3OD6X

Crystal structure of p38alpha y323t active mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
349
structure length
344
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPTDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase 14
publication title Active mutants of the TCR-mediated p38alpha alternative activation site show changes in the phosphorylation lip and DEF site formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 96
structure length 344
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3od6X02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3od6X01
1M14A 3AT3A 4NUSA 5DRBA 4BBEA 4QMNA 4L52A 3ZLWA 3HECA 3E63A 3U4WA 4HNIA 5E7RA 4IDTA 2WMAA 2YCQA 1HOWA 1XWSA 3GCVA 3QBNA 4N70A 2QOQA 5BVWA 2VRXA 4FV8A 1MQ4A 4ZSJA 3QQKA 5HNBA 4HVDA 4ZTNA 5IDNA 4FTIA 4PL5A 4BCFA 5IEYA 4ANSA 5LVMA 4E4LA 1OUKA 4YU2A 5AR5A 4FG9A 5DBXA 2CNVA 3FZTA 4CG8A 4I24A 4EH4A 2PZPA 1KOBA 2PPQA 3F3UA 3OP5A 4BCOA 4FL2A 4FX3A 1ZXEA 4FV5A 4NW5A 3ZSIA 3ZRLA 1Q99A 4HYSA 2VTHA 2C69A 3P0MA 3TN8A 3KF7A 3V6SA 3D83A 4GU9A 3LQ5A 3QWKA 4R5YA 5H8GA 4APPA 3F3TA 2GQRA 4E6QA 4BDEA 3QHWA 3WF6A 3BHUA 3BHVA 3OFMA 2GHLA 4RFMA 5DWRA 4WG5A 3UP2A 2J5EA 3LXNA 2R3KA 2RSVA 3OG7A 4KABA 4AWIA 3QTXA 1Z57A 2B53A 4FSTA 4GT4A 2BFXA 4MKCA 1UU9A 3FQEA 3LFEA 4I21A 4MEDA 3R7EA 1H08A 1YXUA 1IG1A 5IUGA 1G8AA 3QZFA 5M06A 2XK3A 4M13A 4IX5A 2PZIA 3FZPA 4ANQA 3BU5A 4CLIA 5H8BA 5JFWA 1NT2A 2PZ5A 3CKXA 4AGWA 4EH6A 2VTOA 2BAQA 3SXFA 4GU6A 5ETAA 3LM0A 4EKKA 3TNWA 3O17A 4EHGA 2XKCA 2HENA 5BVEA 4DTKA 4R3PA 3BLRA 5C8MA 5LWMA 2PUPA 3ELJA 3V8WA 3EOCA 3FY0A 5FEDA 5HG8A 4BI0A 2ONLA 3SRVB 4O7LA 3R9DA 3ORIA 2ZAZA 2C3LA 1OL6A 3EN5A 3CP9A 4F70A 3HDMA 3LJ2A 5CSHA 4C4JA 3EQIA 5IQHA 4WNPA 2IZRA 5HBHA 1H0VA 3QUDA 2YACA 2OZOA 3POOA 4GH2A 1PXPA 4CYJA 3D4QA 5L6OA 5HLPA 2WB8A 3R9OA 3KREA 4O7WA 3PJ8A 4D2WA 3F3VA 3F61A 4FZ6A 4H36A 4MXYA 4TWCA 2OF2A 5JGDA 5J5SA 3ZRKA 2O65A 4B8MA 4F0GA 3UP7A 4LG4A 3FDNA 5TKDA 4EH2A 4PWNA 1UNGA 3QCQA 1ZY4A 2IVSA 2Q0BA 3F88A 2W1HA 5D7VA 3OCTA 4CV8A 3OW4A 4NKSA 4IXPA 3VUGA 2CKEA 3HEGA 4FT5A 4PDOA 2FH9A 3UIUA 3SW7A 1WVYA 3OT3A 3D15A 4C4IA 2A0CX 4RT7A 3OWPA 1X8BA 3JPVA 4N4SA 2YDKA 5HG5A 5A4CA 3COIA 3P23A 4ANNA 1XJDA 3HV4A 4G5JA 4BI1A 3L1SA 1OI9A 2B1PA 4O7SA 2E9UA 5GJGA 3BPRA 2YCSA 4LRJA 3TNIA 3PLSA 2YLEA 2G2FA 4ZJIA 4AA5A 2YCFA 5C27A 4G16A 3QZHA 3MPMA 3ZUUA 5I9YA 2WU6A 5IG1A 4C02A 5L6WL 2OG8A 2JFLA 4D0WA 2XIYA 3WE8A 4F6UA 4XOZA 2YHVA 4J52A 4OTWA 2ZDUA 2C6MA 3LLAA 4L7FA 3NNVA 5CYIA 4C58A 2C30A 3E8NA 4WSYA 4XG6A 3SOAA 4DCEA 4ZTLA 3PVUA 5M55A 4O1PA 3G51A 3NZ0A 2W1GA 3RK5A 1U5QA 2VTJA 4YPSA 3L8XA 4FT3A 2WTKB 4KRCA 5I9XA 5LXMA 3QZIA 2XK6A 4A4LA 3VIDA 2CN5A 3IW6A 4ZZNA 2Z7QA 4M0ZA 1OL7A 4I94A 4ZTRA 4AX8A 3TM0A 5I9ZA 4WNOA 4C59A 2B55A 2ITNA 4KBKA 4RQKA 4K18A 4ZLOA 3U6JA 5JMSA 4BIEA 3RK7A 4ID7A 4O2ZA 4B6LA 1ZZ2A 3TV6A 3GCPA 2VWXA 4BDDA 4Z7GA 3A8XA 3QRKA 5J7HA 4DFBA 3BGQA 3FC2A 4ACGA 4R78A 4UMPA 3A7FA 4PTCA 1YHWA 4FK3A 2PY3A 2XK8A 3ENHA 4IB0A 4WSQA 3SAYA 4CRSA 4MH7A 4E4XA 3N4VA 3BGZA 5IA0A 4ZMEA 4FK6A 3O7LD 4XG7A 4FICA 1U54A 4TYGA 3KMMA 4XOYA 3ERKA 4EK5A 3T3UA 2WQMA 3HGKA 5I4NA 5EQEA 5I9VA 5AWMA 4IAKA 4CNHA 2WOTA 3VHEA 3NW5A 4OR5A 1P5EA 3LFSA 2ACXA 5E4HA 4BTFA 5HX8A 1YW2A 4NTTA 5M4CA 3GC0A 3R01A 2HK5A 4P2KA 2DYLA 1PMUA 4MWIA 4PTEA 2WGJA 3LZBA 4XG4A 2OJGA 4FYOA 4IACA 1DI8A 5CTPA 1OUYA 4NFMA 4O0YA 2J5FA 4G1WA 3U6IA 3DAJA 3ITZA 1NA7A 4ZS4A 2BDWA 2XCKA 3N9XA 3VW8A 5HX6A 2WOUA 4FKSA 1YDSE 4U40A 2OZAA 3HRFA 5AFVA 3PIXA 2HAKA 3EQFA 3GU8A 2B9IA 4UEUA 4I0TA 4ZTHA 4BYIA 3MVJA 1GIIA 2R9SA 4ITHA 4M8TA 3NNWA 1OL1A 5HNIX 3VUDA 3NSZA 4O83A 3QRJA 4CV9A 3GFWA 3P86A 3CIKA 4BTKA 2GQGA 4ACDA 4EL9A 5JGAA 3EQHA 4FNZA 4NKAA 2IO6A 5LQFA 2ZVAA 3IW5A 4BDBA 4IIRA 5E8TA 3C4CA 5CF5A 3Q60A 3TT0A 2R5TA 4FIGA 3UZRA 4X2JA 2XRWA 3HA6A 3MSSA 1FPUA 4HZSA 3RNYA 3QX2A 2WMSA 3VULA 3R8PA 3DFCB 4R7HA 4AT4A 3DTWA 1V0BA 2Y4IC 2UZNA 2PYWA 3DAEA 4EOLA 4HVHA 4U41A 4CKRA 3GT8A 1Y6BA 2C6EA 3NAYA 4QMTA 4FI1A 3WZJA 3BELA 3E3BX 4JG7A 3KN6A 3IKAA 4ZTQA 2Z60A 3JXWA 4BZOA 4XEYA 4EQUA 2GDOA 4GG7A 3MB7A 3WZEA 2IWIA 4FEXA 3EZVA 4R1VA 4HCVA 4KBAA 5FTQA 1SM2A 2PWLA 5ETIA 2YIXA 4XP2A 5KX8A 5LJJA 4O7NA 3ORTA 4OUCA 2HXLA 2LGCA 2R3IA 5CEQA 3R22A 1OIYA 3DZOA 4AZVA 1WMKA 3MA3A 3ZZWA 2Y6MA 3FMDA 4Z16A 3SXSA 4W9XA 3Q9WA 4RVTA 3ORMA 3ZO4A 3V01A 1FVVA 2Z7SA 1ZY5A 5LMBA 2O5KA 5FM3A 1YXSA 2FYSA 2BVAA 3KRRA 4EK8A 3M1SA 1WVWA 4L7SA 4G3GA 2R0UA 3MY0A 4E3CA 2C6TA 3ZYAA 1XR1A 2HCKA 3GB2A 1XBCA 4D1XA 5CAVA 1PHKA 3LFQA 3L9LA 2W96B 4M3QA 2B4SB 2SRCA 5HOAA 3PSBA 5CVHA 2B0QA 3R7IA 3H0ZA 5HI2A 4M68A 4LUDA 3VRYA 2FB8A 1XKKA 2V62A 4ZY5A 4HCUA 4ACHA 5HU3A 2H8HA 5HQ0A 2UZEA 4RWIA 3HV3A 5EYCA 5L4QA 2PL0A 2WFYA 2XKEA 5EFQA 5JGBA 4U8ZA 3KK9A 4RJ8A 4YLKA 4ERWA 3TKUA 5KKRC 1QCFA 5M51A 3MYGA 2OFVA 3FMNA 4WNMA 3A7IA 1Y8GA 4WA9A 2C0TA 3GENA 3P7CA 4IAYA 4UMUA 4FTCA 4CKJA 4EJ7A 3ROCA 3AMAA 1JKTA 5AIRA 3GU6A 4FGBA 4F6WA 4UXQA 2R7IA 1YWRA 3I5NA 3PY3A 4GMYA 4CSVA 4DFLA 3EFLA 3PWDA 4IAAA 1DAYA 1CMKE 4K9YA 1OKYA 4X3FA 3VW6A 4EK6A 3C51A 3F5GA 1H1PA 4JBPA 5E1EA 3W2RA 3U6HA 3PG3A 1ZAOA 