA 4UQGA 2DO0A 5B0AA 5ADZA 1NH8A 2BBEA 4LUBA 1W25A 5DM6Q 2OFGX 1G4CA 5ETRA 3KDNA 1FD8A 2YNHA 4B3SJ 1YKWA 2RQMA 4PZVA 1Y11A 5B7WA 4O3RA 2GQ2A 1K1QA 3BR8A 2ZHAA 3BQ1A 4ZVFA 2QL5B 2JXIA 5HJYA 4DV1J 2L3MA 2RQKA 2XBPA 4ANEA 3UDLA 2G0CA 3L3CA 1HNZF 3JYTA 3RJMB 3WC2A 1RWXB 2DH7A 3QFWA 2PI4A 1H7WA 3TQEA 1NHVA 3TVZA 3A3OB 5KFVA 3T1AA 4N77A 2QLBB 2XLIA 3R7BB 3T19A 2IA0A 1FRLA 3MUTP 3DU5A 3LPYA 2VB6A 1T3OA 1S77D 1CJKB 1JQGA 4PWWA 3WX4A 2ZJPQ 3QRQA 1IKXB 1PARA 2A0FB 5LMUJ 4ECSA 4O4GA 2UVRA 2HYIB 4CNYA 2E7VA 1YJNS 2AJ0A
chains in the Genus database with same CATH topology
1MYLA 1B28A 2CAXA 1BDTA 1IRQA 2RBFA 2NZCA 2Y3YA 2WVFA 3BKTA 2KELA 3BKUA 2CADA 3VEAA 3QSIA 2BNWA 2BJ3A 2GPEA 3FT7A 2BSQE 3QOQA 2WVDA 3OD2A 2K6LA 2JXIA 1QTGA 1ARRA 1MNTA 3BKFA 2BJ8A 1X93A 2PC6A 1Q5YA 3H87C 2BJ7A 1ARQA 2WVEA 2H1OE 4FXEA 4ME7E 2BJ9A 2CAJA 2AY0A 1U9PA 2BJ1A 4HV0A 2K5JA 2HZVA 3VW4A 2WVCA 2CA9A 2F1FA 2BNZA 2FGCA 2JXHA 4D8JA 2BA3A 1BAZA 3FMTA 1EA4A 2K9IA 3GXQA 2K29A 2K1OA 3LGHA 2HZAA 1NLAA 2WVBA 2CPGA 1P94A 1PARA 3PHTA 1MYKA 2JXGA 1Q5VA 1B01A 1BDVA 3VEBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MYL A;  1B28 A;  2CAX A;  1BDT A;  1IRQ A;  2RBF A;  2NZC A;  2Y3Y A;  2WVF A;  3BKT A;  2KEL A;  3BKU A;  2CAD A;  3VEA A;  3QSI A;  2BNW A;  2BJ3 A;  2GPE A;  3FT7 A;  2BSQ E;  3QOQ A;  2WVD A;  3OD2 A;  2K6L A;  2JXI A;  1QTG A;  1ARR A;  1MNT A;  3BKF A;  2BJ8 A;  1X93 A;  2PC6 A;  1Q5Y A;  3H87 C;  2BJ7 A;  1ARQ A;  2WVE A;  2H1O E;  4FXE A;  4ME7 E;  2BJ9 A;  2CAJ A;  2AY0 A;  1U9P A;  2BJ1 A;  4HV0 A;  2K5J A;  2HZV A;  3VW4 A;  2WVC A;  2CA9 A;  2F1F A;  2BNZ A;  2FGC A;  2JXH A;  4D8J A;  2BA3 A;  1BAZ A;  3FMT A;  1EA4 A;  2K9I A;  3GXQ A;  2K29 A;  2K1O A;  3LGH A;  2HZA A;  1NLA A;  2WVB A;  2CPG A;  1P94 A;  1PAR A;  3PHT A;  1MYK A;  2JXG A;  1Q5V A;  1B01 A;  1BDV A;  3VEB A; 
#chains in the Genus database with same CATH topology
 4X64 F;  5CYM B;  2OUG A;  2WZ1 A;  3QJL A;  4WFA Q;  1NDP A;  2CAX A;  1Z2Z A;  4PEO A;  4KE5 A;  3TEH B;  1J5E F;  2MGZ A;  1TMM A;  5LJ5 Y;  4Q0B B;  3R8Y A;  3D66 A;  3M6U A;  2HWI A;  4FF1 A;  1M0S A;  3MM5 A;  4DCO B;  2V2K A;  1U2R A;  1H2V Z;  5HMZ A;  2LVW A;  1HBU B;  4Y3C A;  2XYG B;  3RB0 A;  2HND A;  3EGV A;  3QNW B;  1RB0 A;  1RP5 A;  3IBW A;  1BUX A;  2KFY A;  4EUV A;  2X3D A;  2DPI A;  1TVR A;  4OZN A;  3X1L B;  1TFW A;  3B82 A;  3NCQ A;  5KFO A;  4N76 A;  1WJ9 A;  3MWB A;  3W61 A;  2FD2 A;  2NYH A;  1HWK A;  1XNR J;  4RUC A;  2JVR A;  5ETQ A;  2Y1L B;  2GW8 A;  3T1H J;  4ZN3 A;  3TP2 A;  3KUG A;  3JQJ A;  3MMA B;  4J9O A;  4G3I A;  4JI0 F;  4YDX A;  5A2Q Y;  1VRU B;  1RT5 B;  2HWH A;  1FO1 A;  1A7G E;  1FRM A;  1UVL A;  3ONQ A;  3LP2 B;  4K4V A;  5D78 A;  4ICL A;  3OJS A;  3S8S A;  1J27 A;  3A8J A;  2VG6 A;  5AE1 A;  1NM2 A;  1ZYQ A;  4B3S F;  3QRP A;  1D8Y A;  2QA4 G;  1UKU A;  4CLU A;  1FXL A;  4X66 J;  3MMC A;  4PUO A;  2F7V A;  4JV5 J;  3K5M A;  4PQA A;  5IXU A;  1U02 A;  2R42 A;  5MLC V;  5EWE A;  1TL7 A;  4KGK A;  2LU2 A;  4DV1 F;  2MKH A;  2YNG A;  5KG4 A;  5AT1 B;  2B9W A;  2MQL A;  4LQ3 A;  3FBC A;  3EGZ A;  5F41 A;  3QAE A;  3HKZ D;  2V2Z A;  1UWA A;  1WC1 A;  1S9G A;  1WHY A;  1S76 D;  2VC0 A;  4ME7 E;  3IXQ A;  1UW9 A;  2DXF A;  4DUT A;  2ZDO A;  4KRW A;  2Y8Y A;  4X4O A;  3B78 A;  1B99 A;  4IO1 A;  1KRP A;  2EVZ A;  2O67 A;  2MLZ A;  4DPT A;  1RAA B;  3ISN D;  1YIJ S;  3W60 A;  1U0S A;  2Q6B A;  2HW3 A;  1RE1 B;  2OTL S;  2DT9 A;  5LMU F;  4BC7 A;  1Y0H A;  2GS8 A;  5C2G A;  2DYA A;  3HKW A;  1VLY A;  1QUP A;  1TL3 B;  2AW0 A;  2CQC A;  2DEI A;  4ZP9 A;  3WX8 A;  1XMQ J;  1M5V C;  1EIY B;  3D1Q A;  2ZZN A;  3OUY A;  2J0W A;  3LWM A;  1HNV A;  4I6A A;  2LDY A;  2CJY B;  2VJV A;  1LFW A;  5F8M A;  4OLP A;  1U2C A;  3EDQ B;  1V5I B;  3L95 X;  4F4Y A;  3UR3 C;  5HLF A;  1VQ6 S;  2H48 B;  4TXS A;  2HVE A;  3H20 A;  3DLL Q;  2Z56 B;  3E2E A;  2VQE J;  2E5I A;  2HHW A;  2Z2L A;  4O44 B;  5DDQ C;  4CTA B;  2CA9 A;  4F3O A;  4CIO A;  2B8Q A;  3ENA A;  3MXH P;  2PMH A;  2M0G B;  1NO8 A;  3A3N B;  3Q8Q B;  1XNR F;  1T03 B;  1UJ6 A;  3I9V 9;  2AJ2 A;  2Z2Y B;  3T1H F;  4F3Q A;  3K5N A;  4NPO A;  4ZP6 A;  1HIY A;  1B01 A;  1TUW A;  1VDH A;  2HVH A;  5LT5 A;  2FYX A;  3W7B A;  4U67 Q;  2FJB B;  1S97 A;  5HVG A;  4DSJ A;  1GK8 A;  2VJU A;  3QGH A;  2OEL A;  1RWV B;  4YB5 A;  4RWX A;  2E5J A;  3ZZ0 A;  3IR6 B;  3H40 A;  2J76 E;  1CEZ A;  1JJC B;  5GAD I;  2ACY A;  3G87 A;  1FCA A;  4I6W A;  4X66 F;  1XQI A;  3OL6 A;  1HQE B;  4JV1 A;  5DG8 A;  2W4C A;  1YTY A;  2M3D A;  1HBM A;  2BAC A;  3CDU A;  4XDC A;  2DNO A;  1Q5Y A;  3E01 B;  2DIS A;  5KFS A;  5DQG A;  1IKV B;  1DHM A;  2YVS A;  2DXD A;  1WEL A;  2QLJ B;  3LOU A;  1SQE A;  3BJY A;  1P8G A;  2V0N A;  4UZC A;  4PQU B;  4ECV A;  1UWB B;  5KFG A;  2IVY A;  3ZTO A;  4ZIV A;  1RUS A;  4IG0 A;  1FK9 A;  4F36 A;  3UN3 A;  1RT7 B;  3DHX A;  5KFZ A;  1BXN A;  2YWF A;  1CG2 A;  4YHH J;  4RR5 A;  5GAE I;  5EWF A;  3D0G E;  1XMO J;  1RAE B;  3D1H A;  5D77 A;  4OZ2 A;  4RBV A;  3CSK A;  3TRG A;  3QZ8 A;  3HSG A;  1XMQ F;  3R3T A;  2L9D A;  2E1P A;  5D4P A;  3PM9 A;  1F9F A;  4JBC A;  4DUZ J;  3R5D A;  1O8B A;  3F0N A;  3KJV B;  3H2V E;  2B3T B;  4ECX A;  5DM7 Q;  2MSS A;  1REG X;  4TKT A;  2APO A;  4QQB A;  2IJR A;  4A4J A;  1TKZ B;  4RLE A;  3GPA A;  1B0T A;  1R31 A;  1AZS A;  4X2B A;  2QC3 A;  2Q2K A;  2D3O 1;  1XR5 A;  3PTW A;  5J2M B;  3NBP A;  4O4R A;  4TYB A;  4HYK A;  3H5U A;  3HVA A;  1FKO B;  4ZLJ A;  1LWF B;  1ZA2 B;  2VQE F;  2J6S A;  4WJB A;  4LF5 J;  2D3U A;  1OYD A;  2K1R B;  4NL5 A;  2R2T A;  3GCX P;  1WG5 A;  4RW6 A;  3NOG A;  3MFI A;  1FER A;  2DY9 A;  1KOO A;  3C19 A;  2A18 A;  4A8S A;  3M8R A;  5F8H A;  2Z30 B;  2F4F A;  1SC6 A;  1QSY A;  2LQ8 A;  5J1E A;  1OYE A;  4JI6 F;  5L1K A;  1U0H B;  1OJ4 A;  5T41 A;  1PJ7 A;  2QSF A;  2AX1 A;  2B5J B;  4J9K A;  1GMV A;  3V4M A;  3ILO A;  3BPS P;  3DRP A;  3NGU A;  1HMV A;  3DHW C;  3N5F A;  3NAI A;  4NZ7 A;  4TQR A;  3FJ2 A;  3X3U A;  4KY3 A;  4ZPW R;  4OJG A;  2CG8 A;  3J81 U;  2RKI B;  3TVY A;  2HAF A;  2ZWP A;  3HHN B;  2XSJ B;  5I4M A;  4B9T A;  2DNR A;  3OR2 A;  3BO3 A;  4KHM A;  1T7P A;  1RT2 B;  2NLW A;  2QFI A;  3HVR A;  1SXL A;  3KLI