3OD2A

E. coli nikr soaked with excess nickel ions
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
b'MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRSALAQEATQQHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVIAQRGVRHGHLQCLPKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nickel-responsive regulatory protein
publication title Structural basis of low-affinity nickel binding to the nickel-responsive transcription factor NikR from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 41
structure length 132
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01402 RHH_1 Ribbon-helix-helix protein, copG family
A PF08753 NikR_C NikR C terminal nickel binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1220.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant Met repressor-like 3od2A01
3.30.70.1150 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits ACT-like. Chain A, domain 2 3od2A02
2BJ7A 4ME7E 1EA4A 3QOQA 1Q5VA 1QTGA 3VEAA 2WVFA 2AY0A 2K29A 3VEBA 2RBFA 1NLAA 2BJ3A 2WVDA 2GPEA 2NZCA 1MNTA 2JXHA 3H87C 2FGCA 1B01A 2BA3A 2BSQE 3VW4A 2CADA 3LGHA 2KELA 1PARA 1BAZA 1P94A 3OD2A 3QSIA 1B28A 2WVBA 2Y3YA 4HV0A 1BDVA 3FT7A 3FMTA 1Q5YA 2BJ1A 2CPGA 1MYLA 2BJ9A 2K9IA 2BJ8A 2K5JA 1X93A 1U9PA 3PHTA 3GXQA 2PC6A 2CAJA 1BDTA 2CA9A 4D8JA 1ARQA 3BKFA 2BNZA 4FXEA 2WVEA 2BNWA 2CAXA 1ARRA 2H1OE 1IRQA 2K1OA 2K6LA 2WVCA 2JXIA 2F1FA 2JXGA 2HZAA 3BKUA 2HZVA 3BKTA 1MYKA
chains in the Genus database with same CATH superfamily
3FC9A 3QOQA 2VQFJ 1KTVA 3ZZOA 4F4XA 1SIWA 4FKXA 4EO6A 1IR2A 4ELUA 5KFAA 1LFWA 3OVSA 3R5DA 2F5GA 3HJFA 2F8HA 1NJIT 1N5YA 4AQYF 2V9WA 3H4BA 3VZIA 3KHRA 4DMZA 2F65A 1U45A 4QIVA 4X4QA 2DGVA 2DR7A 3LP1A 1AXQA 1TUVA 5KFSA 2IA0A 4WWSA 3T3FA 4OJHA 4NCAA 3BGLA 3CCQS 5C25A 4IDKB 3SEOA 1SL2A 1C0UA 4KB7A 3DLLQ 2DGUA 1U9PA 4ECVA 1HL6A 1N8RT 1NAQA 2OTLS 4IG0A 4B9UA 4JP8A 2YPZA 3VALA 3AAWB 4Q5VA 5E7OB 1ARRA 2OO4A 1R43A 1RAEB 1RYSA 2KVQE 2JXIA 4B9VA 1OY9A 1MWYA 1T9VA 2AZ1A 4ZA1A 3M30A 1JLFB 4LSLB 1NO8A 5IFMA 4A8QA 4P10A 3SDEB 1TL1A 3VQSA 1BUXA 2E44A 5CXTA 2A3JA 1NH8A 1CLFA 1FK9B 1CJUB 4LF9F 4L74A 4F36A 1T7PA 1UFLA 3OL9A 4TU8A 4A8OA 1S1UA 1NU4A 3IS9A 3AHPA 2DGQA 1VQKS 2FUG9 4PQUB 2J9DE 4YB7A 3D3BJ 2FQQB 3U02A 3K89A 3W66A 5E2QA 2BZ2A 2UXDF 2L9DA 3LP2A 4OYZA 3M1VB 5CCMA 1MROA 1M5KC 3U1LA 1S77D 3DYAB 1FWPA 4J9VA 4JI1J 4ZVFA 2YNFA 1EAYC 1VHIA 2EPIA 2DXEA 3OR1B 2DK2A 2W2PP 3N6MA 2AYEA 2R2TA 2HZAA 4MKBA 3L4BC 3QYYA 5C42A 4DV4F 1YJVA 4U96A 4DV0F 4USJC 2POKA 2X3DA 3D2WA 3MAAB 5C5JA 1G6BA 2VONA 4EO8A 2RBFA 2LQ9A 1V3RA 3FGVA 2CUYA 3LA0A 4PG6A 3HD1A 2DNPA 2CDQA 4DPTA 4WBFA 6AT1B 3WX4A 3B4DA 1DURA 4KT0C 4ALZA 5CQGA 2IVFB 3ZNJ1 2Z56B 1SL0A 4DR6J 4GKKF 2ZJQQ 5KOXA 1XNQF 3E01B 2D41A 2OPSA 4HT5A 7FD1A 4Y2CA 3M2UA 1R7IA 3J7YU 4RW6B 2KT3A 4WFBQ 1HNVA 3GQCA 4DLEA 3CCJS 5IM0A 5LSRA 3KXDA 1VIOA 1RT4B 2QLWA 5KFMA 1C1CA 1Y3JA 4OI6A 3E2EA 5KFJA 5KFEA 3WDOA 1MU2B 3DCAA 3OTEA 3MR3A 1X0FA 5BXIA 2VASA 5DQIA 1TKXB 2LEBA 4DS5A 2R7TA 1BLUA 1G3OA 4LMZA 3NL0A 2KL8A 3N6LA 3MUVP 1U1MA 1HPZA 1T03B 5IWAJ 4RR5A 1VBXA 1ZS6A 3BO4A 4JV5F 1MNTA 1PAUB 5ADZA 3UR3C 1P27B 4H4KC 2R9LA 3M9NB 2OUGA 3ENAA 3LGHA 4F2RA 2FVPA 4LF4F 3LUYA 3ZFVA 1S49A 2ZH7A 1B0TA 1UZDA 4WPAA 2EK6A 2QFIA 2FLNA 2JWNA 2CJXB 2DGWA 3ISZA 2Q6CA 2W25A 2BVZA 1AA1B 1VBYA 1VC5A 2XMVA 3NOCA 1JLAB 1SC6A 2VFVA 2VZ9A 1NDKA 1HNZF 3UNYA 1VJWA 4JI0F 4KH1B 2HFSA 4ZVPB 2PMHA 1S9GB 1BQXA 1JJCB 2PN6A 3HX9A 1ITPA 2GQCA 2X1FA 3GIIA 3ICLA 4ZKAA 3RYLA 3FVYA 4P2MA 3DMJB 1Q8BA 1RA7A 3MF5A 5K20B 1X4HA 2WONB 3Q8UA 3KJVA 3W63A 1RAOA 3UD3P 2JEFA 1FXDA 1U25A 1TQLA 3MM7A 3K2YA 2LMIA 4PYDA 3SQGB 4NXMJ 4LUBA 2RRAA 1RWOB 2VPWB 4BBYA 1PC4A 5JXSA 1EHWA 3W9HA 2J9EA 3KLGA 4TLRA 1Y00A 2KFNA 4X4NA 1NKCA 5H9FK 3PX0A 2ZZNA 2B6AA 3PYEA 3SCLE 1U1OA 1YK9A 1T02A 3LOUA 2W01A 4DZDA 2F7VA 4YS2A 3IO1A 1U0SA 1OY8A 2B9XA 2R7UA 3CCTA 3LWMA 1EP4B 3GTYX 4J9UE 2R8HA 5H9EK 1GX6A 2QC3A 2FLLA 3QT8A 2DHGA 2OPPB 2L9WA 4KJIA 3V4IB 1XNRJ 1P9QC 1KS2A 1CJVA 2V94A 3D1OA 4ZPAA 1P1TA 2R8GA 4XK8C 4QCLA 2N7CA 2HBZB 4NLGA 4B9SA 3TUZC 2DXFA 1KTQA 2DITA 3BJYA 3SCJE 4DSFA 3OT9A 5F8NA 1S1WB 1MMNA 2DH8A 4RPFA 3CJ8A 4P7VA 3D66A 2HHHF 1IR1A 1IJEB 1OSDA 2J0SD 5EN1A 1RAHB 5E33A 1HMVA 2F9DA 3KTQA 4PKDB 5MAOA 2CADA 4QR2A 4DR7F 1HI8A 2J0QD 4ZOSA 2MPUA 1J27A 2ATCB 5A0YA 5EX3A 3PJWA 4U8YA 4JI2F 2MQMA 3DRRA 3QLHA 1U48A 3MD1A 5LSOA 5J2PB 4WYWA 3PZPA 1WC5A 3PKYA 3GJSB 3JTOA 3Q89A 3G6XA 2UUCJ 1NK8A 4ZLPA 4UTGA 2YX4A 3D0IE 2Q43A 2MQOA 3N79A 3PRVA 5IS2A 3H2UB 3G2XA 1FTCA 2QFJA 4F4WA 5KG2A 4X62F 3KJFB 3CDBA 1FDNA 1J5OA 1CJKB 5F0WA 1WDTA 2AEFA 4P75A 1FKAF 1XMOF 2F63A 2AJ4A 1K73T 1LWEB 3KK1B 4F4YA 4MIAA 3HHLB 3JSYA 1FD8A 4PAAA 1LV5A 3UN3A 3D0GE 2GW8A 2DY9A 2OPQA 4FVCA 2YWWA 2MHEA 3H87C 4TVAB 2VPXB 1LK5A 1QDUB 3H5UA 3H2LA 5HBMA 4XDCA 2DYAA 4DX5A 1LW0B 4OHWA 4AYBD 5HROB 2AT1B 4QU7A 2ROGA 3MEEA 2VG7B 3NO7A 4B9TA 1S0MA 3M32B 3FMTA 2M9KA 1JLEA 1UA1A 2LU2A 3ONQA 1YX2A 1F5BA 3S7RA 3FZBA 4S0MA 5LJ5Y 3I31A 1R89A 4RUCA 4KO0B 1GTHA 1UEKA 3TZYA 4EYHB 3CW2C 1FERA 3DLJA 4ZVQB 1H7WA 2UV8A 1N36J 4UOCA 4I6WA 4ITSA 3EICA 2IPOB 5IC4B 3MM6A 1U1QA 1N4LA 4IH5A 1IJFB 4OYIA 1O6XA 1SJ4P 2K1RA 2ZE2A 1QUVA 1XK8A 1ROFA 4DF8A 4L3KA 2KHCA 5KT2A 3CVKA 1HWJA 1KQFB 2MTLA 4A46A 1VQ6S 3ENWA 4NA3A 4OZ3A 1LWFA 2XMUA 4J7CA 4WK3A 2CKWA 5K8NA 3G9CA 1R3NA 3I56S 1PGZA 2HHUA 1E6YB 2HQ3A 3CCZA 2UUAF 2AYGA 3CJRA 1X5OA 5B7WA 3PIOQ 2EC0A 1X4CA 2XLKA 3W61A 5HO4A 4NCBA 3SV4A 1IWGA 7FDRA 1I6JA 4F3QA 1D0EA 3DLEA 4OZ0A 3GJTB 2PO4A 1XQIA 3M05A 2LDIA 2PD1A 4WXWA 3VQTA 1ZAXA 3T6BA 4USMA 3MTJA 3NS7B 2CZ9A 1WC4A 3D9BA 3HHNB 1KWMA 4DV6F 4PR6A 5J2NA 4FXDA 1ZOTA 3GB0A 1Q53A 3CXCR 4KAIA 4H54A 2HQFA 3JTNA 2AJQA 3MOZA 3UO0A 4DL0C 1N5SA 4DFKA 3W9IA 3TUJC 5DDOC 3TQEA 4PUOB 1RTHB 2GCFA 3THTA 1D9AA 1VYAA 3GSDA 2LQJA 1VRUA 3LPYA 1BE4A 3TA0A 1RT1B 1YI2S 1RT3A 1SIZA 3F44A 4WTOB 1JKHA 2G2OA 5KFTA 4B3RJ 5A6WA 1N48A 3MMCB 2IVYA 3AA8A 1TKZA 2JBVA 1WHYA 4LVOP 1SC4B 1OPZA 4RW4B 1L5UA 2KYXA 4BHQA 2ZBPA 2VQEJ 2W2OP 2Z30B 3IR7B 4WE1A 2DIUA 3T41A 1RHUB 1YJRA 1VQSA 3FZ2A 5HL7Q 1B0PA 4WFYA 2KXNB 3LWLA 3M6XA 3QRPA 3MR2A 2YNGB 3IG1A 2U1AA 2MQNA 4Z7YA 2VFTA 3D6MB 2IMOA 2MMYA 3BQ2A 4IRCA 2WW4A 3OW2R 3Q83A 1WACA 1KSPA 3O5TB 2GMLA 4RW8A 1WDDA 4LR9A 2Z8QA 3PV8A 5B0AA 3BGRB 4RU9A 1U2FA 4RW7B 1ZZNA 5T7LA 3G86A 2F8EX 3MPDA 1S9EA 4ZVHA 4RNFA 4URGA 2VKZG 2J9CA 4DUZF 4LFAJ 3QSIA 2JVOA 4HV0A 2B4PA 1RWKB 2VL1A 1RU2A 2ADBA 4ZVEA 3R5AA 4YY3J 4ECSA 1MMLA 4AFFA 1LWXA 3NY0A 4O3PA 5CZVA 2E9ZA 1IKVB 2WAQD 3PVXA 4X64F 5DQGA 1U2RA 2RQMA 4KR0B 1D8YA 5J1NA 3ILJA 2MKIA 2CFXA 3QNWB 2XLIA 1SIWB 3NMAA 2MSSA 4HDHA 1QAXA 3RBXA 1RA6A 5K9FA 2ZHOA 2I38A 3VGSA 1N5YB 2HQDA 4NLQA 5LMUF 2OLWA 3QJPA 2BSQE 2FB0A 3T1AA 1S4EA 4I67A 4F4AA 2FHKA 1DLOA 3LP1B 2IIHA 1R8HA 4BC7A 4NMXA 4TU9A 2W4PA 2LYVA 4ILLA 1N34F 3GCWP 3AJ2A 3R1LA 5C25B 3GR0A 2Z4PA 3M8QB 3PRDA 2BMBA 3U1NA 2VOOA 5LMNF 4C6AA 3POTB 2FJXA 3AXKA 1WTBA 4C8KA 2I8EA 3MM8A 2H1OE 2HQIA 1ZH5A 1RT7B 3I87A 3RG6A 4J9SA 4LF5J 3BSCA 3M30B 1J5EF 4A8XA 4G6VB 2H4WB 5E3CA 1AFIA 1TL7A 2ZJPQ 1TL1B 2V2QA 3MCMA 4EUVA 3MPYA 4OI3A 1QSSA 3DLGA 4FNHA 1PKUA 3I4HX 2DISA 3AOAA 2QO3A 5B0GA 2ZUAA 1GMWD 5DM7Q 4G3IA 2EG1A 2MZ1A 4LF6F 1LXNA 2B5JA 1VK3A 1VQ9S 4E2FB 3T6JA 3RB4A 3GU0A 4QWDA 4JOUA 2LCWA 2DT9A 2ZKTA 4IRKA 3HHLD 5U47A 1DBDA 1GX5A 1M5VC 4K0KF 4IR1A 1FKPA 4Y34A 3C19A 4NYZA 3LP2B 3KLIA 5D4LA 2BQRA 2MYFA 2R8IA 3KUHA 1WHXA 1FD2A 3M2RA 3ENQA 3J7AN 1IM4A 2YNFB 1LEOA 3QIPA 4L73A 4V19J 2CZ4A 3IMQJ 5J1EA 3AODA 3D54A 2LQ8A 5DDPC 2CWKA 4DBQA 3N9UC 1X5SA 3OTBA 1EJ7L 3JSMA 4OHYA 3MPUB 1U47A 3NAIA 2MZQA 3GYNA 1F5CA 5CYMB 3V6HA 2ILZA 2DJWA 2N3LA 3VCDA 4ANDA 1RAJA 3VEAA 1Y10A 5E5NA 2BR0A 2B9YA 3CJ3A 5BR8J 2XSFA 4DFMA 3SV3A 4LFBJ 3V6DA 2F40A 5EHHA 5C24A 3BDPA 2WBMA 5HK4A 3IR6B 2E7WA 2JL9A 4FKYA 1KP6A 3T9NA 5B09A 1HW8A 2VBXA 2QMUB 3N01A 1VISA 1U4BA 1GAOA 3L9ZA 2ACMA 4PPDA 3HM9A 4CO1A 1VJQA 1RHMB 2PSZA 4PG8A 3R8YA 1ICEB 3HMJG 2AKWB 5IZHA 2VPYB 3BPDA 3QQCD 3I32A 4QOTA 2KHDA 2OFHX 3LQVA 2FDNA 4BDPA 4H4OA 1NKEA 4X4SA 2AD9A 2H5EA 2EBGA 2OPSB 4JV1A 1KLMA 1XMBA 4PXEA 3M2UB 4IG3A 4NWBA 2YTCA 4MYTA 2JLGA 4RL1A 4I7FB 3J7Z5 1M1KT 1UWBA 2P9CA 1SBRA 1TTHB 3HT3A 2DH9A 2HWTA 2HPUA 2RQCA 3JSRA 5A8KB 4WP9A 2ZHAA 1EQ0A 2CQ2A 1U09A 1SC1B 2K29A 3C15A 1KRPA 5KFLA 1LKZA 2MEWA 4X4UA 4ZVGA 1FESA 1HPZB 3P6YC 4J9LA 1V5VA 3KDNA 2V8DA 4ED8A 3I82A 2RS2A 5FLXU 3GE9A 1RI7A 3CDUA 4I64A 5LXYA 4EGLA 2W9CB 4F0KA 8RUCA 2NZ4A 1S0NA 1HWKA 3HULA 1RWUA 2BKNA 3ZZRA 1SKRA 1PCAA 4LBIA 1HNIA 4IRDA 1D9DA 3MURP 1CSJA 3CDEA 3VAHA 2KZMA 1T9UA 4CLLA 4OJ1A 4CO3A 4D8JA 4AL6A 4PPZA 2JOQA 3AD7C 3OSPA 2ZDPA 2XYHB 3MHYA 1RB0A 3NAHA 4F04B 1SJ1A 3H2VE 4FN5A 3FDSA 4DV2J 2VKRA 2V4RA 4NZ0A 4NLPA 4ZPVR 2WVFA 2CDRB 1F1BB 2OJ3A 5D4OA 5F8LA 2KXFA 4OZ5A 4DSKA 3CD7A 5D0HA 2V4QA 3K7RA 4ECXA 2BKOA 3V81A 4USWA 3G6VA 3UVJA 4KHPF 1R8AA 1W26A 4ERDA 4USUA 1NJWA 1GMUA 4MJKA 1TZ0A 3KLGB 1MN9A 1TAUA 2QEXS 2AGOA 5KT6A 2XCAA 3X1LB 2V6AA 1NPKA 2B6AB 4NLOA 5G0RB 3D68A 2K3KA 1OG7A 3DOKA 1FJGF 2BE2B 1FFWB 2KFYA 5KT3A 2RKIB 3TAQA 2M8DB 2ZH9A 2YKNB 1FHTA 3FEZA 5EWFA 2AYBA 4M5NA 3EVMA 3B78A 1CJVB 1X9WA 3UNGC 4KRWA 3EDQB 2JZ5A 3DFEA 4WYLA 4RJVA 1X5TA 5CYJA 1YJWS 4K5RA 4DI6A 4CLSA 1LK7A 3WC0A 2E5GA 2V8HA 4DV3J 3R7SB 1WORA 1T9YA 2QX0A 4DQRA 1RWWB 5L8RC 1HBUA 2J76E 4K4VA 4PZVA 2JHEA 3UFCX 5KFZA 2QZ8A 3Q8SB 3OVBA 4YB6A 3ILLA 2CQGA 4ZK7M 4C98A 1OS5A 1FJ7A 2WTFA 3RAXA 4KC5A 2J7WA 1HMVB 3CSKA 2EFGA 1U6BA 5A0YB 1NDCA 4DQPA 2A0FB 3H8YA 4M94A 1RJJA 3QLHB 4U67Q 3HZEA 1EX8A 3KLHA 5D77A 2VFRA 4M5DA 3ET6A 5F8GA 1JNZB 1TU0B 3SFGA 3V5RA 2HQGA 1UFKA 5HMYA 4I0WA 1NCLA 4CTAA 2VBYA 2YNIB 3BB5A 1KBRA 2IM0A 2X51A 1UVJA 2AZ3A 4E0DA 1J5OB 1F2GA 1HBMA 1R6VA 1M1HA 2XBPA 3RBDA 5CD4H 4KE5A 4NLXA 4P74A 5AXLA 2ZBRA 4NXNJ 4AAIA 3G82B 1Q16A 1A0OB 4AL7A 2W7PA 1RAAB 1VR6A 4C0BA 4ZHRA 4ED3A 1PIEA 4FP9A 3QFHA 3HD2A 3DXSX 5F8JA 4JI7F 1Y5IB 3KLEB 4XPEA 3PO4A 4PABA 2ASJA 2EC2A 1FE0A 1WEYA 4N76A 1I5OB 1SVDA 1ZM3A 4RNOA 3UN2A 5IT9Y 2A2DA 1S7HA 5E41A 4DV7F 3CF5Q 1JLEB 4X2BA 1K44A 4GVBA 1YIJS 4HKQA 2OPRB 1ZPVA 1Y9OA 5HVFA 4Q8EA 2J8SA 3FNNA 3I6PA 3RTVA 4UQTA 4ZCIA 5LOQA 5IV3A 2DNQA 5M2PA 4CI0B 3JQKA 3FCWA 3UE2A 3TI0A 1RISA 2OI2A 3LPEA 1SH3A 4HH0A 1RU1A 2RUGA 4YOEA 3FEYB 2OD6A 4Q2MA 3HKWA 3VR1A 4U6PA 4K4UA 1SQFA 3DN9A 1KFDA 3MEKA 2Q79A 4C97A 2LFVA 2WW8A 2W1BA 1RADB 2XC9A 1YRXA 3PEHA 5CCLA 1NK9A 2K1RB 4IUFA 1WC3A 2EI5A 3J80U 3FMWA 4CH7A 3ISNC 2VOPA 1RWNB 1BHNA 