3OD6X

Crystal structure of p38alpha y323t active mutant
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
349
structure length
344
Chain Sequence
ERPTFYRQELNKTIWEVPERYQNLSPVGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPTDQSFESRDLLIDEWKSLTYDEVISFVPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active mutants of the TCR-mediated p38alpha alternative activation site show changes in the phosphorylation lip and DEF site formation.
pubmed doi rcsb
molecule keywords Mitogen-activated protein kinase 14
molecule tags Transferase
source organism Homo sapiens
total genus 96
structure length 344
sequence length 349
ec nomenclature ec 2.7.11.24: Mitogen-activated protein kinase.
pdb deposition date 2010-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3od6X02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3od6X01
3BPRA 2ITNA 2BKZA 1Y6BA 5D9HA 3UTOA 3SC1A 2X7FA 4GS6A 1T45A 3F3UA 5CF5A 2F49A 2W4KA 4LM5A 5CYIA 2BILB 4BCPA 3R02A 3G9LX 2OI4X 5A4QA 3KEXA 2AYPA 4XOZA 2WMRA 3ETAA 5KMMA 1MRUA 2C6OA 2I1MA 2QO2A 2C4GA 3ORZA 3E92A 3FMDA 3H3CA 4NCTA 1YDSE 3R30A 3VS6A 2GTNA 3BV2A 4IWDA 4ZTSA 3ACJA 1H27A 1E1XA 3E63A 3QC9A 4KAOA 5GJGA 5JGBA 2YIWA 1PYXA 2GQRA 1KE5A 4A4XA 3PPKA 4P7EA 4P4CA 3AGMA 2YA9A 5CVGA 4W4YA 1TQMA 2YN8A 4RX8A 3OMVA 3C0GA 2O5KA 3D4QA 4XG6A 4PMMA 4I5HA 3D5VA 3R71A 2W5HA 5AP5A 3VBQA 4NJ3A 2W4JA 3A61A 4OTGA 5HCZA 1P4FA 3MS9A 4K11A 4IB5A 4C3RA 3VNTA 4BVUA 4DEHA 4E6AA 5KX8A 5E8XA 3JR1A 2PE1A 2E9PA 5IQCA 5HOAA 2JBOA 4H3BA 5AUWA 3HDMA 4FTLA 3ZXZA 4KKGA 1KV2A 3QZGA 2HXLA 4NW5A 4WNPA 4O0XA 2CGWA 2UW4A 4KRDA 5E91A 5T68A 4R78A 4I6BA 4GVAA 4ZSLA 2GQGA 3O8UA 2JGZA 1JKLA 4FV4A 4XV9A 3IQ7A 4F0GA 3HMIA 4U7ZA 4YJNA 3HUCA 3PE2A 5ANOA 5D7AA 5HE0A 2WTJA 3KFAA 2WMVA 3PXYA 1XH5A 2CLXA 4XG8A 3VQHA 4BI1A 4XEYA 4AT3A 4CV8A 4EUTA 1RDQE 3KCFA 3PFQA 1OUKA 5I9VA 5IUIA 2QG7A 3BV3A 4WG4A 2G01A 2EB2A 1YHSA 3Q9ZA 