B;  4I1T A;  2RHS B;  4Q43 A;  2N3O A;  1IBL J;  5L1L A;  1WKJ A;  2WVE A;  2BM0 A;  4L75 A;  3BPD A;  2CAJ A;  2BE2 A;  2C1E B;  3KLG B;  3GE9 A;  2E66 A;  1RCX B;  2J7W A;  4DN0 A;  5D3G B;  1IBC B;  2P6T A;  3ZZO A;  3MM7 B;  3W5Z A;  3MGJ A;  3KLH B;  2JWN A;  2R7U A;  1RAI B;  2ATC B;  2ZKT A;  3DU6 A;  5K8P A;  3GIL A;  1MU2 A;  2PFD A;  2PFF B;  4RJV A;  1Y00 A;  1BMQ B;  4MIA A;  1MYL A;  1ZPW X;  4P71 A;  2IAJ B;  4YHH F;  5A8W A;  5FJ4 A;  2VKZ G;  1XMO F;  3UPF A;  5A8R B;  4M1K A;  3N9U C;  4DL7 A;  3QID A;  5HAT A;  1NUE A;  1XBW A;  4CO2 A;  2C28 A;  4Q7A A;  2JFK A;  5EN1 A;  3DI6 B;  4YME A;  3HFV A;  3FCH A;  1HR0 J;  2ZH2 A;  3Q8S B;  3W9I A;  1QTG A;  3D6H B;  5KG3 A;  3WBZ A;  1RWM B;  5CYQ A;  2ZDP A;  2V69 A;  3TA1 A;  1YK9 A;  2B4V A;  2PO4 A;  1S1V A;  2HQF A;  1RT6 B;  3VGT A;  2VA3 A;  3I4H X;  2BV3 A;  3OQ2 A;  1Q79 A;  1IN0 A;  1JLB A;  2GML A;  2XNR A;  2LYV A;  3QQC D;  4XAK A;  4RW4 B;  4TY9 A;  2RVJ A;  2I2Y A;  2MXY A;  1H6K X;  1ZM4 A;  3CCR S;  4MFB B;  4LF5 F;  3K7R A;  5FLX U;  4LBP A;  2XSF A;  2AIR B;  3SV3 A;  2GGP B;  1U1M A;  4PXD A;  3Q83 A;  5AJ3 J;  1KQS R;  3TUZ C;  1FKP B;  2RRN A;  3A8E A;  3TAP A;  4DV6 J;  1DTQ B;  1RTJ A;  2X3G A;  5LSL A;  3SV4 A;  2DXE A;  1WC5 A;  1Q78 A;  2IJN A;  3DLG A;  3KMQ A;  4IG3 A;  5J2Q A;  2D1C A;  2EK6 A;  4CYU B;  4K5R A;  1BY9 A;  4QR2 A;  3HSZ A;  1HWI A;  4UOG A;  2YQ0 A;  3HMJ G;  3CO0 P;  4QBU A;  2HBQ B;  2LA4 A;  3OFE A;  3D3B J;  3CDB A;  4K4Z A;  1IJF B;  3ZNJ 1;  5H9F J;  4DSF A;  1ARO P;  1HKA A;  1HAR A;  1TQL A;  4ED8 A;  1IKW A;  1IBL F;  1RXO B;  2FVC A;  4D3H A;  2A6M A;  1S0V A;  2E7W A;  3CB4 A;  5I3Q A;  3DDI A;  2N4C A;  2V6A A;  4K2J A;  2YKM A;  3M30 B;  1O51 A;  1RI7 A;  1B7Y B;  3OL9 A;  3OR1 A;  1KD1 T;  4NCG A;  1IQT A;  1N5Y A;  1WC4 A;  3CCT A;  2IM2 A;  1JLA B;  5SZT A;  1RTH B;  2CQ2 A;  4HT7 A;  1WSR A;  4I7F A;  1CBK A;  2DPJ A;  5E3Q A;  1HR0 F;  4K4W A;  1XR7 A;  3L9Z A;  1D09 B;  2W9A A;  4ELU A;  3P49 B;  3GFH A;  2RH3 A;  5GAG I;  3NO7 A;  4RUB A;  4FXE A;  1VRT A;  1X4A A;  3W2V A;  1RWP B;  2XI2 A;  1DLO A;  2IRY A;  4BWM A;  2Q79 A;  2RDD A;  1Q8K A;  3HVT B;  3MAA A;  4EGL A;  5LOQ A;  1FNM A;  1IUJ A;  2R3V A;  4R25 A;  3BSA A;  4RNF A;  1S6O A;  2HLU A;  2C3O A;  4EK2 A;  2J5A A;  2MTL A;  2WOM A;  1FES A;  5KFK A;  4RW7 B;  4KGM A;  3LP1 A;  4YB6 A;  2Y8W A;  2IRX A;  2F9D A;  4I4B A;  3OJU A;  3HK2 A;  1S7I A;  4K4U A;  1U2F A;  1NU4 A;  3E8O A;  4DV6 F;  2VC1 A;  3MDF A;  3HT3 A;  3M2V B;  4DL6 A;  3VR1 A;  4DOZ A;  1Y3J A;  3POT B;  3P5B P;  1IQZ A;  4NRU A;  1U1R A;  3KHH A;  4DX7 A;  3VAG A;  3DRS B;  2KXF A;  1HHT P;  2BW2 A;  3JSM B;  3UQS A;  4DV3 J;  2DEJ A;  4WFN Q;  4PYD A;  2D9O A;  2LEP A;  3D1O A;  1TL3 A;  3U1M A;  1SJ1 A;  3DLE B;  2J7K A;  2ERR A;  2BUN A;  5HVH A;  1L3U A;  2ZVI A;  3PV8 A;  1BQM B;  3I82 A;  1TR0 A;  5F3Z A;  1ZTT A;  1OPZ A;  1W7W A;  2B56 A;  3R7S B;  1PC5 A;  2GIF A;  3D6T B;  2LLZ A;  5L9N A;  3OL8 A;  2XZT B;  1NJY A;  2CJK A;  1Q5V A;  2DGS A;  1RT3 A;  3OTB A;  4C9D A;  2XMU A;  2CPF A;  3Q8Y A;  4UY8 5;  4NLR A;  4ZVE A;  3H4B A;  4CTA A;  1IR2 A;  5C24 A;  2FJA B;  4DPO A;  2KHD A;  2YH0 A;  3H90 A;  4ETZ A;  1SJ3 P;  2DO4 A;  3PCO B;  2GPE A;  1T03 A;  2M7S A;  3GLJ A;  2VFS A;  2C2D A;  1X5O A;  4LSL B;  2FZG B;  3W8P A;  2V4Q A;  1G7C B;  2B4O A;  3GIK A;  2DGT A;  4ZJO A;  1F2G A;  5E41 A;  1R0A A;  2XS2 A;  3PXG a;  4L73 A;  1S6Q B;  3CJ3 A;  2CPD A;  3M2R A;  1N8R T;  4LF7 J;  1IWA A;  5E5N A;  1WC3 A;  2QLX A;  1TL4 A;  4Q8E A;  5G0R A;  3MR6 A;  3BDP A;  2ZBR A;  1UZH A;  1VJW A;  2OLW A;  3WC0 A;  2RIJ A;  5E7O B;  1MW7 A;  3P6Y C;  4CT9 A;  3KXD A;  3MEE B;  1NK9 A;  4CLZ A;  2K2P A;  3K58 A;  1U1L A;  3AJ2 A;  3CCM S;  3M2U A;  2HNY B;  1GEH A;  4LJM A;  5EHH A;  2RT3 A;  4M5I A;  1NK6 A;  2VU5 A;  1LW2 B;  4USM A;  2E9T A;  2EBG A;  1HL6 A;  3ZZP A;  1JLF A;  1LK5 A;  4G65 A;  5B0C A;  4HEA 9;  3IWL A;  1X4F A;  1TK5 A;  3KKF A;  3TO8 A;  3NCP A;  1TKX A;  1VMB A;  4BLG A;  3RR7 A;  2NS1 B;  4L3N A;  1UWB A;  4LVN P;  2MHE A;  4NLV A;  2IHR 1;  2UUW A;  3BGR B;  3KK3 A;  4DV4 F;  2W7A A;  3CCE S;  3KG1 A;  1M5S A;  3W63 A;  4FN5 A;  1KFS A;  4DV3 F;  3MPW A;  5FDL A;  2RQ4 A;  1WEY A;  2M88 A;  3GU0 A;  1R27 B;  2BOA A;  2FHK A;  1IBM J;  3K5O A;  4IRC A;  4AD6 A;  1UA1 A;  1NZA A;  2HQ3 A;  2IA6 A;  4GO7 X;  2HBY B;  2KM8 B;  4GKK J;  1J5O A;  2EFV A;  1BAZ A;  3TYT A;  2XHW A;  3DLK A;  4CLY A;  1KHV A;  2B7B B;  2IFX A;  1TFY A;  4OYB A;  1FDB A;  2H54 B;  4H4O B;  3NMR A;  2FC8 A;  2P8I A;  3KUH A;  2F4V J;  1Y5N B;  1S49 A;  2KJW A;  1MRO B;  4R5P A;  2BZ2 A;  3O6Q A;  5G4D A;  1OSD A;  4F50 A;  4P2X A;  3CJK B;  1K1S A;  4B9U A;  3HHL B;  1NJX A;  1FRK A;  4PYA A;  4TU9 A;  2YNI B;  3DLJ A;  4O3N A;  2ZOM A;  4F3M A;  1V5V A;  1CJT B;  3AD9 C;  2UU9 J;  3OD2 A;  4JI4 J;  1S7H A;  1C0U B;  2VG7 A;  4B9V A;  3BKF A;  2KRR A;  4HHJ A;  4LQ9 A;  1I5O B;  3L7P A;  2F8E X;  1Y10 A;  1EX8 A;  4ECU A;  4K0K J;  5K8N A;  1LW0 B;  4RW8 A;  1S1X A;  4OZ1 A;  3TJ8 A;  4LF7 F;  2COL A;  2MB0 B;  4WZQ A;  2GJ2 A;  1HA1 A;  4IFV B;  1TV6 B;  2XMT A;  2ILY A;  1VOM A;  4QIE A;  3L09 A;  5HN0 A;  4K59 A;  4DR7 J;  2OPR B;  3QO9 A;  1N56 A;  4AXJ A;  5KFM A;  3G6E S;  5A6W A;  2EFP A;  2JNJ A;  3KLI A;  1WDD A;  2GHW A;  3FCV A;  4YOE A;  3F41 A;  3MOZ A;  2BA9 A;  4WIQ A;  3AAW B;  3D28 A;  3M8Q A;  2HGN A;  2QA4 S;  1XIQ A;  3QMQ A;  4X4V A;  5T7L A;  2HIQ A;  1DUR A;  3W9H A;  2EG2 A;  4JOU A;  5IQ6 A;  2ZIT A;  4ZP8 A;  2HLT A;  1U49 A;  4WXW A;  2J9D A;  1NDL A;  1M1G A;  2E7X A;  4QU6 A;  2GCF A;  4F0H A;  3DC2 A;  3CIZ A;  2W4D A;  2L9N A;  2V8H A;  3KMS A;  4LRF A;  2BVZ A;  3IRX B;  1EQ0 A;  5DDR C;  1S1U A;  3GG0 A;  1RWU A;  3SBM A;  4RUH A;  2BJ1 A;  2CQ1 A;  1ZS6 A;  1IBM F;  4IKA A;  1DQ8 A;  3OVA A;  2W2M P;  2LXU A;  4W4M A;  3V2U C;  4GKK F;  1T05 A;  4IH7 A;  1S1W B;  2W2Q P;  4HI1 A;  4U6P A;  2LU1 A;  1YZ7 A;  3R97 A;  3MEK A;  4GMK A;  1HHS A;  4OZ5 A;  3I87 A;  5EX3 A;  3V6J A;  5IT4 A;  1P27 B;  1GXT A;  2F4V F;  1NK7 A;  1DTT A;  4CO1 A;  4WF9 Q;  3BQ0 A;  4NXN F;  1FJE B;  