3FPMA 3VBVA 1FOTA 2X1NA 2RFNA 3GCSA 4QMYA 5KZ0A 3SDJA 5BNJA 3DTCA 3NYOA 5DOSA 5EKOA 2WEIA 3QQHA 2GHMA 3BKBA 1CSNA 4WG3A 4YZNA 2HY0A 5LVLA 3I5ZA 2F7XE 4CFUA 5CXHA 2XK4A 3C7QA 3PSCA 1TQPA 4CQEA 3H30A 4HW7A 4QP7A 1KV2A 3C5IA 2BUJA 3EN6A 3NUXA 4RGJA 3VS6A 2RL5A 1JNKA 5EH0A 3SV0A 3QFVA 5CT0A 4M14A 2YDJA 3OHTA 2WQEA 3GQIA 3QUPA 4S30A 1STCE 4FZFB 4C0TA 4PP7A 5CEMA 5IQDA 3HL7A 3W2CA 5A4TA 3FC1X 1VEBA 2ZOQA 4AOIA 4IADA 3ET7A 1J1CA 1VYWA 3PA3A 4YJVA 2BILB 1GZNA 5CT7A 5FEQA 3WF5A 3EN9A 3H10A 3MV5A 4FIIA 4EQCA 1OBGA 1H00A 4L3JA 3R1SA 3ZFXA 2IVVA 3ROYA 5A4EA 4QPMA 3Q3BA 2AC5A 5BX0A 2J7TA 3IGGA 3QA0A 2C5XA 2XS0A 2JKQA 3KULA 2YIQA 1OECA 2PVFA 3B2TA 3KGAA 4JOAA 4ENYA 3DBCA 2JLDA 3VBWA 3SG8A 4I4FA 4QPSA 1KV1A 5BQ0A 1J7LA 3QKLA 4FSNA 5IA2A 1WBPA 3BQCA 2RG6A 4J99A 4FEUA 2EU9A 3FEGA 1QPEA 3LCOA 1OIQA 2UV2A 1DS5A 4FTKA 4IZ5A 2VU3A 3TUBA 1L8TA 4XS2A 4L6QA 3BV2A 5EM5A 4A4OA 2OJFE 4HJOA 1YRPA 2F2UA 4YNOA 5BVDA 3KKVA 3BEAA 2WMTA 4FTQA 3T9IA 4E5WA 2PUIA 5E8VA 1YQJA 4XP0A 5K0KA 2BMCA 3RALA 3EFWA 1FVRA 2CPKE 4C4FA 2XEZA 1PY5A 1QMZA 4RWKA 1PXJA 4BIBA 4GFOA 4LFIA 5LWNA 3KRXA 4FOBA 2YJRA 3OY1A 3KA0A 3FI8A 3CJFA 3ZOSA 5DGZA 1UU7A 5AA9A 2OXDA 4DAWA 5ANJA 5D1JA 2XKDA 3KCFA 5DMZA 5TOZA 3MN3A 2WTDA 3BYUA 4TYJA 3RK9A 4CLJA 5FXSA 3ANQA 4CMOA 2JIUA 4M69A 3HRBA 3NIZA 3ODZX 5BUJA 5AIKA 5E8YA 5J95A 2X7GA 5ACBC 5EW9A 1LEWA 4GSBA 1JLUE 2XYUA 1GZOA 2QCSA 3QTSA 5AA8A 3PVGA 3QWJA 2CSNA 1XH5A 3GI3A 4GT3A 2E9OA 3HVCA 3S4QA 2WELA 3FYJX 3LJ0A 2G1TA 4FSUA 1ATPE 3AC2A 5KMOA 4MHAA 4Z55A 4JX7A 1OVEA 2O2UA 1JVPP 5ANKA 3NMUF 5M44A 4WHZA 3KXMA 2XM8A 1ZYCA 5D9HA 5LMAA 3LQ8A 5CNNA 4PMSA 1OITA 4OTHA 3UOHA 3CJGA 1Q8UA 2GNHA 3NAXA 3DGKA 3HX4A 4NM7A 1UWJA 1JAMA 4C2VA 2WD1A 3W18A 4C34A 4NK9A 3S0OA 4QTAA 4BZDA 5GHVA 2QR8A 3TZ9A 2R3JA 3DZQA 4O38A 3WBLA 5LMKC 4MNEA 2VTAA 2C5NA 4YSMA 2VWVA 3ALNA 3GC9A 5KCVA 3K54A 1GOLA 1DAWA 4I0SA 3RP9A 4BKYA 1J7IA 2YM8A 5KHXA 3FL4A 2VTIA 1P14A 3FQSA 3G9NA 4O0UA 4OT6A 4PL3A 5KUPA 2UZUE 5IUHA 5D10A 3CD8A 2Y4IB 3ZS5A 4NM5A 4QYGA 2UW7A 4JBOA 5L2TA 4BDJA 4OTDA 2OWBA 5CI7A 3DLSA 4FV7A 4UYAA 4XG8A 4GFMA 5E1SA 4F1OA 4MAOA 4CTBA 2F57A 1CDKA 4RZWA 3UC4A 4BTMA 4X6RA 3E93A 2YITA 3UQFA 3GXLA 1E9HA 3DFAA 3G6GA 4O27B 4JBQA 3VS4A 2JIIA 4D1SA 4IVDA 2WMRA 4AZSA 4D4RA 3H9OA 3B8RA 1GIHA 3G0EA 2PUNA 4DBXA 5B2MA 1GIJA 4FKJA 1W98A 3I0QA 2QC6A 4J7BA 5E8WA 4O84A 5CEIA 2R0IA 4BCQA 4DTAA 4FUXA 4J98A 4C61A 2QI8A 3KXXA 4BCJA 3PRIA 4DG2E 5M56A 3S3IA 2YM5A 4EOQA 2ZMDA 4TYHA 3VF8A 5B2KA 4DEEA 2Q83A 2IG7A 4GL9A 3ZZEA 3VBYA 4ZJVA 3F69A 3QKKA 3P7BA 4FL3A 1YKRA 2GS6A 3TNQB 4C57A 3DK6A 4IWDA 4ZK5A 2XUUA 2F7ZE 4L43A 4BB4A 3Q4TA 3QQGA 1GY3A 4DITA 3WF7A 3DBEA 5FEEA 4AS0A 2BDJA 3UVRA 4ASXA 3AOXA 4I22A 5ANIA 3RAIA 4O21A 3TACA 3GEQA 3BU3A 1GJOA 2PVNA 3TIZA 4FSWA 5FQDC 1UWHA 4WIHA 5E91A 4CCUA 2UZOA 4TNBA 3LAUA 4CGAA 3P7AA 2CJMA 2QLQA 2JBPA 3R21A 4RX8A 4RX9A 3RZFA 4Q2AA 3OXZA 3ULZA 2C3JA 3ZTXA 4QQJA 5DR9A 2VO3A 4LRMA 5AAFA 4FNYA 4EJNA 5KKRB 1B38A 4AP7A 5AP0A 4ASZA 3SD0A 4D2TA 2GNLA 4I1ZA 4FV6A 3Q04A 4FV3A 5EW3A 1JSVA 5C8NA 4X3JA 4KKHA 2XCHA 3BIZA 3EN4A 3ZDUA 4N57A 3QA8A 4ITJA 4EONA 2X9FA 1JSUA 5DEWA 5E8XA 4I93A 4V04A 4E93A 3DDQA 4QQCA 2UVZA 1URWA 4FIEA 3RJCA 1FGKA 3K5VA 4RJ6A 4BHNA 3O51A 4QD6A 4F7NA 4PMTA 2YWPA 4LV5A 4CFWA 5L8LA 3U51A 4RLKA 2ZM1A 3D5XA 5F9EA 3KY2A 3NYVA 2C4GA 5IQIA 3FZSA 4EH8A 2O63A 3NLBA 4LMUA 3QC9A 3NIEA 3BQRA 1K2PA 2WTCA 3HP5A 3UOLA 3WYYA 3CTQA 4EC8A 1SVHA 1JKSA 3JY9A 2OIQA 4NIFA 5J7BA 3NUNA 3W10A 3I60A 3ZONA 5CSVA 5L6PA 3C4WA 1RJBA 4IB1A 3A4PA 3QQJA 4F9YA 3D7TB 3VN9A 1Q8TA 4K2RA 2Y9QA 3IONA 1ZZLA 2QOIA 2X2KA 2PE1A 5CU4A 4JL9A 1YDTE 4FZ7A 4C37A 3MH1A 1R1WA 4W9WA 3ATSA 3WF8A 4DEBA 4QMZA 3OTUA 5DNRA 2XVDA 1RE8A 3LFBA 5EI8A 1YI6A 2JDVA 3VBTA 2UVXA 4JDKA 5CVGA 5A6NA 2A1AB 4I5PA 4BCIA 2XNMA 2ITUA 5KNJA 3LMIA 2PMOX 3W2SA 2GNIA 5IQCA 4XX9A 4W8DA 4XH6A 4JI9A 4NWMA 2PU8A 4ZLZA 2I40A 2QHNA 4PPBA 2CGWA 4RIOA 5HE1A 4IX3A 3TV4A 4G3EA 1KE5A 1PKDA 3FI4A 5KBQA 1UNHA 3IOPA 2OJIA 1H8FA 4EOKA 2QOBA 2B9HA 4WG4A 2BROA 2X0GA 2W05A 3Q96A 3ZSHA 1GZKA 4DHFA 3PXZA 3D5UA 3OCSA 3BYMA 1WCCA 3SVVA 2OI4X 3BE2A 4NYEA 3F3ZA 1VJYA 3UYTA 5C03A 5H9BA 4B7TA 1JOWB 1REKA 1H01A 4N6YA 2ZM4A 3VUKA 5IH4A 4FEVA 3AGLA 3UPZA 1I44A 4U97A 3OBGA 4OTFA 3GC7A 1BMKA 4YUQA 3PG1A 1NW1A 3EH9A 2XNPA 4LQMA 4PPCA 2J0KA 3PP1A 2XJ1A 4G31A 3WILA 3ZFYA 5KHWA 3O23A 3QUEA 2WMVA 2XNGA 4EI4A 4I92A 4QNYA 2J50A 1QPCA 5HE0A 3NDMA 4KD1A 3RZBA 5AP2A 4DGOA 5HCYA 5CEKA 5EOLA 4C62A 5K5NA 3AD6A 2CKPA 5JEBA 4L45A 4QMUA 5DHJA 3R73A 3K3JA 5EM8A 4MX9A 2X8DA 5JZJA 3LQ3A 4ZOGA 1UU8A 3IW8A 4QP6A 3UVQA 4F09A 3P1AA 2QOLA 4I6QA 3ZEWA 2Y7JA 3GGFA 3VUIA 5CAPA 3R7YA 4ALUA 2BCJA 4ZY4A 4IWQA 4F1TA 4BDIA 4U0IA 2W5BA 2J0LA 3MH3A 3S95A 3ZHPC 2BRMA 4D5HA 4D5KA 5CEOA 3IS5A 3F6XA 1V0OA 2OU7A 2YDIA 4HGSA 2W17A 2P4IA 1BKXA 1SVEA 4JX3A 3C0IA 3MFSA 2R3LA 1Q8YA 3BHYA 5IF1A 2I7QA 2EVAA 2W1FA 3EL7A 3QCYA 1Q3DA 3UJGA 3KU2A 4JAIA 2QU6A 4O2PA 4CT1A 2JIVA 3PFQA 4BWKA 4EUTA 4HPUE 5CS6A 3G2FA 4ZEGA 2P33A 2JDOA 3RPRA 3U9CA 3U8WA 4AW1A 5IEXA 4UY9A 5IUIA 5D7AA 4IMYA 4PNKA 4TZRA 2ERKA 1NXKA 4XJ0A 