5KFBA 4IDKA 1L3TA 2YBVA 3FQKA 4KBIA 5DZ6A 2E5LJ 2CQ0A 1EKRA 1RBAA 4DX6A 2M88A 4YFUA 2ACYA 2MB0B 1N6QA 3NGUA 4RW9A 4LQ9A 3GIMA 1RKIA 5DM6Q 3NLCA 4DS4A 1A7GE 4ILMA 5F8HA 2A1BA 2RHSB 3R97A 1NSAA 3SDEA 2CRLA 2CXEA 1FVQA 3L3CA 3WZ0A 5ETQA 3NWGA 3OXFA 4DPYA 1TK8A 3DLEB 2ZD1B 2QG9B 3PTWA 1P9YA 1IBKF 3KOAA 3AB4B 3DM2B 3K59A 3GIRA 4O3NA 1H7XA 2R7XA 4URSA 5A8WB 5LSLA 3JAMU 3I5BA 2XMAA 1XWLA 4N8OA 2D1CA 5GMKa 3X3UA 3CD5A 4WKYA 3M1VA 1VRUB 2AV5A 2N4CA 2ASYA 3MCSA 4DR4J 2GV1A 3QT6A 4O0NA 3WIVA 1JKHB 1WF0A 1KOHA 4AXJA 1I3OB 2YWHA 3AY0A 3GFZA 2DNMA 2HG4A 2MZSA 2ATLA 3PR4A 4OX9F 1TVRB 1N5QA 3T1HJ 2HK3A 3ZZYA 2HNDB 4DQSA 1S79A 1ULRA 2KM8C 5E0OA 1RAIB 2UXBF 2GMHA 4JI4F 3IAM9 2IFXA 4BCAA 4NMLA 2XZTB 3LW5C 2HVDA 3BO2A 3FFIA 4EFAC 2XO7A 4LRAA 4WE1B 1B99A 3MAAA 3QSYB 2KXHA 2MLZA 4B17A 4OI1A 2XMTA 3EXCX 1IVZA 3RBZA 2JC0A 1HQEA 2RJZA 3NG8A 1TFWA 4FS2A 3NNHA 1S6QA 3I0SB 3IG1B 4OV6A 3OFGA 1XIQA 1TFYA 2WZ1A 1FDAA 1Q4RA 5HMWA 4I4BA 3PW5A 2BE7D 4DV0J 2UUWA 2ZC3A 4F25A 4KV8A 4P2FA 4NX9A 3DXBA 2KU7A 4ZPBA 3E01A 2YH0A 3EPIA 2O5DA 1YHQS 2OEKA 3AH6A 2CJ9A 4RW6A 3NBPB 2X7IA 1U26A 2V2KA 4HR2A 2DKOB 3NCPA 3VAIA 1YKWA 1MWZA 3C14A 3ZZPA 1WELA 1RT4A 5LT5A 3OPKA 2K9IA 2RT3A 3GWCA 4O44A 3UDLA 3GV7B 1MU2A 2KRBA 4A4JA 2DHHA 1IBLF 4IH7A 4CM0A 4KIAA 3MUMP 1VQ4S 1XNQJ 1NZAA 4WU2A 3GG0A 2H1YA 3DGPA 1Y4ZB 4PWWA 2VDIA 2PMWA 4JYAF 3F73A 1HNXF 1WUUA 2CQHA 3CJKA 2RH3A 1WC0A 1VRTA 1QVFR 3GONA 1T03A 1FKOA 2VB6A 3AB2B 3MPWA 5B08A 1QVGR 1VK8A 1C2PA 3PEJA 1S6PA 2QLFB 4PEOA 3VAKA 3HXMA 3R5JB 3OUYA 4GMKA 4BLGA 1TL4A 2ROPA 4DX7A 2DXDA 1D3WA 4IOBA 1YDLA 4NLDA 3RUBL 5CYQA 1JLAA 4OL8A 4KYZA 4KGKA 3SCKE 1S59A 1S9GA 1HD1A 3N28A 1DLOB 2UUTA 3SSRA 1TR0A 1RTIA 2LXFA 2DHAA 3DDIA 1TL5A 3NS6A 1NNDA 2GC8A 5GAHU 4C3KA 4EEYA 3DMJA 3IGVA 3GXQA 4P71A 2Y8WA 4HT7A 2XNQA 4ED2A 2E1AA 5A2QY 2J7UA 2BBEA 5CD4A 2WONA 3M8PA 4ZN1A 1R6YA 4WCEQ 2AN7A 2NSBA 4AXIA 4YEAA 1LOUA 3SQGA 3H4DA 4W98A 2HK2A 3CGIA 3PACA 3QT5A 1WOPA 1APSA 4ZVTB 1RCXB 2BEFA 4PG5A 3NGRA 2BQ3A 1TL7B 4RO0A 1X4DA 5KFVA 4RUBA 3DLGB 5LJ3Y 1NLAA 2ZOMA 5AE2A 4HH1A 3VGTA 4QR0A 2HMIA 1YJTA 5C2GA 3IAS9 3GYXB 3GLJA 2JFKA 1EP4A 1JXLA 2R7RA 4JB8B 4UT4A 2MKJA 1V9OA 2ZFHA 4N77A 2C28A 1BD6A 1YJ7A 3IA0A 4ECYA 1FKPB 2UU9J 1OMSA 4DN9A 4Q45A 2VPZB 1FX2A 2MKSA 4WXOA 5AE1A 1VBKA 3OTOJ 1RACB 3BO3A 1RTJB 1Q8LA 4UOHA 1JLQA 1RABB 4LVNP 4RLEA 3H59A 4JI1F 2VG6B 1S1WA 3QIPB 5I3QA 5AXNA 2R3VA 1WKLA 4AD6A 3CULA 2MZTA 5J1EB 4MT1A 2OD4A 2ZWPA 3M8YA 2I2YA 2HS3A 5L9XA 2HGNA 3W2WA 2AWZA 3GYGA 4DL5A 1B0VA 2RHQB 1DRZA 3M9MB 2F9JA 2ASDA 5BYRA 2JH3A 4DR5F 3PW4A 3FUYA 1WOOA 1DQ8A 3ZTPA 2CVEA 4CLPA 3HHDA 1PJ5A 2NUUG 5J2QA 3PDNA 2CQ4A 2C2EA 2RRBA 3KMQA 2U2FA 3HJVA 1L3KA 2D9PA 1SB6A 2CJQA 2D3ZA 1NJZA 4LT6A 2QGFB 2E1PA 3SCIE 1GMWA 3KYLA 3IFEA 2AX0A 4DR6F 4DPXA 1Q7YT 4Z2XA 1LWEA 1KLMB 4Z7CA 4B3MF 1LW2B 5SZTA 3HHLA 5C7PA 3TVZA 5CZXA 3RR8A 3A13A 5ETRA 4UOGA 3LALA 1UWBB 2VD3A 3WX8A 1UP1A 3M6VA 3JYTB 1F6TA 2DPJA 4YHHJ 4J9MA 4ECQA 2L3MA 1NJXA 4DOZA 2DPIA 1Y0HA 3C15B 2FC9A 3OTDA 3PM9A 3M32A 4Q2LA 2RAQA 3UD5A 1NHUA 5IWAF 4CH1A 1D8ZA 5AJ3J 1G1XA 2R2SA 2IM3A 4KO0A 4NPOA 3TAPA 2BABA 2ZH6A 3ZXWA 3EZ5A 1HNIB 3C6TA 4X66J 5GAGU 2K7JA 4ZLNA 3QZ8A 1N0UA 1CC7A 2C2RA 4CH0S 4IO1A 2DY1A 1DHMA 1CULA 4B3TJ 2G4BA 2YNHA 2DO0A 3K5NA 5EGYA 1XMQJ 4LIWA 3R5BA 3Q2TC 4K8RA 5HQLA 2NQPA 3CCVS 1JK9B 2XSJA 4LRDA 4LF8J 1OWXA 2OGUA 3UW1A 3KK2B 2LDYA 2E1RA 2RU9A 2J9DA 1E6YA 5GMDA 4QBUA 3SBMA 4RNNA 2VC0A 3PHEA 3V81B 1J2VA 3UVJB 3PIPQ 3PX6A 2KI2A 4NXMF 2ZITA 4OYBA 5HSPA 2XS7A 3FBBA 1VLYA 2XLJA 2RB7A 1VDHA 4QU6A 4DX8H 2JDJA 2XNRA 3WIUA 4A8YA 4ZLJA 3H5XA 4PRFA 2UVVA 1DJ0A 2FHMA 4J9QA 3BGUA 2B43A 5CA5A 3OLBA 4F4KA 1B7YB 3OHAA 4A8MP 2SXLA 1IQZA 3DOKB 5THWA 2WB4A 3GFXA 5L1LA 4Q0BB 1HR0J 2W8KA 3CMQA 4O3OA 3K57A 3MAQA 3Q8RB 2HHTA 1N33J 3L7PA 1RTHA 3FQLA 4IOCQ 1XNRF 1XERA 3AFGA 4DL4A 4HI2A 8ATCB 4OZNA 2QA4S 2KKHA 1HBUB 1GT8A 3LP0A 3VTIA 4J9KA 3J7A1 2E7VA 2A10A 1Q81T 1GQEA 3UPFA 3IC1A 3GG1A 2BA3A 5KFKA 2EFPA 2DNGA 1DTTB 5EDWA 4RZRA 4GC6A 4RW4A 1S1TB 2AEJA 3GZ7A 2M8HA 4DV1J 4NASA 4QYRA 2B0GA 1S4FA 4X84A 2Y8YA 1B3TA 1KR4A 1X0PA 4RU2A 2V4JB 3DLKA 2HFUA 3NCRA 1VC6A 2M7SA 4KFBA 1K0TA 1UVKA 2CA9A 1K0VA 4P52A 3TA2A 3CE8A 4D3GA 2C3OA 2UUCF 2HQCA 4MFBB 2GIRA 1AZSA 2C2DA 3G87A 1UEVA 4CTAB 2NYHA 5L39A 9ATCB 3ZTRA 2AMCB 2EFNA 1BQNA 4TU7A 3K5OA 4Y3CA 2VG5A 2XTJP 4RW7A 1G4CA 4ID8A 1HBMB 5KG3A 1XEZA 3FJ2A 2B3TB 3D4JA 2HS0A 3H5SA 4JI3J 1O0PA 3VEBA 2XY7A 4IR9A 1WI8A 1Q16B 2XYPB 1M1GA 4RWXA 5L1IA 1YG0A 2OMOA 4TY9A 5A8RA 4MH8A 4ZVSB 3FBFA 1VMBA 4JI8J 2QIFA 2M5YA 4OHVA 4WTYA 1R8BA 2M3DA 1HBOB 1XR7A 5FJ4A 2IRYA 3T1YJ 3MEDA 2GHWA 3R9LA 4GVBB 4QQBA 2OIHA 2HWIA 3TJAA 3HF5A 4OYPA 2AW0A 3QAEA 3CCLS 4YQWA 3H0PA 3N5FA 1S48A 1SQEA 2HZCA 2UVWA 3TANA 3PJ9A 4WIIA 2ZM6J 2HZVA 1H98A 4F3MA 3NWRA 4M5KA 4LF1A 1PJ7A 4CO5A 1N36F 3OFHA 1WJ9A 1H2UX 4YMEA 2DEIA 1VS3A 2ILYA 3PYDA 1NKBA 1N52B 1VRQC 2R4FA 4DCPB 1SV5B 3CJ5A 2LA6A 1SH0A 4CT8A 2AQ4A 4WIQA 3DC2A 1IBMJ 3U1MA 4YDXA 1HWUA 2CPHA 1AYEA 1UKUA 3M8QA 4KHMA 2XWYA 2KDOA 2HYIB 3CCWA 2DNOA 5F8MA 2NXNA 4ED0A 4NCGA 4F0HA 2DHSA 4CDIA 1RGVA 5F0UA 3POTA 1QE1B 2FIUA 3TEHB 5HVGA 3M8WA 2R8KA 1N6QB 4RW9B 2NPIA 2KFZA 1UZHA 2QMXA 1RT7A 3J81Y 4ICLB 3PHTA 1BC6A 5I42B 2QA2A 4DR3J 2D7SA 5ETPA 2CPYA 4NLUA 1U1LA 2KRRA 3OLAA 1QUPA 3M6UA 1ZAWA 1R0AB 3Q8VA 1FRLA 1QSLA 4OZ2A 2D9OA 2PI5A 1IXKA 1X4FA 3CJSA 5IT4A 1TV6B 3BH7B 1YZ7A 3K5MA 4OYOA 4HYKA 2L08A 2PA8D 2DHXA 2L9NA 4QYZK 3MMBB 2R7SA 4EU0A 4QIGA 4C8MA 3KFWX 4F67A 4FVMA 4KGZB 3I0RA 2H65B 4X4OA 3O1LA 1U6FA 2FLOA 1SC3B 4Y00A 3E3XA 1GNKA 3DI6B 3ZZTA 3CIZA 3ADAC 5JUMA 2EXUA 4ZVUB 1WTFA 2BJ1A 4CYUA 2C3UA 5T14A 3IXQA 2OSQA 2CPFA 4ZPDA 2FVQA 1GFWB 3C16A 5CYMA 2QRRA 4UW2A 3UD4P 1S76D 4LR8A 4ATNA 4OMFG 1XBWA 3FFIB 3JTPA 1RT5A 2VQEF 2HBRB 2F4VJ 2FVCA 1YZ6A 2VFSA 2EW9A 2BJ7A 2BJEA 1HQEB 2ZBQA 1S6QB 2CPEA 3BZQA 3W64A 2AJFE 1HI1A 4C7QA 2W9BA 5KFXA 1N54B 1VQYA 3OJUA 4HI1A 4UZBA 3ZC4A 4N5SA 4OLPA 2B56A 2GPEA 4KV8B 2EVZA 3T5KA 2DRBA 4J5OA 4E8UA 3SYZA 1FFGB 5D0EA 4DPOA 3R27A 2QL9B 2YX7A 3B8HA 1PC5A 3ZZ0A 4DR1J 1R8PA 1KVIA 1AW0A 4I7FA 4DPWA 4MJWA 2N3OA 1WHVA 4ZCLA 4LFAF 3C14B 4NLYA 4O44B 3DRPB 4NOHA 2JEJA 5IV4A 2LEAA 4I6YA 1EKSA 1U8WA 2HGLA 2CJBA 1EARA 2DNRA 1KKHA 5A6PA 4N8NA 5A8KA 3DGPB 1N88A 3QZ7A 3MMAB 4P2SA 2L41A 4YY3F 1NLKL 3CJKB 3KK3B 1VRTB 3MXHP 1FKOB 1WF1A 1W25A 5D0RA 2L48A 3CC7S 3BH6B 2PGCA 4DCJB 4XO0A 1FDBA 3KHHA 2W9CA 3MEGB 1MMDA 2EEYA 3V2UC 3ULHA 3IBFB 3R2DJ 1WI6A 1S6PB 2K7KA 4YUDA 1HHQA 3OL7A 2VIHA 3HKZD 4I2QA 3ZNUA 3OUYB 4RNMA 3EJMA 1HQ2A 4XPCA 2BUNA 4U9RA 1Q95G 5CYQB 4DDFA 2R7OA 5GAHI 2EFVA 3A1YG 1YWXA 5D3GB 1IKYB 1WKJA 4LFCJ 4BWJA 1CC8A 2ZBCA 2YQ1A 1RTIB 1FCAA 3P4UB 1I94J 1UL3A 1CJTA 3WQPA 3V6JA 1ACMB 2YPYA 1YBAA 5AE3A 3N4WA 1SJFA 5L38A 4L3NA 2BNZA 3V6KA 1HD0A 1RP5A 2V2VA 3IBWA 1SKUB 3M8PB 4ZCKA 3HZGA 2YVSA 2RDDA 5KAKA 4RKUC 3TARA 2P9EA 1R31A 4IQMA 1EA4A 3LJPA 3G8TA 3NNEA 1NK6A 2B4OA 4LF5F 3RU0A 1OO0B 2VBWA 1UCNA 4PCQA 1JNRB 4F7VA 1FO1A 1NBEB 2KVIA 2HRUA 3AT1B 5DGBA 2FJAB 2UUBJ 4OI0A 2VC1A 5G0RA 2HMIB 1NK0A 3OR2A 1U02A 2BE2A 1QY7A 2RKIA 4TXSA 4A48A 1HI0P 4UQGA 1GXTA 2NXUA 2EKYA 2YKNA 3K8VA 3D28A 5HP1A 3CCSS 4WFAQ 4CIOA 2ZHBA 2B9EA 3MAHA 3O44A 2ZKUA 2CG8A 3G6YA 5HVHA 4TN2A 3NNAA 1SJ3P 2BW7A 2B4UA 4Q44A 1SKWA 3BBBA 3QATA 2ALYB 3RGIA 2P2CB 1JLBA 2XCPA 2XWXA 4M5LA 5E3PA 4QYZJ 1JLQB 3BR9A 1HIYA 2FJDB 2OFGX 4NL5A 3U7JA 2G13A 3UDEA 5KT5A 1X9SA 1MNEA 2RE1A 1AUDA 1E6VB 5IC6B 4WP3A 2HFNA 3DHXA 1NK7A 3EWGA 2XHWA 2M4MA 3HVAA 3W2WB 3HVTB 1ZA1B 2QE5A 1N32J 3PX4A 1URRA 1T94A 2FJBB 4DL2A 4O3RA 2C3MA 3H5YA 3BBCA 2MXYA 4DUTA 4C48A 2E5JA 3BYRA 5BR8F 2QL5B 4FF2A 5DG8A 2BACA 8AT1B 1KQSR 3HCXA 4URQU 2IJFA 2JFDA 2Z57B 1VC0A 1RWMB 2VHGA 2I5JA 3OJSA 3RBEA 2J5AA 3EZUA 2M2BA 5J2QB 2YH1A 1TK0A 5JJBA 2ZZMA 3CC4S 3MECA 1Q1KA 3TZXA 2YNIA 2BANB 4C0HA 1A6LA 5KFRA 3G5OA 4ZPCA 2GZOA 3A4TA 2Y1RI 5GADI 4U7UK 2I1RA 1PBAA 1X7VA 3A3PB 2KH9A 3D67A 3DRXA 4Y2KA 3TJ8A 2FC8A 3LANA 2ZH8A 2QLJB 3G82A 2BRLA 3TZWA 2JX2A 2HNYB 2OELA 1NEEA 4IOAQ 2ZH1A 2J0XA 2BOAA 1QAIA 1QTGA 4O3QA 3K0JA 1C4AA 2HW3A 6FDRA 1S72S 3KLEA 3K17A 3OV7A 3EMTA 2IBKA 4I6AA 3IN5A 4X65J 3W2VB 1WF2A 4ZP6A 2MHNA 3SIPB 2C22A 4Z37A 2IJRA 2G9OA 4MAKA 2HFOA 2OPRA 5J2MB 2KOEA 3VAMA 2BQUA 4TQRA 3MM9A 3M4XA 4FS1A 4DV5J 1ELOA 3AJDA 3OVAA 3HHLC 3C6TB 2XS2A 4DR2J 5DLGA 4ELTA 2H48B 1C0TB 4O4RA 3TX0A 1C1BA 2R7VA 2W7AA 4OYMA 4B02A 1CULB 5IT0A 4KH0B 2YNHB 2WVCA 2COLA 1KDNA 2EG2A 1IWAA 3IWLA 4ZCMA 3BKUA 3GR1A 4YN3B 2HIQA 2AIRB 2HLUA 4G1QA 1PAEX 4BS2A 2W24A 3O2IA 2XSJB 1N56A 3MR5A 4DV2F 1NHVA 3M8RA 5L1JA 1WC1A 4NYOA 1DQAA 2O01C 4A8KA 2Z2YB 4U8VA 3S1TA 1HFEL 4DL3A 1YBUA 2FZGB 4MK7A 2PDAA 1DAXA 3Q86A 2C42A 5RUBA 5KFGA 2XMWA 2WVBA 4X4PA 4ECZA 4WZMA 2F4FA 5DG9A 2NXEA 2ZD1A 3A8EA 2YKQA 1DZ5A 3UCUP 2YY3A 3MMJA 1QLNA 5F9NA 1R0CB 2NS1B 1Q7LB 1D1UA 3LF0A 3QGHA 3ILIA 4CO0A 1L3VA 1GH8A 4EBCA 2YWKA 4PG4A 3DM2A 4TYAA 1H3DA 1ZM9A 4FXEA 2MJNA 4P6QA 3QIDA 5JVHQ 4HLBA 5K8PA 1TMJA 1MG7A 1VQPS 3CO9A 5A8WA 1NPPA 3BSOA 5M2RA 1VQ5S 2XQCA 1RT6A 1FVSA 2VJUA 1SUQB 2DNHA 1A9NB 3CD6S 4A8FA 1FRXA 5DZ7A 4DG1A 2PIIA 5KFYA 3B6BA 4OJGA 2X1GA 3OFEA 3LP0B 4ER8A 2A2BA 3CJ2A 3CO0P 2MDAA 1TVRA 2G1HA 1Z2LA 5L46A 3DU6A 3MFHA 2C2ZB 2HNDA 4CLWA 2J6TA 3B4MA 2CPDA 5ETKA 2DGOA 3C3LA 2JJ4D 4NI2B 2O1PA 2C2MB 4ZPWR 4DF4A 3TAMA 3QRQA 2AHOB 2AGQA 1G7CB 1U8SA 4K7QA 3DLKB 5KFHA 2CAJA 4U7UD 4HVZA 3C66A 4KFBB 3I0SA 2DR8A 2DBBA 4O23A 2GNKA 3H42A 3QO9A 2UXBJ 2GIQA 2B51A 2ZVSA 1AZSB 4OV1A 1YRTA 2XS5A 3BKTA 1NHKL 1BQNB 2KJVA 2WOMB 2VG5B 1M5HA 3DRSA 4CO4A 6FD1A 2D3UA 3NBPA 4DUYJ 4OZJA 4F50A 5KOWA 3MZIA 3RB0A 3TX8A 3DOMB 1UWAA 4CNZA 2HNZA 2E29A 1ZYQA 4PG7A 3BM7A 1SL1A 1VI7A 4QJVA 1WG5A 3ETMA 2NSCA 5KFWA 5HI7A 3QFWA 2KELA 2MGZA 3NOGA 2WCXA 5A8RB 3D1HA 3CJQA 2CPXA 4DSIA 5I3PA 1VBZA 3BGFA 3PFEA 3I4PA 1X4EA 1RCOB 3GIKA 4LRFA 1WC6A 1RHKB 2OKQA 2VUGA 2BW2A 1W2IA 3MEDB 4CWBA 1SJRA 5B0DA 5HLFB 2DB1A 2MLXA 4P7TA 4K4SA 1IRQA 4J90A 5KG0A 2K6LA 1RTDB 4F3OA 3EGVA 5MLCV 4WJBA 3H7HB 2WB1D 2MQLA 4MMOA 2N82B 5D78A 1MYKA 5D15A 3BQ0A 1BGXT 4Y2AA 5KFQA 3CTRA 4C3LA 5ETSA 4MIBA 2MSTA 5H1SV 1RHRB 4Y6IA 2BV3A 1SQGA 2WSFC 1SI9A 2LKZA 4LF7J 3VF0B 1FJEB 1T3OA 3BF4A 4USTA 2FHOB 3Q8QB 2XGPA 2A6OA 1U6ZA 2Z2MA 3MOJB 4NCGB 1REVA 2E5LF 2CQ3A 2CPGA 4JBCA 2PFFB 2GJFA 3BYPA 2FJEB 3LGMA 2H54B 1FWLA 3QJJA 2DRDA 3Q22A 4ETXA 2VDHA 4ANEA 4ECRA 4QR1A 4GVLA 4XDDA 3OQ2A 2XZDB 1NPRA 3I5CA 4CLTA 3S01A 2V63A 2CJKA 3VGUA 2RF2B 4HHUA 4PWDA 2IDLA 