2LDI A;  3C46 A;  3KNA A;  2W9B B;  3LQV A;  7AT1 B;  4DHV A;  2AEJ A;  5E0O A;  5HL7 Q;  2QIF A;  4DZD A;  1KP6 A;  3FSY A;  4ILL A;  3Q2T C;  3AA8 A;  2UU9 F;  1RA6 A;  1JLQ A;  4JI4 F;  1U47 A;  2NRE A;  4JI3 J;  1UJ5 A;  2JDJ A;  3OXG A;  4GC7 A;  4HR2 A;  4PR6 A;  1FD2 A;  1RIS A;  1SV5 A;  2RF2 A;  2YWH A;  4K0K F;  4LR9 A;  3TJ9 A;  3PW4 A;  3MUR P;  1GFW B;  3CED A;  3PX0 A;  2CIM A;  1VCT A;  1ZM2 A;  1I1G A;  2FHM A;  4H54 A;  2R8I A;  2VDH A;  3W5Y A;  2FVP A;  3EVM A;  2F65 A;  3DRY A;  4DR7 F;  1WOP A;  3BGU A;  3N0V A;  5F0U A;  2JXG A;  4FPR A;  1HD0 A;  2DIT A;  5J2N A;  2XCP A;  1RZM A;  2WTF A;  1CC8 A;  3MPD A;  1UP1 A;  2UUB J;  2M8H A;  1EHW A;  1RLC L;  3EWG A;  3OTC A;  4DR3 J;  4DWI A;  2XLK A;  3QRR A;  3SSQ A;  1BQN A;  8AT1 B;  1Y5I B;  4HKQ A;  5IZH A;  3G4S S;  5DDO C;  1GTE A;  1S1T A;  2UVW A;  2E9R X;  2H4Y B;  4DX8 H;  3CJR A;  3VQT A;  2PC6 A;  1FKA F;  2HQI A;  4JI2 J;  4WK3 A;  3CDA A;  1YDL A;  2XGP A;  3GB0 A;  2DGQ A;  3KHR A;  1JLA A;  3MM9 A;  1QSL A;  4CI0 B;  2F1F A;  2K8G A;  4EU0 A;  2W01 A;  1SKS A;  2AEM A;  3LGH A;  3C6U B;  1KLM B;  4RU9 A;  2IYG A;  2CPG A;  3UNY A;  2JSX A;  2AQ4 A;  2AGP A;  5SUH A;  1N33 J;  1K47 A;  5A2Q U;  1RU2 A;  4DF8 A;  1BDV A;  4MAK A;  2YBV A;  4KFB B;  2VPY B;  4LRE A;  3KJF B;  4MMO A;  4U95 A;  3HXM A;  2KHC A;  3Q22 A;  2MQM A;  2DTJ A;  2V68 A;  3NMA A;  1WG4 A;  5H9E J;  5KT4 A;  3IN5 A;  2M70 A;  1SIW A;  1IR0 A;  2ZFH A;  3CDE A;  3PIP Q;  2OH2 A;  2WB4 A;  2WHO A;  1JX4 A;  9ATC B;  3ICL A;  1T11 A;  4JI3 F;  3B6B A;  3DRR A;  4FNI A;  1T95 A;  2OSQ A;  2DB1 A;  4O3P A;  1OS5 A;  3OV7 A;  2RUG A;  2RIL A;  2G1D A;  4EZ9 A;  2ASD A;  4K50 A;  4ECQ A;  1M5H A;  1Q53 A;  1PC4 A;  4N8N A;  3PY8 A;  3C16 B;  4DPU A;  5A8K A;  1SH0 A;  1EAR A;  3J7Y I;  5ETL A;  4BDP A;  2XM3 A;  3AOD A;  3AFG A;  1TKT A;  1R8H A;  2QLF B;  2B9Y A;  4UTG A;  2PE8 A;  4EFA C;  3K5L A;  5HBM B;  5J2P A;  1MML A;  3J81 Y;  3H0P A;  3BGL A;  4CO0 A;  1LQ9 A;  3LP0 A;  2JBV A;  1K8A T;  2UUB F;  4JI1 J;  1VQN S;  4D3G A;  2J0X A;  2CVI A;  3GJT B;  4DR3 F;  4F4W A;  5IT9 U;  3SIP B;  4O3S A;  2VG5 B;  3FFI A;  1KQF B;  3ZO7 A;  4N41 A;  3IAS 9;  3G8Q A;  3F44 A;  1LXJ A;  2V9W A;  2PA8 D;  1WEZ A;  2GVD B;  2AX0 A;  2G9O A;  5I3U A;  2V2Q A;  4W90 B;  2EC0 A;  2VD3 A;  3GCW P;  2IC3 B;  1RHM B;  3SDE A;  3C3L A;  4JI2 F;  3QFH A;  2IYI A;  4HV0 A;  4QCL A;  4A8Q A;  4U8V A;  1HYS A;  3GXQ A;  1XJW B;  3DYA B;  3V81 A;  4TU8 A;  1AUS L;  1H98 A;  1RHR B;  3UR0 A;  4NLP A;  2UUA J;  4WTY A;  2ZBI A;  2HBR B;  2H51 B;  2X7I A;  1N33 F;  3V6D B;  3LAM A;  1M5P C;  1X5T A;  4WFX A;  4AL6 A;  3GG1 A;  5IC4 B;  2R7W A;  1YVF A;  2NXJ A;  2CNL B;  2HHV A;  3FT7 A;  4YY3 J;  3VAL A;  2PT0 A;  1UVM A;  2IM0 A;  3MEG B;  4U7C A;  5D0E A;  1KQK A;  1WOO A;  4DXL A;  2FVS A;  4IOC Q;  4IFY B;  4UOH A;  1E6Y A;  2KG1 A;  2J0S D;  3ZFV A;  3DM2 B;  3S01 A;  4C8K A;  4ECW A;  2YKN A;  2Q3P A;  3CJT A;  5C42 A;  3FBF A;  3SQG A;  5LL6 d;  2HKE A;  3ADA C;  3GMG A;  2IDL A;  2V63 A;  1V9O A;  3AB2 B;  4KHR A;  4PWD B;  4ED0 A;  2POK A;  3CCU S;  4ZKA A;  4R0E A;  3UO0 A;  3BGR A;  1NLK L;  1RKJ A;  4P6Q A;  2HGM A;  1V3S A;  4ZHR B;  3PIO Q;  1YBA A;  2CUY A;  3TAQ A;  3KYL A;  5L1I A;  1G6B A;  2UUC F;  1LWE A;  1RBL A;  1N88 A;  3MFH A;  1RTZ A;  2B9E A;  2KTQ A;  1Z4U A;  3UFC X;  1HQU A;  3K0J A;  1NND A;  1CS4 B;  1J2V A;  4DL3 A;  4JI1 F;  3S7R A;  4DCP B;  1RT1 A;  3V5R A;  4DQR A;  1HW8 A;  3I56 S;  3NG8 A;  1C0T B;  4C4W A;  3U02 A;  3HHD A;  2V9K A;  3CCQ S;  3GIM A;  1H7X A;  1MRO A;  5HQL A;  1N5V A;  3FUY A;  4ID8 A;  2CKW A;  1TL5 A;  1UW4 A;  3H87 C;  3CJ5 A;  1VQ5 S;  1YJ7 A;  2G2Y A;  4JI5 J;  4OI4 A;  5LJ3 Y;  5GME A;  1R0B G;  1NXI A;  3MHY A;  4ZVU B;  4V19 X;  4Y00 A;  3OFG A;  2CYY A;  5CYJ A;  2XLJ A;  2FLN A;  3NGT A;  2YX1 A;  3RW7 A;  2CQD A;  3CUN A;  4USW A;  2K29 A;  3MM8 B;  2I5J A;  3FSX A;  4FNH A;  2WVB A;  2VBZ A;  4ZS6 A;  2R8J A;  4OX9 J;  3GR0 A;  4Z37 A;  2LXF A;  2UUA F;  2LP4 A;  3NWG A;  4Z2X A;  3UVJ B;  2YNF B;  1SUQ A;  4PWU A;  1T9T A;  3VV2 B;  1WTB A;  4X4P A;  3MPY A;  3M8P A;  2YY3 A;  4KH1 B;  1YRU A;  2ZBQ A;  2E1C A;  3BN4 A;  3ILI A;  2E5H A;  1XER A;  1O5J A;  4QIG A;  1FX2 A;  3U7J A;  2UV8 G;  3I0R B;  5F8G A;  5ETS A;  4YY3 F;  1S0N A;  2B51 A;  2R9L A;  1ARR A;  2WSC C;  2CDR B;  4FXD A;  3ZZZ A;  4F7V A;  3GV7 B;  2EWH A;  1VQY A;  5DS7 A;  3ISZ A;  4K7Q A;  1Q8B A;  4LF8 J;  4HAC B;  3QGP A;  4QWA A;  4A8F A;  3BM7 A;  4HH0 A;  4FZV A;  1JKH B;  1OG7 A;  4W98 A;  1WC6 A;  4C2M A;  2D74 B;  1Y7P A;  4DBQ A;  1XMB A;  2GQC A;  5E33 A;  4NI2 B;  3VHQ A;  2AEF A;  3AD7 C;  5F9N A;  3DGP A;  1YZ6 A;  1CJU B;  2DCU B;  2DCL A;  2KKH A;  3OVB A;  4OJ1 A;  4G1I A;  3ZNU A;  1Z1Z A;  4B3T J;  4DLE A;  1X7V A;  4I2P A;  4C0O C;  1HPZ B;  4C48 A;  5HP1 A;  3LJP A;  2ZC3 A;  3R1H A;  2ROP A;  3TUI C;  2DR7 A;  2FJV A;  2AF6 A;  1NJW A;  3GR1 A;  4B3O B;  2KXN B;  1S1W A;  1D1U A;  4Q5V A;  2Z2Z A;  2DHS A;  5D0R A;  2QTW A;  3GJQ B;  3RYL A;  5E2Q A;  3MUV P;  1YJT A;  1S59 A;  4K8R A;  1D9D A;  3VVT A;  2DNL A;  1VFJ A;  3BBF A;  2W9B A;  3OLA A;  1YJR A;  4JI5 F;  5KFT A;  3CJQ A;  1Q16 B;  1QE1 A;  3IR7 A;  2K7J A;  4G1Q A;  1RAH B;  2OPP B;  3UN5 A;  3V4I B;  2BM1 A;  2I9S A;  4PG7 A;  2XWY A;  2KZM A;  4MH8 A;  1AW0 A;  4OX9 F;  4L3K A;  3H4D A;  2DRA A;  2N82 B;  3UDE A;  1N34 J;  3GYN A;  3JSR A;  3RAQ A;  4IO9 Q;  2AZ1 A;  2Y1J A;  2HRU A;  4L6V 3;  3CMA S;  4DPX A;  4LVO P;  3QIP A;  5AXK A;  4TLQ A;  3IP0 A;  5ETP A;  2KT3 A;  1JLE A;  3B54 A;  4YEA A;  1FNX H;  3EIC A;  3W2W A;  5FII A;  1C4C A;  3CCV S;  1Q4R A;  3G82 A;  2C2E A;  1RWO B;  3I5C A;  3DXS X;  5BYQ A;  5LXY A;  1UEK A;  2BMB A;  2HUR A;  4OZ0 A;  1YBT A;  3JTP A;  5E3P A;  1WSV A;  4NAS A;  3B8H A;  1B0V A;  4LF8 F;  1KTV A;  2XQC A;  5I42 B;  4QYR A;  3Q8P B;  4YR2 A;  4B3M J;  2J6U A;  2HHX A;  4ZA1 A;  2KZZ A;  3SYZ A;  2FHO B;  3LUY A;  3RUB L;  1S6U A;  4TY8 B;  3LA0 A;  3NS6 A;  1VRQ C;  2CNK B;  5KG0 A;  4L74 A;  4ZPV R;  1QTM A;  4CLT A;  4M5J A;  3DRX A;  4YR0 A;  4B3T F;  3KLE A;  2ZE2 A;  