3OT8A 3MI9A 4RWLA 2I0HA 3RPSA 5LCJA 2C5YA 3UG1A 4IQ6A 3POZA 1M7QA 5FDXA 5LVPA 2BPMA 5EW8A 3DJ5A 4PF4A 4EK4A 4JDHA 4TL0A 3EJ1A 2QKRA 2HOGA 3NEWA 4AE9A 5EYDA 2JGZA 5GJFA 3P4KA 2W1IA 4CT2A 2HZ0A 4LOOA 2PVJA 2R2PA 5HG9A 1CM8A 5A4LA 3M42A 3UIBA 3AMBA 4QTDA 3ZU7A 4C8BA 4YZMA 4DGGA 4UB7A 3G90X 3OBJA 5C9CA 4EZ5A 4ZTMA 4MXCA 4RQVA 1BUHA 4KIOA 4IFGA 4ZSGA 2IW9A 4EH3A 3C4XA 3MY1A 3I6UA 3EFJA 4JRNA 2B54A 4O0VA 3NNXA 3FQHA 3O8UA 1H25A 4FKIA 4PDYA 5AUVA 1OIRA 4IANA 5EHLA 3RCDA 2Z2WA 4YJRA 3KVXA 5AR2A 4AOTA 4XUFA 3RM7A 5M4IA 3V5QA 3HZTA 4RFZA 3OWKA 2C6IA 4K6ZA 4JXFA 4UN0C 3GC8A 2X9EA 4LYNA 4PV0A 4UX9A 3AD5A 4QTCA 3VUMA 1PRYA 2W9FB 3PSDA 4TWOA 5AUTA 3UOJA 3LIJA 2ZV8A 4ONAA 2QURA 3R7VA 4CZUA 3DKGA 4TPTA 3LPBA 4JAJA 1Q62A 4MK0A 4Y83A 5DLSA 4J53A 2PMIA 2XBAA 2OZAB 1JQHA 4HGTA 4AW0A 3FL5A 2W7XA 4RC4A 5EOBA 2PMLX 3FJQE 3LCSA 5CWZA 2BAJA 2WO6A 2BZIB 1PXLA 2XIKA 2CCIA 2X7OA 1YXXA 4DLJA 3RWPA 2BALA 3PIZA 3P79A 1Y91A 5DA3A 5DVRA 5EDRA 4XG3A 2WTWA 4EORA 5E8ZA 4F4PA 4ALWA 5DRDA 4FL1A 4F9AA 1OB3A 4MCVA 4S31A 5GIOE 2WMUA 2IVUA 4X2NA 3PXQA 3SXRA 3TKHA 4NJ3A 4AZWA 4ZTSA 3AQVA 4I20A 4WKQA 5HD7A 2BRBA 5IH5A 3VC4A 3VRZA 4BDGA 4G9RA 3MWUA 4LV8A 4B99A 4C3RA 4DBNA 2UZTA 3MDYA 3WOWA 4FNWA 1BI7A 4EYJA 5HD4A 1IASA 2BIKB 4Y85A 2OK1A 4M67A 4OBOA 3ORZA 3D9VA 4RBLA 4A9YA 3HMNA 2VAGA 4DGLC 1YDRE 5CU6A 3ZH8A 1A06A 3PA5A 2EB3A 3ZXZA 4MBIA 3CR0A 4EH5A 2C6OA 3CEKA 1B39A 4D9TA 5J1WA 3PY1A 4E4NA 3HLLA 2O3PA 5DR2A 2ITYA 3WZDA 2YWVA 4XNEA 5L3AA 4II5A 1PKGA 2YM4A 4IZ7A 3FMLA 4NCTC 4QP8A 3RPOA 2QU5A 2J0JA 4JT3A 4O7ZA 3ZBFA 3FI2A 3LVPA 3I0OA 4EWQA 4FEWA 2W9ZB 4V0GB 4IVBA 3VVHA 4EHEA 5AR4A 4L01A 2XK9A 5L8KA 4FT9A 4A7CA 3IDPA 4XBUA 4ZSAA 3FAAA 2UW8A 5AEPA 4X21A 4E8AA 3U9NA 4YJTA 5AP4A 3KVWA 2YAAA 3AC1A 3MS9A 4QP1A 4XYFA 2J2IB 4C2WA 4QMQA 3OEZA 5DN3A 3KC3A 5HHWA 3FLNC 5J5TA 3VBXA 4LGGA 5CF6A 4U6RA 4TY1A 3ZBXA 3GU7A 4XCUA 4EOIA 4TWPA 4G6OA 5CALA 2UZVA 3I79A 3WI6A 3FMMA 2WTIA 4IAIA 1KUTA 4QOXA 4AG8A 5EG3A 4HCTA 2C6LA 3IECA 4AGUA 5J9LA 3M11A 3PRFA 2CGUA 4D2PA 3B2WA 5AM7A 3S2PA 4YO6A 3DQWA 4FSYA 1OL2A 3FSFA 1XO2B 4RVKA 4WT6A 5KMKA 4MD9E 2QG7A 3W55A 4K77A 4L44A 1MRUA 3RKBA 4YBJA 2VO6A 5JQ5A 5DT3A 1JSTA 3UQGA 5JZNA 4MXOA 4P4CA 5AR7A 4ZJJA 3LXLA 4RVLA 1W83A 4H3QA 3L9PA 3AC3A 1OPJA 3Q4UA 4MYGA 2YEXA 3BWJA 3WF9A 2IZTA 4ZLYA 2XMYA 3OF0A 4DH5A 3R63A 1KE7A 3PIYA 2OF4A 1ZYDA 2ITQA 4QYFA 4XLIA 2KULA 3PXYA 2G15A 3FSKA 3R0TA 3EN7A 4Y5HA 2ITXA 4EC9A 3DKCA 2GMXA 2R3FA 3KF4A 4FA2A 5JN2A 3LLTA 3Q6UA 4E1ZA 4F9CA 1LP4A 1H26A 4YZ9A 2PVHA 5L8JA 4CCBA 3OTVA 4U3ZA 3PVBA 1W0XC 2XBJA 3E7VA 4KKGA 4Y5QA 3FMHA 5AV3A 3SX9A 5A54A 4U44A 3E7OA 3HV6A 1YI4A 2GFCA 4EZ3A 3MESA 3AT2A 4WUNA 3A7JA 4CD0A 4KSQA 3G0FA 4TW9A 3HMPA 5AADA 4FTNA 5IA4A 4HYUA 4BN1A 3FZOA 4V05A 3VNTA 4QP4A 5F20A 3F2RA 4PP9A 4EOOA 3DXPA 1UNLA 4IVCA 4MBJA 3R8LA 5IQEA 1U5RA 3AC8A 4YPDA 5K0XA 1OKWA 4ZZMA 3WARA 1F5QA 4AFJA 2GHGA 4Z9LA 4XP3A 4IJPA 2ITPA 2X6EA 4DEAA 3IDCA 4KAOA 2EXMA 3MPAA 3KL8A 1EH4A 2HIWA 2Z7LA 1RW8A 2YAKA 3PTGA 4U79A 4ASDA 3K5UA 2QKWB 1AD5A 3NGAA 5EHYA 4OTQA 3FKLA 5E92A 5JSMA 3I1AA 3LM5A 3QYZA 4FTTA 4X6QC 3R02A 4AZFA 4U45A 4D4SA 4CG9A 3CTJA 2ZYBA 3MA6A 4KRDA 4QMOA 2W0JA 4O81A 4FKOA 5GJDA 5TO8A 3DQXA 2C0IA 1K9AA 1JBPE 2F9GA 3BRBA 4BDHA 4RIWB 4FR4A 5AAGA 5AP3A 1IRKA 3RAHA 5CY3A 3UO5A 2R64A 3OUKA 3HUBA 3DS6A 4Q5HA 5AV0A 3VF9A 3JVSA 5FDPA 2GFSA 2XEYA 1JKLA 2QODA 3OC1A 3QLGA 2E9VA 5IZFA 5IA5A 1YVJA 4I23A 4EYMA 4DN5A 3A62A 2B52A 3ZXTA 1XQZA 4KIPA 3FLZA 4PMMA 4G3DA 4EHVA 3UNJA 2UW6A 2DUVA 4RIYA 4OTGA 3RBWA 4FVRA 4AN9A 3DDPA 2NP8A 4PX6A 5HZNA 1JPAA 5CZHA 5IMXA 2OBJA 5EDQA 3PE2A 3II5A 2ZDTA 3VWAA 5L2SA 1O6LA 3DY7A 3P08A 1YXTA 4KWPA 1Q8ZA 2OSCA 2Z8CA 3BI6A 3MIYA 4FUYA 2J9MA 4G17A 5ETCA 3VO3A 4M69B 3W16A 5GINE 3OZ6A 5I3RA 4DA5A 4OAVB 3CKWA 2RG5A 5GZAA 5BUEA 3BEGA 3TZMA 1ZMUA 5EYKA 4D28A 4J95A 3E8CA 1OGUA 2VX0A 3OCGA 4JVGA 1OPLA 4HPTE 1CTPE 1WBSA 2IZSA 5TR6A 1ZOGA 4ANMA 3OXTA 4O0XA 4O0TA 2X39A 1WBWA 3NS9A 1IR3A 3KMWA 4R3RA 2OICA 4LUEA 5BMSA 5HTIA 3AC4A 1CKJA 1H24A 3R8ZA 5CEPA 4Y73A 4DFXE 4ZAUA 3UVPA 5CAOA 3QALE 3CQWA 4ANLA 4YC3A 1MP8A 4U80A 2EB2A 2YZAA 3ETAA 4MNEB 4E73A 4AOJA 2VO0A 4CMUA 4DGNA 4WBOA 2QOHA 4FTJA 2P2HA 1CKIA 4NJDA 4AE6A 3NVKI 3TIYA 1IA9A 3CD3A 4ASEA 1MQBA 4L9IA 4D4VA 2YIWA 3IW4A 2R3OA 4MQ1A 5CSWA 1VYZA 2BRGA 5M4FA 2P3GX 3VS2A 3A2CA 3UNKA 4BF2A 2JDTA 3QC4A 3JS2A 3S00A 4JLCA 3F5XA 4CVAA 5DT0A 1Q97A 3H4JA 3HAVA 3OS3A 2PVKA 4UZHA 4QNAA 5KO1A 2PULA 2AUHA 2QOOA 2QNJA 4FTLA 4GYIA 5C26A 4BCMA 4BWPA 3ZDIA 3ORXA 5KZIA 3QQUA 1AQ1A 2QO2A 3MFTA 2VX1A 1W8CA 4FTUA 2ONLC 4MXAA 3FXZA 4O86A 2BKZA 2VTSA 4IBMA 2UZWE 4NTSA 3Q53A 5HBEA 2VTRA 4QMVA 2RFDA 4Y95A 4FYNA 4J96A 2VUWA 4O96A 4OGRA 4YZCA 2XJ2A 5JRQA 1URCA 3EHAA 5ACKA 1QPJA 5ANEA 3WIKA 3ORLA 3DNEA 3W2OA 2WIHA 4BCNA 5AUZA 3R9NA 4R3CA 4YO4A 3ORNA 5IA1A 3UO6A 5HO8A 4R7IA 1WZYA 3ATTA 4WRSA 3TCPA 5JFVA 1SNUA 1GAGA 5BYYA 1IAHA 2IN6A 4JIAA 4KIKB 2XM9A 3CQUA 3C4FA 3H3CA 2HZIA 1J1BA 4GRBA 4LL5A 4BGHA 3R30A 4CZTA 4QMWA 1OL5A 1V1KA 4GUBA 5ANDA 4AT3A 2A4LA 4C4GA 3QTUA 3R1NA 4JG6A 5HICA 3UZPA 3BV3A 5JT2A 2FUMA 3S1HA 5HIEA 