4BWMA 2N4DA 5I3UA 1T05A 2C2NA 3NKYA 3O8WA 2W2MP 1KHWA 3HSGA 3M7VA 4M5GA 4K2XA 1X60A 3MI7X 1JLGA 2XMMA 9RUBA 2E7XA 2IY5B 3W5YA 2DGTA 2GX8A 3B82A 2VH7A 1NK4A 4CRJA 3P8BB 3I0RB 1F60B 2E9RX 4E98A 1RTJA 4TQSA 1BY9A 4MK9A 4OHZA 5KFOA 4DSEA 1B28A 4DR4F 4U7CA 2VG6A 4OX7A 3NGSA 2GVZA 3QMQA 1UPMB 3MWBA 2H3AA 4CYUB 1EIYB 3EUNA 2B9WA 2IBOA 1Q79A 1ZZFA 3H20A 1U1KA 3FK4A 3T1HF 1WHWA 1FNMA 3C16B 1T9TA 1H6KX 1FRIA 5I4MA 2RDIA 1OSCA 2ADLA 1VQOS 4NRUA 4RBVA 1RT5B 3RW6A 2HBYB 3HPOA 2CVIA 2WBRA 5ETTA 1S12A 3OL6A 1KQGB 1EB0A 1KQKA 2M52A 2RMLA 4YDDB 3CCMS 4B3SF 5E3AA 3SZ2A 1ZTTA 4ZVOB 2W9BB 3CCUS 3KDOA 4ELVA 4CLUA 3J7YI 5T41A 1RWXB 4KTQA 4C4WA 3QPIA 1LFPA 1N5VA 3ZTOA 1X9MA 4DR5J 2I6WA 1KNZA 2XG8A 2OAUA 2HHQA 3HI9A 4RBTA 1IM6A 5AT1B 1LW2A 4B3OA 2LLZA 1WOSA 3V4MA 2DNLA 2DD8S 1FDDA 1PSDA 4DWIA 1S9FA 1TL3A 2AP6A 3F0NA 3OBIA 2IJNA 3QBCA 3P3DA 4ECUA 3JYTA 2C1EB 4KPYA 3JSBA 1RK8A 1H2VZ 2H9ZA 1WNEA 3AD9C 2MQ8A 3I96A 3CJTA 3BS9A 5CAAA 2F1FA 1JMTA 4B3MJ 1EZZB 5HQ8A 2QYCA 1OY6A 1KD1T 2HVHA 1RBLA 4J9PA 3DU5A 2KKEA 3QT7A 3PR5B 3PW0A 4I68A 4YR3A 1VQNS 1VGYA 3IM9A 3CPWR 2CPIA 1TP7A 2Y0SD 4I2QB 3AOCA 2W4CA 5DDQC 2ZC4A 5ETVA 4GO5X 4O4GA 3G71S 2R42A 5IXUA 4P72A 2AJ1A 4EZ6A 2LVWA 1T9XA 5ETNA 1BDVA 1KHVA 5A76A 1RXOB 4M63A 2ZBIA 2IC3B 1SCJB 1CJTB 3M9OB 2IAJA 1UPPA 2V8VA 4I1TA 3IRWP 2CJAA 2UP1A 2UVUA 2MQPA 3HHEA 1HA1A 3CMES 2K1OA 3KK2A 2YKMA 1S5ZA 2FZKB 4RUAA 2GMJA 1NM2A 3MD3A 1FTRA 1AROP 4CLZA 4RX6A 5B0EA 4N7TA 3NNCA 3O6QA 2LXUA 4ZDNA 1FXRA 1SH2A 1YLXA 4UZCA 4JI5J 4CZCA 1V3ZA 3RJMB 3Q8PB 4C2MA 4ZJLA 4EK2A 3MM5B 4JI6J 1I1GA 2UXCJ 3PYGA 4HACB 4KPCA 2G0CA 4DN0A 1UVMA 1MSWD 4LJMA 4DU8A 5B0FA 4ES1A 3H98A 2VU5A 1NH7A 1RQ0A 2ZUGA 1UEUA 3JXOA 2D74B 2KT2A 3IWXA 1TKTB 3OR2B 4J9RA 1OQ3A 2FVSA 4K50A 4W90B 4Q0BA 2HURA 1JXVA 5HP1B 2F3JA 4LSNA 1SXLA 2GGPB 3VGVA 2PC6A 2UU9F 1VLOA 3FBEA 1H0HB 1JLBB 3OTOF 4YR0A 2C3PA 3EVOA 2E5HA 4XAKA 4ES3A 3A3OB 1IKXA 4ZS6A 1JWWA 3DGVA 3TUIC 1DTTA 1K1SA 2RD5C 1S1TA 1RKJA 4O3SA 2BXJA 4M1KA 1X8DA 2MKYA 2DGXA 3E51A 2BOPA 1HLWA 2AX1A 3A3NB 1Q8IA 3GSIA 4R8UA 2V4JA 1Y3KA 2IRUA 3GFYA 1KC8T 3KNAA 4EMDA 2I5JB 2DGSA 4F4ZA 4QIFA 1P94A 3L7UA 1V5IB 2E5IA 4MFBA 4OI4A 1LXJA 3MECB 1EQMA 4MYUA 1UW4A 2N7YA 3C6UA 2JSXA 1XTZA 2KTQA 3W7BA 2WK4A 2JC1A 2A6MA 4ID5B 4KY3A 2MY7A 2W2NP 3CDAA 3LTOA 1S7IA 3NP5A 3G4SS 2O67A 5DGAA 3KKFA 3MTKA 1B70B 3FSXA 2O3DA 2FHJD 1U2CA 4M5MA 4ZP9A 3ILOA 4FF3A 2JVRA 3G8SA 5HJYA 1QD1A 1HQUB 1YBTA 4FPIA 2C2OB 3NCQA 3VWSA 1JX4A 1FRKA 3BGOP 3VV2B 4YHHF 3P5BP 3W5XA 1P8GA 2VV5A 3KNGA 2CNLB 2XY6A 4OJ3A 2OEMA 2NZCA 1KLNA 4DZ6A 2QV6A 1HBOA 5CABA 2YX1A 2DNYA 1Y7PA 1FEEA 1YTYA 1CPZA 4FYVB 3MM9B 3OXLA 3TZZA 5AJ3F 4AUKA 2Y1LB 2RILA 3TRGA 1EETB 3C8YA 5FIIA 3EGZA 2WSEC 4C8OA 4X66F 3PRBA 2MKKA 2ZEJA 4KGXB 5B0CA 4GKJJ 1C1BB 3KWMA 4ZPTR 5DS7A 1SV5A 2GA7A 3D6HB 4B3TF 1RZMA 4K5SA 4G1QB 2MJUA 3T19A 1HHTP 1X31C 5EWGA 1XMQF 2VFUA 4AQYJ 3KHLA 2V5HG 2GAHC 4HL9A 1CS4B 2DCUB 2HKEA 4ES2A 2K8GA 1QE1A 4LF8F 1F9FA 4Q7AA 3L09A 4ICLA 2YXLA 4B9LA 2FLPA 5I42A 4IYQA 2HIYA 3EXYA 1FRHA 1R0AA 3RB3A 3TVYA 3EGNA 3C2PA 1RDRA 5DJBA 3GV5B 3VAJA 1M5OC 2CQPA 2H4YB 4F2SA 1Q5YA 4DCOB 2GVDA 3TO8A 1BXNA 3PJXA 2HSEB 4R5PB 1TV6A 1JJ4A 1X93A 4UOFA 1R0BG 1XN9A 3RRGA 1S0VA 1S97A 1SJQA 4A8WA 3B54A 2KO1A 2V34A 2R7WA 5LL6d 1RT2B 4TY8A 4H4MA 4C8LA 2WVEA 5IT9U 1FNOA 4C8NA 4LRVA 2P5VA 2QJ3A 4FDFA 3IRXB 2XMKA 2EFOA 2V8PA 3MMBA 2JXGA 1S57A 5F3ZA 1RBOB 4IFYB 3UCGA 1HR0F 3P5TL 2YWGA 1RT6B 2JNJA 1NMEB 1NSQA 3P45B 4W92B 1ZBTA 4LF9J 1N33F 4FYWB 5EWEA 5DO2A 4DG1B 1T11A 3DI6A 3RZAA 4UF4A 1GEHA 3BSAA 2VBZA 3PKMA 4IO9Q 4C11A 1WG4A 4NEYA 5H9FJ 2JLEA 2IMWP 3IGNA 2QA1A 3WBZA 2UXDJ 3CT9A 3DLHA 2GQQA 4ED5A 5L9NA 1OYEA 3HLUA 2HVZA 3FT7A 2W2QP 3NS5A 3F56A 2EFQA 4DV1F 2I0XA 5H9EJ 2FY1A 2ZJRQ 4ECWA 2XY5A 2WSCC 3TJ9A 3TAMB 3I5AA 3HK2A 2MLYA 4UUXA 3M2VB 3UR0A 2WRMA 2K3IA 3CC2S 2M70A 1HNWF 4Y28C 3QRRA 3SFUA 3QO9B 2ZH4A 3DOLB 4DV4J 3TR5A 2AJ2A 3HSZA 1T9WA 3RB6A 3P49B 2XMJA 2CQ1A 5AXMA 4OQJA 1X5PA 4LBHA 3DRSB 2B7CB 2RS8A 4A8SA 2GJIA 4CLYA 2RU3A 3UWTA 2IM1A 1U1PA 3HO1A 3R5CA 1S1VA 4JI3F 3MR7A 2HNZB 3H90A 3DRPA 2EWHA 4GKKJ 2MGZB 2PEHA 3GCXP 4QWAA 1DTQA 1S0OA 3KG4A 3MMAA 3IWNC 4IFVA 4NLTA 4DL7A 1F3FA 1B64A 3KK3A 1U1NA 1T8EA 4JI8F 3G8QA 5GAEU 3MEGA 2IYIA 2V69A 2ZVIA 3T1YF 2XHCA 1NDPA 3BPSP 2XULA 2EK1A 4FZVA 2X3GA 2VQFF 2YKOA 2NYIA 2LA4A 3ENVA 4LRCA 3TYTA 2KB2A 3IM8A 3JQMA 3CJ0A 2ZM6F 1VQ8S 4JV5J 4K2JA 4KKOA 1UW9A 5D3GA 7AT1B 1IKYA 3US5A 5FDLB 3GV8B 3GMGA 4LF4J 2JXHA 2H5IB 3WHIA 4I56A 3DDNA 4KHRA 2ZH5A 3VW4A 4BC9A 3RRKA 1IR0A 1IBMF 4PXCA 2DNNA 2CPJA 1R8CA 4L76A 2D3O1 2ERRA 3LAKA 1NXIA 1HNZJ 1REVB 1RWPB 2BJ9A 4JV0A 4JI0J 4PYAA 4W4MA 3TNVA 4C9DA 4GC7A 2VA3A 3HFZB 3W65A 3KHGA 2HVIA 4TKTA 2W8LA 4DR3F 2GHVC 1C0UB 4NLWA 4OX8A 1T95A 1Q82T 1TMMA 1S1XA 2G1DA 3FMBA 4HEA9 4PWDB 3KJNB 5I3UB 3IBCB 2J6UA 4N47A 4IG0B 1T05B 2KYZA 2V9KA 1WWHA 5HMZA 2AY0A 4EBEA 2ZH3A 2FJWA 3ZO7A 1M0SA 4NEZA 2CQIA 1F2HA 4DJBA 4NLSA 3W5ZA 1TAQA 1JLGB 3TQ1A 2Q1LA 2ZWOA 2PI4A 3Q2SC 2E1CA 1MN7A 4ZITA 4TNOA 1ZTWA 3I55S 3EPGA 3H25A 4ZN3A 3TP2A 1RHQB 2ZH2A 5ETOA 2DR9A 4AT1B 2GHPA 2V2ZA 5K5MA 4HTJA 2GVZB 5E3RA 1S1UB 2RDJA 3N0VA 1E6VA 3IS9B 5CHCB 1QAJA 4NLVA 1IKWA 3BDEA 5ITHA 3HVTA 2LP4A 3T5JA 3HDSA 1U0HA 1WD6A 3CB4A 4NA2A 3HFVA 4OHXA 1K47A 1MROB 5A2QU 4FYXB 1H2TZ 5G4DA 4OI2A 2K06A 3CCES 3UCZP 2OMLA 2J6SA 4FBUA 2F4VF 3TOQA 3ZZZA 3R7NB 5FLXY 2HHHJ 1UVIA 2NUHA 1JJ2R 3P96A 1LWCA 2HHWA 3NGDA 4DR7J 2V0NA 1RWVB 2DRAA 5C42B 1KFSA 2NXJA 2BANA 4JI2J 4IKAA 3J7ZT 1P6TA 3H40A 2CZVC 3ITHA 2GFFA 4B3OB 3M8ZA 4WFNQ 3PFOA 3Q0AA 3PO5A 4IH6A 4M95A 5IQQA 1FXLA 3M8SA 3D5MA 4DR1F 2HNYA 2MY8A 1TL3B 2ABYA 1R27B 4RWWA 1X4BA 3HFKA 1SPBP 2CYYA 1XR6A 3AQOA 4K4WA 4X62J 2XB2D 4RNHA 3LGNA 2V8GA 4DFJA 1X4AA 1OQ6A 4KGVB 2J0WA 3WC2A 1Y5NB 5FD1A 1XMOJ 4R0EA 3BEGB 2OP5A 2G2YA 2W7OA 3W2VA 2YQ3A 3GJRB 2CWXA 1HNVB 1RSCA 5IM0B 1Q78A 4LIRA 5J2MA 4XTTA 2DCLA 5IOLA 4GO7X 2Y9HA 1C1CB 2CQCA 1MWQA 4KQZA 1BQMA 5KTQA 4MKVA 4M5JA 3TW0A 3HSJA 1JLCA 5KG4A 3BN7A 3OXGA 3KG0A 4I2PA 5D6GA 1C0TA 3RAMA 1YVFA 4O4GB 3QAUA 2PA3A 4V19X 1CQNA 3D6TB 2DH7A 1ZM4A 5EX0A 3CD0A 2KN4A 3VHQA 1K9MT 4FYYB 3PW7A 4F26A 4EZ9A 4LFCF 2XO6A 1NB2A 4RUHA 2KT5A 2IAJB 1FJCA 2XZWA 1CBKA 1I94F 4B08A 1H73A 1RUSA 2HFZA 2Q6BA 4FF1A 3ZTQA 3N5BA 2YKMB 2Z2LA 3KUEA 4FF4A 1NK5A 1U24A 2BYCA 2MZRA 3D1QA 1OYDA 4F8RA 1HBNA 2IHR1 1KOOA 2FY8A 2YKPA 4PQAA 5F8IA 3HVRA 3CEDA 4P73A 1W7WA 3SMZA 3LAMA 3GILA 1TELA 4X4TA 1ZA2B 1L3UA 2ZOFA 3A12A 4HHJA 3KJVB 2J7KA 2UUAJ 2UUBF 1NZ8A 4HDGA 4CO2A 3MM7B 2F8MA 2DVIA 1HYSA 4NA1A 4USVA 4LSNB 2K2PA 3TWZA 1SUQA 4B9MA 2EBEA 3MFIA 3BKFA 4EI2A 3KLFA 4I69A 4Q43A 3AA9A 1YSJA 4DV6J 4N41A 3PY8A 2ZDOA 3NEKA 1IKXB 4NZ6A 4PXDA 1AT1B 1QAYA 1Z1ZA 2VF3A 1KVJA 1JXEA 1PBUA 4UY8T 3FRZA 3BBFA 2X1BA 1HKAA 1N32F 2WVDA 3EDRB 4X4RA 4DEZA 4NI2A 3DDKA 3FKBA 4Q8FA 2W4DA 3T5HA 2BM1A 3OSNA 4R8UB 2HHVA 4QWCA 3MDFA 3I9V9 3VVUA 4CCHA 4NRTA 2RUSA 2JLFA 5KG7A 3C6UB 1PJ6A 4G65A 2WOMA 2DR6A 1VCTA 3UI3A 1N5TA 1H38A 4ED6A 2CQBA 3DRRB 4CP5A 2BJDA 2NLWA 1C4CA 4UY85 1PILA 3DOMA 4PXBA 3BN4A 4C8ZA 1U1RA 4R0JA 4DQQA 3J80Y 2ROEA 3FBCA 1QJHA 4WP8A 1XR5A 4DSLA 3NXZA 4D3HA 1PYOB 2XGQA 4P9SA 1VOMA 4WFXA 1I51B 2CNKB 1M90T 4JUZA 4DPUA 2Z0GA 1FRMA 4A47A 4DUZJ 2ADCA 1F3VA 5DLFA 3SSSA 2HBQB 5DQHA 5SUHA 4X65F 1TUWA 4NYPA 5LXRA 1K1QA 5HLFA 4ZJOA 2CJYB 3W3SA 4QPXA 5K8MA 2O66A 2OPQB 3G96A 4ED7A 4QW8A 1FF2A 3VZHA 1TKDA 1RTDA 2BJ8A 3VAFA 2UV8G 1Z4UA 1S6UA 4CQ1A 3R3TA 4ZIVA 3EM1A 4ANCA 5HBMB 4DV5F 4M8LA 5C2CA 3QJLA 3MEEB 4X64J 4DR2F 3BREA 3QGPA 2FZCB 3MCOA 1M5PC 1CEZA 2G2ZA 5K14A 4J9OA 3JAMY 1CG2A 3SXLA 1FEHA 4F02A 1WSRA 4CLFA 1ZETA 3GIJA 2VA2A 5LMUJ 4V1Ak 2C2KB 4KSEB 1T0TV 2Q2KA 5EUHA 3DLBA 4LR7A 1AFJA 2YWEA 3MM6B 1RHJB 2FHJA 4LQ3A 1N34J 2ZE2B 3IP0A 2NPFA 3D0HE 1GMVA 3EZOA 3AJ1A 3NMRA 3GJQB 2ZZTA 1ZPWX 5LMNJ 1O8BA 3OTCA 4DFPA 2GVDB 3MGJA 1Q86T 4JV2A 2RF2A 4CNYA 1YRUA 1FWKA 3FRYA 2B4VA 2ASLA 1RAFB 3PG9A 1LWFB 4Y2IA 2FYXA 5DDRC 3W60A 3QGIA 3DNCA 4K59A 1H74A 3QWPA 3MR6A 1AB8A 4TY8B 4H4MB 4OLOA 5JVGQ 1RE1B 1J5EJ 2DR5A 3N6NA 4MKAA 5IQ6A 3EGWB 1JLFA 3HT0A 4LSLA 3JB9k 1DQ9A 2AYMA 2BA9A 2P8IA 4RBUA 2XI2A 1UVNA 1FI4A 1FK9A 4WKRA 5J1PA 1CJUA 2Q3PA 5D8HB 4LF6J 2DIVA 2KM8B 1LNQA 4B3RF 4WU3A 3GFHA 3L7OA 5J2NB 5JMNA 1KONA 2E9TA 5DRKA 4K0KJ 4C11B 1REGX 2HRYA 4PQUA 2Y0BB 1SKSA 3AXMA 3T5LA 2Y3YA 4DL6A 4K4XA 2X1AA 2Q66A 4DHVA 4AE5A 2IYGA 1HW9A 1P1LA 3D7SB 3DYAA 4O0IA 1Y11A 4DU7A 1RT3B 1URNA 1WKKA 1BDTA 5BJRA 3OR1A 1YJ9S 1UETA 5KG1A 1TKZB 2LU1A 2QL7B 2CAXA 2IRXA 3J81U 4KGMA 1MW7A 2VODA 3R6GB 4FYDA 4QIWD 4EBDA 2MQQA 5HATA 2OTJS 4HHHA 3KJQB 2V50A 2UZAA 3KLVA 1DFDA 4OZLA 3KMSA 2H5JB 3VVTA 2RNEA 3DKDA 4DSJA 2J8AA 1UFWA 2QT7A 4IQXA 4ED1A 1GXUA 3L95X 4B3SJ 4FNIA 3QWUA 4DUYF 4C8YA 1S1VB 5KFNA 3MUTP 3FSYA 3U27A 2M0GB 1KEKA 2HEKA 1B7FA 2NCKL 1RTZA 5ETMA 1H72C 1F9EB 1UAWA 1BAZA 2R7QA 2GS8A 2QSWA 5GAEI 2A2CA 3DHWC 1Y5LB 1S99A 1Q8KA 4RW8B 1UVLA 1DTQB 4H4KA 2JEIA 4ZP7A 1G2EA 4IFVB 4J91A 2PMZD 5T7LB 2HAIA 1S9EB 2KG1A 3C46A 4TYBA 4ZMMA 1L3SA 4Y65A 2DNKA 2R2UA 2W9AA 5CH7B 5E3QA 4MKYA 4L6V3 1CVJA 1F5AA 1FA0A 3Q23A 4DXLA 1NSPA 3EVWA 4USIA 1NSKL 3THVA 3TVKA 1TKXA 5AXKA 2JEGA 4ILRA 1LQ9A 2H51B 5KT7A 5HQMA 2BRKA 3BR8A 2RVJA 4N56A 3EE3A 4QWEA 1QTNB 2BKPA 2FD2A 4GRSA 3HSDA 2NR0A 3RAQA 5KG5A 3UQSA 4YR2A 4FXWA 4KKOB 1NUEA 1GK8A 1PO6A 1V6HA 2H3EB 3RW7A 2OHDA 4MK8A 5GMEA 5KFCA 1VQMS 1IBCB 3W8PA 2IC3A 3BSNA 3K8WA 3A8KA 1VFJA 1M5SA 3NGTA 2Y1IA 2BM0A 4QW9A 4LF7F 3CDWA 3E8OA 1JJHA 2BDPA 4B9NA 3CNQP 4WZQA 2YKAA 2IDEA 3PCOB 4ETZA 2R8JA 1IQTA 1S10A 1D09B 2P6SA 4USKA 5F41A 1O5JA 3DRYA 1ARQA 4XIUA 2HFVA 4NZ7A 3MM5A 4HACA 5D4PA 3VAGA 2JRSA 1VQ7S 3FEXB 3EYZA 1N0VC 2PE8A 1TK5A 1OHNA 1S1XB 1JIHA 2D69A 4R25A 3OFFA 4J37A 1TKTA 4ZVRB 3EX7B 3MM8B 2B8PA 2YWFA 1IN0A 4KHPJ 2PT0A 1UMJA 1DARA 2NREA 5B0BA 2IVMA 5HN0A 1WEXA 2GIFA 3QGGA 1UJ6A 2XYGB 2FTRA 5D4NA 2FGCA 2GGPA 1JB0C 2DO4A 3K5PA 5HMXA 3AOBA 4LREA 2DNZA 3PW2A 1HHSA 2ZNZA 3O3LA 2CIMA 5D0GA 1FJGJ 1RLDA 4EWTA 1YJNS 2B5JB 3G6ES 4ZLLA 1QTMA 1IKWB 2LECA 5BYQA 2OPPA 3W9JA 3V4IA 4OYXA 3UDVA 1RLCL 2PEBA 2CPZA 1VIXA 3D6FB 2AF6A 1U0HB 4K4TA 3W8GA 3SSQA 3Q24A 1YQHA 1KVKA 1OJ4A 3KLIB 2A18A 5HAOA 1D9FA 1IUJA 5KFIA 2HS4A 4ME7E 4LBPA 4LFBF 3M2RB 3IR5B 3ETOA 4FBTA 3ISND 3T9ZA 4OX6A 4YB1P 4AL5A 5DG7A 3HP6A 3TEGA 4FXVA 2FVRA 5ETLA 1LWCB 1X4GA 3JSMB 2VJVA 3FSIA 1ZAVA 2ZNYA 4L72B 4WFZA 1FX4A 3LH2S 1RAGB 2MKCA 3ZTSA 3NRBA 2RQKA 3J81j 2G0IA 5HJXA 4ID5A 3V6DB 3S8SA 2DTJA 5C24B 