5CI6A 1G8SA 4FC0A 1XH9A 4ZS0A 3C4XA 5JT2A 2ITTA 4RIYA 3KXHA 5E8SA 3NCZA 4W9XA 2KULA 3H9OA 1Q8ZA 2BTRA 2B0QA 2B54A 3FEGA 1O9UA 4F09A 2OZOA 4RVLA 4L42A 5JFVA 4YLLA 3IO7A 3P86A 5JGDA 2OLCA 3PIYA 2V0DA 1YQJA 2YIYA 3C0IA 2ZV2A 3FLWA 5HU3A 2CDZA 3Q52A 5I9ZA 2R3PA 4FT9A 3GGFA 3RZFA 5K3YA 4TT7A 4DITA 4TYIA 4GK4A 2Z7SA 2XBJA 3BU5A 4AT4A 5J9YA 5T6KA 3LCKA 2ZDTA 4IJPA 4AGWA 4IW0A 4OR5A 2BHEA 4CTCA 5AM7A 5A6NA 5IQAA 3NW7A 4XP2A 5H8GA 2WPAA 3O96A 2W1FA 4EHVA 3ORMA 1OM1A 2WMQA 4W8EA 2YDJA 5JN2A 4FTCA 2F2CB 3O7LD 3U4WA 1ERKA 4CMUA 3EFLA 2X8EA 1YHWA 1R39A 3C51A 2ITZA 5HZNA 3O2MA 3P1AA 4NCTC 3A62A 5E7RA 4AOTA 2J0JA 5M4IA 3RCJA 3D2KA 4RLKA 4C38A 4IZAA 2HYYA 1CDKA 3BGQA 3UO6A 3PSCA 4FTNA 3FHRA 5ANEA 4DGMA 4UMUA 3CD8A 4BCGA 4BDFA 2ACXA 3MFRA 5KHXA 3VRYA 4CFNA 3LLAA 3ZRMA 3FSFA 5KMIA 4QMUA 5AM6A 5FDXA 2R4BA 2ETKA 4C2WA 4M8TA 5HE3A 3ZO2A 4CZYB 5CVHA 4MXYA 3D2IA 3GT8A 4G5JA 4PRJA 4GYIA 1B6CB 5A14A 4FSNA 3VIDA 3QF9A 3N9XA 1XQZA 3OT8A 5EDQA 4F9AA 1K9AA 5EYCA 4CRLA 3LFAA 4NM5A 3LIJA 4I6HA 1OL5A 5CY3A 3Q9XA 5F95A 4TZRA 3SRVB 3WILA 4EH3A 2XYUA 3NVMB 3UP7A 4TYJA 2OIDA 2YCRA 4MKCA 1Q8UA 3GENA 3PXZA 3QLFA 4JG8A 3E8EA 3E3BX 5E8VA 3VBWA 5CF8A 2IN6A 3MH2A 2HW7A 3QZIA 3RBWA 2O0UA 4BKZA 1IEPA 4KBAA 3PA5A 4RQKA 4I22A 3UG2A 4D4RA 1GY3A 2I0EA 5IUGA 5HIDA 1Y91A 4WSYA 5CXHA 2QKWB 4UV0A 5M09A 4APPA 4PTGA 4UALA 1GZOA 2GHGA 1ZXEA 3GU4A 2J51A 2X6DA 3AD4A 2C6IA 1QMZA 3VC4A 3Q2JA 3BYUA 4L01A 4C34A 3R8LA 4C37A 3HMOA 4BCMA 4F6UA 1B38A 2C3LA 3E93A 2RG5A 4NTTA 4RG0A 5J79A 2YEXA 3CKWA 4FNWA 4CFXA 5DMZA 5I9YA 4BCIA 4CKRA 1YW2A 5CSPA 3F7WA 1KOAA 4KA3A 1F5QA 1S9JA 4UYNA 2Q83A 2G2FA 3COMA 4MXAA 3ZDIA 3DDPA 1DM2A 3PA3A 4FL2A 4F9CA 3KN6A 2RKUA 4IX4A 4WNMA 4OBPA 3SG9A 4JAIA 3TL8A 2R3LA 4QYYA 5BYLA 2PVHA 4MBIA 3UG1A 3P08A 4NU1A 2H6DA 3GFEA 3DK3A 2GTMA 3PZEA 3QCYA 4FKGA 2P2HA 5EYDA 4YUQA 2QG5A 4FSZA 4KS7A 4IZYA 4L7SA 4ZIMA 5CEOA 4FG7A 3E8DA 3BLHA 3FKOA 