3IO7A 2XNOA 5FM2A 5I5ZA 4EHZA 2C3IB 5AR3A 3PZEA 4IX4A 1NVSA 2YM6A 3L8PA 3N4TA 3MY5A 5TT7A 1XBAA 4EQMA 1P4OA 4RSSA 5J87A 2AC3A 5H3QA 1BL6A 2XRUA 1BI8A 4IWPA 3TG1A 2JITA 3W33A 4WUAA 3FMEA 2XZSA 3VUTA 4ZSLA 5C01A 1KE8A 4BIDA 3VHKA 4DINA 1PXNA 2A27A 2YM7A 4O0WA 2F7EE 4FEQA 2RGPA 2YZLA 1R39A 2YISA 3RCJA 2ZV9A 3Q52A 4RFYA 3ZEPA 1P2AA 3EKNA 3CQEA 3BYVA 2OXXA 3HKOA 3EYHA 4I5MA 5HIDA 2J4ZA 3ENMA 4RX7A 5CNOA 5GNKA 3REPA 2NO3A 3QL8A 4GKHA 3A61A 3V6RA 3R2YA 3RPYA 3PP0A 3BLQA 3K2LA 4MTAA 4L3PA 2HY81 4DFNA 4EK3A 4MNFA 4X0MA 2R3GA 3PLAE 1IA8A 2YM3A 4OTPA 2HZNA 2ZMCA 3F66A 3RI1A 4CFMA 5C4LA 1E1VA 4BKJA 1K3AA 3KXZA 4ANBA 4J1RA 4K33A 3R9HA 5HCXA 4BKZA 3UE4A 3QQLA 3QXOA 4C4HA 5BUIA 5HU9A 2CNUA 3DV3A 3LFDA 5HVYA 3SW4A 3JR1A 4ORKA 4AAAA 4FKWA 1OZ1A 2X4ZA 3LJ1A 3QF9A 2PHKA 4QYEA 2W4KA 1J3HA 4M66A 4Y72A 1GZ8A 4FZDB 4OTIA 3SHEA 4CMTA 3MH2A 4UMRA 3KEXA 3UIMA 4A9TA 4AGDA 1Q5KA 4E6DA 3QAME 5LVOA 4JNWA 5CU3A 3NUPA 2HWPA 4PMPA 3C0GA 1M7NA 4IJ9A 4N6ZA 1FQ1B 4FVQA 4XLVA 4D9UA 1M2RA 3E8DA 4BY9E 4JG8A 4XRJA 1BX6A 3RAKA 4BCGA 3D5VA 2VZ6A 2H34A 4WRGA 2WMQA 2IVTA 2UW4A 3DB8A 3HAMA 3P5KA 3LXPA 2PVMA 5ANGA 3FLYA 5JH6A 3CY2A 2YCRA 2XIXA 3TL8A 3TZ8A 1PYEA 3IOKA 3TNHA 3LCDA 2W99B 4UMTA 4BHZA 4X7QA 2C1BA 2QOCA 3V51A 4DLIA 4PDSA 1A48A 2JAMA 4RIXB 5EHOA 5CXZA 5ANOA 5B2LA 2A19B 3PZHA 1SZMA 3NR9A 1MRVA 2UUEA 4UALA 3NX8A 3UGCA 5AMNA 4DG0E 3I81A 4PTGA 4F64A 4TN6A 1NVQA 3LMGA 2W5HA 2X81A 2I0EA 4RJ3A 4G3FA 4P5ZA 2JC6A 3D2IA 3FMKA 3DKOA 3QTIA 5FGKA 4JR3A 3UODA 3PJ3A 2ETKA 5CAQA 4D58A 2X4FA 5I0BA 3OUNB 3UOKA 5B7VA 4DCAA 3JUHA 1XH9A 4E5AX 4KNBA 3EFKA 4XMOA 2YLFA 3VUHA 4F9BA 4G6LA 5L2WA 4BGGA 2VGPA 3KXNA 1IAJA 3H0YA 4F99A 1PJKA 3HV7A 2V55A 4MXXA 2O0UA 1ZMVA 2CHLA 3QKMA 5CI6A 4GK4A 5CSPA 5A4QA 3DU8A 5M09A 4BTJA 1M17A 4HNFA 4DFUA 1H1RA 3CE3A 3D14A 3BYOA 2V22A 2EUFB 4IHPA 2ITWA 2XYNA 3DXNA 4ZIMA 5HTCA 4K0YA 2WXVA 4O7TA 3CCNA 2JBOA 3LXKA 3QD3A 1U4DA 3PYYA 3HP2A 2WEVA 4ZSEA 3TUDA 3UMXA 4QYHA 5HTBA 3MIAA 4NL0A 4O7YA 4Z7HA 4QMLA 2QONA 4NM0A 2B7AA 3GCUA 5HIBA 4HGEA 2FSMX 4LM5A 5LVNA 4PL4A 4L42A 3GCQA 4XHKB 5BVKA 5JFXA 1MUOA 3LCKA 5IU2A 3KFAA 2WMXA 1FBNA 1MRYA 4PY1A 2QVSE 5A3XA 3VS0A 2ITOA 2QHMA 4BZNA 2Q0NA 5BVNA 3TXOA 2Y6OA 4AN2A 5C4KA 2BRNA 4HZRA 2JKMA 1YHSA 5T68A 2VWBA 4BL1A 3FHRA 2BTRA 2EWAA 2QQ7A 3V5LA 3W2PA 3EQBA 4H3BA 4MXZA 3UYSA 1RQQA 3TUCA 2Y0AA 4R8QA 5E8UA 4EOJA 4HVGA 4L00A 4DG3E 3CBLA 4FTOA 5AR8A 4AA0A 3NCGA 3FHIA 2IW8A 3AGMA 1PXIA 3GQLA 3FKOA 4FSMA 4OT5A 3RM6A 3WZUA 4DH1A 2GNFA 2QOFA 4HVIA 4I6BA 3ZO2A 3L8VA 1OPKA 2GTNA 3PDTA 3P78A 5K9IA 1Z5MA 3UZTA 3N51A 4YBKA 1W7HA 4L3LA 1Q61A 4GS6A 4QT1A 1BLXA 5HORA 5KMMA 1I09A 4RA4A 5D11A 1ZMWA 4O91A 3E3PA 4X3FC 3E5AA 2X8EA 4YJUA 2ZB1A 3CS9A 3FXXA 3R1YA 4JBVA 4YHFA 4I6HA 4NZWB 5GZ9A 4D2SA 2UW5A 2X6DA 3R7GA 4FC0A 4PRJA 1R0PA 3EL8A 1TVOA 1QPDA 3MJ2A 4A4XA 4NT4A 3THBA 2W1ZA 3SOCA 5C8KA 4X2KA 2PVRA 4Q9SA 2XF0A 3U4UA 5ITAA 3F3WA 2QG5A 2OGVA 4BBMA 3F2AA 1H1SA 3TKIA 3VAPA 3CXWA 4DT8A 3PPZA 4PPAA 4C38A 3MB6A 2W4JA 1ZOHA 4ANOA 3L9MA 4B4LA 4BDKA 4B8LA 4JS8A 4DGMA 2XA4A 1FINA 3ORPA 5E9EA 1TQIA 4GT5A 4I41A 5HE2A 2BZHB 3COMA 3ODYX 3DLZA 4LOPA 4O7VA 2UVYA 3OOGA 3G6HA 5TF9A 3E87A 1YHVA 3O8PA 4USFA 1ZYLA 2O64A 3I7BA 3IW7A 3PJ1A 3R7OA 4Q5EA 5K3YA 3AT4A 3HDNA 4D1ZA 2ETRA 3VS5A 3MH0A 2BDFA 5KMNA 4AZEA 3CSVA 1L3RE 3KN5A 4FKUA 1F0QA 3AD4A 3DOGA 1WBOA 4IM3A 4P90A 3W32A 5BVFA 3QTZA 5JQ8A 1GNGA 1XH4A 2WQOA 1IEPA 2V7AA 5HEZA 3R00A 4GW8A 3TI1A 4TTHB 3HMMA 4RC2A 3BCEA 3D7TA 4YP8A 5LARA 5CENA 2VNWA 4FV2A 4O22A 2OH4A 4XV2A 1CKPA 4BWXA 3KRWA 3ZCLA 2ZV2A 1LUFA 4W8EA 3IK3A 3UNZA 1U54B 5FG8A 3RMFA 4C4EA 1PXMA 4K11A 3F82A 2XNBA 5DT4A 4F9WA 4JR7A 4DE4A 4WOVA 1H4LA 1ZRZA 2HW6A 2OIBA 4RMZA 4ZZOA 4I0RA 5K5XA 3AXWA 4J97A 5F94A 2LAVA 4W4WA 5FD2A 4A9UA 2BTSA 2QO9A 1J91A 2V7OA 2H96A 3MFUA 3Q4CA 4HYIA 4RJ4A 4BICA 2JDRA 4HVSA 2OJJA 4WNKA 4J8MA 5CX9A 4F63A 3Q2JA 4IE9A 3R83A 4BYJA 2GTMA 3WE4A 4AA4A 4H05A 3E92A 5CF4A 1FVTA 5AUYA 2OXYA 3G9LX 1DM2A 4UBAA 3TZ7A 4AW2A 4GIHA 3MJ1A 2NNWB 4G9CA 3VS3A 3JY0A 3W1FA 1A9UA 2V5QA 2VGOA 4BCKA 4IZYA 4GVAA 4RWJA 3RNIA 3VQHA 3V3VA 5BVOA 4RG0A 2EXCX 1RDQE 4L46A 1TKIA 2NPQA 2QO7A 2UZLA 4F7LA 3NUSA 4A07A 4EUUA 3DK7A 3QQFA 4JQEA 5A46A 4R77A 4JIKA 4E6AA 4MD8E 2GNJA 2AYPA 2X2LA 3PXRA 4M15A 4K1BA 4TRLA 2XIRA 4U9AA 4YJQA 4RX5A 2PTKA 4TXCA 2FSLX 2HXQA 1UV5A 2CKOA 2GPHA 4XV9A 5HKMA 3G5DA 5CU2A 5F1ZA 3DXQA 2C68A 3TJDA 4KS7A 1U59A 4IFCA 4GJ2A 4Y8DA 4U3YA 4RZVA 4W4VA 4J71A 4YSJA 4JQ8A 4WBBB 3E64A 4I3ZA 1SMHA 1XHAA 4FF8A 4YHTA 4P5QA 4ERKA 3ZO1A 3OW3A 3QTQA 4L53A 4BCPA 3GOPA 4H3PA 4TYEA 4Z3VA 5LOHA 1LEZA 3A99A 4FODA 2BKKA 3CLYA 4Y46A 1R0EA 5CLPA 4KB8A 3ACJA 3C13A 2VTNA 4FIJA 1VR2A 3NCZA 4UWYA 3LMHA 3TDVA 1S9IA 2CGXA 3COKA 2H9VA 2C5OA 3ZUTA 2ITTA 3CTHA 4NM3A 2BAKA 2G9XA 1OMWA 4QP2A 5I3OA 5JRSA 3L9NA 3TJCA 1QL6A 4FKTA 4JDJA 4C3PA 5CANA 1ZARA 3Q2MA 4AACA 4YZDA 5B0XA 3DKFA 3DT1A 4F7JA 5AP1A 5JFSA 2NRYA 3MTFA 3Q9ZA 1G8SA 4F65A 1H1WA 5LMKA 3FY2A 4NU1A 4PQNA 4R1YA 2WNTA 2R3MA 4PNIA 1PYXA 5HVJA 3JVRA 2VNYA 3RWQA 4S2ZA 5FTOA 4LL0A 4MVFA 4NFNA 2RFEA 2YA9A 2VTLA 1Z9XA 4BC6A 3T8OA 