3ELHA 3JQJA 3ITHB 3ZZUA 1MYLA 2CNOB 5J2PA 4C0OC 3TA1A 5KFDA 2CQDA 3R7BB 4UUWA 2HWHA 4QWBA 1WSVA 1HQUA 3MCNA 1UJ5A 2LQBA 3A8IA 1TUGB 4YP3A 1NDLA 4DQIA 4M5HA 4U95A 4MTPA 1WG1A 2BX6A 3RRHA 1W2BR 1YJUA 1O51A 4H4OB 1CJKA 2G0JA 3GP9A 5HANA 2ALZA 1OIAA 3KK1A 4IG3B 3M6WA 5GAGI 1CQMA 4NLRA 2EKNA 3Q8YA 4CM2A 2PFDA 4EYIB 4G1PA 4LF2A 5LM7E 5GADU 3CIMA 2RQ4A 4JI7J 1BQMB 1AUSL 2UVRA 2XI3A 3PXGa 5KT4A 1EETA 4M5IA 5KFFA 1JLCB 2HVEA 4J9NA 1LW0A 2OSRA 5HROA 5M2UA 4I2PB 2VG7A 4NE9C 4DV7J 2APOA 2HRTA 3LO3A 3JS9A 4OYAA 2FJVA 1YITS 2E1MC 4CLKA 2V67A 2Z2ZA 4OIXA 2KJWA 5F3TA 2GO8A 1YGYA 2V68A 3F41A 1RYRA 4DLGA 2Z58B 1CS4A 3FCVA 2QLBB 4ED4A 2RRNA 1FT8A 3W62A 3BQ1A 3BV8A 3AD8C 4ENOA 3NGKA 1UTAA 1WEZA 1HBNB 4FPRA 2OH2A 2I9SA 2FPHX 1VQLS 4PWUA 1UA0A 4JI5F 4USHA 2QTWA 2BJ3A 2Y1JA 4JI6F 3OHBA 2KG0A 2UXCF 2B7BB 4R5PA 3A8JA 1B01A 3GPAA 3UDCA 2P9GA 1PG5B 3HHKA 4WK1A 4OFZA 1NJYA 4LSZB 5DETA 1XJWB 2CG4A 3K5LA 2HHXA 1RT2A 3D3CJ 2QA4G 4Y0FA 2AEMA 2LEPA 3IRXA 1HYSB 1MLAA 1JQGA 1FRJA 3KUGA 1QM9A 2NXCA 4IFYA 1T3NA 2MKHA 3TUPA 1UJ4A 1K8AT 3R5GA 2XM3A 2B8QA 2HHSA 3R2CJ 5KG6A 3SQOP 4ZIWA 3KLFB 1IBKJ 4ZJQA 1Q0NA 4HTIA 4QZVB 2MZJA 4ECTA 2GAGC 3OL8A 1U49A 4DV3F 1HWLA 2QSFA 1BWVA 2QMWA 2FGOA 3K58A 2OEJA 3S6EA 4ZP8A 1S6OA 2IM2A 5KFUA 2WHOA 3R1HA 4PUOA 1OPIA 4L75A 5F9LA 1FFSB 4G1IA 3CMAS 1ZM2A 4K4ZA 4TLQA 2RIJA 2IA6A 1U7LA 1RT1A 4OZ1A 2VICA 4F0MA 1NRKA 1BMQB 3MMCA 1PARA 4OX9J 1GXLA 1QSYA 3M2VA 2AJ0A 1XC9A 2HGMA 5KFPA 2C3YA 3PNIA 5L1KA 3SI8A 2ZOGA 3DOLA 2AU0A 2K5JA 4JI4J 2R2RA 3KG1A 2QN6B 1HARA 2AGPA 2HLTA 3IR7A 2HHPA 4MIWA 1NB7A 1B4SA 2P6TA 3RR7A 2QLXA 3THPA 3CWJA 1F0XA 4K4YA 3KLHB 1HNWJ 3FCHA 1V3SA 2YNGA 2RSQA 2GJ2A 5K8OA 4NXNF 1Q5VA 2D3OR 4M5DB 3W1YC 3ET6B 2HAFA 4Y2MA 1FNXH 4QPTA 2LQ5A 3BGRA 3MPVA 2XEXA 4LRBA 3AQPA 3I9ZA 2GO9A 4X4VA 1PYTA 3PYFA 4OYWA 2KZZA 1DY3A 3OD2A 1KN6A 3CJ4A 1IBLJ 4QIEA 4ZHRB 4WF9Q 2LXIA 4P2XA 2CNNB 4YB5A 4C3MA 1FE4A 1PYSB 2E66A 4JYAJ 2YQ0A 1HNXJ 3CUNA 3HVWA 4CT9A 2BNWA 1VHFA 3UN5A 1IKVA 3R6LB 3CCRS 2BE9B 1GTEA 5GVQA 1BWEA 1Z2ZA 2DEJA 5FDLA 4GKJF 1F9HA 2GQ2A 1HWIA 5K14B 5BYSA 2QYGA
chains in the Genus database with same CATH topology
2BJ7A 4ME7E 1EA4A 3QOQA 1Q5VA 1QTGA 3VEAA 2WVFA 2AY0A 2K29A 3VEBA 2RBFA 1NLAA 2BJ3A 2WVDA 2GPEA 2NZCA 1MNTA 2JXHA 3H87C 2FGCA 1B01A 2BA3A 2BSQE 3VW4A 2CADA 3LGHA 2KELA 1PARA 1BAZA 1P94A 3OD2A 3QSIA 1B28A 2WVBA 2Y3YA 4HV0A 1BDVA 3FT7A 3FMTA 1Q5YA 2BJ1A 2CPGA 1MYLA 2BJ9A 2K9IA 2BJ8A 2K5JA 1X93A 1U9PA 3PHTA 3GXQA 2PC6A 2CAJA 1BDTA 2CA9A 4D8JA 1ARQA 3BKFA 2BNZA 4FXEA 2WVEA 2BNWA 2CAXA 1ARRA 2H1OE 1IRQA 2K1OA 2K6LA 2WVCA 2JXIA 2F1FA 2JXGA 2HZAA 3BKUA 2HZVA 3BKTA 1MYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BJ7 A;  4ME7 E;  1EA4 A;  3QOQ A;  1Q5V A;  1QTG A;  3VEA A;  2WVF A;  2AY0 A;  2K29 A;  3VEB A;  2RBF A;  1NLA A;  2BJ3 A;  2WVD A;  2GPE A;  2NZC A;  1MNT A;  2JXH A;  3H87 C;  2FGC A;  1B01 A;  2BA3 A;  2BSQ E;  3VW4 A;  2CAD A;  3LGH A;  2KEL A;  1PAR A;  1BAZ A;  1P94 A;  3OD2 A;  3QSI A;  1B28 A;  2WVB A;  2Y3Y A;  4HV0 A;  1BDV A;  3FT7 A;  3FMT A;  1Q5Y A;  2BJ1 A;  2CPG A;  1MYL A;  2BJ9 A;  2K9I A;  2BJ8 A;  2K5J A;  1X93 A;  1U9P A;  3PHT A;  3GXQ A;  2PC6 A;  2CAJ A;  1BDT A;  2CA9 A;  4D8J A;  1ARQ A;  3BKF A;  2BNZ A;  4FXE A;  2WVE A;  2BNW A;  2CAX A;  1ARR A;  2H1O E;  1IRQ A;  2K1O A;  2K6L A;  2WVC A;  2JXI A;  2F1F A;  2JXG A;  2HZA A;  3BKU A;  2HZV A;  3BKT A;  1MYK A; 
#chains in the Genus database with same CATH topology
 3FC9 A;  3QOQ A;  2VQF J;  1KTV A;  3ZZO A;  4F4X A;  1SIW A;  4FKX A;  4EO6 A;  1IR2 A;  4ELU A;  5KFA A;  1LFW A;  3OVS A;  3R5D A;  2F5G A;  3HJF A;  2F8H A;  1NJI T;  1N5Y A;  4AQY F;  2V9W A;  3H4B A;  3VZI A;  3KHR A;  4DMZ A;  2F65 A;  1U45 A;  4QIV A;  4X4Q A;  2DGV A;  2DR7 A;  3LP1 A;  1AXQ A;  1TUV A;  5KFS A;  2IA0 A;  4WWS A;  3T3F A;  4OJH A;  4NCA A;  3BGL A;  3CCQ S;  5C25 A;  4IDK B;  3SEO A;  1SL2 A;  1C0U A;  4KB7 A;  3DLL Q;  2DGU A;  1U9P A;  4ECV A;  1HL6 A;  1N8R T;  1NAQ A;  2OTL S;  4IG0 A;  4B9U A;  4JP8 A;  2YPZ A;  3VAL A;  3AAW B;  4Q5V A;  5E7O B;  1ARR A;  2OO4 A;  1R43 A;  1RAE B;  1RYS A;  2KVQ E;  2JXI A;  4B9V A;  1OY9 A;  1MWY A;  1T9V A;  2AZ1 A;  4ZA1 A;  3M30 A;  1JLF B;  4LSL B;  1NO8 A;  5IFM A;  4A8Q A;  4P10 A;  3SDE B;  1TL1 A;  3VQS A;  1BUX A;  2E44 A;  5CXT A;  2A3J A;  1NH8 A;  1CLF A;  1FK9 B;  1CJU B;  4LF9 F;  4L74 A;  4F36 A;  1T7P A;  1UFL A;  3OL9 A;  4TU8 A;  4A8O A;  1S1U A;  1NU4 A;  3IS9 A;  3AHP A;  2DGQ A;  1VQK S;  2FUG 9;  4PQU B;  2J9D E;  4YB7 A;  3D3B J;  2FQQ B;  3U02 A;  3K89 A;  3W66 A;  5E2Q A;  2BZ2 A;  2UXD F;  2L9D A;  3LP2 A;  4OYZ A;  3M1V B;  5CCM A;  1MRO A;  1M5K C;  3U1L A;  1S77 D;  3DYA B;  1FWP A;  4J9V A;  4JI1 J;  4ZVF A;  2YNF A;  1EAY C;  1VHI A;  2EPI A;  2DXE A;  3OR1 B;  2DK2 A;  2W2P P;  3N6M A;  2AYE A;  2R2T A;  2HZA A;  4MKB A;  3L4B C;  3QYY A;  5C42 A;  4DV4 F;  1YJV A;  4U96 A;  4DV0 F;  4USJ C;  2POK A;  2X3D A;  3D2W A;  3MAA B;  5C5J A;  1G6B A;  2VON A;  4EO8 A;  2RBF A;  2LQ9 A;  1V3R A;  3FGV A;  2CUY A;  3LA0 A;  4PG6 A;  3HD1 A;  2DNP A;  2CDQ A;  4DPT A;  4WBF A;  6AT1 B;  3WX4 A;  3B4D A;  1DUR A;  4KT0 C;  4ALZ A;  5CQG A;  2IVF B;  3ZNJ 1;  2Z56 B;  1SL0 A;  4DR6 J;  4GKK F;  2ZJQ Q;  5KOX A;  1XNQ F;  3E01 B;  2D41 A;  2OPS A;  4HT5 A;  7FD1 A;  4Y2C A;  3M2U A;  1R7I A;  3J7Y U;  4RW6 B;  2KT3 A;  4WFB Q;  1HNV A;  3GQC A;  4DLE A;  3CCJ S;  5IM0 A;  5LSR A;  3KXD A;  1VIO A;  1RT4 B;  2QLW A;  5KFM A;  1C1C A;  1Y3J A;  4OI6 A;  3E2E A;  5KFJ A;  5KFE A;  3WDO A;  1MU2 B;  3DCA A;  3OTE A;  3MR3 A;  1X0F A;  5BXI A;  2VAS A;  5DQI A;  1TKX B;  2LEB A;  4DS5 A;  2R7T A;  1BLU A;  1G3O A;  4LMZ A;  3NL0 A;  2KL8 A;  3N6L A;  3MUV P;  1U1M A;  1HPZ A;  1T03 B;  5IWA J;  4RR5 A;  1VBX A;  1ZS6 A;  3BO4 A;  4JV5 F;  1MNT A;  1PAU B;  5ADZ A;  3UR3 C;  1P27 B;  4H4K C;  2R9L A;  3M9N B;  2OUG A;  3ENA A;  3LGH A;  4F2R A;  2FVP A;  4LF4 F;  3LUY A;  3ZFV A;  1S49 A;  2ZH7 A;  1B0T A;  1UZD A;  4WPA A;  2EK6 A;  2QFI A;  2FLN A;  2JWN A;  2CJX B;  2DGW A;  3ISZ A;  2Q6C A;  2W25 A;  2BVZ A;  1AA1 B;  1VBY A;  1VC5 A;  2XMV A;  3NOC A;  1JLA B;  1SC6 A;  2VFV A;  2VZ9 A;  1NDK A;  1HNZ F;  3UNY A;  1VJW A;  4JI0 F;  4KH1 B;  2HFS A;  4ZVP B;  2PMH A;  1S9G B;  1BQX A;  1JJC B;  2PN6 A;  3HX9 A;  1ITP A;  2GQC A;  2X1F A;  3GII A;  3ICL A;  4ZKA A;  3RYL A;  3FVY A;  4P2M A;  3DMJ B;  1Q8B A;  1RA7 A;  3MF5 A;  5K20 B;  1X4H A;  2WON B;  3Q8U A;  3KJV A;  3W63 A;  1RAO A;  3UD3 P;  2JEF A;  1FXD A;  1U25 A;  1TQL A;  3MM7 A;  3K2Y A;  2LMI A;  4PYD A;  3SQG B;  4NXM J;  4LUB A;  2RRA A;  1RWO B;  2VPW B;  4BBY A;  1PC4 A;  5JXS A;  1EHW A;  3W9H A;  2J9E A;  3KLG A;  4TLR A;  1Y00 A;  2KFN A;  4X4N A;  1NKC A;  5H9F K;  3PX0 A;  2ZZN A;  2B6A A;  3PYE A;  3SCL E;  1U1O A;  1YK9 A;  1T02 A;  3LOU A;  2W01 A;  4DZD A;  2F7V A;  4YS2 A;  3IO1 A;  1U0S A;  1OY8 A;  2B9X A;  2R7U A;  3CCT A;  3LWM A;  1EP4 B;  3GTY X;  4J9U E;  2R8H A;  5H9E K;  1GX6 A;  2QC3 A;  2FLL A;  3QT8 A;  2DHG A;  2OPP B;  2L9W A;  4KJI A;  3V4I B;  1XNR J;  1P9Q C;  1KS2 A;  1CJV A;  2V94 A;  3D1O A;  4ZPA A;  1P1T A;  2R8G A;  4XK8 C;  4QCL A;  2N7C A;  2HBZ B;  4NLG A;  4B9S A;  3TUZ C;  2DXF A;  1KTQ A;  2DIT A;  3BJY A;  3SCJ E;  4DSF A;  3OT9 A;  5F8N A;  1S1W B;  1MMN A;  2DH8 A;  4RPF A;  3CJ8 A;  4P7V A;  3D66 A;  2HHH F;  1IR1 A;  1IJE B;  1OSD A;  2J0S D;  5EN1 A;  1RAH B;  5E33 A;  1HMV A;  2F9D A;  3KTQ A;  4PKD B;  5MAO A;  2CAD A;  4QR2 A;  4DR7 F;  1HI8 A;  2J0Q D;  4ZOS A;  2MPU A;  1J27 A;  2ATC B;  5A0Y A;  5EX3 A;  3PJW A;  4U8Y A;  4JI2 F;  2MQM A;  3DRR A;  3QLH A;  1U48 A;  3MD1 A;  5LSO A;  5J2P B;  4WYW A;  3PZP A;  1WC5 A;  3PKY A;  3GJS B;  3JTO A;  3Q89 A;  3G6X A;  2UUC J;  1NK8 A;  4ZLP A;  4UTG A;  2YX4 A;  3D0I E;  2Q43 A;  2MQO A;  3N79 A;  3PRV A;  5IS2 A;  3H2U B;  3G2X A;  1FTC A;  2QFJ A;  4F4W A;  5KG2 A;  4X62 F;  3KJF B;  3CDB A;  1FDN A;  1J5O A;  1CJK B;  5F0W A;  1WDT A;  2AEF A;  4P75 A;  1FKA F;  1XMO F;  2F63 A;  2AJ4 A;  1K73 T;  1LWE B;  3KK1 B;  4F4Y A;  4MIA A;  3HHL B;  3JSY A;  1FD8 A;  4PAA A;  1LV5 A;  3UN3 A;  3D0G E;  2GW8 A;  2DY9 A;  2OPQ A;  4FVC A;  2YWW A;  2MHE A;  3H87 C;  4TVA B;  2VPX B;  1LK5 A;  1QDU B;  3H5U A;  3H2L A;  5HBM A;  4XDC A;  2DYA A;  4DX5 A;  1LW0 B;  4OHW A;  4AYB D;  5HRO B;  2AT1 B;  4QU7 A;  2ROG A;  3MEE A;  2VG7 B;  3NO7 A;  4B9T A;  1S0M A;  3M32 B;  3FMT A;  2M9K A;  1JLE A;  1UA1 A;  2LU2 A;  3ONQ A;  1YX2 A;  1F5B A;  3S7R A;  3FZB A;  4S0M A;  5LJ5 Y;  3I31 A;  1R89 A;  4RUC A;  4KO0 B;  1GTH A;  1UEK A;  3TZY A;  4EYH B;  3CW2 C;  1FER A;  3DLJ A;  4ZVQ B;  1H7W A;  2UV8 A;  1N36 J;  4UOC A;  4I6W A;  4ITS A;  3EIC A;  2IPO B;  5IC4 B;  3MM6 A;  1U1Q A;  1N4L A;  4IH5 A;  1IJF B;  4OYI A;  1O6X A;  1SJ4 P;  2K1R A;  2ZE2 A;  1QUV A;  1XK8 A;  1ROF A;  4DF8 A;  4L3K A;  2KHC A;  5KT2 A;  3CVK A;  1HWJ A;  1KQF B;  2MTL A;  4A46 A;  1VQ6 S;  3ENW A;  4NA3 A;  4OZ3 A;  1LWF A;  2XMU A;  4J7C A;  4WK3 A;  2CKW A;  5K8N A;  3G9C A;  1R3N A;  3I56 S;  1PGZ A;  2HHU A;  1E6Y B;  2HQ3 A;  3CCZ A;  2UUA F;  2AYG A;  3CJR A;  1X5O A;  5B7W A;  3PIO Q;  2EC0 A;  1X4C A;  2XLK A;  3W61 A;  5HO4 A;  4NCB A;  3SV4 A;  1IWG A;  7FDR A;  1I6J A;  4F3Q A;  1D0E A;  3DLE A;  4OZ0 A;  3GJT B;  2PO4 A;  1XQI A;  3M05 A;  2LDI A;  2PD1 A;  4WXW A;  3VQT A;  1ZAX A;  3T6B A;  4USM A;  3MTJ A;  3NS7 B;  2CZ9 A;  1WC4 A;  3D9B A;  3HHN B;  1KWM A;  4DV6 F;  4PR6 A;  5J2N A;  4FXD A;  1ZOT A;  3GB0 A;  1Q53 A;  3CXC R;  4KAI A;  4H54 A;  2HQF A;  3JTN A;  2AJQ A;  3MOZ A;  3UO0 A;  4DL0 C;  1N5S A;  4DFK A;  3W9I A;  3TUJ C;  5DDO C;  3TQE A;  4PUO B;  1RTH B;  2GCF A;  3THT A;  1D9A A;  1VYA A;  3GSD A;  2LQJ A;  1VRU A;  3LPY A;  1BE4 A;  3TA0 A;  1RT1 B;  1YI2 S;  1RT3 A;  1SIZ A;  3F44 A;  4WTO B;  1JKH A;  2G2O A;  5KFT A;  4B3R J;  5A6W A;  1N48 A;  3MMC B;  2IVY A;  3AA8 A;  1TKZ A;  2JBV A;  1WHY A;  4LVO P;  1SC4 B;  1OPZ A;  4RW4 B;  1L5U A;  2KYX A;  4BHQ A;  2ZBP A;  2VQE J;  2W2O P;  2Z30 B;  3IR7 B;  4WE1 A;  2DIU A;  3T41 A;  1RHU B;  1YJR A;  1VQS A;  3FZ2 A;  5HL7 Q;  1B0P A;  4WFY A;  2KXN B;  3LWL A;  3M6X A;  3QRP A;  3MR2 A;  2YNG B;  3IG1 A;  2U1A A;  2MQN A;  