4C3L A;  3M8S A;  1ZM3 A;  5A0Y A;  5GAH U;  1LNQ A;  4FDF A;  3CJS A;  3GSI A;  3TZX A;  1KLM A;  1SQG A;  4E2F B;  2WVD A;  1CUL B;  1S9E A;  4HDG A;  3NS5 A;  2B43 A;  2RDJ A;  4ANC A;  3HLU A;  1AA1 B;  1HBO B;  3H25 A;  4MIB A;  5IM0 B;  2AV5 A;  3FNN A;  4G1P A;  2VF3 A;  4J7C A;  4OHX A;  3R5G A;  2A1B A;  3ENV A;  1U8W A;  2FTR A;  1VS3 A;  2XUL A;  2CJQ A;  2DD8 S;  3RBD A;  2QGF B;  2K7K A;  5HRO B;  3K59 A;  1S12 A;  5KT3 A;  4WBF A;  3JTO A;  4DG1 B;  3QLH B;  5K20 B;  1S5Z A;  1RAJ A;  4A47 A;  2KKE A;  1HHQ A;  4C8M A;  4ZJQ A;  1BWE A;  4X4N A;  4EO6 A;  2C3Y A;  1N34 F;  4MT1 A;  5K14 A;  2NQP A;  1U1N A;  1WUU A;  4DS5 A;  4KV8 B;  1H3D A;  2P5V A;  4M5H A;  3MM6 B;  4WK1 A;  4OYM A;  2NXU A;  3CD5 A;  2VUG A;  4M5D B;  4WII A;  4EBE A;  3PX4 A;  2BW7 A;  3PG9 A;  2OJ3 A;  1AB8 A;  2V34 A;  4NMX A;  4ZN1 A;  3KLF A;  5KFC A;  1UAW A;  1I3O B;  3KK2 B;  4NWB A;  2R2S A;  3QAU A;  3IGN A;  2GHV C;  1REV A;  2ZH1 A;  3I0S B;  1KC8 T;  1NDK A;  2GQQ A;  1UFK A;  2XMJ A;  2W7P A;  4NA1 A;  2J9E A;  1DY3 A;  3LAL A;  2WB1 D;  3N6L A;  3FC9 A;  1IKY A;  3O8W A;  3IRW P;  4EBD A;  3GWC A;  3VGS A;  3IG1 B;  2FVR A;  4CM2 A;  4NZ0 A;  1TL1 A;  4F4X A;  1RSC A;  2JEI A;  5KG2 A;  1B0P A;  3PRV A;  5HVF A;  4B3M F;  4EMD A;  4M63 A;  5C25 B;  4P75 A;  4CLF A;  3R5C A;  3FMW A;  1JXL A;  5BR8 J;  3MI7 X;  3IWN C;  2X1G A;  4NEY A;  2HPU A;  1ZZN A;  4UF4 A;  2B8P A;  3WHI A;  4Y34 A;  1ZAX A;  1GXU A;  4J9N A;  4IUF A;  3SFU A;  4ED6 A;  1KHW A;  1KDN A;  3I31 A;  1RT4 A;  2GHP A;  2XMV A;  2LQ9 A;  3JXO A;  1HLW A;  5M2P A;  4GO5 X;  4A8Y A;  1RTD A;  3AA9 A;  1ARQ A;  3FEY B;  1CVJ A;  4ZLP A;  3EYZ A;  4ELV A;  4I0W A;  4WFY A;  2N7C A;  4OI6 A;  2MZT A;  4KO0 B;  3AJ1 A;  3IR5 B;  2VDI A;  4LT6 A;  3DKD A;  3SZ2 A;  2VOP A;  3N4W A;  3BB5 A;  4LR7 A;  2F3J A;  1N5S A;  2Q66 A;  2XC9 A;  1XEZ A;  4LF4 J;  2I38 A;  3BRE A;  1RHJ B;  1XR6 A;  2QLW A;  1BE4 A;  1DRZ A;  4CLS A;  1T9V A;  2CPH A;  3AH6 A;  2KFN A;  5JMN A;  3O1L A;  3GFX A;  2C2M B;  4N47 A;  1GX6 A;  1MLA A;  3ZC4 A;  3M9N B;  3M9M B;  1VQ8 S;  2KEL A;  2HIY A;  4OV6 A;  3AB4 B;  2MZQ A;  3CW2 C;  3CCS S;  1SKU B;  4NA3 A;  1SKR A;  4AAI A;  1NKE A;  3BH7 B;  3IS9 A;  2WBR A;  1PJ6 A;  4HDH A;  1OY8 A;  4EI2 A;  1S10 A;  3RBX A;  1RAC B;  1RCO B;  2FQQ B;  1VHI A;  5DGA A;  3T41 A;  3D67 A;  2A2D A;  4YB7 A;  1TP7 A;  3HJF A;  4AL5 A;  3N5B A;  1JJ4 A;  3UWT A;  4LF9 J;  3C15 A;  2BX6 A;  1S6P B;  1L3S A;  2BKO A;  4IR1 A;  2G13 A;  4OHW A;  3M32 A;  3LAN A;  4F02 A;  3HZG A;  1PSD A;  4ID5 B;  3TAR A;  2HMI A;  1FFG B;  2ZH3 A;  1FX4 A;  4AFF A;  1ZZF A;  4U9R A;  2VPZ B;  2ZH6 A;  2XEX A;  1X8D A;  3UI3 A;  2DGX A;  5T14 A;  3EZ5 A;  2LEB A;  2BAN B;  2PMW A;  5BR8 F;  2RBF A;  2HVZ A;  4KHP J;  2W9C A;  4I2Q B;  1SJF A;  4NLW A;  3VEA A;  5DLF A;  3J80 U;  2BJ3 A;  1GH8 A;  2ROE A;  1WF1 A;  2B7C B;  2RUS A;  2CQB A;  1XNQ J;  8RUC A;  4ELT A;  2IRU A;  2HRY A;  4P10 A;  4ES2 A;  3QGI A;  3FEZ A;  2EKN A;  2FDN A;  1HFE L;  1ZAV A;  3UVJ A;  4CWB A;  2QRR A;  2VV5 A;  3FBE A;  4F4K A;  4RBT A;  1NK8 A;  5ETV A;  5JUM A;  4A8O A;  1MSW D;  2KB2 A;  8ATC B;  3PR5 B;  3PRB A;  1UPP A;  3NY0 A;  1FTR A;  2V50 A;  2G2O A;  2R7R A;  2CQ3 A;  4HH1 A;  2QSW A;  3O3L A;  2AT1 B;  5KT6 A;  1D9A A;  4LF4 F;  4PCQ A;  4RL1 A;  3HHK A;  4UOF A;  1F3F A;  1JNZ B;  3MEC B;  4FVC A;  2RNE A;  5JXS A;  3C14 A;  2Z0G A;  4EYI B;  2KRB A;  2O01 C;  3BR9 A;  4URQ U;  1HD1 A;  1IRQ A;  2XO7 A;  1FFS B;  3W9J A;  2RSQ A;  1JKH A;  2ZM6 J;  1C1C A;  1F3V A;  3VWS A;  4URG A;  3RGI A;  4C6A A;  1PKU A;  3Q8R B;  4ES3 A;  4O0I A;  1VQL S;  2UV8 A;  1QAX A;  3JQK A;  1KWM A;  2J8S A;  1KS2 A;  2LKZ A;  1HNI B;  4RX6 A;  4USJ C;  2ZD1 A;  1DBD A;  3GJS B;  2ZZM A;  4DR5 J;  3U27 A;  2ZHO A;  3EXC X;  3IFE A;  1HBN A;  5DG7 A;  5D4L A;  3OT9 A;  4OFZ A;  1KQG B;  3CT9 A;  2VL1 A;  2RB7 A;  1TMJ A;  1AFI A;  2DR8 A;  1UEV A;  3DOM B;  1IR1 A;  2OPS A;  1JMT A;  4RNM A;  3IMQ J;  1D0E A;  4LF9 F;  4B9L A;  5L38 A;  2WON A;  3NLC A;  2W2N P;  3TNV A;  2YH1 A;  5ITH A;  4CQ1 A;  4CRJ A;  4WKY A;  4ZLN A;  4M95 A;  4KGZ B;  5IT9 Y;  1KNZ A;  1L3T A;  4GVL A;  3BH6 B;  2JOQ A;  2YNH B;  1CPZ A;  2XMA A;  4DLG A;  2CXE A;  3LPE A;  4RUA A;  2IY5 B;  3MED A;  4A8W A;  2V94 A;  4KHP F;  2MEW A;  2H5J B;  1EKS A;  4OL8 A;  3JYT B;  3W1Y C;  5C5J A;  2AYB A;  2QJ3 A;  1E6V B;  1XNQ F;  4ZIT A;  4I6Y A;  1DZ5 A;  2F40 A;  4P7T A;  2B0G A;  1HI8 A;  3ETO A;  5IC6 B;  4NLD A;  4KPY A;  1SB6 A;  2HFS A;  1X5P A;  4FYY B;  2BJ7 A;  2B6A A;  3M4X A;  4O3O A;  3C6T A;  3TVK A;  4MKB A;  4WE1 B;  1NHU A;  3Q23 A;  4YR3 A;  3OHA A;  1EP4 A;  4O4G B;  2DGO A;  3EVO A;  4PXE A;  4A8X A;  3FMT A;  2L41 A;  4J91 A;  5HK4 A;  5CZV A;  1LXN A;  1Q1K A;  3P3D A;  5CZX A;  4L76 A;  1UCN A;  2CPZ A;  5K5M A;  2ZOG A;  2OPQ A;  2M2B A;  2MGZ B;  1WI6 A;  2YPY A;  4ILR A;  1RYS A;  1PGZ A;  3MCO A;  4K4T A;  1YJU A;  3QBC A;  4IOB A;  4JV5 F;  1GX5 A;  1QY7 A;  1WHW A;  4UZB A;  3OXL A;  3MM5 B;  1WD6 A;  4OX7 A;  3HD2 A;  2ZM6 F;  1DJ0 A;  3WIV A;  4ZVT B;  2HND B;  1A9N B;  4FS2 A;  1VQ4 S;  3ITH A;  3DDN A;  4HL9 A;  3H8Y A;  2QFJ A;  2GX8 A;  9RUB A;  1VYA A;  1TVR B;  1SI9 A;  1IXK A;  3T5K A;  4DR5 F;  1VGY A;  4HTI A;  3RAX A;  5ETT A;  5DG9 A;  2CQP A;  3MD3 A;  2J6T A;  4KGV B;  1QSS A;  3PNI A;  1HI1 A;  1Y4Z B;  2VFU A;  2ZH7 A;  4DX5 A;  2KVQ E;  4Z7C A;  1YLX A;  3K8W A;  1N6Q A;  2BQR A;  3HHE A;  4DQI A;  2AZ3 A;  3PJW A;  5IWA J;  2R7O A;  1NME B;  4ICL B;  4A8K A;  4WXO A;  1YG0 A;  2VG6 B;  1NSP A;  2Z8Q A;  3HSD A;  2KH9 A;  2Z2M A;  4URS A;  5J1N A;  2L08 A;  4MIW A;  1CQN A;  1N36 J;  1DAR A;  1RTI A;  3MMC B;  3NRB A;  1TL7 B;  3RG6 A;  4Q2L A;  1T9U A;  1OSC A;  2YNG B;  2VIH A;  2CQG A;  4CLP A;  2ZH4 A;  4ETX A;  1AFJ A;  5D4O A;  1X0F A;  1U4B A;  2F8H A;  4KKO B;  1S9G B;  3MPV A;  3CIM A;  2SXL A;  3PEJ A;  2JZ5 A;  3O5T B;  3BBC A;  5KG6 A;  3MR7 A;  2MZ1 A;  1RQ0 A;  1RKI A;  3GP9 A;  2AJ4 A;  4ZCI A;  3CJ8 A;  2J0Q D;  2WW4 A;  3A12 A;  2HZV A;  1F5A A;  4PAA A;  4Q8F A;  1RA7 A;  3ELH A;  4ECY A;  1FF2 A;  1QUV A;  