5A6OA 3PJ2A 5AUXA 2I1MA 5AAEA 1SVGA 3IG7A 4FT0A 4FIFA 4IVAA 2WIPA 5DE2A 1P4FA 4I6FA 1H28A 2UZBA 1TQMA 3FLWA 3PA4A 4WD5A 3HYHA 3EMGA 1ZWSA 3WZKA 2BR1A 5I9WA 3A60A 3IGOA 4A9RA 4V01A 4E6CA 3QRIA 3I6WA 4CEGA 2I6LA 4E4MA 5AUWA 2FVDA 2VV9A 1WBTA 5HO7A 2CGVA 2WKMA 4OTRA 3SRVA 4RIYB 3VQUA 4DC2A 3V5WA 4M84A 3KRLA 3ULIA 1UKHA 4DEIA 5AV2A 3SGCA 3C1XA 3EKKA 3IPHA 5AP5A 2HELA 3GOKA 3BHTA 3RHKA 3IQ7A 5AP6A 3EZRA 3ZC6A 4YJSA 3DBDA 2GU8A 3A8WA 2HYYA 3LHJA 5DI1A 4A9SA 2Z02A 4NEUA 3HV5A 2R3RA 4ZY6A 5ICPA 2G2HA 2BZJA 3W8LA 3PVWA 4DEGA 2R4BA 4KSPA 3C4ZA 3G33A 2VWWA 2GNGA 5DPVA 1O9UA 4X3FB 4H58A 4FVPA 4XG9A 3O0GA 4G5PA 3R7UA 4DH7A 5EKNA 5AX9A 5D41A 5I9UA 3KK8A 2CNQA 2X8IA 5LCKA 2IPXA 2ZM3A 4JRVA 4CXAA 3OCBA 1T46A 1B6CB 2VTQA 1ZLTA 3EYGA 3PPJA 5J8IA 1PXOA 4FKQA 1OKVA 3RPVA 1M2QA 3DBQA 4FKLA 3BBTB 2JEDA 2PZRA 4LOQA 2F4JA 3OD6X 1YOMA 2BHEA 3MTLA 2DWBA 3Q6WA 1WBNA 1REJA 3DCVA 3H9RA 4HGLA 3O50A 3T3VA 4E26A 5HO6A 1PXKA 2ETMA 2QD9A 4LGHA 1FMOE 2XIZA 2XKFA 3HMOA 2UW0A 3ZO3A 5L2QA 3BGPA 3A4OX 4X2FA 5FBNC 3G15A 5KBRA 3P9JA 5FTGA 4O6LA 2J51A 4G6NA 4XV3A 4MWHA 2HW7A 4BRXA 3KXGA 5HVKA 3U55A 4YGAA 5AUUA 5K4JA 3UIXA 3F5PA 4UWCA 2UW9A 1WVXA 2XNNA 2FGIA 3GVUA 5EDPA 1JWHA 3O71A 2E2BA 5HCZA 3TTIA 3AMYA 3QD2B 5L2IA 4ZS0A 4FNXA 4GVJA 4U7ZA 3KULB 2VTPA 4KBCA 5KMLA 1XH7A 3BWFA 4QO9A 2NRUA 1ERKA 3MVMA 1YWNA 1SNXA 4IWOA 1ZOEA 1Q4LA 5FLFA 5DFPA 5DH3A 4CFXA 3F2NA 2X2MA 4FIHA 4GK3A 4GV1A 4C3FA 4O7RA 4TNDA 2FSTX 3OWLA 3U87A 4P7EA 4AFEA 4EKLA 5DIAA 3DBFA 3ZLYA 3D5WA 3IDBA 3ID6C 1XH8A 4BVUA 3PE1A 1KE6A 3DJ7A 3LOKA 4UMQA 5HBJA 2J0IA 4ITIA 2CDZA 4IAFA 1ZYJA 4V0GA 4KS8A 3BBWA 2BZKB 5EQPA 4QTBA 3R8MA 3UO4A 2YABA 4EBVA 1NVRA 2JKKA 5A9UA 2H6DA 4GJ3A 2XP2A 2E9NA 3V5PA 3SG9A 4E7WA 3D94A 4GFGA 4F0IA 2PE2A 4FKVA 2O8YA 4AQCA 3NNUA 1E1XA 5ETFA 1Q8WA 2A2AA 2OFUA 3EQDA 4F08A 4GG5A 1WFCA 2GCDA 5HLWA 2X7FA 3OMVA 3W8QA 2GQSA 2FO0A 3V8SA 5E8SA 3LW0A 3V5JA 4TT7A 1ZYSA 4YTHA 4O0RA 3GBZA 3GUBA 3MPTA 1T45A 4YLJA 5GZ8A 3ANRA 2R3HA 3W2QA 2WAJA 3ZM9A 2OLCA 2QR7A 3GU5A 1YXVA 1UA2A 3ZC5A 3FLQA 5EYMA 1G3NA 2W4OA 3JYAA 5IQFA 4FTMA 3D0EA 2EXEA 4E20A 5CVFA 4UWBA 3FLSA 3R1QA 4BI2A 3HUCA 4EOPA 4F6SA 4OBQA 3NUAA 4TYIA 3MBLA 5FWKK 3WIGA 3D2KA 4CTCA 2HWOA 2WQNA 5BYLA 3F7WA 4C7TA 5FXRA 2VO7A 2VWZA 3I7CA 3PUPA 4L8MA 4QMPA 4D4YA 5GIPE 3I4BA 2OW3A 4AF3A 3F7ZA 3MVHA 2WMWA 3V8TA 5DYJA 5J9YA 2CLXA 3FE3A 3TTJA 2YN8A 3VBQA 4CQGA 4R5SA 4IZAA 4DFZE 2HZ4A 3C4EA 2GS7A 3DAKA 3L8SA 4RVMA 2BFYA 4IH8A 4AW5A 1Y57A 2UZDA 3QX4A 2IJMA 2OO8X 5DG5A 2WU7A 4DH3A 4AU8A 2DQ7X 2WQBA 3F5UA 3NYNA 3RAWA 5C1QB 3QRTA 4CFFA 4QTEA 5CU0A 2YFXA 4IEBA 4QP9A 1KE9A 4FT7A 5FBOA 3NVMB 4BDAA 3HRCA 5FP6A 5M08A 5F95A 3OY3A 2P2IA 2ZV7A 3VJNA 4BCHA 3BZ3A 3GFEA 4DH8A 4LMNA 4IC8A 4PUZA 5AV4A 1H07A 2PZYA 2R3QA 3EQGA 3HMIA 4ENXA 4S32A 5M4UA 3R6XA 4IM0A 1J7UA 1W82A 4FMQA 5BMMA 2IW6A 4AXAA 1PMNA 4FSRA 2I0YA 3QCSA 4U5JA 3NRMA 5DR6A 4PDPA 2OKRA 2C3KA 2DS1A 4O82A 3TWJA 4USEA 2Z7RA 3E8EA 4BBFA 3RGFA 4IW0A 2PMNX 3ZUVA 4DFYA 2VWYA 3CC6A 5HESA 1HCLA 3LFNA 4RJ5A 4TYHB 4DYMA 2WMBA 3BE9A 3FBVA 4EH9A 4NW6A 5IEVA 2PK9A 3MVLA 4ALVA 3CPCA 4YR8A 1OM1A 4RLLA 5IQGA 2ITZA 4QP3A 3KCKA 4HOKA 4XG2A 3AG9A 1H0WA 4OBPA 4RIWA 3EIDA 4IAZA 4YHJA 4U43A 4DTBA 2CMWA 2PVYA 3DA6A 2C6DA 3GU4A 4YC8A 4LGDA 3TEIA 3UG2A 2XJ0A 2OIDA 4RC3A 2GS2A 2OJ9A 3FZRA 4RRVA 4H39A 2PUUA 3SKCA 3OOMA 4U81A 3TNPC 3PY0A 5AP7A 4B9DA 1YOJA 4B0GA 1PW2A 3Q32A 4L67A 3UMWA 3QLFA 4TWNA 1M2PA 4YJOA 4D2RA 4O6EA 5FRIA 2BIYA 5AV1A 2J90A 4YURA 2C1AA 3RVGA 1OBDA 4O0SA 5DEYA 5E90A 3R71A 4APCA 4GIIA 4S33A 3O96A 3MFRA 3PPKA 4EWHA 5M53A 3N4UA 4FKPA 1U46A 3ZM4A 2QLUA 3Q4ZA 3GNIB 5G6VA 3Q9YA 4H1JA 3VS1A 5IH6A 3FYKX 4OLIA 2VN9A 5BPYA 3R8UA 4M97A 1F3MC 4YLLA 1H27A 2VTMA 4QPAA 4MQ2A 4ZXTA 1KWPA 2QOKA 2C5VA 4LI5A 3QTRA 4DEDA 2R3PA 5EM6A 3DB6A 4DEHA 3EB0A 2WTVA 1O6YA 1H1QA 2VD5A 4MF0A 4EBWA 3CPBA 4R7BA 4FZAB 3FMJA 2W1EA 2J6MA 3GP0A 4YC6A 2W1DA 2P55A 4KIQA 3SC1A 3VS7A 3VJOA 1VZOA 4YJNA 3FI3A 4F1MA 3OEFX 3EWHA 3FWQA 3O8TA 3OROA 4JQ7A 4W4XA 3DK3A 5HG7A 1BYGA 2B9JA 3NUYA 3QTWA 4NIFB 5CQWA 3UDBA 3FUPA 2VWUA 4KA3A 3ACKA 4C35A 4D55A 2XH5A 4QQTA 3LFFA 2P0CA 3NYXA 3F9NA 4J8NA 5HGIA 5TE0A 3QGWA 5KMIA 5T3QA 5J1VA 4CFNA 4QMMA 3BYSA 3COHA 3KRJA 4AT5A 4TKSA 4IB5A 2WHBA 4QRCA 2XNEA 4GYGA 1PF8A 5BYZA 1OKZA 2ZB0A 4FOCA 3M2WA 3B8QA 2VX3A 3PXKA 3OXIA 3QZGA 5HE3A 2JFMA 5CZIA 3QU0A 4ZMFA 2YERA 3KB7A 4RJ7A 3NUUA 3UQCA 4NSTA 1YI3A 3U54A 4KUJA 4ARKA 2C0OA 3DJ6A 5CAUA 1KSWA 3PWYA 4FKGA 4BDCA 1YOLA 5M57A 2REIA 2WPAA 3HA8A 3R8VA 2Y8OA 3MGYA 4YJPA 1SYKA 3PJCA 4NCTA 4ZP5A 5F4NA 4FGRA 5IDPA 3C9WA 2UW3A 2Y4PA 3BX5A 4RPVA 1R3CA 2F2CB 4F0FA 4N0SA 3LFCA 3OWJA 4KINA 5CASA 4M7IA 4LRKA 3LFAA 3QRUA 4AN3A 4FBXA 3NW7A 2C47A 5J9ZA 3O7LB 4UZDA 5T6KA 2RKUA 5IA3A 2ZJWA 4KKEA 3QGYA 2ESMA 1DI9A 2KTYA 2C6KA 3LCTA 2VTTA 1PMEA 2W5AA 3LE6A 4OW8A 1FGIA 1PMVA 3ZLSA 3BLHA 3C0HA 1NY3A 2GSFA 4K8AA 4FTAA 1Y8YA 4NH1A 4D0XA 4KIKA 3T9TA 4FSZA 4G3CA 5IISA 1LR4A 4FKRA 3UBDA 3D7ZA 1Q3WA 5CQUA 1KOAA 5KMJA 2RIOA 4L68A 4EH7A 4DF3A 2FSOX 4RA5A 3QD4A 4MF1A 4FG8A 4YTFA 2ITVA 5JKGA 3ZSGA 5IPJA 3ZRMA 4GCJA 4WO5A 5H8EA 