4Z7Y A;  2VFT A;  3D6M B;  2IMO A;  2MMY A;  3BQ2 A;  4IRC A;  2WW4 A;  3OW2 R;  3Q83 A;  1WAC A;  1KSP A;  3O5T B;  2GML A;  4RW8 A;  1WDD A;  4LR9 A;  2Z8Q A;  3PV8 A;  5B0A A;  3BGR B;  4RU9 A;  1U2F A;  4RW7 B;  1ZZN A;  5T7L A;  3G86 A;  2F8E X;  3MPD A;  1S9E A;  4ZVH A;  4RNF A;  4URG A;  2VKZ G;  2J9C A;  4DUZ F;  4LFA J;  3QSI A;  2JVO A;  4HV0 A;  2B4P A;  1RWK B;  2VL1 A;  1RU2 A;  2ADB A;  4ZVE A;  3R5A A;  4YY3 J;  4ECS A;  1MML A;  4AFF A;  1LWX A;  3NY0 A;  4O3P A;  5CZV A;  2E9Z A;  1IKV B;  2WAQ D;  3PVX A;  4X64 F;  5DQG A;  1U2R A;  2RQM A;  4KR0 B;  1D8Y A;  5J1N A;  3ILJ A;  2MKI A;  2CFX A;  3QNW B;  2XLI A;  1SIW B;  3NMA A;  2MSS A;  4HDH A;  1QAX A;  3RBX A;  1RA6 A;  5K9F A;  2ZHO A;  2I38 A;  3VGS A;  1N5Y B;  2HQD A;  4NLQ A;  5LMU F;  2OLW A;  3QJP A;  2BSQ E;  2FB0 A;  3T1A A;  1S4E A;  4I67 A;  4F4A A;  2FHK A;  1DLO A;  3LP1 B;  2IIH A;  1R8H A;  4BC7 A;  4NMX A;  4TU9 A;  2W4P A;  2LYV A;  4ILL A;  1N34 F;  3GCW P;  3AJ2 A;  3R1L A;  5C25 B;  3GR0 A;  2Z4P A;  3M8Q B;  3PRD A;  2BMB A;  3U1N A;  2VOO A;  5LMN F;  4C6A A;  3POT B;  2FJX A;  3AXK A;  1WTB A;  4C8K A;  2I8E A;  3MM8 A;  2H1O E;  2HQI A;  1ZH5 A;  1RT7 B;  3I87 A;  3RG6 A;  4J9S A;  4LF5 J;  3BSC A;  3M30 B;  1J5E F;  4A8X A;  4G6V B;  2H4W B;  5E3C A;  1AFI A;  1TL7 A;  2ZJP Q;  1TL1 B;  2V2Q A;  3MCM A;  4EUV A;  3MPY A;  4OI3 A;  1QSS A;  3DLG A;  4FNH A;  1PKU A;  3I4H X;  2DIS A;  3AOA A;  2QO3 A;  5B0G A;  2ZUA A;  1GMW D;  5DM7 Q;  4G3I A;  2EG1 A;  2MZ1 A;  4LF6 F;  1LXN A;  2B5J A;  1VK3 A;  1VQ9 S;  4E2F B;  3T6J A;  3RB4 A;  3GU0 A;  4QWD A;  4JOU A;  2LCW A;  2DT9 A;  2ZKT A;  4IRK A;  3HHL D;  5U47 A;  1DBD A;  1GX5 A;  1M5V C;  4K0K F;  4IR1 A;  1FKP A;  4Y34 A;  3C19 A;  4NYZ A;  3LP2 B;  3KLI A;  5D4L A;  2BQR A;  2MYF A;  2R8I A;  3KUH A;  1WHX A;  1FD2 A;  3M2R A;  3ENQ A;  3J7A N;  1IM4 A;  2YNF B;  1LEO A;  3QIP A;  4L73 A;  4V19 J;  2CZ4 A;  3IMQ J;  5J1E A;  3AOD A;  3D54 A;  2LQ8 A;  5DDP C;  2CWK A;  4DBQ A;  3N9U C;  1X5S A;  3OTB A;  1EJ7 L;  3JSM A;  4OHY A;  3MPU B;  1U47 A;  3NAI A;  2MZQ A;  3GYN A;  1F5C A;  5CYM B;  3V6H A;  2ILZ A;  2DJW A;  2N3L A;  3VCD A;  4AND A;  1RAJ A;  3VEA A;  1Y10 A;  5E5N A;  2BR0 A;  2B9Y A;  3CJ3 A;  5BR8 J;  2XSF A;  4DFM A;  3SV3 A;  4LFB J;  3V6D A;  2F40 A;  5EHH A;  5C24 A;  3BDP A;  2WBM A;  5HK4 A;  3IR6 B;  2E7W A;  2JL9 A;  4FKY A;  1KP6 A;  3T9N A;  5B09 A;  1HW8 A;  2VBX A;  2QMU B;  3N01 A;  1VIS A;  1U4B A;  1GAO A;  3L9Z A;  2ACM A;  4PPD A;  3HM9 A;  4CO1 A;  1VJQ A;  1RHM B;  2PSZ A;  4PG8 A;  3R8Y A;  1ICE B;  3HMJ G;  2AKW B;  5IZH A;  2VPY B;  3BPD A;  3QQC D;  3I32 A;  4QOT A;  2KHD A;  2OFH X;  3LQV A;  2FDN A;  4BDP A;  4H4O A;  1NKE A;  4X4S A;  2AD9 A;  2H5E A;  2EBG A;  2OPS B;  4JV1 A;  1KLM A;  1XMB A;  4PXE A;  3M2U B;  4IG3 A;  4NWB A;  2YTC A;  4MYT A;  2JLG A;  4RL1 A;  4I7F B;  3J7Z 5;  1M1K T;  1UWB A;  2P9C A;  1SBR A;  1TTH B;  3HT3 A;  2DH9 A;  2HWT A;  2HPU A;  2RQC A;  3JSR A;  5A8K B;  4WP9 A;  2ZHA A;  1EQ0 A;  2CQ2 A;  1U09 A;  1SC1 B;  2K29 A;  3C15 A;  1KRP A;  5KFL A;  1LKZ A;  2MEW A;  4X4U A;  4ZVG A;  1FES A;  1HPZ B;  3P6Y C;  4J9L A;  1V5V A;  3KDN A;  2V8D A;  4ED8 A;  3I82 A;  2RS2 A;  5FLX U;  3GE9 A;  1RI7 A;  3CDU A;  4I64 A;  5LXY A;  4EGL A;  2W9C B;  4F0K A;  8RUC A;  2NZ4 A;  1S0N A;  1HWK A;  3HUL A;  1RWU A;  2BKN A;  3ZZR A;  1SKR A;  1PCA A;  4LBI A;  1HNI A;  4IRD A;  1D9D A;  3MUR P;  1CSJ A;  3CDE A;  3VAH A;  2KZM A;  1T9U A;  4CLL A;  4OJ1 A;  4CO3 A;  4D8J A;  4AL6 A;  4PPZ A;  2JOQ A;  3AD7 C;  3OSP A;  2ZDP A;  2XYH B;  3MHY A;  1RB0 A;  3NAH A;  4F04 B;  1SJ1 A;  3H2V E;  4FN5 A;  3FDS A;  4DV2 J;  2VKR A;  2V4R A;  4NZ0 A;  4NLP A;  4ZPV R;  2WVF A;  2CDR B;  1F1B B;  2OJ3 A;  5D4O A;  5F8L A;  2KXF A;  4OZ5 A;  4DSK A;  3CD7 A;  5D0H A;  2V4Q A;  3K7R A;  4ECX A;  2BKO A;  3V81 A;  4USW A;  3G6V A;  3UVJ A;  4KHP F;  1R8A A;  1W26 A;  4ERD A;  4USU A;  1NJW A;  1GMU A;  4MJK A;  1TZ0 A;  3KLG B;  1MN9 A;  1TAU A;  2QEX S;  2AGO A;  5KT6 A;  2XCA A;  3X1L B;  2V6A A;  1NPK A;  2B6A B;  4NLO A;  5G0R B;  3D68 A;  2K3K A;  1OG7 A;  3DOK A;  1FJG F;  2BE2 B;  1FFW B;  2KFY A;  5KT3 A;  2RKI B;  3TAQ A;  2M8D B;  2ZH9 A;  2YKN B;  1FHT A;  3FEZ A;  5EWF A;  2AYB A;  4M5N A;  3EVM A;  3B78 A;  1CJV B;  1X9W A;  3UNG C;  4KRW A;  3EDQ B;  2JZ5 A;  3DFE A;  4WYL A;  4RJV A;  1X5T A;  5CYJ A;  1YJW S;  4K5R A;  4DI6 A;  4CLS A;  1LK7 A;  3WC0 A;  2E5G A;  2V8H A;  4DV3 J;  3R7S B;  1WOR A;  1T9Y A;  2QX0 A;  4DQR A;  1RWW B;  5L8R C;  1HBU A;  2J76 E;  4K4V A;  4PZV A;  2JHE A;  3UFC X;  5KFZ A;  2QZ8 A;  3Q8S B;  3OVB A;  4YB6 A;  3ILL A;  2CQG A;  4ZK7 M;  4C98 A;  1OS5 A;  1FJ7 A;  2WTF A;  3RAX A;  4KC5 A;  2J7W A;  1HMV B;  3CSK A;  2EFG A;  1U6B A;  5A0Y B;  1NDC A;  4DQP A;  2A0F B;  3H8Y A;  4M94 A;  1RJJ A;  3QLH B;  4U67 Q;  3HZE A;  1EX8 A;  3KLH A;  5D77 A;  2VFR A;  4M5D A;  3ET6 A;  5F8G A;  1JNZ B;  1TU0 B;  3SFG A;  3V5R A;  2HQG A;  1UFK A;  5HMY A;  4I0W A;  1NCL A;  4CTA A;  2VBY A;  2YNI B;  3BB5 A;  1KBR A;  2IM0 A;  2X51 A;  1UVJ A;  2AZ3 A;  4E0D A;  1J5O B;  1F2G A;  1HBM A;  1R6V A;  1M1H A;  2XBP A;  3RBD A;  5CD4 H;  4KE5 A;  4NLX A;  4P74 A;  5AXL A;  2ZBR A;  4NXN J;  4AAI A;  3G82 B;  1Q16 A;  1A0O B;  4AL7 A;  2W7P A;  1RAA B;  1VR6 A;  4C0B A;  4ZHR A;  4ED3 A;  1PIE A;  4FP9 A;  3QFH A;  3HD2 A;  3DXS X;  5F8J A;  4JI7 F;  1Y5I B;  3KLE B;  4XPE A;  3PO4 A;  4PAB A;  2ASJ A;  2EC2 A;  1FE0 A;  1WEY A;  4N76 A;  1I5O B;  1SVD A;  1ZM3 A;  4RNO A;  3UN2 A;  5IT9 Y;  2A2D A;  1S7H A;  5E41 A;  4DV7 F;  3CF5 Q;  1JLE B;  4X2B A;  1K44 A;  4GVB A;  1YIJ S;  4HKQ A;  2OPR B;  1ZPV A;  1Y9O A;  5HVF A;  4Q8E A;  2J8S A;  3FNN A;  3I6P A;  3RTV A;  4UQT A;  4ZCI A;  5LOQ A;  5IV3 A;  2DNQ A;  5M2P A;  4CI0 B;  3JQK A;  3FCW A;  3UE2 A;  3TI0 A;  1RIS A;  2OI2 A;  3LPE A;  1SH3 A;  4HH0 A;  1RU1 A;  2RUG A;  4YOE A;  3FEY B;  2OD6 A;  4Q2M A;  3HKW A;  3VR1 A;  4U6P A;  4K4U A;  1SQF A;  3DN9 A;  1KFD A;  3MEK A;  2Q79 A;  4C97 A;  2LFV A;  2WW8 A;  2W1B A;  1RAD B;  2XC9 A;  1YRX A;  3PEH A;  5CCL A;  1NK9 A;  2K1R B;  4IUF A;  1WC3 A;  2EI5 A;  3J80 U;  3FMW A;  4CH7 A;  3ISN C;  2VOP A;  1RWN B;  1BHN A;  5KFB A;  4IDK A;  1L3T A;  2YBV A;  3FQK A;  4KBI A;  5DZ6 A;  2E5L J;  2CQ0 A;  1EKR A;  1RBA A;  4DX6 A;  2M88 A;  4YFU A;  2ACY A;  2MB0 B;  1N6Q A;  3NGU A;  4RW9 A;  4LQ9 A;  3GIM A;  1RKI A;  5DM6 Q;  3NLC A;  4DS4 A;  1A7G E;  4ILM A;  5F8H A;  2A1B A;  2RHS B;  3R97 A;  1NSA A;  3SDE A;  2CRL A;  2CXE A;  1FVQ A;  3L3C A;  3WZ0 A;  5ETQ A;  3NWG A;  3OXF A;  4DPY A;  1TK8 A;  3DLE B;  2ZD1 B;  2QG9 B;  3PTW A;  1P9Y A;  1IBK F;  3KOA A;  3AB4 B;  3DM2 B;  3K59 A;  3GIR A;  4O3N A;  1H7X A;  2R7X A;  4URS A;  5A8W B;  5LSL A;  3JAM U;  3I5B A;  2XMA A;  1XWL A;  4N8O A;  2D1C A;  5GMK a;  3X3U A;  3CD5 A;  4WKY A;  3M1V A;  1VRU B;  2AV5 A;  2N4C A;  2ASY A;  3MCS A;  4DR4 J;  2GV1 A;  3QT6 A;  4O0N A;  3WIV A;  1JKH B;  1WF0 A;  1KOH A;  4AXJ A;  1I3O B;  2YWH A;  3AY0 A;  3GFZ A;  2DNM A;  2HG4 A;  2MZS A;  2ATL A;  3PR4 A;  4OX9 F;  1TVR B;  1N5Q A;  3T1H J;  2HK3 A;  3ZZY A;  2HND B;  4DQS A;  1S79 A;  1ULR A;  2KM8 C;  5E0O A;  1RAI B;  2UXB F;  2GMH A;  4JI4 F;  3IAM 9;  2IFX A;  4BCA A;  4NML A;  2XZT B;  3LW5 C;  2HVD A;  3BO2 A;  3FFI A;  4EFA C;  2XO7 A;  4LRA A;  4WE1 B;  1B99 A;  3MAA A;  3QSY B;  2KXH A;  2MLZ A;  4B17 A;  4OI1 A;  2XMT A;  3EXC X;  1IVZ A;  3RBZ A;  2JC0 A;  1HQE A;  2RJZ A;  3NG8 A;  1TFW A;  4FS2 A;  3NNH A;  1S6Q A;  3I0S B;  3IG1 B;  4OV6 A;  3OFG A;  1XIQ A;  1TFY A;  2WZ1 A;  1FDA A;  1Q4R A;  5HMW A;  4I4B A;  3PW5 A;  2BE7 D;  4DV0 J;  2UUW A;  2ZC3 A;  4F25 A;  4KV8 A;  4P2F A;  4NX9 A;  3DXB A;  2KU7 A;  4ZPB A;  3E01 A;  2YH0 A;  3EPI A;  2O5D A;  1YHQ S;  2OEK A;  3AH6 A;  2CJ9 A;  4RW6 A;  3NBP B;  2X7I A;  1U26 A;  2V2K A;  4HR2 A;  2DKO B;  3NCP A;  3VAI A;  1YKW A;  1MWZ A;  3C14 A;  3ZZP A;  1WEL A;  1RT4 A;  5LT5 A;  3OPK A;  2K9I A;  2RT3 A;  3GWC A;  4O44 A;  3UDL A;  3GV7 B;  1MU2 A;  2KRB A;  4A4J A;  2DHH A;  1IBL F;  4IH7 A;  4CM0 A;  4KIA A;  3MUM P;  1VQ4 S;  1XNQ J;  1NZA A;  4WU2 A;  3GG0 A;  2H1Y A;  3DGP A;  1Y4Z B;  4PWW A;  2VDI A;  2PMW A;  4JYA F;  3F73 A;  1HNX F;  1WUU A;  2CQH A;  3CJK A;  2RH3 A;  1WC0 A;  1VRT A;  1QVF R;  3GON A;  1T03 A;  1FKO A;  2VB6 A;  3AB2 B;  3MPW A;  5B08 A;  1QVG R;  1VK8 A;  1C2P A;  3PEJ A;  1S6P A;  2QLF B;  4PEO A;  3VAK A;  3HXM A;  3R5J B;  3OUY A;  4GMK A;  4BLG A;  1TL4 A;  2ROP A;  4DX7 A;  2DXD A;  1D3W A;  4IOB A;  1YDL A;  4NLD A;  3RUB L;  5CYQ A;  1JLA A;  4OL8 A;  4KYZ A;  4KGK A;  3SCK E;  1S59 A;  1S9G A;  1HD1 A;  3N28 A;  1DLO B;  2UUT A;  3SSR A;  1TR0 A;  1RTI A;  2LXF A;  2DHA A;  3DDI A;  1TL5 A;  3NS6 A;  1NND A;  2GC8 A;  5GAH U;  4C3K A;  4EEY A;  3DMJ A;  3IGV A;  3GXQ A;  4P71 A;  2Y8W A;  4HT7 A;  2XNQ A;  4ED2 A;  2E1A A;  5A2Q Y;  2J7U A;  2BBE A;  5CD4 A;  2WON A;  3M8P A;  4ZN1 A;  1R6Y A;  4WCE Q;  2AN7 A;  2NSB A;  4AXI A;  4YEA A;  1LOU A;  3SQG A;  3H4D A;  4W98 A;  2HK2 A;  3CGI A;  3PAC A;  3QT5 A;  1WOP A;  1APS A;  4ZVT B;  1RCX B;  2BEF A;  4PG5 A;  3NGR A;  2BQ3 A;  1TL7 B;  4RO0 A;  1X4D A;  5KFV A;  4RUB A;  3DLG B;  5LJ3 Y;  1NLA A;  2ZOM A;  5AE2 A;  4HH1 A;  3VGT A;  4QR0 A;  2HMI A;  1YJT A;  5C2G A;  3IAS 9;  3GYX B;  3GLJ A;  2JFK A;  1EP4 A;  1JXL A;  2R7R A;  4JB8 B;  4UT4 A;  2MKJ A;  1V9O A;  2ZFH A;  4N77 A;  2C28 A;  1BD6 A;  1YJ7 A;  3IA0 A;  4ECY A;  1FKP B;  2UU9 J;  1OMS A;  4DN9 A;  4Q45 A;  2VPZ B;  1FX2 A;  2MKS A;  4WXO A;  5AE1 A;  1VBK A;  3OTO J;  1RAC B;  3BO3 A;  1RTJ B;  1Q8L A;  4UOH A;  1JLQ A;  1RAB B;  4LVN P;  4RLE A;  3H59 A;  4JI1 F;  2VG6 B;  1S1W A;  3QIP B;  5I3Q A;  5AXN A;  2R3V A;  1WKL A;  4AD6 A;  3CUL A;  2MZT A;  5J1E B;  4MT1 A;  2OD4 A;  2ZWP A;  3M8Y A;  2I2Y A;  2HS3 A;  5L9X A;  2HGN A;  3W2W A;  2AWZ A;  3GYG A;  4DL5 A;  1B0V A;  2RHQ B;  1DRZ A;  3M9M B;  2F9J A;  2ASD A;  5BYR A;  2JH3 A;  4DR5 F;  3PW4 A;  3FUY A;  1WOO A;  1DQ8 A;  3ZTP A;  2CVE A;  4CLP A;  3HHD A;  1PJ5 A;  2NUU G;  5J2Q A;  3PDN A;  2CQ4 A;  2C2E A;  2RRB