3KK1 A;  1WNE A;  2O3D A;  4FYW B;  1F5B A;  3PW7 A;  2R7Q A;  4A8M P;  5AE3 A;  4X65 J;  2FLP A;  1S4F A;  4FF3 A;  1R7I A;  2DR9 A;  2RAQ A;  3DOL A;  3OUY B;  4ED1 A;  2CPX A;  1HNV B;  3QSY B;  3IGV A;  2UXD J;  1XK8 A;  2MYF A;  2KO1 A;  5L8R C;  3CGI A;  4GVB A;  2OO4 A;  2FIU A;  3R5B A;  3PW0 A;  5B0G A;  3DMJ A;  2DKO B;  5KT7 A;  4FKY A;  4H4K A;  2ZZT A;  5CAB A;  2BQU A;  2VKR A;  4OZL A;  3Q8V A;  3G8S A;  5LSO A;  2NXE A;  4LMZ A;  4C11 A;  1RAB B;  2QO3 A;  1SKW A;  1K0T A;  4NRT A;  2ZVS A;  2YXL A;  2QG9 B;  2BJ9 A;  2XHC A;  2FC9 A;  1SL1 A;  3DLB A;  1TZ0 A;  4TLR A;  3R5A A;  1EB0 A;  1RAD B;  2ZJQ Q;  1XTZ A;  2XS5 A;  1FVS A;  2Z4P A;  2K1O A;  1LWC A;  4DFM A;  7FD1 A;  1JLG A;  3OTO J;  2EW9 A;  4PAB A;  2ALY B;  5A6P A;  3H42 A;  3ET6 A;  4DDF A;  5IWA F;  5H1S V;  4TVA B;  2C3U A;  4DUZ F;  4ZCK A;  4F2S A;  2GVZ B;  3MMB A;  2EPI A;  4WFZ A;  4KQZ A;  3NEK A;  3R2C J;  2JLF A;  4W92 B;  1S0O A;  1N36 F;  1RBO B;  1OIA A;  2JEG A;  2BAB A;  5U47 A;  3I96 A;  1OMS A;  2CJA A;  3RBE A;  4OYO A;  4DSI A;  5B0B A;  3KG0 A;  4LRC A;  3QT6 A;  1NPP A;  2MKI A;  3EGW B;  2EBE A;  3KWM A;  1RYR A;  3BS9 A;  1FJC A;  1TUG B;  1FK9 B;  2MST A;  2J8A A;  4OYP A;  2JXH A;  2C2R A;  4DZ6 A;  1AXQ A;  2ADB A;  4NXM J;  5DQI A;  5MAO A;  2M5Y A;  2R7T A;  2ZOF A;  2MQP A;  3BDE A;  2XY6 A;  2HQC A;  2VON A;  3BZQ A;  3KUE A;  4F8R A;  4Y2K A;  2NPF A;  3GII A;  4KTQ A;  1CJK A;  2Z58 B;  4IQX A;  2YX4 A;  4X65 F;  3PO5 A;  1VQ9 S;  2ILZ A;  4PG8 A;  1IKX A;  2MMY A;  3PZP A;  1NB2 A;  3KJQ B;  1FWP A;  2WVF A;  3D9B A;  3QJJ A;  3US5 A;  4OYW A;  5CYM A;  1R8P A;  5KFN A;  3ISN C;  1DQ9 A;  2CWX A;  2UXD F;  3SFG A;  1AZS B;  2HFN A;  1KKH A;  2FZK B;  2XTJ P;  3NBP B;  1H2U X;  2VFV A;  3PRD A;  4Q0B A;  1VK8 A;  5HAO A;  4HTJ A;  3GON A;  2P6S A;  2FGO A;  1GMW A;  3EJM A;  2HHU A;  2HFZ A;  5ETK A;  3T5H A;  1HBU A;  2H9Z A;  2FPH X;  4OV1 A;  2OIH A;  2A6O A;  1HI0 P;  5IFM A;  2G4B A;  4RW6 B;  4C3K A;  3NNH A;  3A1Y G;  1S9F A;  4BCA A;  2BXJ A;  1URR A;  5KAK A;  2HFV A;  2DNQ A;  2YKQ A;  4QOT A;  5J1E B;  4OLO A;  3RB6 A;  4GKJ J;  5AE2 A;  3OTO F;  5DDP C;  3DRP B;  5B0F A;  3Q24 A;  4C8N A;  1HMV B;  2GFF A;  3VEB A;  4UT4 A;  2LCW A;  1FRX A;  2HGL A;  3MMA A;  4Y2C A;  3QAT A;  1FRI A;  2E29 A;  3BKT A;  3CME S;  1VRU A;  4NE9 C;  3CO9 A;  1RT5 A;  3MAH A;  3LW5 C;  3V6K A;  4CLK A;  4QWD A;  1VC6 A;  3LP2 A;  2A10 A;  1Q86 T;  3G96 A;  4USV A;  3HZE A;  3RRK A;  3GFZ A;  4RU2 A;  4ES1 A;  2LQB A;  1N52 B;  2PSZ A;  3CDW A;  3MEC A;  2MY8 A;  2IM3 A;  5HQM A;  2BE2 B;  1JXE A;  2ASY A;  4OQJ A;  3D4J A;  5IS2 A;  3KLV A;  4ENO A;  2ADL A;  3W5X A;  4WWS A;  3AJD A;  2DRD A;  3BV8 A;  2AYE A;  2F5G A;  5C2C A;  5KG5 A;  5AJ3 F;  4DR1 J;  1X4G A;  3NL0 A;  4FVM A;  2XWX A;  2DHA A;  3G71 S;  3AD8 C;  1X4E A;  3E3X A;  4NXM F;  5ETO A;  5A8W B;  4P72 A;  1B7F A;  2DGU A;  3EX7 B;  1R8A A;  4KH0 B;  3CNQ P;  3VGU A;  1U24 A;  2GAH C;  2HFO A;  2QA1 A;  1W2B R;  4F0M A;  4OIX A;  2MQN A;  4JI0 J;  3UD5 A;  1R3N A;  5ETM A;  4DR2 J;  4NLY A;  1LWX A;  5CYQ B;  1EQM A;  4Y2A A;  3SI8 A;  1ZTW A;  3SCL E;  3QOQ A;  1S1V B;  4DS4 A;  4JI7 J;  3MCM A;  1YJ9 S;  3EXY A;  1JLB B;  4J90 A;  4EZ6 A;  1JB0 C;  2MKY A;  2DJW A;  5J1P A;  2H4W B;  3BN7 A;  3QT5 A;  4DSE A;  2AJQ A;  5DZ6 A;  2XI3 A;  1RAG B;  1CSJ A;  1PYO B;  5K8M A;  1E6V A;  4B02 A;  3G6V A;  2FLO A;  2K9I A;  1Y3K A;  1N0V C;  4OYX A;  4O44 A;  3U1N A;  1JLC B;  3TI0 A;  3R6L B;  1RTJ B;  1G1X A;  5B0D A;  1Z2L A;  3CXC R;  4J9S A;  4GKJ F;  1QM9 A;  3O2I A;  1T9X A;  2V4R A;  3JS9 A;  3T6B A;  4Q45 A;  3LO3 A;  2CRL A;  3DLG B;  1VQK S;  4WE1 A;  1P9Y A;  4USU A;  4JV2 A;  1R0C B;  4IG3 B;  5J2Q B;  1HNX J;  1FWK A;  2MDA A;  2XGQ A;  3MUM P;  2IBK A;  3QSI A;  2F8M A;  2JFD A;  4QWC A;  2P2C B;  5GMK a;  3PFE A;  4AL7 A;  1KVI A;  1RWN B;  3SEO A;  2HNZ B;  4NLQ A;  2P9C A;  1FJG J;  2QYC A;  4F0K A;  3PJ9 A;  4DUY J;  4RWW A;  1IKW B;  1SIZ A;  4LIR A;  2EFO A;  3J7A 1;  1WI8 A;  1P9Q C;  2CNN B;  1HQE A;  3J7Z 5;  5IOL A;  2HWT A;  3KTQ A;  1LKZ A;  3TWZ A;  3L7U A;  2G0J A;  2VZ9 A;  1X9S A;  1U7L A;  2FVQ A;  2JEJ A;  2YKO A;  2QV6 A;  3E01 A;  2H5I B;  5DRK A;  3R7N B;  4DU8 A;  4KB7 A;  1X4H A;  1F9E B;  2AU0 A;  2YKM B;  2KL8 A;  1IKV A;  2UP1 A;  4DR1 F;  4I64 A;  3ZZT A;  3OR1 B;  4LRD A;  4K4Y A;  2J7U A;  4NCG B;  1N5Y B;  1ZH5 A;  2AHO B;  4B08 A;  4PQU A;  4OYZ A;  3UW1 A;  5CHC B;  4XPC A;  3CC2 S;  1VBK A;  4CM0 A;  1RT7 A;  2DR6 A;  2BRK A;  4LR8 A;  2ZBP A;  3KOA A;  1DAX A;  4I7F B;  1ZET A;  1UL3 A;  3PX6 A;  2E5L J;  4B9S A;  2BSQ E;  3WQP A;  5JVH Q;  4DR2 F;  3G5O A;  1IVZ A;  1ZA1 B;  2HG4 A;  2V2V A;  2MJU A;  3GJR B;  4OX8 A;  3GZ7 A;  5KOX A;  1VRT B;  4JI7 F;  2BJ8 A;  4X4T A;  1NHK L;  3LAK A;  3OHB A;  3W2V B;  3KJV A;  2ZWO A;  1UFL A;  4DL5 A;  1NPR A;  1DLO B;  4OX6 A;  3CPW R;  2PEH A;  2W24 A;  1TKZ A;  3MAA B;  3FRY A;  1YBU A;  2FJX A;  3VCD A;  2ZNY A;  6FD1 A;  5F8N A;  5J2M A;  4KPC A;  5HI7 A;  1FKO A;  5KT5 A;  2MLX A;  1H73 A;  3BYR A;  1LWF A;  2WOM B;  1A0O B;  3PHE A;  4KKO A;  4USK A;  3LP1 B;  1P94 A;  3GQC A;  3J80 Y;  3BEG B;  2ZJR Q;  2V4J B;  1VIO A;  2K1R A;  4DSK A;  3FK4 A;  3W3S A;  2OHD A;  2CAD A;  2B4P A;  1HNX F;  3CCZ A;  1U0H A;  2J9C A;  4KGX B;  2B5J A;  3HJV A;  4LSZ B;  2V5H G;  3DXB A;  2HFU A;  4B9M A;  2CJB A;  3CF5 Q;  4KT0 C;  4ED7 A;  3I5A A;  1URN A;  3NOC A;  1S99 A;  1FJG F;  2RJZ A;  4DUY F;  5KFY A;  2RKI A;  2EI5 A;  2YWE A;  1JXV A;  3HDS A;  5EDW A;  2XSJ A;  1R6V A;  4ALZ A;  1FXR A;  4PG6 A;  4FPI A;  1CC7 A;  2JL9 A;  2BJE A;  2GA7 A;  3G2X A;  4K4S A;  4DPW A;  1RT2 A;  1PIL A;  2MHN A;  4C8Z A;  2YKA A;  1U8S A;  4EEY A;  3D5M A;  5KFU A;  5HMX A;  1DFD A;  1BGX T;  3KLG A;  4OJH A;  1RT3 B;  4ZMM A;  5D3G A;  3UDV A;  3DLH A;  2KDO A;  4CH7 A;  3PDN A;  2I1R A;  3MM7 A;  2XYP B;  2Q43 A;  5KT2 A;  4NYP A;  2YPZ A;  1NCL A;  3ILJ A;  4IDK B;  4FF2 A;  5C24 B;  3GV5 B;  3KLH A;  1RK8 A;  4LBI A;  3MCN A;  3N6M A;  2W1B A;  1P1L A;  1A6L A;  2MQQ A;  4PG5 A;  3B4D A;  1MN7 A;  3PAC A;  2IAJ A;  4JI6 J;  3AHP