2G2IA 2PVLA 3FXWA 4GK2A 4YTIA 3SQQA 3TDWA 3TV7A 3KMUA 4CRLA 2RF9A 2W1CA 3ORKA 4XBRA 4IC7A 4USDA 2JAVA 2JKOA 4S34A 3QXPA 3ZMMA 1BL7A 5A14A 1ND4A 1V0PA 3RINA 3EQCA 5IQBA 1UKIA 5IQAA 3DPKA 4BGQA 1Q41A 3QYWA 2VWIA 3WYXA 4C36A 4E5BA 2WZJA 4FG7A 4EEVA 2PSQA 4BFMA 2E9PA 1WBVA 1XBBA 1JKKA 3QHRA 3E62A 3NWWA 2B9FA 3UTOA 4W4YA 4M12A 4YNEA 5KE0A 4EOSA 3MW1A 5HLNA 2CKQA 5FUTA 1HCKA 3NW6A 1UVRA 5AM6A 4U42A 4FV0A 5EI6A 3FZ1A 4EOMA 3FKNA 4MBLA 3RHXA 4FV9A 4ACMA 3SLSA 3A7HA 4IB3A 4AGCA 3R2BA 4UYNA 5K4IA 1Y6AA 2WTKC 4QYYA 4FTRA 4AUAA 1G5SA 3DNDA 3QD0A 3A7GA 3Q5IA 1XH6A 3BU6A 2J0MB 1Q24A 2ERZE 2R7BA 1APME 4CYIA 3V5TA 3ZLXA 4A06A 4YMJA 2YJSA 2XB7A 2CLQA 3BHHA 4UV0A 4XV1A 4XRLA 4IX6A 5HNGA 4AZTA 3C50A 2I0VA 5AX3A 2XK7A 5IKWA 5FP5A 3CGOA 3H9FA 4FV1A 4I5CA 4I4EA 5H2UA 5M07A 3KXHA 2CN8A 4QQ5A 4Q9ZA 5CF8A 4O1OA 1W84A 4UXLA 5CSXA 4YTCA 3NPCA 4F7SA 5IMEA 4H1MA 3LKMA 3E88A 3ALOA 3R04A 2R3NA 3KQ7A 4GUEA 4R6VA 4OAUC 4FE2A 4IDVA 2WTJA 3UPXA 3R28A 5G1XA 2BRHA 1S9JA 1O6KA 2FA2A 4M0YA 2YIRA 2G01A 2OH0E 2V0DA 4CKIA 1YWVA 2JDSA 4FV4A 1LPUA 4ACCA 2IZUA 4FSQA 2YIYA 5J79A 3HNGA 4HYHA 4BDFA 1R78A 3K3IA 4G2FA 4CFVA 3C5UA 2PE0A 2BHHA 2CCHA 2JD5A 3O2MA 3EQPA 2RFSA 3Q9XA 3SA0A 4DT9A 3OVVA 4YZBA 5JK3A 4CZYB 4C33A 3FV8A 4JDIA 5EI2A 4D2VA 3QCXA 3Q5ZA 4BR3A 1UU3A 1FMKA 3PXFA 4EZ7A 5D12A 3CY3A 3R9RA 2F49A 4G34A 4RIXA 4X2GA 3AC5A 4MD7E 5EM7A 5FXQA 3ZFMA 4GKIA 3UC3A 5EK7A 3CGFA 5AJQA 4GEOA 3RTPA 2W06A 3V04A 4I5HA 4QMSA 1M52A 3FPQA 1OIUA 5EQYA 4JJRA 4QMXA 1WAKA 1AGWA 3EQRA 4IM2A
chains in the Genus database with same CATH superfamily
1M14A 3AT3A 4NUSA 5DRBA 4BBEA 4QMNA 4L52A 3ZLWA 3HECA 3E63A 3U4WA 4HNIA 5E7RA 4IDTA 2XALA 2WMAA 2YCQA 1HOWA 1XWSA 3GCVA 3QBNA 4N70A 2QOQA 5BVWA 2VRXA 4FV8A 1MQ4A 4ZSJA 3QQKA 5HNBA 4HVDA 4ZTNA 5IDNA 4FTIA 4PL5A 4BCFA 5IEYA 4ANSA 5LVMA 4E4LA 1OUKA 4YU2A 5AR5A 4FG9A 5DBXA 2CNVA 3FZTA 4CG8A 4I24A 3PFYA 4EH4A 2PZPA 1KOBA 2PPQA 3F3UA 3OP5A 4BCOA 4FL2A 4FX3A 1ZXEA 4FV5A 4NW5A 2ZFYA 3ZSIA 3ZRLA 1Q99A 4HYSA 2VTHA 2C69A 3P0MA 3TN8A 3KF7A 3V6SA 3D83A 4GU9A 3LQ5A 3QWKA 4R5YA 5H8GA 4APPA 3F3TA 2GQRA 4E6QA 4BDEA 3QHWA 3WF6A 3BHUA 3BHVA 3OFMA 2GHLA 4RFMA 5DWRA 4WG5A 3UP2A 2J5EA 3LXNA 2R3KA 2RSVA 3OG7A 4KABA 4AWIA 3QTXA 1Z57A 2B53A 4FSTA 4GT4A 2BFXA 4MKCA 1UU9A 3FQEA 3LFEA 4I21A 4MEDA 3R7EA 1H08A 1YXUA 1IG1A 5IUGA 1G8AA 3QZFA 5M06A 2XK3A 4M13A 4IX5A 2PZIA 3FZPA 4ANQA 3BU5A 4CLIA 5H8BA 5JFWA 1NT2A 4AXDA 2PZ5A 3CKXA 4AGWA 4EH6A 2VTOA 2BAQA 3SXFA 4GU6A 5ETAA 3LM0A 4EKKA 3TNWA 3O17A 4EHGA 2XKCA 2HENA 5BVEA 4DTKA 4R3PA 3BLRA 5C8MA 5LWMA 2PUPA 3ELJA 3V8WA 3EOCA 3FY0A 5FEDA 5HG8A 4BI0A 2ONLA 3SRVB 4O7LA 3R9DA 3ORIA 2ZAZA 2C3LA 1OL6A 3EN5A 3CP9A 4F70A 3HDMA 3LJ2A 5CSHA 4C4JA 3EQIA 5IQHA 4WNPA 2IZRA 5HBHA 1H0VA 3QUDA 2YACA 2OZOA 3POOA 4GH2A 1PXPA 4CYJA 3D4QA 5L6OA 5HLPA 2WB8A 3R9OA 3KREA 4O7WA 3PJ8A 4D2WA 3F3VA 3F61A 4FZ6A 4H36A 4MXYA 4TWCA 2OF2A 5JGDA 5J5SA 3ZRKA 2O65A 4B8MA 4F0GA 3UP7A 4LG4A 3FDNA 5TKDA 4EH2A 4PWNA 1UNGA 3QCQA 1ZY4A 2IVSA 2Q0BA 3F88A 2W1HA 5D7VA 3OCTA 4CV8A 3OW4A 4NKSA 4IXPA 3VUGA 2CKEA 3HEGA 4FT5A 4PDOA 2FH9A 3UIUA 3SW7A 1WVYA 3OT3A 3D15A 4C4IA 2A0CX 4RT7A 3OWPA 1X8BA 3JPVA 4N4SA 2YDKA 5HG5A 5A4CA 3COIA 3P23A 4ANNA 1XJDA 3HV4A 4G5JA 4BI1A 3L1SA 1OI9A 2B1PA 4O7SA 2E9UA 5GJGA 3BPRA 2YCSA 4LRJA 3TNIA 3PLSA 2YLEA 2G2FA 4ZJIA 4AA5A 2YCFA 5C27A 4G16A 3QZHA 3MPMA 3ZUUA 5I9YA 2WU6A 5IG1A 4LV7A 4C02A 5L6WL 2OG8A 2JFLA 4D0WA 2XIYA 3WE8A 4F6UA 4XOZA 2YHVA 4J52A 4OTWA 2ZDUA 2C6MA 3LLAA 4L7FA 3NNVA 5CYIA 4C58A 2C30A 3E8NA 4WSYA 4XG6A 3SOAA 4DCEA 3W0RA 4ZTLA 3PVUA 5M55A 4O1PA 3G51A 3NZ0A 2W1GA 3RK5A 1U5QA 2VTJA 4YPSA 3L8XA 4FT3A 2WTKB 4KRCA 5I9XA 5LXMA 3QZIA 2XK6A 4A4LA 3VIDA 2CN5A 3IW6A 4ZZNA 2Z7QA 4M0ZA 1OL7A 4I94A 4ZTRA 4AX8A 3TM0A 5I9ZA 4WNOA 4C59A 2B55A 2ITNA 4KBKA 4RQKA 4K18A 4ZLOA 3U6JA 5JMSA 4BIEA 3RK7A 4ID7A 4O2ZA 4B6LA 2XANA 1ZZ2A 3TV6A 3GCPA 2VWXA 4BDDA 4Z7GA 3A8XA 3QRKA 5J7HA 4DFBA 3BGQA 3FC2A 4ACGA 4R78A 4UMPA 3A7FA 4PTCA 1YHWA 4FK3A 2PY3A 2XK8A 3ENHA 4IB0A 4WSQA 3SAYA 4CRSA 4MH7A 4E4XA 3N4VA 4QDVA 3BGZA 5IA0A 4ZMEA 4FK6A 3O7LD 4XG7A 4FICA 1U54A 4TYGA 3KMMA 4XOYA 3ERKA 4EK5A 3T3UA 2WQMA 3HGKA 5I4NA 4FRFA 5EQEA 5I9VA 5AWMA 4IAKA 4CNHA 2WOTA 3VHEA 3NW5A 4OR5A 1P5EA 3LFSA 2ACXA 5E4HA 4BTFA 5HX8A 1YW2A 4NTTA 5M4CA 3GC0A 3R01A 2HK5A 4P2KA 2DYLA 1PMUA 4MWIA 4PTEA 2WGJA 3LZBA 4XG4A 2OJGA 4FYOA 4IACA 1DI8A 5CTPA 1OUYA 4NFMA 4O0YA 2J5FA 4G1WA 3U6IA 3DAJA 3ITZA 1NA7A 4ZS4A 2BDWA 2XCKA 3N9XA 3VW8A 5HX6A 2WOUA 4FKSA 1YDSE 4U40A 2OZAA 3HRFA 5AFVA 3PIXA 2HAKA 3EQFA 3GU8A 2B9IA 4UEUA 4I0TA 4ZTHA 4BYIA 3MVJA 1GIIA 2R9SA 4ITHA 4M8TA 3NNWA 1OL1A 5BV3A 5HNIX 3VUDA 3NSZA 4O83A 3QRJA 4CV9A 3GFWA 3P86A 3CIKA 4BTKA 2GQGA 4ACDA 4EL9A 5JGAA 3EQHA 4FNZA 4NKAA 2IO6A 5LQFA 2ZVAA 3IW5A 4BDBA 4IIRA 5E8TA 3C4CA 5CF5A 3Q60A 3TT0A 2R5TA 4FIGA 3UZRA 4X2JA 2XRWA 3HA6A 3MSSA 1FPUA 4HZSA 3RNYA 3QX2A 2WMSA 3VULA 3R8PA 3DFCB 4R7HA 4FJVA 4AT4A 3DTWA 1V0BA 2Y4IC 2UZNA 2PYWA 3DAEA 4EOLA 4HVHA 4U41A 4CKRA 3GT8A 1Y6BA 2C6EA 3NAYA 4QMTA 4FI1A 3WZJA 3BELA 3E3BX 4JG7A 3KN6A 3IKAA 4ZTQA 2Z60A 3JXWA 4BZOA 