A;  3KMQ A;  2U2F A;  3HJV A;  1L3K A;  2D9P A;  1SB6 A;  2CJQ A;  2D3Z A;  1NJZ A;  4LT6 A;  2QGF B;  2E1P A;  3SCI E;  1GMW A;  3KYL A;  3IFE A;  2AX0 A;  4DR6 F;  4DPX A;  1Q7Y T;  4Z2X A;  1LWE A;  1KLM B;  4Z7C A;  4B3M F;  1LW2 B;  5SZT A;  3HHL A;  5C7P A;  3TVZ A;  5CZX A;  3RR8 A;  3A13 A;  5ETR A;  4UOG A;  3LAL A;  1UWB B;  2VD3 A;  3WX8 A;  1UP1 A;  3M6V A;  3JYT B;  1F6T A;  2DPJ A;  4YHH J;  4J9M A;  4ECQ A;  2L3M A;  1NJX A;  4DOZ A;  2DPI A;  1Y0H A;  3C15 B;  2FC9 A;  3OTD A;  3PM9 A;  3M32 A;  4Q2L A;  2RAQ A;  3UD5 A;  1NHU A;  5IWA F;  4CH1 A;  1D8Z A;  5AJ3 J;  1G1X A;  2R2S A;  2IM3 A;  4KO0 A;  4NPO A;  3TAP A;  2BAB A;  2ZH6 A;  3ZXW A;  3EZ5 A;  1HNI B;  3C6T A;  4X66 J;  5GAG U;  2K7J A;  4ZLN A;  3QZ8 A;  1N0U A;  1CC7 A;  2C2R A;  4CH0 S;  4IO1 A;  2DY1 A;  1DHM A;  1CUL A;  4B3T J;  2G4B A;  2YNH A;  2DO0 A;  3K5N A;  5EGY A;  1XMQ J;  4LIW A;  3R5B A;  3Q2T C;  4K8R A;  5HQL A;  2NQP A;  3CCV S;  1JK9 B;  2XSJ A;  4LRD A;  4LF8 J;  1OWX A;  2OGU A;  3UW1 A;  3KK2 B;  2LDY A;  2E1R A;  2RU9 A;  2J9D A;  1E6Y A;  5GMD A;  4QBU A;  3SBM A;  4RNN A;  2VC0 A;  3PHE A;  3V81 B;  1J2V A;  3UVJ B;  3PIP Q;  3PX6 A;  2KI2 A;  4NXM F;  2ZIT A;  4OYB A;  5HSP A;  2XS7 A;  3FBB A;  1VLY A;  2XLJ A;  2RB7 A;  1VDH A;  4QU6 A;  4DX8 H;  2JDJ A;  2XNR A;  3WIU A;  4A8Y A;  4ZLJ A;  3H5X A;  4PRF A;  2UVV A;  1DJ0 A;  2FHM A;  4J9Q A;  3BGU A;  2B43 A;  5CA5 A;  3OLB A;  4F4K A;  1B7Y B;  3OHA A;  4A8M P;  2SXL A;  1IQZ A;  3DOK B;  5THW A;  2WB4 A;  3GFX A;  5L1L A;  4Q0B B;  1HR0 J;  2W8K A;  3CMQ A;  4O3O A;  3K57 A;  3MAQ A;  3Q8R B;  2HHT A;  1N33 J;  3L7P A;  1RTH A;  3FQL A;  4IOC Q;  1XNR F;  1XER A;  3AFG A;  4DL4 A;  4HI2 A;  8ATC B;  4OZN A;  2QA4 S;  2KKH A;  1HBU B;  1GT8 A;  3LP0 A;  3VTI A;  4J9K A;  3J7A 1;  2E7V A;  2A10 A;  1Q81 T;  1GQE A;  3UPF A;  3IC1 A;  3GG1 A;  2BA3 A;  5KFK A;  2EFP A;  2DNG A;  1DTT B;  5EDW A;  4RZR A;  4GC6 A;  4RW4 A;  1S1T B;  2AEJ A;  3GZ7 A;  2M8H A;  4DV1 J;  4NAS A;  4QYR A;  2B0G A;  1S4F A;  4X84 A;  2Y8Y A;  1B3T A;  1KR4 A;  1X0P A;  4RU2 A;  2V4J B;  3DLK A;  2HFU A;  3NCR A;  1VC6 A;  2M7S A;  4KFB A;  1K0T A;  1UVK A;  2CA9 A;  1K0V A;  4P52 A;  3TA2 A;  3CE8 A;  4D3G A;  2C3O A;  2UUC F;  2HQC A;  4MFB B;  2GIR A;  1AZS A;  2C2D A;  3G87 A;  1UEV A;  4CTA B;  2NYH A;  5L39 A;  9ATC B;  3ZTR A;  2AMC B;  2EFN A;  1BQN A;  4TU7 A;  3K5O A;  4Y3C A;  2VG5 A;  2XTJ P;  4RW7 A;  1G4C A;  4ID8 A;  1HBM B;  5KG3 A;  1XEZ A;  3FJ2 A;  2B3T B;  3D4J A;  2HS0 A;  3H5S A;  4JI3 J;  1O0P A;  3VEB A;  2XY7 A;  4IR9 A;  1WI8 A;  1Q16 B;  2XYP B;  1M1G A;  4RWX A;  5L1I A;  1YG0 A;  2OMO A;  4TY9 A;  5A8R A;  4MH8 A;  4ZVS B;  3FBF A;  1VMB A;  4JI8 J;  2QIF A;  2M5Y A;  4OHV A;  4WTY A;  1R8B A;  2M3D A;  1HBO B;  1XR7 A;  5FJ4 A;  2IRY A;  3T1Y J;  3MED A;  2GHW A;  3R9L A;  4GVB B;  4QQB A;  2OIH A;  2HWI A;  3TJA A;  3HF5 A;  4OYP A;  2AW0 A;  3QAE A;  3CCL S;  4YQW A;  3H0P A;  3N5F A;  1S48 A;  1SQE A;  2HZC A;  2UVW A;  3TAN A;  3PJ9 A;  4WII A;  2ZM6 J;  2HZV A;  1H98 A;  4F3M A;  3NWR A;  4M5K A;  4LF1 A;  1PJ7 A;  4CO5 A;  1N36 F;  3OFH A;  1WJ9 A;  1H2U X;  4YME A;  2DEI A;  1VS3 A;  2ILY A;  3PYD A;  1NKB A;  1N52 B;  1VRQ C;  2R4F A;  4DCP B;  1SV5 B;  3CJ5 A;  2LA6 A;  1SH0 A;  4CT8 A;  2AQ4 A;  4WIQ A;  3DC2 A;  1IBM J;  3U1M A;  4YDX A;  1HWU A;  2CPH A;  1AYE A;  1UKU A;  3M8Q A;  4KHM A;  2XWY A;  2KDO A;  2HYI B;  3CCW A;  2DNO A;  5F8M A;  2NXN A;  4ED0 A;  4NCG A;  4F0H A;  2DHS A;  4CDI A;  1RGV A;  5F0U A;  3POT A;  1QE1 B;  2FIU A;  3TEH B;  5HVG A;  3M8W A;  2R8K A;  1N6Q B;  4RW9 B;  2NPI A;  2KFZ A;  1UZH A;  2QMX A;  1RT7 A;  3J81 Y;  4ICL B;  3PHT A;  1BC6 A;  5I42 B;  2QA2 A;  4DR3 J;  2D7S A;  5ETP A;  2CPY A;  4NLU A;  1U1L A;  2KRR A;  3OLA A;  1QUP A;  3M6U A;  1ZAW A;  1R0A B;  3Q8V A;  1FRL A;  1QSL A;  4OZ2 A;  2D9O A;  2PI5 A;  1IXK A;  1X4F A;  3CJS A;  5IT4 A;  1TV6 B;  3BH7 B;  1YZ7 A;  3K5M A;  4OYO A;  4HYK A;  2L08 A;  2PA8 D;  2DHX A;  2L9N A;  4QYZ K;  3MMB B;  2R7S A;  4EU0 A;  4QIG A;  4C8M A;  3KFW X;  4F67 A;  4FVM A;  4KGZ B;  3I0R A;  2H65 B;  4X4O A;  3O1L A;  1U6F A;  2FLO A;  1SC3 B;  4Y00 A;  3E3X A;  1GNK A;  3DI6 B;  3ZZT A;  3CIZ A;  3ADA C;  5JUM A;  2EXU A;  4ZVU B;  1WTF A;  2BJ1 A;  4CYU A;  2C3U A;  5T14 A;  3IXQ A;  2OSQ A;  2CPF A;  4ZPD A;  2FVQ A;  1GFW B;  3C16 A;  5CYM A;  2QRR A;  4UW2 A;  3UD4 P;  1S76 D;  4LR8 A;  4ATN A;  4OMF G;  1XBW A;  3FFI B;  3JTP A;  1RT5 A;  2VQE F;  2HBR B;  2F4V J;  2FVC A;  1YZ6 A;  2VFS A;  2EW9 A;  2BJ7 A;  2BJE A;  1HQE B;  2ZBQ A;  1S6Q B;  2CPE A;  3BZQ A;  3W64 A;  2AJF E;  1HI1 A;  4C7Q A;  2W9B A;  5KFX A;  1N54 B;  1VQY A;  3OJU A;  4HI1 A;  4UZB A;  3ZC4 A;  4N5S A;  4OLP A;  2B56 A;  2GPE A;  4KV8 B;  2EVZ A;  3T5K A;  2DRB A;  4J5O A;  4E8U A;  3SYZ A;  1FFG B;  5D0E A;  4DPO A;  3R27 A;  2QL9 B;  2YX7 A;  3B8H A;  1PC5 A;  3ZZ0 A;  4DR1 J;  1R8P A;  1KVI A;  1AW0 A;  4I7F A;  4DPW A;  4MJW A;  2N3O A;  1WHV A;  4ZCL A;  4LFA F;  3C14 B;  4NLY A;  4O44 B;  3DRP B;  4NOH A;  2JEJ A;  5IV4 A;  2LEA A;  4I6Y A;  1EKS A;  1U8W A;  2HGL A;  2CJB A;  1EAR A;  2DNR A;  1KKH A;  5A6P A;  4N8N A;  5A8K A;  3DGP B;  1N88 A;  3QZ7 A;  3MMA B;  4P2S A;  2L41 A;  4YY3 F;  1NLK L;  3CJK B;  3KK3 B;  1VRT B;  3MXH P;  1FKO B;  1WF1 A;  1W25 A;  5D0R A;  2L48 A;  3CC7 S;  3BH6 B;  2PGC A;  4DCJ B;  4XO0 A;  1FDB A;  3KHH A;  2W9C A;  3MEG B;  1MMD A;  2EEY A;  3V2U C;  3ULH A;  3IBF B;  3R2D J;  1WI6 A;  1S6P B;  2K7K A;  4YUD A;  1HHQ A;  3OL7 A;  2VIH A;  3HKZ D;  4I2Q A;  3ZNU A;  3OUY B;  4RNM A;  3EJM A;  1HQ2 A;  4XPC A;  2BUN A;  4U9R A;  1Q95 G;  5CYQ B;  4DDF A;  2R7O A;  5GAH I;  2EFV A;  3A1Y G;  1YWX A;  5D3G B;  1IKY B;  1WKJ A;  4LFC J;  4BWJ A;  1CC8 A;  2ZBC A;  2YQ1 A;  1RTI B;  1FCA A;  3P4U B;  1I94 J;  1UL3 A;  1CJT A;  3WQP A;  3V6J A;  1ACM B;  2YPY A;  1YBA A;  5AE3 A;  3N4W A;  1SJF A;  5L38 A;  4L3N A;  2BNZ A;  3V6K A;  1HD0 A;  1RP5 A;  2V2V A;  3IBW A;  1SKU B;  3M8P B;  4ZCK A;  3HZG A;  2YVS A;  2RDD A;  5KAK A;  4RKU C;  3TAR A;  2P9E A;  1R31 A;  4IQM A;  1EA4 A;  3LJP A;  3G8T A;  3NNE A;  1NK6 A;  2B4O A;  4LF5 F;  3RU0 A;  1OO0 B;  2VBW A;  1UCN A;  4PCQ A;  1JNR B;  4F7V A;  1FO1 A;  1NBE B;  2KVI A;  2HRU A;  3AT1 B;  5DGB A;  2FJA B;  2UUB J;  4OI0 A;  2VC1 A;  5G0R A;  2HMI B;  1NK0 A;  3OR2 A;  1U02 A;  2BE2 A;  1QY7 A;  2RKI A;  4TXS A;  4A48 A;  1HI0 P;  4UQG A;  1GXT A;  2NXU A;  2EKY A;  2YKN A;  3K8V A;  3D28 A;  5HP1 A;  3CCS S;  4WFA Q;  4CIO A;  2ZHB A;  2B9E A;  3MAH A;  3O44 A;  2ZKU A;  2CG8 A;  3G6Y A;  5HVH A;  4TN2 A;  3NNA A;  1SJ3 P;  2BW7 A;  2B4U A;  4Q44 A;  1SKW A;  3BBB A;  3QAT A;  2ALY B;  3RGI A;  2P2C B;  1JLB A;  2XCP A;  2XWX A;  4M5L A;  5E3P A;  4QYZ J;  1JLQ B;  3BR9 A;  1HIY A;  2FJD B;  2OFG X;  4NL5 A;  3U7J A;  2G13 A;  3UDE A;  5KT5 A;  1X9S A;  1MNE A;  2RE1 A;  1AUD A;  1E6V B;  5IC6 B;  4WP3 A;  2HFN A;  3DHX A;  1NK7 A;  3EWG A;  2XHW A;  2M4M A;  3HVA A;  3W2W B;  3HVT B;  1ZA1 B;  2QE5 A;  1N32 J;  3PX4 A;  1URR A;  1T94 A;  2FJB B;  4DL2 A;  4O3R A;  2C3M A;  3H5Y A;  3BBC A;  2MXY A;  4DUT A;  4C48 A;  2E5J A;  3BYR A;  5BR8 F;  2QL5 B;  4FF2 A;  5DG8 A;  2BAC A;  8AT1 B;  1KQS R;  3HCX A;  4URQ U;  2IJF A;  2JFD A;  2Z57 B;  1VC0 A;  1RWM B;  2VHG A;  2I5J A;  3OJS A;  3RBE A;  2J5A A;  3EZU A;  2M2B A;  5J2Q B;  2YH1 A;  1TK0 A;  5JJB A;  2ZZM A;  3CC4 S;  3MEC A;  1Q1K A;  3TZX A;  2YNI A;  2BAN B;  4C0H A;  1A6L A;  5KFR A;  3G5O A;  4ZPC A;  2GZO A;  3A4T A;  2Y1R I;  5GAD I;  4U7U K;  2I1R A;  1PBA A;  1X7V A;  3A3P B;  2KH9 A;  3D67 A;  3DRX A;  4Y2K A;  3TJ8 A;  2FC8 A;  3LAN A;  2ZH8 A;  2QLJ B;  3G82 A;  2BRL A;  3TZW A;  2JX2 A;  2HNY B;  2OEL A;  1NEE A;  4IOA Q;  2ZH1 A;  2J0X A;  2BOA A;  1QAI A;  1QTG A;  4O3Q A;  3K0J A;  1C4A A;  2HW3 A;  6FDR A;  1S72 S;  3KLE A;  3K17 A;  3OV7 A;  3EMT A;  2IBK A;  4I6A A;  3IN5 A;  4X65 J;  3W2V B;  1WF2 A;  4ZP6 A;  2MHN A;  3SIP B;  2C22 A;  4Z37 A;  2IJR A;  2G9O A;  4MAK A;  2HFO A;  2OPR A;  5J2M B;  2KOE A;  3VAM A;  2BQU A;  4TQR A;  3MM9 A;  3M4X A;  4FS1 A;  4DV5 J;  1ELO A;  3AJD A;  3OVA A;  3HHL C;  3C6T B;  2XS2 A;  4DR2 J;  5DLG A;  4ELT A;  2H48 B;  1C0T B;  4O4R A;  3TX0 A;  1C1B A;  2R7V A;  2W7A A;  4OYM A;  4B02 A;  1CUL B;  5IT0 A;  4KH0 B;  2YNH B;  2WVC A;  2COL A;  1KDN A;  2EG2 A;  1IWA A;  3IWL A;  4ZCM A;  3BKU A;  3GR1 A;  4YN3 B;  2HIQ A;  2AIR B;  2HLU A;  4G1Q A;  1PAE X;  4BS2 A;  2W24 A;  3O2I A;  2XSJ B;  1N56 A;  3MR5 A;  4DV2 F;  1NHV A;  3M8R A;  5L1J A;  1WC1 A;  4NYO A;  1DQA A;  2O01 C;  4A8K A;  2Z2Y B;  4U8V A;  3S1T A;  1HFE L;  4DL3 A;  1YBU A;  2FZG B;  4MK7 A;  2PDA A;  1DAX A;  3Q86 A;  2C42 A;  5RUB A;  5KFG A;  2XMW A;  2WVB A;  4X4P A;  4ECZ A;  4WZM A;  2F4F A;  5DG9 A;  2NXE A;  2ZD1 A;  3A8E A;  2YKQ A;  1DZ5 A;  3UCU P;  2YY3 A;  3MMJ A;  1QLN A;  5F9N A;  1R0C B;  2NS1 B;  1Q7L B;  1D1U A;  3LF0 A;  3QGH A;  3ILI A;  4CO0 A;  1L3V A;  1GH8 A;  4EBC A;  2YWK A;  4PG4 A;  3DM2 A;  4TYA A;  1H3D A;  1ZM9 A;  4FXE A;  2MJN A;  4P6Q A;  3QID A;  5JVH Q;  4HLB A;  5K8P A;  1TMJ A;  1MG7 A;  1VQP S;  3CO9 A;  5A8W A;  1NPP A;  3BSO A;  5M2R A;  1VQ5 S;  2XQC A;  1RT6 A;  1FVS A;  2VJU A;  1SUQ B;  2DNH A;  1A9N B;  3CD6 S;  4A8F A;  1FRX A;  5DZ7 A;  4DG1 A;  2PII A;  5KFY A;  3B6B A;  4OJG A;  2X1G A;  3OFE A;  3LP0 B;  4ER8 A;  2A2B A;  3CJ2 A;  3CO0 P;  2MDA A;  1TVR A;  2G1H A;  1Z2L A;  5L46 A;  3DU6 A;  3MFH A;  2C2Z B;  2HND A;  4CLW A;  2J6T A;  3B4M A;  2CPD A;  5ETK A;  2DGO A;  3C3L A;  2JJ4 D;  4NI2 B;  2O1P A;  2C2M B;  4ZPW R;  4DF4 A;  3TAM A;  3QRQ A;  2AHO B;  2AGQ A;  1G7C B;  1U8S A;  4K7Q A;  3DLK B;  5KFH A;  2CAJ A;  4U7U D;  4HVZ A;  3C66 A;  4KFB B;  3I0S A;  2DR8 A;  2DBB A;  4O23 A;  2GNK A;  3H42 A;  3QO9 A;  2UXB J;  2GIQ A;  2B51 A;  2ZVS A;  1AZS B;  4OV1 A;  1YRT A;  2XS5 A;  3BKT A;  1NHK L;  1BQN B;  2KJV A;  2WOM B;  2VG5 B;  1M5H A;  3DRS A;  4CO4 A;  6FD1 A;  2D3U A;  3NBP A;  4DUY J;  4OZJ A;  4F50 A;  5KOW A;  3MZI A;  3RB0 A;  3TX8 A;  3DOM B;  1UWA A;  4CNZ A;  2HNZ A;  2E29 A;  1ZYQ A;  4PG7 A;  