A;  4O0N A;  4MKY A;  5GMD A;  3I5B A;  2E5L F;  1R0A B;  1T8E A;  4WPA A;  2ASJ A;  5A8R A;  1VQM S;  4UY8 T;  4XDD A;  2UZA A;  2DNP A;  4TNO A;  3M2R B;  3NNA A;  4TYA A;  3T5J A;  1H2T Z;  1GTH A;  5CQG A;  3I55 S;  3DI6 A;  4CP5 A;  1KLN A;  3LH2 S;  5KFE A;  5G0R B;  2DIU A;  2GVZ A;  3RBZ A;  2MPU A;  5KFH A;  4R0J A;  2NSC A;  3FQK A;  2PDA A;  2RS8 A;  2FLL A;  2YWW A;  4CDI A;  3E51 A;  5C7P A;  3SSS A;  3M2U B;  3G6Y A;  1RT6 A;  1KON A;  4QJV A;  2Y1R I;  1TTH B;  2WSF C;  1X9M A;  1RU1 A;  1VQS A;  2DBB A;  5HSP A;  4RNH A;  2GJF A;  5B08 A;  4DFP A;  5THW A;  2QYG A;  4RW4 A;  5KG1 A;  4TQS A;  1JLF B;  2UXC J;  2D69 A;  4S0M A;  1XN9 A;  3MAQ A;  1W26 A;  1U25 A;  1S0M A;  3TZW A;  3Q8U A;  4MFB A;  4QPT A;  1TKX B;  2GGP A;  2BR0 A;  1M5O C;  3J7Z T;  1R43 A;  3NGS A;  1FKP A;  4WU3 A;  2AGQ A;  3KK3 B;  4UUW A;  1RHU B;  5KFQ A;  1X4D A;  1DTQ A;  4X62 J;  2W7O A;  2QE5 A;  2OP5 A;  3UNG C;  2UVU A;  1MMD A;  4MK8 A;  5ETN A;  5FDL B;  3CC4 S;  3MD1 A;  1SBR A;  3PW5 A;  1JIH A;  4OI3 A;  3MR3 A;  3OSP A;  2D9P A;  3IM9 A;  3W66 A;  2KJV A;  3D6M B;  3C8Y A;  3SMZ A;  4CYU A;  1F60 B;  1F5C A;  4XTT A;  3NGD A;  1KBR A;  1F0X A;  1F6T A;  3Q89 A;  3VAJ A;  5E3R A;  1J5O B;  2OGU A;  2JEF A;  2JRS A;  2QMW A;  4FBU A;  3DLK B;  1S4E A;  1FRH A;  1NKB A;  3Q86 A;  1X5S A;  3SCI E;  2VPX B;  2E1M C;  1QDU B;  2HK3 A;  3BBB A;  1AUD A;  2F9J A;  4R5P B;  1V6H A;  3NWR A;  5BYR A;  2DK2 A;  2ZEJ A;  4MKV A;  2Z57 B;  4XO0 A;  2V67 A;  5L9X A;  3UCU P;  2R8G A;  2VOD A;  3ENW A;  4ZIW A;  3M8Y A;  1Q8L A;  1YJV A;  3A3P B;  3M30 A;  3UD4 P;  1LEO A;  2OI2 A;  2QZ8 A;  2DH8 A;  3SCK E;  3MZI A;  2B9X A;  3MMJ A;  3DOK B;  3FZB A;  3HUL A;  3N28 A;  2VG7 B;  3JSB A;  2AD9 A;  4N5S A;  2FY1 A;  5L46 A;  1FDN A;  5IV4 A;  4F67 A;  2AKW B;  4ZPB A;  2RML A;  1BC6 A;  4OYI A;  4FYX B;  4RW8 B;  1RTH A;  1S1X B;  2PA3 A;  1IM4 A;  4KSE B;  2XY5 A;  4OJ3 A;  4MJK A;  3H5S A;  1HW9 A;  2AGO A;  2JHE A;  4AXI A;  3CCJ S;  4RW9 B;  3QO9 B;  3BYP A;  1NEE A;  1WWH A;  1ZBT A;  2OEK A;  2D3O R;  2HAI A;  5FD1 A;  3TA0 A;  3QT8 A;  1I6J A;  3G8T A;  2DHH A;  3HSJ A;  3WZ0 A;  1YX2 A;  4K4X A;  4F26 A;  4NOH A;  5CA5 A;  3HVT A;  2UXC F;  5HAN A;  3M8Q B;  3D3C J;  4B3R J;  3FRZ A;  4BBY A;  4X84 A;  4C97 A;  5T7L B;  1ZM9 A;  1BLU A;  2JC1 A;  4H4M B;  4RW7 A;  3RU0 A;  1RWW B;  1QLN A;  2WSE C;  4ZVP B;  3UDC A;  3BO4 A;  3H98 A;  2IJF A;  4X62 F;  2Q1L A;  3M2V A;  2QL9 B;  4A46 A;  4JI8 J;  5B0E A;  5IV3 A;  4U96 A;  2LQJ A;  2IVF B;  3POT A;  4OHV A;  4X4S A;  1MNT A;  2DGV A;  1PBA A;  3T3F A;  1S1U B;  2O66 A;  2AP6 A;  3DRS A;  5LMN J;  3JQM A;  2RD5 C;  4IH5 A;  5GAH I;  2ZH9 A;  1JJH A;  3JSM A;  3OTE A;  4DEZ A;  3HFK A;  4JYA J;  2HRT A;  4LF6 J;  1EJ7 L;  1AT1 B;  3NCR A;  1T05 B;  2V8V A;  3IM8 A;  3DLE A;  3O44 A;  2OAU A;  2DNM A;  4DCJ B;  4QYZ J;  1SVD A;  2I6W A;  1BQM A;  2QX0 A;  2QA2 A;  2XZW A;  3MPU B;  3BQ2 A;  3G6X A;  2LEC A;  5F8L A;  1DTT B;  3UD3 P;  1UFW A;  1G3O A;  2KG0 A;  1YJW S;  4DV0 J;  3CC7 S;  4I56 A;  1KSP A;  2X1A A;  1LFP A;  3FKB A;  5EWG A;  2MKC A;  2OKQ A;  3F56 A;  3G86 A;  3VAH A;  1BD6 A;  2RU9 A;  1T02 A;  2BOP A;  1H72 C;  3D54 A;  1JLQ B;  3D7S B;  1TAQ A;  1NKC A;  1EKR A;  5KFI A;  1JLC A;  2HS4 A;  1RAF B;  3K17 A;  4QW8 A;  1SV5 B;  2RF2 B;  1EZZ B;  1IM6 A;  3ZXW A;  2VPW B;  4WZM A;  4NYZ A;  2UXB J;  1X93 A;  1OO0 B;  4ZVS B;  1WOS A;  3Q0A A;  4LSL A;  4EYH B;  4ILM A;  3HFZ B;  4NLT A;  3R1L A;  6AT1 B;  3W62 A;  4N56 A;  4ED5 A;  1V3Z A;  4LSN B;  2U2F A;  3OL7 A;  3KHL A;  1T94 A;  4PXB A;  2IMW P;  1S6Q A;  3T9Z A;  2HNZ A;  4E0D A;  1NSK L;  3QWP A;  2A2B A;  5HQ8 A;  2CQH A;  2YX7 A;  1FFW B;  5J2N B;  5HMY A;  1RHQ B;  3ETM A;  1YRX A;  5DQH A;  3MEE A;  1ITP A;  1MG7 A;  3QWU A;  4AYB D;  5F3T A;  2DIV A;  3PYE A;  5AXM A;  2HNY A;  3GSD A;  1PJ5 A;  1H0H B;  1H74 A;  4B3R F;  3CD7 A;  1BQN B;  3TW0 A;  1LW2 A;  4ZK7 M;  4OI1 A;  2YQ1 A;  3UCZ P;  2RU3 A;  4J5O A;  1UEU A;  2KI2 A;  4C7Q A;  2GJI A;  1S1T B;  2HVD A;  4UST A;  4J9L A;  4UOC A;  3PEH A;  3QZ7 A;  4U7U D;  5F9L A;  4PPZ A;  3U1L A;  3A13 A;  4JI8 F;  1FT8 A;  3L4B C;  3TR5 A;  3OVS A;  3MM9 B;  1GMW D;  2FUG 9;  2UVV A;  4GRS A;  5DZ7 A;  5L39 A;  5LMN F;  1ROF A;  1M90 T;  1FRJ A;  4KIA A;  2ZC4 A;  2AJ1 A;  1U09 A;  2OML A;  2W25 A;  4YFU A;  4JYA F;  1D8Z A;  2K5J A;  2MKJ A;  4LF6 F;  4DU7 A;  3BGF A;  2XO6 A;  2W4P A;  2XG8 A;  2HHP A;  3P8B B;  1EA4 A;  1TAU A;  3IBF B;  1P1T A;  6FDR A;  5L1J A;  4Y2M A;  4NCB A;  2ZUA A;  1MYK A;  2EFQ A;  2MQO A;  2YWK A;  3HVW A;  1B70 B;  3CJ4 A;  5AXN A;  1S72 S;  3TUJ C;  4ECT A;  4AUK A;  1NZ8 A;  2YTC A;  1Q95 G;  4H4O A;  2D3Z A;  4DV0 F;  1BDT A;  1VIX A;  3BKU A;  1SIW B;  3KJN B;  4GC6 A;  3CJK A;  1YSJ A;  2HZC A;  4UQT A;  4ED3 A;  3HHL A;  4JP8 A;  3T5L A;  1QVG R;  2XCA A;  2K6L A;  2VBW A;  2YNI A;  3DRR B;  2V4J A;  3BF4 A;  3LF0 A;  1CJT A;  4OHY A;  3W64 A;  5K8O A;  4KR0 B;  4F4A A;  4WYL A;  5KG7 A;  1LV5 A;  5HMW A;  2UXB F;  3GIJ A;  1C0U A;  4CO3 A;  4DV4 J;  5A8K B;  3MCS A;  1D3W A;  2Q6C A;  5D15 A;  2NYI A;  4I68 A;  4C8O A;  2IMO A;  3VW4 A;  4MKA A;  4I69 A;  1TKT B;  2QEX S;  1LW0 A;  2CNO B;  4DQQ A;  4FF4 A;  2XMW A;  1CJV B;  5J2P B;  3OFF A;  4IFV A;  1TV6 A;  5EGY A;  3LP0 B;  2W2P P;  1U6F A;  1N32 J;  4FBT A;  5GAD U;  1OY6 A;  2H5E A;  2EXU A;  4M8L A;  2OPR A;  3HCX A;  2Y0B B;  1LK7 A;  3FFI B;  2RHQ B;  4IOA Q;  1GXL A;  1SL0 A;  1SC1 B;  3AQP A;  1Y5L B;  4PRF A;  4M5L A;  1EAY C;  5KTQ A;  5I3U B;  4ZPC A;  2NPI A;  4QR1 A;  3JAM Y;  4IDK A;  3RRG A;  5GVQ A;  5KFD A;  2OMO A;  4OZJ A;  3SDE B;  2GIR A;  2CJ9 A;  1C4A A;  1UPM B;  4IRK A;  1QVF R;  1HYS B;  2OTJ S;  2M52 A;  1OY9 A;  3V81 B;  4RBU A;  1UMJ A;  2MZR A;  2DH9 A;  2IIH A;  1S48 A;  5GAE U;  1Q8I A;  4QPX A;  4QIV A;  2WW8 A;  1L5U A;  5EX0 A;  3IRX A;  5F0W A;  2BKN A;  4BHQ A;  2N4D A;  3R5J B;  2NCK L;  2HK2 A;  4E8U A;  2VAS A;  1F1B B;  1B3T A;  3HF5 A;  1TK8 A;  1ACM B;  3BSO A;  2P9E A;  4MYU A;  4X4Q A;  1WHX A;  2IPO B;  3TZY A;  1WTF A;  3HP6 A;  3BO2 A;  2RDI A;  1EET B;  1NH7 