4XEYA 4EQUA 2GDOA 4GG7A 3MB7A 3WZEA 2IWIA 4FEXA 3EZVA 4R1VA 4HCVA 4KBAA 5FTQA 1SM2A 2PWLA 5ETIA 2YIXA 4XP2A 5KX8A 5LJJA 4O7NA 3ORTA 4OUCA 2HXLA 2LGCA 2R3IA 5CEQA 3R22A 1OIYA 3DZOA 4AZVA 1WMKA 3MA3A 3ZZWA 2Y6MA 3FMDA 4Z16A 3SXSA 4W9XA 3Q9WA 4RVTA 3ORMA 3ZO4A 3V01A 2Z7SA 1FVVA 1ZY5A 5LMBA 2O5KA 5FM3A 1YXSA 2FYSA 2BVAA 3KRRA 4EK8A 3M1SA 1WVWA 4L7SA 4G3GA 2R0UA 3MY0A 4E3CA 2C6TA 3ZYAA 1XR1A 2HCKA 3GB2A 1XBCA 4D1XA 5CAVA 1PHKA 3LFQA 3L9LA 2W96B 4M3QA 2B4SB 2SRCA 5HOAA 3PSBA 5CVHA 2B0QA 3R7IA 3H0ZA 5HI2A 4M68A 4LUDA 3VRYA 2FB8A 1XKKA 2V62A 4ZY5A 4HCUA 4ACHA 5HU3A 2H8HA 5HQ0A 2UZEA 4RWIA 3HV3A 5EYCA 5L4QA 2PL0A 2WFYA 2XKEA 5EFQA 5JGBA 4U8ZA 3KK9A 4RJ8A 4DHJA 4YLKA 4ERWA 3TKUA 5KKRC 1QCFA 5M51A 3MYGA 2OFVA 3FMNA 4WNMA 1G8KA 3A7IA 1Y8GA 4WA9A 2C0TA 3GENA 3P7CA 4IAYA 4UMUA 4FTCA 4CKJA 4EJ7A 3ROCA 3AMAA 1JKTA 5AIRA 3GU6A 4FGBA 4F6WA 4UXQA 2R7IA 1YWRA 3I5NA 3PY3A 4GMYA 4CSVA 4DFLA 3EFLA 3PWDA 4IAAA 1DAYA 1CMKE 4K9YA 1OKYA 4X3FA 3VW6A 4EK6A 3C51A 3F5GA 1H1PA 4JBPA 5E1EA 3W2RA 3U6HA 3PG3A 1ZAOA 3FPMA 3VBVA 1FOTA 2X1NA 2RFNA 3GCSA 4QMYA 5KZ0A 2XARA 3SDJA 5BNJA 3DTCA 3NYOA 5DOSA 5EKOA 2WEIA 3QQHA 2GHMA 3BKBA 1CSNA 4WG3A 4YZNA 2HY0A 5LVLA 3I5ZA 2F7XE 4CFUA 5CXHA 2XK4A 3C7QA 3PSCA 1TQPA 4CQEA 3H30A 4HW7A 4QP7A 1KV2A 3C5IA 2BUJA 3EN6A 3NUXA 4RGJA 3VS6A 2RL5A 1JNKA 5EH0A 3SV0A 3QFVA 5CT0A 4M14A 2YDJA 3OHTA 2WQEA 3GQIA 3QUPA 4S30A 1STCE 4FZFB 4C0TA 4PP7A 5CEMA 5IQDA 3HL7A 3W2CA 5A4TA 3FC1X 1VEBA 2ZOQA 4AOIA 4IADA 3ET7A 1J1CA 1VYWA 3PA3A 4YJVA 2BILB 1GZNA 5CT7A 5FEQA 4O4BB 3WF5A 3EN9A 3H10A 3MV5A 2IF8A 4FIIA 4EQCA 1OBGA 1H00A 4L3JA 3R1SA 3ZFXA 2IVVA 3ROYA 5A4EA 4QPMA 3Q3BA 4F78A 2AC5A 5BX0A 2J7TA 3IGGA 3QA0A 2C5XA 2XS0A 2JKQA 3KULA 2YIQA 1OECA 2PVFA 3B2TA 3KGAA 4JOAA 4ENYA 3DBCA 2JLDA 3VBWA 3SG8A 4I4FA 4QPSA 1KV1A 5BQ0A 1J7LA 3QKLA 4FSNA 5IA2A 1WBPA 3BQCA 2RG6A 4J99A 4FEUA 2EU9A 3FEGA 1QPEA 3LCOA 1OIQA 2UV2A 1DS5A 4FTKA 4IZ5A 2VU3A 3TUBA 1L8TA 4XS2A 4L6QA 3BV2A 5EM5A 4A4OA 2OJFE 4HJOA 1YRPA 2F2UA 4YNOA 5BVDA 3KKVA 3BEAA 2WMTA 4FTQA 3T9IA 4E5WA 2PUIA 5E8VA 1YQJA 4XP0A 5K0KA 2BMCA 3RALA 3EFWA 1FVRA 2CPKE 4C4FA 2XEZA 1PY5A 1QMZA 4RWKA 1PXJA 4BIBA 4GFOA 4LFIA 5LWNA 3KRXA 4FOBA 2YJRA 3OY1A 3KA0A 3FI8A 3CJFA 3ZOSA 5DGZA 1UU7A 5AA9A 2OXDA 4DAWA 5ANJA 5D1JA 2XKDA 3KCFA 5DMZA 5TOZA 3MN3A 2WTDA 3BYUA 4TYJA 3RK9A 4CLJA 5FXSA 3ANQA 4CMOA 2JIUA 4M69A 3HRBA 3NIZA 3ODZX 5BUJA 5AIKA 5E8YA 5J95A 2X7GA 5ACBC 5EW9A 1LEWA 4GSBA 1JLUE 2XYUA 1GZOA 2QCSA 3QTSA 5AA8A 3PVGA 3QWJA 2CSNA 1XH5A 3GI3A 4GT3A 2E9OA 3HVCA 3S4QA 2WELA 3FYJX 3LJ0A 2G1TA 4FSUA 1ATPE 3AC2A 5KMOA 4MHAA 4Z55A 4JX7A 1OVEA 2O2UA 1JVPP 5ANKA 3NMUF 5M44A 4WHZA 3KXMA 2XM8A 1ZYCA 5D9HA 5LMAA 3UDSA 3LQ8A 5CNNA 4PMSA 1OITA 4OTHA 3UOHA 3CJGA 1Q8UA 2GNHA 3NAXA 3DGKA 3HX4A 4NM7A 1UWJA 1JAMA 4C2VA 2WD1A 3W18A 4C34A 4NK9A 3S0OA 4QTAA 4BZDA 5GHVA 2QR8A 3TZ9A 2R3JA 3DZQA 4O38A 3WBLA 5LMKC 4MNEA 4QDEA 2VTAA 2C5NA 4YSMA 2VWVA 3ALNA 3GC9A 5KCVA 3K54A 1GOLA 1DAWA 4I0SA 3RP9A 4BKYA 1J7IA 2YM8A 5KHXA 3FL4A 2VTIA 1P14A 3FQSA 3G9NA 4O0UA 4OT6A 4PL3A 5KUPA 2UZUE 5IUHA 5D10A 3CD8A 2Y4IB 3ZS5A 4NM5A 4QYGA 2UW7A 4JBOA 5L2TA 4BDJA 4OTDA 2OWBA 5CI7A 3DLSA 4FV7A 4UYAA 4XG8A 4GFMA 5E1SA 4F1OA 4MAOA 4CTBA 2F57A 1CDKA 4RZWA 3UC4A 4I6LA 4BTMA 4X6RA 3E93A 2YITA 3UQFA 3GXLA 1E9HA 3DFAA 3G6GA 4O27B 4JBQA 3VS4A 2JIIA 4D1SA 4IVDA 2WMRA 4AZSA 4D4RA 3H9OA 3B8RA 1GIHA 3G0EA 2PUNA 4DBXA 5B2MA 1GIJA 4FKJA 1W98A 3I0QA 2QC6A 4J7BA 5E8WA 4O84A 5CEIA 2R0IA 4BCQA 4DTAA 4FUXA 4J98A 4C61A 2QI8A 3KXXA 4BCJA 3PRIA 4DG2E 5M56A 4DHIB 3S3IA 2YM5A 4EOQA 2ZMDA 4TYHA 3VF8A 5B2KA 4DEEA 2Q83A 2IG7A 4GL9A 3ZZEA 3VBYA 4ZJVA 3F69A 3QKKA 3P7BA 4FL3A 1YKRA 2GS6A 3TNQB 4C57A 3DK6A 4IWDA 4ZK5A 2XUUA 2F7ZE 4L43A 4BB4A 3Q4TA 3QQGA 1GY3A 4DITA 3WF7A 3DBEA 5FEEA 4AS0A 2BDJA 3UVRA 4ASXA 3AOXA 4I22A 5ANIA 3RAIA 4O21A 3TACA 3GEQA 3BU3A 1GJOA 2PVNA 3TIZA 4FSWA 5FQDC 1UWHA 4WIHA 5E91A 4CCUA 2UZOA 4TNBA 3LAUA 4CGAA 3P7AA 2CJMA 2QLQA 2JBPA 3R21A 4RX8A 4RX9A 3RZFA 4Q2AA 3OXZA 3ULZA 2C3JA 3ZTXA 4QQJA 5DR9A 2VO3A 4LRMA 5AAFA 4FNYA 4EJNA 5KKRB 1B38A 4AP7A 5AP0A 4ASZA 3SD0A 4D2TA 2GNLA 4I1ZA 4FV6A 3Q04A 4FV3A 5EW3A 1JSVA 5C8NA 4X3JA 4KKHA 2XCHA 3BIZA 3EN4A 3ZDUA 4N57A 3QA8A 4ITJA 4EONA 2X9FA 1JSUA 5DEWA 5E8XA 4I93A 4V04A 4E93A 3DDQA 4QQCA 2UVZA 1URWA 4FIEA 3RJCA 1FGKA 3K5VA 4RJ6A 4BHNA 3O51A 4QD6A 4F7NA 4PMTA 2YWPA 4LV5A 4CFWA 5L8LA 3U51A 4RLKA 2ZM1A 3D5XA 5F9EA 3KY2A 3NYVA 2C4GA 5IQIA 3FZSA 4EH8A 2O63A 3NLBA 4LMUA 3QC9A 3NIEA 3BQRA 1K2PA 2WTCA 3HP5A 3UOLA 3WYYA 3CTQA 4EC8A 1SVHA 1JKSA 3JY9A 2OIQA 4NIFA 5J7BA 4DHZA 3NUNA 3W10A 3I60A 3ZONA 5CSVA 5L6PA 3C4WA 1RJBA 1TZDA 3A4PA 3QQJA 4IB1A 4F9YA 3D7TB 3VN9A 1Q8TA 4K2RA 2Y9QA 3IONA 1ZZLA 2QOIA 2X2KA 2PE1A 5CU4A 4JL9A 1YDTE 4FZ7A 4C37A 3MH1A 1R1WA 4W9WA 3ATSA 3WF8A 4DEBA 4QMZA 3OTUA 5DNRA 2XVDA 1RE8A 3LFBA 5EI8A 1YI6A 2JDVA 3VBTA 2UVXA 4JDKA 5CVGA 5A6NA 2A1AB 4I5PA 4BCIA 2XNMA 2ITUA 5KNJA 3LMIA 2PMOX 3W2SA 2GNIA 5IQCA 4XX9A 4W8DA 4O4DA 4XH6A 4JI9A 4NWMA 2PU8A 4ZLZA 2I40A 2QHNA 4PPBA 2CGWA 4RIOA 5HE1A 4IX3A 3TV4A 4G3EA 1KE5A 1PKDA 3FI4A 5KBQA 