3BM7 A;  1SL1 A;  1VI7 A;  4QJV A;  1WG5 A;  3ETM A;  2NSC A;  5KFW A;  5HI7 A;  3QFW A;  2KEL A;  2MGZ A;  3NOG A;  2WCX A;  5A8R B;  3D1H A;  3CJQ A;  2CPX A;  4DSI A;  5I3P A;  1VBZ A;  3BGF A;  3PFE A;  3I4P A;  1X4E A;  1RCO B;  3GIK A;  4LRF A;  1WC6 A;  1RHK B;  2OKQ A;  2VUG A;  2BW2 A;  1W2I A;  3MED B;  4CWB A;  1SJR A;  5B0D A;  5HLF B;  2DB1 A;  2MLX A;  4P7T A;  4K4S A;  1IRQ A;  4J90 A;  5KG0 A;  2K6L A;  1RTD B;  4F3O A;  3EGV A;  5MLC V;  4WJB A;  3H7H B;  2WB1 D;  2MQL A;  4MMO A;  2N82 B;  5D78 A;  1MYK A;  5D15 A;  3BQ0 A;  1BGX T;  4Y2A A;  5KFQ A;  3CTR A;  4C3L A;  5ETS A;  4MIB A;  2MST A;  5H1S V;  1RHR B;  4Y6I A;  2BV3 A;  1SQG A;  2WSF C;  1SI9 A;  2LKZ A;  4LF7 J;  3VF0 B;  1FJE B;  1T3O A;  3BF4 A;  4UST A;  2FHO B;  3Q8Q B;  2XGP A;  2A6O A;  1U6Z A;  2Z2M A;  3MOJ B;  4NCG B;  1REV A;  2E5L F;  2CQ3 A;  2CPG A;  4JBC A;  2PFF B;  2GJF A;  3BYP A;  2FJE B;  3LGM A;  2H54 B;  1FWL A;  3QJJ A;  2DRD A;  3Q22 A;  4ETX A;  2VDH A;  4ANE A;  4ECR A;  4QR1 A;  4GVL A;  4XDD A;  3OQ2 A;  2XZD B;  1NPR A;  3I5C A;  4CLT A;  3S01 A;  2V63 A;  2CJK A;  3VGU A;  2RF2 B;  4HHU A;  4PWD A;  2IDL A;  4BWM A;  2N4D A;  5I3U A;  1T05 A;  2C2N A;  3NKY A;  3O8W A;  2W2M P;  1KHW A;  3HSG A;  3M7V A;  4M5G A;  4K2X A;  1X60 A;  3MI7 X;  1JLG A;  2XMM A;  9RUB A;  2E7X A;  2IY5 B;  3W5Y A;  2DGT A;  2GX8 A;  3B82 A;  2VH7 A;  1NK4 A;  4CRJ A;  3P8B B;  3I0R B;  1F60 B;  2E9R X;  4E98 A;  1RTJ A;  4TQS A;  1BY9 A;  4MK9 A;  4OHZ A;  5KFO A;  4DSE A;  1B28 A;  4DR4 F;  4U7C A;  2VG6 A;  4OX7 A;  3NGS A;  2GVZ A;  3QMQ A;  1UPM B;  3MWB A;  2H3A A;  4CYU B;  1EIY B;  3EUN A;  2B9W A;  2IBO A;  1Q79 A;  1ZZF A;  3H20 A;  1U1K A;  3FK4 A;  3T1H F;  1WHW A;  1FNM A;  3C16 B;  1T9T A;  1H6K X;  1FRI A;  5I4M A;  2RDI A;  1OSC A;  2ADL A;  1VQO S;  4NRU A;  4RBV A;  1RT5 B;  3RW6 A;  2HBY B;  3HPO A;  2CVI A;  2WBR A;  5ETT A;  1S12 A;  3OL6 A;  1KQG B;  1EB0 A;  1KQK A;  2M52 A;  2RML A;  4YDD B;  3CCM S;  4B3S F;  5E3A A;  3SZ2 A;  1ZTT A;  4ZVO B;  2W9B B;  3CCU S;  3KDO A;  4ELV A;  4CLU A;  3J7Y I;  5T41 A;  1RWX B;  4KTQ A;  4C4W A;  3QPI A;  1LFP A;  1N5V A;  3ZTO A;  1X9M A;  4DR5 J;  2I6W A;  1KNZ A;  2XG8 A;  2OAU A;  2HHQ A;  3HI9 A;  4RBT A;  1IM6 A;  5AT1 B;  1LW2 A;  4B3O A;  2LLZ A;  1WOS A;  3V4M A;  2DNL A;  2DD8 S;  1FDD A;  1PSD A;  4DWI A;  1S9F A;  1TL3 A;  2AP6 A;  3F0N A;  3OBI A;  2IJN A;  3QBC A;  3P3D A;  4ECU A;  3JYT A;  2C1E B;  4KPY A;  3JSB A;  1RK8 A;  1H2V Z;  2H9Z A;  1WNE A;  3AD9 C;  2MQ8 A;  3I96 A;  3CJT A;  3BS9 A;  5CAA A;  2F1F A;  1JMT A;  4B3M J;  1EZZ B;  5HQ8 A;  2QYC A;  1OY6 A;  1KD1 T;  2HVH A;  1RBL A;  4J9P A;  3DU5 A;  2KKE A;  3QT7 A;  3PR5 B;  3PW0 A;  4I68 A;  4YR3 A;  1VQN S;  1VGY A;  3IM9 A;  3CPW R;  2CPI A;  1TP7 A;  2Y0S D;  4I2Q B;  3AOC A;  2W4C A;  5DDQ C;  2ZC4 A;  5ETV A;  4GO5 X;  4O4G A;  3G71 S;  2R42 A;  5IXU A;  4P72 A;  2AJ1 A;  4EZ6 A;  2LVW A;  1T9X A;  5ETN A;  1BDV A;  1KHV A;  5A76 A;  1RXO B;  4M63 A;  2ZBI A;  2IC3 B;  1SCJ B;  1CJT B;  3M9O B;  2IAJ A;  1UPP A;  2V8V A;  4I1T A;  3IRW P;  2CJA A;  2UP1 A;  2UVU A;  2MQP A;  3HHE A;  1HA1 A;  3CME S;  2K1O A;  3KK2 A;  2YKM A;  1S5Z A;  2FZK B;  4RUA A;  2GMJ A;  1NM2 A;  3MD3 A;  1FTR A;  1ARO P;  4CLZ A;  4RX6 A;  5B0E A;  4N7T A;  3NNC A;  3O6Q A;  2LXU A;  4ZDN A;  1FXR A;  1SH2 A;  1YLX A;  4UZC A;  4JI5 J;  4CZC A;  1V3Z A;  3RJM B;  3Q8P B;  4C2M A;  4ZJL A;  4EK2 A;  3MM5 B;  4JI6 J;  1I1G A;  2UXC J;  3PYG A;  4HAC B;  4KPC A;  2G0C A;  4DN0 A;  1UVM A;  1MSW D;  4LJM A;  4DU8 A;  5B0F A;  4ES1 A;  3H98 A;  2VU5 A;  1NH7 A;  1RQ0 A;  2ZUG A;  1UEU A;  3JXO A;  2D74 B;  2KT2 A;  3IWX A;  1TKT B;  3OR2 B;  4J9R A;  1OQ3 A;  2FVS A;  4K50 A;  4W90 B;  4Q0B A;  2HUR A;  1JXV A;  5HP1 B;  2F3J A;  4LSN A;  1SXL A;  2GGP B;  3VGV A;  2PC6 A;  2UU9 F;  1VLO A;  3FBE A;  1H0H B;  1JLB B;  3OTO F;  4YR0 A;  2C3P A;  3EVO A;  2E5H A;  4XAK A;  4ES3 A;  3A3O B;  1IKX A;  4ZS6 A;  1JWW A;  3DGV A;  3TUI C;  1DTT A;  1K1S A;  2RD5 C;  1S1T A;  1RKJ A;  4O3S A;  2BXJ A;  4M1K A;  1X8D A;  2MKY A;  2DGX A;  3E51 A;  2BOP A;  1HLW A;  2AX1 A;  3A3N B;  1Q8I A;  3GSI A;  4R8U A;  2V4J A;  1Y3K A;  2IRU A;  3GFY A;  1KC8 T;  3KNA A;  4EMD A;  2I5J B;  2DGS A;  4F4Z A;  4QIF A;  1P94 A;  3L7U A;  1V5I B;  2E5I A;  4MFB A;  4OI4 A;  1LXJ A;  3MEC B;  1EQM A;  4MYU A;  1UW4 A;  2N7Y A;  3C6U A;  2JSX A;  1XTZ A;  2KTQ A;  3W7B A;  2WK4 A;  2JC1 A;  2A6M A;  4ID5 B;  4KY3 A;  2MY7 A;  2W2N P;  3CDA A;  3LTO A;  1S7I A;  3NP5 A;  3G4S S;  2O67 A;  5DGA A;  3KKF A;  3MTK A;  1B70 B;  3FSX A;  2O3D A;  2FHJ D;  1U2C A;  4M5M A;  4ZP9 A;  3ILO A;  4FF3 A;  2JVR A;  3G8S A;  5HJY A;  1QD1 A;  1HQU B;  1YBT A;  4FPI A;  2C2O B;  3NCQ A;  3VWS A;  1JX4 A;  1FRK A;  3BGO P;  3VV2 B;  4YHH F;  3P5B P;  3W5X A;  1P8G A;  2VV5 A;  3KNG A;  2CNL B;  2XY6 A;  4OJ3 A;  2OEM A;  2NZC A;  1KLN A;  4DZ6 A;  2QV6 A;  1HBO A;  5CAB A;  2YX1 A;  2DNY A;  1Y7P A;  1FEE A;  1YTY A;  1CPZ A;  4FYV B;  3MM9 B;  3OXL A;  3TZZ A;  5AJ3 F;  4AUK A;  2Y1L B;  2RIL A;  3TRG A;  1EET B;  3C8Y A;  5FII A;  3EGZ A;  2WSE C;  4C8O A;  4X66 F;  3PRB A;  2MKK A;  2ZEJ A;  4KGX B;  5B0C A;  4GKJ J;  1C1B B;  3KWM A;  4ZPT R;  5DS7 A;  1SV5 A;  2GA7 A;  3D6H B;  4B3T F;  1RZM A;  4K5S A;  4G1Q B;  2MJU A;  3T19 A;  1HHT P;  1X31 C;  5EWG A;  1XMQ F;  2VFU A;  4AQY J;  3KHL A;  2V5H G;  2GAH C;  4HL9 A;  1CS4 B;  2DCU B;  2HKE A;  4ES2 A;  2K8G A;  1QE1 A;  4LF8 F;  1F9F A;  4Q7A A;  3L09 A;  4ICL A;  2YXL A;  4B9L A;  2FLP A;  5I42 A;  4IYQ A;  2HIY A;  3EXY A;  1FRH A;  1R0A A;  3RB3 A;  3TVY A;  3EGN A;  3C2P A;  1RDR A;  5DJB A;  3GV5 B;  3VAJ A;  1M5O C;  2CQP A;  2H4Y B;  4F2S A;  1Q5Y A;  4DCO B;  2GVD A;  3TO8 A;  1BXN A;  3PJX A;  2HSE B;  4R5P B;  1TV6 A;  1JJ4 A;  1X93 A;  4UOF A;  1R0B G;  1XN9 A;  3RRG A;  1S0V A;  1S97 A;  1SJQ A;  4A8W A;  3B54 A;  2KO1 A;  2V34 A;  2R7W A;  5LL6 d;  1RT2 B;  4TY8 A;  4H4M A;  4C8L A;  2WVE A;  5IT9 U;  1FNO A;  4C8N A;  4LRV A;  2P5V A;  2QJ3 A;  4FDF A;  3IRX B;  2XMK A;  2EFO A;  2V8P A;  3MMB A;  2JXG A;  1S57 A;  5F3Z A;  1RBO B;  4IFY B;  3UCG A;  1HR0 F;  3P5T L;  2YWG A;  1RT6 B;  2JNJ A;  1NME B;  1NSQ A;  3P45 B;  4W92 B;  1ZBT A;  4LF9 J;  1N33 F;  4FYW B;  5EWE A;  5DO2 A;  4DG1 B;  1T11 A;  3DI6 A;  3RZA A;  4UF4 A;  1GEH A;  3BSA A;  2VBZ A;  3PKM A;  4IO9 Q;  4C11 A;  1WG4 A;  4NEY A;  5H9F J;  2JLE A;  2IMW P;  3IGN A;  2QA1 A;  3WBZ A;  2UXD J;  3CT9 A;  3DLH A;  2GQQ A;  4ED5 A;  5L9N A;  1OYE A;  3HLU A;  2HVZ A;  3FT7 A;  2W2Q P;  3NS5 A;  3F56 A;  2EFQ A;  4DV1 F;  2I0X A;  5H9E J;  2FY1 A;  2ZJR Q;  4ECW A;  2XY5 A;  2WSC C;  3TJ9 A;  3TAM B;  3I5A A;  3HK2 A;  2MLY A;  4UUX A;  3M2V B;  3UR0 A;  2WRM A;  2K3I A;  3CC2 S;  2M70 A;  1HNW F;  4Y28 C;  3QRR A;  3SFU A;  3QO9 B;  2ZH4 A;  3DOL B;  4DV4 J;  3TR5 A;  2AJ2 A;  3HSZ A;  1T9W A;  3RB6 A;  3P49 B;  2XMJ A;  2CQ1 A;  5AXM A;  4OQJ A;  1X5P A;  4LBH A;  3DRS B;  2B7C B;  2RS8 A;  4A8S A;  2GJI A;  4CLY A;  2RU3 A;  3UWT A;  2IM1 A;  1U1P A;  3HO1 A;  3R5C A;  1S1V A;  4JI3 F;  3MR7 A;  2HNZ B;  3H90 A;  3DRP A;  2EWH A;  4GKK J;  2MGZ B;  2PEH A;  3GCX P;  4QWA A;  1DTQ A;  1S0O A;  3KG4 A;  3MMA A;  3IWN C;  4IFV A;  4NLT A;  4DL7 A;  1F3F A;  1B64 A;  3KK3 A;  1U1N A;  1T8E A;  4JI8 F;  3G8Q A;  5GAE U;  3MEG A;  2IYI A;  2V69 A;  2ZVI A;  3T1Y F;  2XHC A;  1NDP A;  3BPS P;  2XUL A;  2EK1 A;  4FZV A;  2X3G A;  2VQF F;  2YKO A;  2NYI A;  2LA4 A;  3ENV A;  4LRC A;  3TYT A;  2KB2 A;  3IM8 A;  3JQM A;  3CJ0 A;  2ZM6 F;  1VQ8 S;  4JV5 J;  4K2J A;  4KKO A;  1UW9 A;  5D3G A;  7AT1 B;  1IKY A;  3US5 A;  5FDL B;  3GV8 B;  3GMG A;  4LF4 J;  2JXH A;  2H5I B;  3WHI A;  4I56 A;  3DDN A;  4KHR A;  2ZH5 A;  3VW4 A;  4BC9 A;  3RRK A;  1IR0 A;  1IBM F;  4PXC A;  2DNN A;  2CPJ A;  1R8C A;  4L76 A;  2D3O 1;  2ERR A;  3LAK A;  1NXI A;  1HNZ J;  1REV B;  1RWP B;  2BJ9 A;  4JV0 A;  4JI0 J;  4PYA A;  4W4M A;  3TNV A;  4C9D A;  4GC7 A;  2VA3 A;  3HFZ B;  3W65 A;  3KHG A;  2HVI A;  4TKT A;  2W8L A;  4DR3 F;  2GHV C;  1C0U B;  4NLW A;  4OX8 A;  1T95 A;  1Q82 T;  1TMM A;  1S1X A;  2G1D A;  3FMB A;  4HEA 9;  4PWD B;  3KJN B;  5I3U B;  3IBC B;  2J6U A;  4N47 A;  4IG0 B;  1T05 B;  2KYZ A;  2V9K A;  1WWH A;  5HMZ A;  2AY0 A;  4EBE A;  2ZH3 A;  2FJW A;  3ZO7 A;  1M0S A;  4NEZ A;  2CQI A;  1F2H A;  4DJB A;  4NLS A;  3W5Z A;  1TAQ A;  1JLG B;  3TQ1 A;  2Q1L A;  2ZWO A;  2PI4 A;  3Q2S C;  2E1C A;  1MN7 A;  4ZIT A;  4TNO A;  1ZTW A;  3I55 S;  3EPG A;  3H25 A;  4ZN3 A;  3TP2 A;  1RHQ B;  2ZH2 A;  5ETO A;  2DR9 A;  4AT1 B;  2GHP A;  2V2Z A;  5K5M A;  4HTJ A;  2GVZ B;  5E3R A;  1S1U B;  2RDJ A;  3N0V A;  1E6V A;  3IS9 B;  5CHC B;  1QAJ A;  4NLV A;  1IKW A;  3BDE A;  5ITH A;  3HVT A;  2LP4 A;  3T5J A;  3HDS A;  1U0H A;  1WD6 A;  3CB4 A;  4NA2 A;  3HFV A;  4OHX A;  1K47 A;  1MRO B;  5A2Q U;  4FYX B;  1H2T Z;  5G4D A;  4OI2 A;  2K06 A;  3CCE S;  3UCZ P;  2OML A;  2J6S A;  4FBU A;  2F4V F;  3TOQ A;  3ZZZ A;  3R7N B;  5FLX Y;  2HHH J;  1UVI A;  2NUH A;  1JJ2 R;  3P96 A;  1LWC A;  2HHW A;  3NGD A;  4DR7 J;  2V0N A;  1RWV B;  2DRA A;  5C42 B;  1KFS A;  2NXJ A;  2BAN A;  4JI2 J;  4IKA A;  3J7Z T;  1P6T A;  3H40 A;  2CZV C;  3ITH A;  2GFF A;  4B3O B;  3M8Z A;  4WFN Q;  3PFO A;  3Q0A A;  3PO5 A;  4IH6 A;  4M95 A;  5IQQ A;  1FXL A;  3M8S A;  3D5M A;  4DR1 F;  2HNY A;  2MY8 A;  1TL3 B;  2ABY A;  1R27 B;  4RWW A;  1X4B A;  3HFK A;  1SPB P;  2CYY A;  1XR6 A;  3AQO A;  4K4W A;  4X62 J;  2XB2 D;  4RNH A;  3LGN A;  2V8G A;  4DFJ A;  1X4A A;  1OQ6 A;  4KGV B;  2J0W A;  3WC2 A;  1Y5N B;  5FD1 A;  1XMO J;  4R0E A;  3BEG B;  2OP5 A;  2G2Y A;  2W7O A;  3W2V A;  2YQ3 A;  3GJR B;  2CWX A;  1HNV B;  1RSC A;  5IM0 B;  1Q78 A;  4LIR A;  5J2M A;  4XTT A;  2DCL A;  5IOL A;  4GO7 X;  2Y9H A;  1C1C B;  2CQC A;  1MWQ A;  4KQZ A;  1BQM A;  5KTQ A;  4MKV A;  4M5J A;  3TW0 A;  3HSJ A;  1JLC A;  5KG4 A;  3BN7 A;  3OXG A;  3KG0 A;  4I2P A;  5D6G A;  1C0T A;  3RAM A;  1YVF A;  4O4G B;  3QAU A;  2PA3 A;  4V19 X;  1CQN A;  3D6T B;  2DH7 A;  1ZM4 A;  5EX0 A;  3CD0 A;  2KN4 A;  3VHQ A;  1K9M T;  4FYY B;  3PW7 A;  4F26 A;  4EZ9 A;  4LFC F;  