A;  2KXH A;  1KR4 A;  1U1P A;  3DFE A;  3WIU A;  1E6Y B;  2FHJ A;  4MTP A;  3GYX B;  3DDK A;  4LRV A;  4DSL A;  2YKN B;  1FE0 A;  4IH6 A;  3PR4 A;  5C42 B;  1GMU A;  2E1R A;  3SQG B;  4YP3 A;  4RNN A;  3ENQ A;  1CQM A;  1YQH A;  3AOA A;  4LF1 A;  3HD1 A;  1NB7 A;  3G9C A;  4YQW A;  3TAM B;  3THV A;  3GFY A;  2R7S A;  1VI7 A;  2ZH5 A;  5M2R A;  2X1F A;  1JWW A;  4HVZ A;  4OHZ A;  5LM7 E;  3FCW A;  1TUV A;  3D6F B;  2XY7 A;  4DL4 A;  1R8B A;  5KFR A;  1FNO A;  1PAE X;  2K3K A;  3H5X A;  3EE3 A;  1LWE B;  4DI6 A;  3QT7 A;  4MK9 A;  1NK5 A;  5DLG A;  4C98 A;  2V8P A;  4WCE Q;  2W8L A;  3GV8 B;  1HQU B;  1NJZ A;  1FHT A;  5CH7 B;  4H4K C;  1NDC A;  2LXI A;  4DR6 J;  1N32 F;  3EMT A;  4J9M A;  2FJD B;  4C8L A;  3GTY X;  1RT1 B;  1HWU A;  3NP5 A;  2NZC A;  4F25 A;  5KFB A;  3K2Y A;  2MZJ A;  1VQO S;  2ABY A;  3N6N A;  4IRD A;  3M8Z A;  3VAF A;  1LOU A;  4NXN J;  2BE7 D;  2BE9 B;  1NAQ A;  2FB0 A;  3SCJ E;  1YHQ S;  1IBK J;  1PCA A;  4DX6 A;  1U6Z A;  2E5G A;  1SQF A;  1WAC A;  4YDD B;  1U6B A;  1TU0 B;  5H9F K;  1OWX A;  4NZ6 A;  1UVN A;  4Z7Y A;  1I94 J;  4UW2 A;  2CPJ A;  3DOK A;  1U45 A;  2BDP A;  1NSA A;  2KFZ A;  1VQ7 S;  2I5J B;  2CQ0 A;  5HO4 A;  3UN2 A;  1X0P A;  1FTC A;  4QU7 A;  1JNR B;  3DN9 A;  2DHG A;  2DNG A;  1VHF A;  4PXC A;  1SUQ B;  3T9N A;  1FEH A;  4P2F A;  5DO2 A;  3M8P B;  1N54 B;  2AYG A;  1Y9O A;  3ZTQ A;  1GNK A;  4ITS A;  3C6U A;  1R6Y A;  2VFR A;  2HEK A;  1Q7Y T;  3IAM 9;  4RW9 A;  2LQ5 A;  2MKS A;  4Y2I A;  1VK3 A;  2R8H A;  4RZR A;  1NPK A;  2JJ4 D;  3K57 A;  4NCA A;  4KFB A;  3EPG A;  2U1A A;  4DF4 A;  3TQ1 A;  1TK0 A;  2C3P A;  1WKL A;  3M1V B;  1MNE A;  2KYZ A;  1WF2 A;  3GYG A;  3IA0 A;  2H65 B;  2GZO A;  1DQA A;  2DNK A;  5BYS A;  1QTN B;  1VIS A;  1PYT A;  1SH2 A;  4X4R A;  4MK7 A;  3J81 j;  2ZHB A;  2CPE A;  5D4N A;  1U1K A;  3ILL A;  4H4M A;  2HHS A;  4PPD A;  4XK8 C;  2RRB A;  4AE5 A;  4MJW A;  1HWJ A;  3DGP B;  1UVK A;  3PYD A;  4RNO A;  2HQG A;  3QPI A;  4NYO A;  3FMB A;  2PGC A;  1SJ4 P;  1YWX A;  1O0P A;  4ZCM A;  5IT0 A;  3C16 A;  2GMH A;  1OPI A;  3R27 A;  5EUH A;  5DJB A;  4I67 A;  4I2P B;  1D9F A;  3THT A;  4P2S A;  2H3E B;  1FEE A;  5HP1 B;  2O5D A;  5B09 A;  4DR6 F;  1NJI T;  4IYQ A;  3TEG A;  2DNN A;  4ZVQ B;  1QD1 A;  3M6W A;  5HBM A;  3CVK A;  1GAO A;  4CO4 A;  4DFJ A;  3MR5 A;  1Q81 T;  4F04 B;  1F2H A;  1FA0 A;  3KFW X;  4C0B A;  1Q0N A;  4Q44 A;  1BWV A;  4NLU A;  2GV1 A;  2VG5 A;  2C22 A;  2N7Y A;  3TAN A;  1IBK F;  2VH7 A;  1QE1 B;  3I32 A;  3IR7 B;  4CCH A;  3W65 A;  1M1K T;  1I94 F;  2GVD A;  3K8V A;  4G1Q B;  2BKP A;  2V8G A;  3SSR A;  2LFV A;  4A48 A;  3ULH A;  1JK9 B;  1Q7L B;  1VBX A;  1VQP S;  2UUT A;  3VZI A;  2XNQ A;  4ERD A;  4P7V A;  1M1H A;  2IC3 A;  2CQ4 A;  3VAI A;  2DNY A;  1KTQ A;  1VBY A;  5DET A;  1BQX A;  3D68 A;  3WDO A;  4QWB A;  3ZTP A;  3P5T L;  4J9Q A;  2PD1 A;  2C2Z B;  3KG4 A;  3DYA A;  2F63 A;  2AYM A;  1RWK B;  4LSN A;  2LEA A;  4Y28 C;  3CUL A;  3QIP B;  1WKK A;  5E3A A;  2XMK A;  3D2W A;  1VJQ A;  2OEM A;  2YWG A;  4OYA A;  1JLE B;  4IQM A;  2CPY A;  3T1Y J;  3V6D A;  2EK1 A;  3W2W B;  3RR8 A;  4ECZ A;  3G82 B;  5GAG U;  2G1H A;  5KFW A;  1P6T A;  4ZVH A;  1F9H A;  2BJD A;  3AXM A;  4DL0 C;  3H7H B;  4AQY J;  2BRL A;  4F2R A;  2KT2 A;  2G2Z A;  2I0X A;  4J9V A;  3EGN A;  4ZJL A;  3I4P A;  4ZVO B;  3OLB A;  3MEG A;  1ULR A;  4M5M A;  4OI2 A;  1KOH A;  4OI0 A;  4LF2 A;  4IFY A;  5KFP A;  3MR2 A;  3DM2 A;  4CZC A;  2A2C A;  4C0H A;  4CNZ A;  2FGC A;  4EBC A;  1FI4 A;  4ER8 A;  1N0U A;  2JVO A;  3AT1 B;  3IO1 A;  3NNC A;  1NLA A;  2K3I A;  4XIU A;  4WP3 A;  4PWD A;  1X4B A;  2IM1 A;  3VAM A;  4NML A;  1UET A;  4FYV B;  1QAY A;  3KLE B;  4ECR A;  2WRM A;  3RRH A;  2ZE2 B;  1TKD A;  5I3P A;  2G0I A;  5A0Y B;  4NX9 A;  2CJX B;  3NAH A;  4ZHR A;  1SL2 A;  4NEZ A;  2MY7 A;  4P73 A;  2M8D B;  1B28 A;  2JLE A;  1C1B B;  3DCA A;  1S9E B;  3B4M A;  4F4Z A;  1MWY A;  4ZCL A;  1FDA A;  5LSR A;  4J9R A;  4N7T A;  1SC3 B;  2H1Y A;  3JSY A;  4NLO A;  3HI9 A;  4WP8 A;  1CS4 A;  4ZLL A;  1T0T V;  2NUH A;  4M5K A;  2EFG A;  4Q2M A;  3EZU A;  2JC0 A;  1C0T A;  3K5P A;  2LMI A;  2KOE A;  3GIR A;  3PVX A;  1WG1 A;  2GIQ A;  2LA6 A;  1ZPV A;  4JV0 A;  3ZZR A;  5CD4 H;  1UVI A;  3D0I E;  3VGV A;  2DGW A;  2FZC B;  2L9W A;  2BNZ A;  2ZH8 A;  3RAM A;  2RRA A;  4O3Q A;  3AOC A;  5CAA A;  3C66 A;  2GNK A;  3FZ2 A;  2OSR A;  1MWZ A;  3PHT A;  1R89 A;  4FKX A;  1L3K A;  1RAO A;  1N48 A;  1QJH A;  5AXL A;  5K14 B;  1N5Q A;  4FP9 A;  2KVI A;  2XS7 A;  3MM8 A;  2ROG A;  3S1T A;  1X9W A;  3FGV A;  2M4M A;  3FSI A;  3MOJ B;  2Y3Y A;  3ZTS A;  2E1A A;  2UUC J;  5D8H B;  2YNF A;  2B4U A;  4WFB Q;  1O6X A;  1CJV A;  3SQO P;  3P96 A;  3M9O B;  3T1Y F;  3KLF B;  4QR0 A;  1REV B;  1H38 A;  4HLB A;  5A76 A;  4B17 A;  4AQY F;  4DFK A;  1VBZ A;  4QZV B;  2R7V A;  3I0R A;  3VF0 B;  3TA2 A;  1ELO A;  1HQ2 A;  2FJW A;  3LGN A;  4IR9 A;  2MQ8 A;  1IKY B;  4NLG A;  3TOQ A;  3I9Z A;  1TL1 B;  1U9P A;  3H59 A;  1ZOT A;  3M7V A;  1WF0 A;  2CPI A;  2C2K B;  5KFA A;  4CT8 A;  2NXN A;  3CJ0 A;  4HAC A;  4J9U E;  5D6G A;  1R8C A;  5M2U A;  2WCX A;  1NK0 A;  1RBA A;  3EZO A;  3TX0 A;  2NR0 A;  4ZPD A;  3MTK A;  2YKP A;  5KFX A;  1PAU B;  3NNE A;  4NI2 A;  2GMJ A;  4R8U B;  1PYS B;  1RGV A;  5KFL A;  4WKR A;  1CJU A;  3LGM A;  2VA2 A;  3JTN A;  4LRA A;  4HHH A;  4TN2 A;  4KAI A;  2FY8 A;  3AY0 A;  4DR4 J;  3VAK A;  1PIE A;  3NS7 B;  1RT4 B;  2JLG A;  4YN3 B;  3C2P A;  4DQP A;  1HPZ A;  1RTD B;  3SXL A;  4USH A;  2O1P A;  3KDO A;  2HQD A;  4LIW A;  4FYD A;  4B3O A;  3FVY A;  3ZTR A;  5BJR A;  4DPY A;  3OPK A;  2AWZ A;  2WBM A;  2R2R A;  3VQS A;  2HS0 A;  4ZDN A;  1EET A;  2X1B A;  2VFT A;  2RE1 A;  3A8K A;  2V8D A;  4ED2 A;  2I8E A;  3TUP A;  3Q2S C;  2R8K A;  3FEX B;  4ZVG A;  2PN6 A;  2ASL A;  5FLX Y;  1Q82 T;  2M9K A;  3NKY A;  5LXR A;  2YQ3 A;  2DHX A;  2R2U A;  1Q16 A;  3PYF A;  4Y65 A;  4JB8 B;  1OQ6 A;  1T9Y A;  2DRB A;  1UA0 A;  3TAM A;  4DMZ A;  2OPP A;  1SJQ A;  3V4I A;  4DJB A;  1ZAW A;  3I6P A;  2IBO A;  2JX2 A;  1KVK A;  4L72 B;  3LWL A;  3IS9 B;  2WK4 A;  2BNW A;  1JJ2 R;  2QT7 A;  2EKY A;  4CLW A;  3DGV A;  1NRK A;  3W8G A;  4ED4 