1UNHA 3IOPA 3ML1A 2OJIA 1H8FA 4EOKA 2QOBA 2B9HA 4WG4A 2BROA 2X0GA 2W05A 3Q96A 3ZSHA 1GZKA 4DHFA 3PXZA 3D5UA 3OCSA 3BYMA 1WCCA 3SVVA 2OI4X 3BE2A 4NYEA 3F3ZA 1VJYA 3UYTA 5C03A 5H9BA 4B7TA 1JOWB 1REKA 1H01A 4N6YA 2ZM4A 3VUKA 5IH4A 4FEVA 3AGLA 3UPZA 1I44A 4U97A 3OBGA 4OTFA 3GC7A 1BMKA 4YUQA 3PG1A 1NW1A 3EH9A 2XNPA 4LQMA 4PPCA 2J0KA 3PP1A 2XJ1A 4G31A 3WILA 3ZFYA 5KHWA 3O23A 3QUEA 2WMVA 2XNGA 4EI4A 4I92A 4QNYA 2J50A 1QPCA 5HE0A 3NDMA 4KD1A 3RZBA 5AP2A 4DGOA 5HCYA 5CEKA 5EOLA 4C62A 5K5NA 3AD6A 2CKPA 5JEBA 4L45A 4QMUA 5DHJA 3R73A 3K3JA 5EM8A 4MX9A 2X8DA 5JZJA 3LQ3A 4ZOGA 1UU8A 3IW8A 4QP6A 3UVQA 4F09A 3P1AA 2QOLA 4I6QA 3ZEWA 2Y7JA 3GGFA 3VUIA 5CAPA 3R7YA 4ALUA 2BCJA 4ZY4A 4IWQA 4F1TA 4BDIA 4U0IA 2W5BA 2J0LA 3MH3A 3S95A 3ZHPC 2BRMA 4D5HA 4D5KA 5CEOA 3IS5A 3F6XA 1V0OA 2OU7A 2YDIA 4HGSA 2W17A 2P4IA 1BKXA 1SVEA 4JX3A 3C0IA 3MFSA 2R3LA 1Q8YA 3BHYA 5IF1A 2I7QA 2EVAA 2W1FA 3EL7A 3QCYA 1Q3DA 3UJGA 3KU2A 4JAIA 2QU6A 4O2PA 4CT1A 2JIVA 3PFQA 4BWKA 4EUTA 4HPUE 5CS6A 3G2FA 4ZEGA 2P33A 2JDOA 3RPRA 3U9CA 3U8WA 4AW1A 5IEXA 4UY9A 5IUIA 5D7AA 4IMYA 4PNKA 4TZRA 2ERKA 1NXKA 4XJ0A 3OT8A 3MI9A 4RWLA 2I0HA 3RPSA 5LCJA 2C5YA 3UG1A 4IQ6A 3POZA 1M7QA 3W0NA 5FDXA 5LVPA 2BPMA 5EW8A 3DJ5A 4PF4A 4EK4A 4JDHA 4TL0A 3EJ1A 2QKRA 2HOGA 3NEWA 4AE9A 5EYDA 2JGZA 5GJFA 3P4KA 2W1IA 4CT2A 2HZ0A 4LOOA 2PVJA 2R2PA 5HG9A 1CM8A 5A4LA 3M42A 3UIBA 3AMBA 4QTDA 3ZU7A 4C8BA 4YZMA 4DGGA 4UB7A 4MUQA 3G90X 3OBJA 5C9CA 4EZ5A 4ZTMA 4MXCA 4RQVA 1BUHA 4KIOA 4IFGA 4ZSGA 2IW9A 4EH3A 3C4XA 3MY1A 3I6UA 3EFJA 4JRNA 2B54A 4O0VA 3NNXA 3FQHA 3O8UA 1H25A 4FKIA 4PDYA 5AUVA 1OIRA 4IANA 5EHLA 3RCDA 2Z2WA 4YJRA 3KVXA 5AR2A 4AOTA 4XUFA 3RM7A 5M4IA 3V5QA 3HZTA 4RFZA 3OWKA 2C6IA 4K6ZA 4JXFA 4UN0C 3GC8A 2X9EA 4LYNA 4PV0A 4UX9A 3AD5A 4QTCA 3VUMA 1PRYA 2W9FB 3PSDA 4TWOA 5AUTA 3UOJA 3LIJA 2ZV8A 4ONAA 2QURA 3R7VA 4CZUA 3DKGA 4TPTA 3LPBA 4JAJA 1Q62A 4MK0A 4Y83A 5DLSA 4J53A 2PMIA 2XBAA 2OZAB 1JQHA 4HGTA 4AW0A 3FL5A 2W7XA 4RC4A 5EOBA 3AKJA 2PMLX 3FJQE 3LCSA 5CWZA 2BAJA 3NFFB 2WO6A 2BZIB 1PXLA 2AQXA 2XIKA 2CCIA 2X7OA 1YXXA 4DLJA 3RWPA 2BALA 3PIZA 3P79A 1Y91A 5DA3A 5DVRA 5EDRA 1XMMA 4XG3A 2WTWA 4EORA 5E8ZA 4F4PA 4ALWA 5DRDA 4FL1A 4F9AA 1OB3A 4MCVA 4S31A 5GIOE 2WMUA 2IVUA 4X2NA 3PXQA 3SXRA 3TKHA 4NJ3A 4AZWA 4ZTSA 3UDTA 3AQVA 4I20A 4WKQA 5HD7A 2BRBA 5IH5A 3VC4A 3VRZA 4BDGA 3AKLA 4DDIA 4G9RA 2X0PA 3MWUA 4LV8A 4B99A 4C3RA 4DBNA 2UZTA 3MDYA 3WOWA 4FNWA 1BI7A 4EYJA 5HD4A 1IASA 2BIKB 4Y85A 2OK1A 4M67A 4OBOA 3ORZA 3D9VA 4RBLA 4A9YA 3HMNA 2VAGA 4DGLC 1YDRE 5CU6A 3ZH8A 1A06A 3PA5A 2EB3A 3ZXZA 4MBIA 3CR0A 4EH5A 2C6OA 3CEKA 1B39A 4D9TA 5J1WA 3PY1A 4E4NA 3HLLA 2O3PA 5DR2A 4AXEA 2ITYA 3WZDA 2YWVA 4XNEA 3W0MA 5L3AA 4II5A 1PKGA 2YM4A 4IZ7A 3FMLA 4NCTC 4QP8A 3RPOA 2QU5A 2J0JA 4JT3A 4O7ZA 3ZBFA 3FI2A 3LVPA 3I0OA 4EWQA 4FEWA 2W9ZB 4V0GB 4IVBA 3VVHA 4EHEA 5AR4A 4L01A 2XK9A 5L8KA 4FT9A 4A7CA 3IDPA 4XBUA 4ZSAA 3FAAA 2UW8A 5AEPA 4X21A 4E8AA 3U9NA 4YJTA 5AP4A 3KVWA 2YAAA 3AC1A 3MS9A 4QP1A 4XYFA 2J2IB 4C2WA 4QMQA 3OEZA 5DN3A 3KC3A 5HHWA 3FLNC 5J5TA 3VBXA 4LGGA 5CF6A 4U6RA 4TY1A 3ZBXA 3GU7A 4XCUA 4EOIA 4TWPA 4G6OA 5CALA 2UZVA 3I79A 3WI6A 3FMMA 2WTIA 4IAIA 1KUTA 4QOXA 4AG8A 5EG3A 4HCTA 2C6LA 3IECA 4AGUA 5J9LA 3M11A 3PRFA 2CGUA 4D2PA 3B2WA 5AM7A 3S2PA 4YO6A 3DQWA 4FSYA 1OL2A 3FSFA 1XO2B 4RVKA 4WT6A 5KMKA 4MD9E 2QG7A 3W55A 4K77A 4L44A 1MRUA 3RKBA 4YBJA 2VO6A 5JQ5A 5DT3A 1JSTA 3UQGA 5JZNA 4MXOA 4P4CA 5AR7A 4ZJJA 3LXLA 4RVLA 1W83A 4H3QA 3L9PA 3AC3A 1OPJA 3Q4UA 4MYGA 2YEXA 3BWJA 3WF9A 2IZTA 4ZLYA 4AXCA 2XMYA 3OF0A 4DH5A 3R63A 1KE7A 3PIYA 2OF4A 1ZYDA 2ITQA 4QYFA 4XLIA 2KULA 3PXYA 2G15A 3FSKA 3R0TA 3EN7A 4Y5HA 2ITXA 4EC9A 3DKCA 2GMXA 2R3FA 3KF4A 4FA2A 5JN2A 3LLTA 3Q6UA 4E1ZA 4F9CA 1LP4A 1H26A 4YZ9A 2PVHA 5L8JA 4CCBA 3OTVA 4U3ZA 3PVBA 1W0XC 2XBJA 3E7VA 4KKGA 4Y5QA 3FMHA 5AV3A 3SX9A 5A54A 4U44A 3E7OA 3HV6A 1YI4A 2GFCA 4EZ3A 3MESA 3AT2A 4WUNA 3A7JA 4CD0A 4KSQA 3G0FA 4TW9A 3HMPA 5AADA 4FTNA 5IA4A 4HYUA 4BN1A 3FZOA 4V05A 3VNTA 4QP4A 5F20A 3F2RA 4PP9A 4EOOA 3DXPA 3P5JC 1UNLA 4IVCA 4MBJA 1W2CA 3R8LA 5IQEA 1U5RA 3AC8A 4YPDA 5K0XA 1OKWA 4ZZMA 3WARA 1F5QA 4AFJA 2GHGA 4Z9LA 3BL9A 4XP3A 4IJPA 4JMQA 2ITPA 2X6EA 4DEAA 3IDCA 4KAOA 2EXMA 3MPAA 3KL8A 1EH4A 2HIWA 2Z7LA 1RW8A 2YAKA 3PTGA 4U79A 3BL7A 3W0PA 4ASDA 3K5UA 2QKWB 1AD5A 3NGAA 5EHYA 4OTQA 3FKLA 5E92A 5JSMA 3I1AA 3LM5A 3QYZA 4FTTA 4X6QC 3R02A 4AZFA 4U45A 4D4SA 4CG9A 3CTJA 2ZYBA 3MA6A 4KRDA 4QMOA 2W0JA 4O81A 2NYAA 4FKOA 5GJDA 5TO8A 3DQXA 2C0IA 1K9AA 1JBPE 2F9GA 3BRBA 4BDHA 4RIWB 4FR4A 5AAGA 2AEGA 5AP3A 1IRKA 3RAHA 5CY3A 3UO5A 2R64A 3OUKA 3HUBA 3DS6A 4Q5HA 5AV0A 3VF9A 3JVSA 5FDPA 2GFSA 2XEYA 1JKLA 2QODA 3OC1A 3QLGA 2E9VA 5IZFA 5IA5A 1YVJA 4I23A 4EYMA 4DN5A 3A62A 2B52A 3ZXTA 1XQZA 4KIPA 3FLZA 4PMMA 4G3DA 4EHVA 3W0QA 3UNJA 2UW6A 2DUVA 4RIYA 4OTGA 3RBWA 4FVRA 4AN9A 3DDPA 2NP8A 4PX6A 5HZNA 1JPAA 4LDTA 5CZHA 5IMXA 2OBJA 5EDQA 3PE2A 3II5A 2ZDTA 3VWAA 5L2SA 1O6LA 3DY7A 3P08A 1YXTA 4KWPA 1Q8ZA 2OSCA 2Z8CA 3BI6A 3MIYA 4FUYA 2J9MA 4G17A 5ETCA 3VO3A 4M69B 3W16A 5GINE 3OZ6A 5I3RA 4DA5A 4OAVB 3CKWA 2RG5A 5GZAA 5BUEA 3BEGA 3TZMA 1ZMUA