2XO6 A;  1NB2 A;  4RUH A;  2KT5 A;  2IAJ B;  1FJC A;  2XZW A;  1CBK A;  1I94 F;  4B08 A;  1H73 A;  1RUS A;  2HFZ A;  2Q6B A;  4FF1 A;  3ZTQ A;  3N5B A;  2YKM B;  2Z2L A;  3KUE A;  4FF4 A;  1NK5 A;  1U24 A;  2BYC A;  2MZR A;  3D1Q A;  1OYD A;  4F8R A;  1HBN A;  2IHR 1;  1KOO A;  2FY8 A;  2YKP A;  4PQA A;  5F8I A;  3HVR A;  3CED A;  4P73 A;  1W7W A;  3SMZ A;  3LAM A;  3GIL A;  1TEL A;  4X4T A;  1ZA2 B;  1L3U A;  2ZOF A;  3A12 A;  4HHJ A;  3KJV B;  2J7K A;  2UUA J;  2UUB F;  1NZ8 A;  4HDG A;  4CO2 A;  3MM7 B;  2F8M A;  2DVI A;  1HYS A;  4NA1 A;  4USV A;  4LSN B;  2K2P A;  3TWZ A;  1SUQ A;  4B9M A;  2EBE A;  3MFI A;  3BKF A;  4EI2 A;  3KLF A;  4I69 A;  4Q43 A;  3AA9 A;  1YSJ A;  4DV6 J;  4N41 A;  3PY8 A;  2ZDO A;  3NEK A;  1IKX B;  4NZ6 A;  4PXD A;  1AT1 B;  1QAY A;  1Z1Z A;  2VF3 A;  1KVJ A;  1JXE A;  1PBU A;  4UY8 T;  3FRZ A;  3BBF A;  2X1B A;  1HKA A;  1N32 F;  2WVD A;  3EDR B;  4X4R A;  4DEZ A;  4NI2 A;  3DDK A;  3FKB A;  4Q8F A;  2W4D A;  3T5H A;  2BM1 A;  3OSN A;  4R8U B;  2HHV A;  4QWC A;  3MDF A;  3I9V 9;  3VVU A;  4CCH A;  4NRT A;  2RUS A;  2JLF A;  5KG7 A;  3C6U B;  1PJ6 A;  4G65 A;  2WOM A;  2DR6 A;  1VCT A;  3UI3 A;  1N5T A;  1H38 A;  4ED6 A;  2CQB A;  3DRR B;  4CP5 A;  2BJD A;  2NLW A;  1C4C A;  4UY8 5;  1PIL A;  3DOM A;  4PXB A;  3BN4 A;  4C8Z A;  1U1R A;  4R0J A;  4DQQ A;  3J80 Y;  2ROE A;  3FBC A;  1QJH A;  4WP8 A;  1XR5 A;  4DSL A;  3NXZ A;  4D3H A;  1PYO B;  2XGQ A;  4P9S A;  1VOM A;  4WFX A;  1I51 B;  2CNK B;  1M90 T;  4JUZ A;  4DPU A;  2Z0G A;  1FRM A;  4A47 A;  4DUZ J;  2ADC A;  1F3V A;  5DLF A;  3SSS A;  2HBQ B;  5DQH A;  5SUH A;  4X65 F;  1TUW A;  4NYP A;  5LXR A;  1K1Q A;  5HLF A;  4ZJO A;  2CJY B;  3W3S A;  4QPX A;  5K8M A;  2O66 A;  2OPQ B;  3G96 A;  4ED7 A;  4QW8 A;  1FF2 A;  3VZH A;  1TKD A;  1RTD A;  2BJ8 A;  3VAF A;  2UV8 G;  1Z4U A;  1S6U A;  4CQ1 A;  3R3T A;  4ZIV A;  3EM1 A;  4ANC A;  5HBM B;  4DV5 F;  4M8L A;  5C2C A;  3QJL A;  3MEE B;  4X64 J;  4DR2 F;  3BRE A;  3QGP A;  2FZC B;  3MCO A;  1M5P C;  1CEZ A;  2G2Z A;  5K14 A;  4J9O A;  3JAM Y;  1CG2 A;  3SXL A;  1FEH A;  4F02 A;  1WSR A;  4CLF A;  1ZET A;  3GIJ A;  2VA2 A;  5LMU J;  4V1A k;  2C2K B;  4KSE B;  1T0T V;  2Q2K A;  5EUH A;  3DLB A;  4LR7 A;  1AFJ A;  2YWE A;  3MM6 B;  1RHJ B;  2FHJ A;  4LQ3 A;  1N34 J;  2ZE2 B;  3IP0 A;  2NPF A;  3D0H E;  1GMV A;  3EZO A;  3AJ1 A;  3NMR A;  3GJQ B;  2ZZT A;  1ZPW X;  5LMN J;  1O8B A;  3OTC A;  4DFP A;  2GVD B;  3MGJ A;  1Q86 T;  4JV2 A;  2RF2 A;  4CNY A;  1YRU A;  1FWK A;  3FRY A;  2B4V A;  2ASL A;  1RAF B;  3PG9 A;  1LWF B;  4Y2I A;  2FYX A;  5DDR C;  3W60 A;  3QGI A;  3DNC A;  4K59 A;  1H74 A;  3QWP A;  3MR6 A;  1AB8 A;  4TY8 B;  4H4M B;  4OLO A;  5JVG Q;  1RE1 B;  1J5E J;  2DR5 A;  3N6N A;  4MKA A;  5IQ6 A;  3EGW B;  1JLF A;  3HT0 A;  4LSL A;  3JB9 k;  1DQ9 A;  2AYM A;  2BA9 A;  2P8I A;  4RBU A;  2XI2 A;  1UVN A;  1FI4 A;  1FK9 A;  4WKR A;  5J1P A;  1CJU A;  2Q3P A;  5D8H B;  4LF6 J;  2DIV A;  2KM8 B;  1LNQ A;  4B3R F;  4WU3 A;  3GFH A;  3L7O A;  5J2N B;  5JMN A;  1KON A;  2E9T A;  5DRK A;  4K0K J;  4C11 B;  1REG X;  2HRY A;  4PQU A;  2Y0B B;  1SKS A;  3AXM A;  3T5L A;  2Y3Y A;  4DL6 A;  4K4X A;  2X1A A;  2Q66 A;  4DHV A;  4AE5 A;  2IYG A;  1HW9 A;  1P1L A;  3D7S B;  3DYA A;  4O0I A;  1Y11 A;  4DU7 A;  1RT3 B;  1URN A;  1WKK A;  1BDT A;  5BJR A;  3OR1 A;  1YJ9 S;  1UET A;  5KG1 A;  1TKZ B;  2LU1 A;  2QL7 B;  2CAX A;  2IRX A;  3J81 U;  4KGM A;  1MW7 A;  2VOD A;  3R6G B;  4FYD A;  4QIW D;  4EBD A;  2MQQ A;  5HAT A;  2OTJ S;  4HHH A;  3KJQ B;  2V50 A;  2UZA A;  3KLV A;  1DFD A;  4OZL A;  3KMS A;  2H5J B;  3VVT A;  2RNE A;  3DKD A;  4DSJ A;  2J8A A;  1UFW A;  2QT7 A;  4IQX A;  4ED1 A;  1GXU A;  3L95 X;  4B3S J;  4FNI A;  3QWU A;  4DUY F;  4C8Y A;  1S1V B;  5KFN A;  3MUT P;  3FSY A;  3U27 A;  2M0G B;  1KEK A;  2HEK A;  1B7F A;  2NCK L;  1RTZ A;  5ETM A;  1H72 C;  1F9E B;  1UAW A;  1BAZ A;  2R7Q A;  2GS8 A;  2QSW A;  5GAE I;  2A2C A;  3DHW C;  1Y5L B;  1S99 A;  1Q8K A;  4RW8 B;  1UVL A;  1DTQ B;  4H4K A;  2JEI A;  4ZP7 A;  1G2E A;  4IFV B;  4J91 A;  2PMZ D;  5T7L B;  2HAI A;  1S9E B;  2KG1 A;  3C46 A;  4TYB A;  4ZMM A;  1L3S A;  4Y65 A;  2DNK A;  2R2U A;  2W9A A;  5CH7 B;  5E3Q A;  4MKY A;  4L6V 3;  1CVJ A;  1F5A A;  1FA0 A;  3Q23 A;  4DXL A;  1NSP A;  3EVW A;  4USI A;  1NSK L;  3THV A;  3TVK A;  1TKX A;  5AXK A;  2JEG A;  4ILR A;  1LQ9 A;  2H51 B;  5KT7 A;  5HQM A;  2BRK A;  3BR8 A;  2RVJ A;  4N56 A;  3EE3 A;  4QWE A;  1QTN B;  2BKP A;  2FD2 A;  4GRS A;  3HSD A;  2NR0 A;  3RAQ A;  5KG5 A;  3UQS A;  4YR2 A;  4FXW A;  4KKO B;  1NUE A;  1GK8 A;  1PO6 A;  1V6H A;  2H3E B;  3RW7 A;  2OHD A;  4MK8 A;  5GME A;  5KFC A;  1VQM S;  1IBC B;  3W8P A;  2IC3 A;  3BSN A;  3K8W A;  3A8K A;  1VFJ A;  1M5S A;  3NGT A;  2Y1I A;  2BM0 A;  4QW9 A;  4LF7 F;  3CDW A;  3E8O A;  1JJH A;  2BDP A;  4B9N A;  3CNQ P;  4WZQ A;  2YKA A;  2IDE A;  3PCO B;  4ETZ A;  2R8J A;  1IQT A;  1S10 A;  1D09 B;  2P6S A;  4USK A;  5F41 A;  1O5J A;  3DRY A;  1ARQ A;  4XIU A;  2HFV A;  4NZ7 A;  3MM5 A;  4HAC A;  5D4P A;  3VAG A;  2JRS A;  1VQ7 S;  3FEX B;  3EYZ A;  1N0V C;  2PE8 A;  1TK5 A;  1OHN A;  1S1X B;  1JIH A;  2D69 A;  4R25 A;  3OFF A;  4J37 A;  1TKT A;  4ZVR B;  3EX7 B;  3MM8 B;  2B8P A;  2YWF A;  1IN0 A;  4KHP J;  2PT0 A;  1UMJ A;  1DAR A;  2NRE A;  5B0B A;  2IVM A;  5HN0 A;  1WEX A;  2GIF A;  3QGG A;  1UJ6 A;  2XYG B;  2FTR A;  5D4N A;  2FGC A;  2GGP A;  1JB0 C;  2DO4 A;  3K5P A;  5HMX A;  3AOB A;  4LRE A;  2DNZ A;  3PW2 A;  1HHS A;  2ZNZ A;  3O3L A;  2CIM A;  5D0G A;  1FJG J;  1RLD A;  4EWT A;  1YJN S;  2B5J B;  3G6E S;  4ZLL A;  1QTM A;  1IKW B;  2LEC A;  5BYQ A;  2OPP A;  3W9J A;  3V4I A;  4OYX A;  3UDV A;  1RLC L;  2PEB A;  2CPZ A;  1VIX A;  3D6F B;  2AF6 A;  1U0H B;  4K4T A;  3W8G A;  3SSQ A;  3Q24 A;  1YQH A;  1KVK A;  1OJ4 A;  3KLI B;  2A18 A;  5HAO A;  1D9F A;  1IUJ A;  5KFI A;  2HS4 A;  4ME7 E;  4LBP A;  4LFB F;  3M2R B;  3IR5 B;  3ETO A;  4FBT A;  3ISN D;  3T9Z A;  4OX6 A;  4YB1 P;  4AL5 A;  5DG7 A;  3HP6 A;  3TEG A;  4FXV A;  2FVR A;  5ETL A;  1LWC B;  1X4G A;  3JSM B;  2VJV A;  3FSI A;  1ZAV A;  2ZNY A;  4L72 B;  4WFZ A;  1FX4 A;  3LH2 S;  1RAG B;  2MKC A;  3ZTS A;  3NRB A;  2RQK A;  3J81 j;  2G0I A;  5HJX A;  4ID5 A;  3V6D B;  3S8S A;  2DTJ A;  5C24 B;  3ELH A;  3JQJ A;  3ITH B;  3ZZU A;  1MYL A;  2CNO B;  5J2P A;  4C0O C;  3TA1 A;  5KFD A;  2CQD A;  3R7B B;  4UUW A;  2HWH A;  4QWB A;  1WSV A;  1HQU A;  3MCN A;  1UJ5 A;  2LQB A;  3A8I A;  1TUG B;  4YP3 A;  1NDL A;  4DQI A;  4M5H A;  4U95 A;  4MTP A;  1WG1 A;  2BX6 A;  3RRH A;  1W2B R;  1YJU A;  1O51 A;  4H4O B;  1CJK A;  2G0J A;  3GP9 A;  5HAN A;  2ALZ A;  1OIA A;  3KK1 A;  4IG3 B;  3M6W A;  5GAG I;  1CQM A;  4NLR A;  2EKN A;  3Q8Y A;  4CM2 A;  2PFD A;  4EYI B;  4G1P A;  4LF2 A;  5LM7 E;  5GAD U;  3CIM A;  2RQ4 A;  4JI7 J;  1BQM B;  1AUS L;  2UVR A;  2XI3 A;  3PXG a;  5KT4 A;  1EET A;  4M5I A;  5KFF A;  1JLC B;  2HVE A;  4J9N A;  1LW0 A;  2OSR A;  5HRO A;  5M2U A;  4I2P B;  2VG7 A;  4NE9 C;  4DV7 J;  2APO A;  2HRT A;  3LO3 A;  3JS9 A;  4OYA A;  2FJV A;  1YIT S;  2E1M C;  4CLK A;  2V67 A;  2Z2Z A;  4OIX A;  2KJW A;  5F3T A;  2GO8 A;  1YGY A;  2V68 A;  3F41 A;  1RYR A;  4DLG A;  2Z58 B;  1CS4 A;  3FCV A;  2QLB B;  4ED4 A;  2RRN A;  1FT8 A;  3W62 A;  3BQ1 A;  3BV8 A;  3AD8 C;  4ENO A;  3NGK A;  1UTA A;  1WEZ A;  1HBN B;  4FPR A;  2OH2 A;  2I9S A;  2FPH X;  1VQL S;  4PWU A;  1UA0 A;  4JI5 F;  4USH A;  2QTW A;  2BJ3 A;  2Y1J A;  4JI6 F;  3OHB A;  2KG0 A;  2UXC F;  2B7B B;  4R5P A;  3A8J A;  1B01 A;  3GPA A;  3UDC A;  2P9G A;  1PG5 B;  3HHK A;  4WK1 A;  4OFZ A;  1NJY A;  4LSZ B;  5DET A;  1XJW B;  2CG4 A;  3K5L A;  2HHX A;  1RT2 A;  3D3C J;  2QA4 G;  4Y0F A;  2AEM A;  2LEP A;  3IRX A;  1HYS B;  1MLA A;  1JQG A;  1FRJ A;  3KUG A;  1QM9 A;  2NXC A;  4IFY A;  1T3N A;  2MKH A;  3TUP A;  1UJ4 A;  1K8A T;  3R5G A;  2XM3 A;  2B8Q A;  2HHS A;  3R2C J;  5KG6 A;  3SQO P;  4ZIW A;  3KLF B;  1IBK J;  4ZJQ A;  1Q0N A;  4HTI A;  4QZV B;  2MZJ A;  4ECT A;  2GAG C;  3OL8 A;  1U49 A;  4DV3 F;  1HWL A;  2QSF A;  1BWV A;  2QMW A;  2FGO A;  3K58 A;  2OEJ A;  3S6E A;  4ZP8 A;  1S6O A;  2IM2 A;  5KFU A;  2WHO A;  3R1H A;  4PUO A;  1OPI A;  4L75 A;  5F9L A;  1FFS B;  4G1I A;  3CMA S;  1ZM2 A;  4K4Z A;  4TLQ A;  2RIJ A;  2IA6 A;  1U7L A;  1RT1 A;  4OZ1 A;  2VIC A;  4F0M A;  1NRK A;  1BMQ B;  3MMC A;  1PAR A;  4OX9 J;  1GXL A;  1QSY A;  3M2V A;  2AJ0 A;  1XC9 A;  2HGM A;  5KFP A;  2C3Y A;  3PNI A;  5L1K A;  3SI8 A;  2ZOG A;  3DOL A;  2AU0 A;  2K5J A;  4JI4 J;  2R2R A;  3KG1 A;  2QN6 B;  1HAR A;  2AGP A;  2HLT A;  3IR7 A;  2HHP A;  4MIW A;  1NB7 A;  1B4S A;  2P6T A;  3RR7 A;  2QLX A;  3THP A;  3CWJ A;  1F0X A;  4K4Y A;  3KLH B;  1HNW J;  3FCH A;  1V3S A;  2YNG A;  2RSQ A;  2GJ2 A;  5K8O A;  4NXN F;  1Q5V A;  2D3O R;  4M5D B;  3W1Y C;  3ET6 B;  2HAF A;  4Y2M A;  1FNX H;  4QPT A;  2LQ5 A;  3BGR A;  3MPV A;  2XEX A;  4LRB A;  3AQP A;  3I9Z A;  2GO9 A;  4X4V A;  1PYT A;  3PYF A;  4OYW A;  2KZZ A;  1DY3 A;  3OD2 A;  1KN6 A;  3CJ4 A;  1IBL J;  4QIE A;  4ZHR B;  4WF9 Q;  2LXI A;  4P2X A;  2CNN B;  4YB5 A;  4C3M A;  1FE4 A;  1PYS B;  2E66 A;  4JYA J;  2YQ0 A;  1HNX J;  3CUN A;  3HVW A;  4CT9 A;  2BNW A;  1VHF A;  3UN5 A;  1IKV A;  3R6L B;  3CCR S;  2BE9 B;  1GTE A;  5GVQ A;  1BWE A;  1Z2Z A;  2DEJ A;  5FDL A;  4GKJ F;  1F9H A;  2GQ2 A;  1HWI A;  5K14 B;  5BYS A;  2QYG A; 
#chains in the Genus database with same CATH homology
 2BJ7 A;  4ME7 E;  1EA4 A;  3QOQ A;  1Q5V A;  1QTG A;  3VEA A;  2WVF A;  2AY0 A;  2K29 A;  3VEB A;  2RBF A;  1NLA A;  2BJ3 A;  2WVD A;  2GPE A;  2NZC A;  1MNT A;  2JXH A;  3H87 C;  2FGC A;  1B01 A;  2BA3 A;  2BSQ E;  3VW4 A;  2CAD A;  3LGH A;  2KEL A;  1PAR A;  1BAZ A;  1P94 A;  3OD2 A;  3QSI A;  1B28 A;  2WVB A;  2Y3Y A;  4HV0 A;  1BDV A;  3FT7 A;  3FMT A;  1Q5Y A;  2BJ1 A;  2CPG A;  1MYL A;  2BJ9 A;  2K9I A;  2BJ8 A;  2K5J A;  1X93 A;  1U9P A;  3PHT A;  3GXQ A;  2PC6 A;  2CAJ A;  1BDT A;  2CA9 A;  4D8J A;  1ARQ A;  3BKF A;  2BNZ A;  4FXE A;  2WVE A;  2BNW A;  2CAX A;  1ARR A;  2H1O E;  1IRQ A;  2K1O A;  2K6L A;  2WVC A;  2JXI A;  2F1F A;  2JXG A;  2HZA A;  3BKU A;  2HZV A;  3BKT A;  1MYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...