A;  3P4U B;  2OFH X;  3NGK A;  1QAI A;  5HJX A;  2Y0S D;  2QMU B;  2DNH A;  3DNC A;  1ICE B;  3ZZU A;  3N01 A;  4YS2 A;  3C15 B;  1UVJ A;  3FQL A;  3OW2 R;  3IBC B;  3M32 B;  1L3V A;  1FXD A;  3RZA A;  2E9Z A;  1SCJ B;  2R7X A;  1I51 B;  4CH1 A;  2MLY A;  2A3J A;  2HMI B;  1K44 A;  4CLL A;  1AYE A;  4WTO B;  2J9D E;  3N79 A;  2HZA A;  5I42 A;  1OQ3 A;  3MF5 A;  3OBI A;  1K0V A;  2W9C B;  2VOO A;  4KYZ A;  2AMC B;  3PYG A;  4N8O A;  3CD6 S;  3PW2 A;  2MJN A;  3R9L A;  2CZV C;  2XB2 D;  1UTA A;  3PKM A;  2ZKU A;  4TY8 A;  1APS A;  3VVU A;  1W2I A;  3CCL S;  4PG4 A;  4DR4 F;  3TZZ A;  3HPO A;  3HHL D;  4E98 A;  3D0H E;  1TEL A;  3HO1 A;  1U26 A;  1FWL A;  2XMM A;  3FBB A;  1CUL A;  3MTJ A;  4LFB J;  4NA2 A;  3AQO A;  1MN9 A;  4WYW A;  1NSQ A;  3BSN A;  1HBO A;  2VQF J;  1VC0 A;  5CCL A;  4M5N A;  3M6V A;  5IM0 A;  3IWX A;  3RB4 A;  2C3M A;  3M1V A;  2Y9H A;  1UZD A;  4BC9 A;  1B64 A;  3C14 B;  3H2U B;  4V19 J;  2X51 A;  1MWQ A;  5HRO A;  4PUO B;  2PEB A;  4JUZ A;  3RB3 A;  4DG1 A;  1C1C B;  3QLH A;  3A8I A;  3J7A N;  2ACM A;  3QYY A;  4ZVR B;  2VIC A;  4LBH A;  3PKY A;  2ALZ A;  1NBE B;  1S57 A;  2ZD1 B;  3HX9 A;  4ATN A;  3UCG A;  5CD4 A;  2JH3 A;  1FDD A;  1N5T A;  1HNW J;  1HBN B;  4LFA J;  4KJI A;  1SPB P;  2GO8 A;  4LFC J;  1U1Q A;  1K9M T;  1RLD A;  4KV8 A;  5H9E K;  2OD4 A;  3MM6 A;  4EWT A;  2BQ3 A;  2ATL A;  3A4T A;  4BS2 A;  4USI A;  2QMX A;  4HI2 A;  2OPS B;  4M5D A;  4DV5 J;  5CCM A;  3KNG A;  3M6X A;  4KC5 A;  1X60 A;  4QWE A;  2EFN A;  2H1O E;  4U8Y A;  4BWJ A;  3CTR A;  3KK2 A;  2CFX A;  2WON B;  1PG5 B;  2ZNZ A;  2VBY A;  3FDS A;  4TU7 A;  4M5G A;  2N3L A;  3BSC A;  3I0S A;  1YRT A;  2BEF A;  3HT0 A;  2KU7 A;  1FJ7 A;  5K9F A;  4ZPT R;  1UJ4 A;  2D41 A;  4C3M A;  2PI5 A;  3RW6 A;  3L7O A;  4FXW A;  4HHU A;  4P52 A;  5JVG Q;  1U1O A;  1X31 C;  3IG1 A;  3HM9 A;  3KHG A;  1GQE A;  2GC8 A;  3MED B;  2P9G A;  3VZH A;  1KFD A;  4Y0F A;  4PKD B;  5HLF B;  2DY1 A;  4CH0 S;  5C25 A;  2NSB A;  4CO5 A;  2D7S A;  4QYZ K;  1KEK A;  5D0H A;  1IJE B;  2GAG C;  2PMZ D;  1VR6 A;  1T9W A;  2CVE A;  2IVM A;  2CDQ A;  2FHJ D;  4QIF A;  2RQC A;  2ZUG A;  1WHV A;  5E3C A;  1V3R A;  4M94 A;  2B6A B;  4DN9 A;  4DV7 J;  3C6T B;  4XPE A;  1YIT S;  2AN7 A;  4DV2 J;  2H3A A;  2HHQ A;  1EP4 B;  4LFB F;  3OFH A;  2HSE B;  1SC4 B;  2WAQ D;  2AY0 A;  3NGR A;  2VQF F;  4FXV A;  3PO4 A;  1GT8 A;  2C2O B;  5IQQ A;  3R6G B;  2BA3 A;  2VBX A;  4LRB A;  2OPQ B;  4G6V B;  3UE2 A;  1KN6 A;  2KT5 A;  4KO0 A;  2HHH J;  1KVJ A;  3AXK A;  4RKU C;  3CCW A;  3TJA A;  2RS2 A;  2L48 A;  2HVI A;  4V1A k;  1HBM B;  4J37 A;  1T3N A;  1K73 T;  3VTI A;  1FVQ A;  2CZ9 A;  4C8Y A;  3OTD A;  3QGG A;  3ITH B;  1WEX A;  4P74 A;  4P2M A;  2AJF E;  2CWK A;  2ZBC A;  2DVI A;  2W8K A;  4KBI A;  1C2P A;  3OXF A;  4P9S A;  4QW9 A;  2MZS A;  4HT5 A;  1HNW F;  1QAJ A;  1CLF A;  2C2N A;  2KN4 A;  3OSN A;  4LFA F;  4K2X A;  2IDE A;  4LFC F;  1WOR A;  2W2O P;  2XZD B;  4IG0 B;  3J7Y U;  3CWJ A;  1VLO A;  3THP A;  1PBU A;  4DV5 F;  2EG1 A;  2PII A;  1C1B A;  1N6Q B;  1X4C A;  3AOB A;  4RPF A;  1XC9 A;  1NK4 A;  4B9N A;  3M05 A;  3V6H A;  4J9P A;  1BHN A;  1N4L A;  2HBZ B;  4D8J A;  2EC2 A;  2NXC A;  2QL7 B;  2KYX A;  1B4S A;  5KFJ A;  2CG4 A;  1S6P A;  4Y6I A;  4YB1 P;  3LTO A;  2R4F A;  4YUD A;  1RTI B;  4ID5 A;  1OHN A;  4NLS A;  3PJX A;  4AND A;  4NLX A;  3EM1 A;  5D0G A;  2EEY A;  1IWG A;  1MMN A;  1SJR A;  1YGY A;  4FS1 A;  3H5Y A;  4DQS A;  2NZ4 A;  2GO9 A;  4OMF G;  2E44 A;  4O23 A;  2BAN A;  4I2Q A;  2CQI A;  1HNZ J;  1PO6 A;  3F73 A;  2MKK A;  1XWL A;  1WDT A;  4DV7 F;  4QIW D;  3EVW A;  4ZP7 A;  2XYH B;  4DV2 F;  3H2L A;  1WC0 A;  3KK1 B;  1S79 A;  4K5S A;  2HHT A;  5RUB A;  1RJJ A;  4WP9 A;  1RDR A;  4AT1 B;  3P45 B;  3CMQ A;  4RO0 A;  1FE4 A;  3CD0 A;  5BXI A;  3EDR B;  2BYC A;  2FJE B;  2DR5 A;  3JB9 k;  3DOL B;  1U48 A;  2HHH F;  3PFO A;  2Y1I A;  4X64 J;  3OR2 B;  1VC5 A;  4UUX A;  1HWL A;  4GVB B;  5KOW A;  4ZPA A;  1J5E J;  5F8I A;  2VHG A;  3DMJ B;  2ADC A;  7FDR A;  1G2E A;  2K06 A;  3NXZ A;  2NUU G;  3T6J A;  4X4U A;  4U7U K;  4C11 B;  1YI2 S;  4ZOS A;  3EPI A;  3JAM U;  4OZ3 A;  4WU2 A;  3IC1 A;  4EO8 A;  3QJP A;  4R8U A;  3EUN A;  3S6E A;  1HNI A;  1MU2 B;  2QN6 B;  5CXT A;  4DL2 A;  2KM8 C;  3R2D J;  3K89 A;  1LWC B;  2OEJ A;  1JLG B;  2WVC A;  2CZ4 A;  2OD6 A;  2HS3 A;  3CJ2 A;  3DOM A;  3BGO P;  3ET6 B;  3M8W A;  1M5K C;  5JJB A;  4MYT A;  3CE8 A;  3TX8 A;  1SH3 A;  3HHL C;  3MMB B;  2C42 A;  5KFF A;  3RTV A;  5F8J A;  5DGB A;  2DNZ A;  1RHK B;  3ZZY A;  4UQG A;  2DO0 A;  5B0A A;  5ADZ A;  1NH8 A;  2BBE A;  4LUB A;  1W25 A;  5DM6 Q;  2OFG X;  1G4C A;  5ETR A;  3KDN A;  1FD8 A;  2YNH A;  4B3S J;  1YKW A;  2RQM A;  4PZV A;  1Y11 A;  5B7W A;  4O3R A;  2GQ2 A;  1K1Q A;  3BR8 A;  2ZHA A;  3BQ1 A;  4ZVF A;  2QL5 B;  2JXI A;  5HJY A;  4DV1 J;  2L3M A;  2RQK A;  2XBP A;  4ANE A;  3UDL A;  2G0C A;  3L3C A;  1HNZ F;  3JYT A;  3RJM B;  3WC2 A;  1RWX B;  2DH7 A;  3QFW A;  2PI4 A;  1H7W A;  3TQE A;  1NHV A;  3TVZ A;  3A3O B;  5KFV A;  3T1A A;  4N77 A;  2QLB B;  2XLI A;  3R7B B;  3T19 A;  2IA0 A;  1FRL A;  3MUT P;  3DU5 A;  3LPY A;  2VB6 A;  1T3O A;  1S77 D;  1CJK B;  1JQG A;  4PWW A;  3WX4 A;  2ZJP Q;  3QRQ A;  1IKX B;  1PAR A;  2A0F B;  5LMU J;  4ECS A;  4O4G A;  2UVR A;  2HYI B;  4CNY A;  2E7V A;  1YJN S;  2AJ0 A; 
#chains in the Genus database with same CATH homology
 1MYL A;  1B28 A;  2CAX A;  1BDT A;  1IRQ A;  2RBF A;  2NZC A;  2Y3Y A;  2WVF A;  3BKT A;  2KEL A;  3BKU A;  2CAD A;  3VEA A;  3QSI A;  2BNW A;  2BJ3 A;  2GPE A;  3FT7 A;  2BSQ E;  3QOQ A;  2WVD A;  3OD2 A;  2K6L A;  2JXI A;  1QTG A;  1ARR A;  1MNT A;  3BKF A;  2BJ8 A;  1X93 A;  2PC6 A;  1Q5Y A;  3H87 C;  2BJ7 A;  1ARQ A;  2WVE A;  2H1O E;  4FXE A;  4ME7 E;  2BJ9 A;  2CAJ A;  2AY0 A;  1U9P A;  2BJ1 A;  4HV0 A;  2K5J A;  2HZV A;  3VW4 A;  2WVC A;  2CA9 A;  2F1F A;  2BNZ A;  2FGC A;  2JXH A;  4D8J A;  2BA3 A;  1BAZ A;  3FMT A;  1EA4 A;  2K9I A;  3GXQ A;  2K29 A;  2K1O A;  3LGH A;  2HZA A;  1NLA A;  2WVB A;  2CPG A;  1P94 A;  1PAR A;  3PHT A;  1MYK A;  2JXG A;  1Q5V A;  1B01 A;  1BDV A;  3VEB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...