3I79A 3BWJA 2A4LA 5C8NA 3ZLYA 4DAWA 4EWQA 4X2FA 2UZBA 3EQRA 3OC1A 2PSQA 4KBKA 4NIFB 4F63A 4DH1A 1MRVA 4CNHA 5HCXA 4FV7A 1BL7A 3QHRA 1UWHA 4TTHB 5FEEA 3A7GA 4KIQA 1QCFA 1ZRZA 5CEKA 5JFSA 3C4CA 4Y8DA 4PV0A 2C5VA 2BRNA 3LFBA 3AMBA 4ZY6A 3OEZA 2XK7A 1YI6A 2GCDA 2Y9QA 3IK3A 4IX5A 1GZ8A 4FGBA 4YPSA 1UNHA 3COIA 3KK8A 3ORPA 3NAYA 4FG9A 2XNGA 3BGPA 4IH8A 4H36A 4M68A 3VQUA 2PMLX 3D5UA 3IPHA 4C02A 3BQCA 5GZ8A 1OVEA 4FKIA 2YCSA 4ID7A 4Y5QA 5F9EA 4FR4A 2XJ1A 3C9WA 2QHMA 5FQDC 3LFEA 4CG8A 3PG3A 2VNWA 4FICA 3B8RA 1OMWA 1Y8YA 4CFWA 5DIAA 3FL4A 5G1XA 3RPOA 4QNYA 4JBOA 5GIOE 5HG9A 2PWLA 2J0KA 1FGIA 4FKLA 4FTOA 4TY1A 3UZTA 5FM2A 3PY1A 5CZIA 2PUNA 4JDIA 4E5BA 4R7HA 4IJ9A 3HV6A 3QQKA 4YC3A 4JNWA 3MGYA 4QP6A 5IG1A 3QQUA 2VGPA 4ZTQA 5IMXA 3P5KA 4QYHA 2Y4IB 4CQEA 1Q4LA 5AR5A 3F61A 4DF3A 2OZAA 1PXIA 3NUXA 1ZOHA 2Y4PA 4DH3A 2VO3A 2WFYA 5AA8A 1LR4A 1JLUE 3DCVA 4EONA 4NZWB 1LUFA 1Q8TA 5AIRA 3AMYA 3VS4A 2QO7A 4EJ7A 4D4VA 4ORKA 3PVWA 3ZONA 2YLFA 4O21A 2IWIA 3ENHA 5IH5A 1UV5A 2QO9A 3BHUA 3F2AA 3SA0A 3U55A 4BKYA 3QL8A 4BIBA 3UO5A 4X3FA 4BGQA 5A4LA 2ITWA 3L8XA 4CCUA 2HELA 4OTHA 1Q62A 5I9XA 2EUFB 5CAQA 1JVPP 2Y6MA 4PQNA 3I60A 1ZMWA 1IAJA 2O64A 5HI2A 4GK3A 2FA2A 3QYZA 3DT1A 3G15A 1SMHA 3HP5A 4FIEA 4QYFA 4BTMA 4C8BA 2CJMA 3FMNA 4JAJA 4WD5A 4DHFA 2UZDA 1PXOA 4JQ8A 3CEKA 3TXOA 3CS9A 3VO3A 5JRSA 4DBNA 3PY3A 4BIEA 4MK0A 2ITQA 3Q96A 3PDTA 4LFIA 5FG8A 3BELA 4PWNA 5L3AA 3ZM4A 4FK6A 4M12A 2QI8A 3MB7A 3VS7A 3KRJA 5KMJA 1ZYSA 5HESA 4IBMA 3SG8A 2JFLA 3MWUA 4BZOA 3F82A 3MVHA 3THBA 4EH4A 2UW3A 3FV8A 2WMWA 4NM0A 4NYEA 5IQDA 2NO3A 1W84A 4Q9SA 3WIKA 5DEWA 2W1EA 2V55A 1Q61A 4C0TA 4IM3A 2PE2A 2X7OA 2ZJWA 4RVKA 3A2CA 5FEQA 5I5ZA 3SHEA 4JDJA 3CIKA 3EL8A 1YXVA 4FYOA 1OPJA 3GU8A 2BMCA 2HZ0A 3HDNA 3R00A 4MXOA 3WF5A 5L2WA 3H30A 4I3ZA 3MI9A 2ZVAA 4LV8A 2ITVA 4D9TA 5HO6A 3ROCA 1XBCA 2PU8A 5CLPA 4O96A 4PDYA 3PVBA 3WYXA 2WQNA 2O3PA 3HZTA 3RPVA 4BCJA 2WMSA 2YIRA 2QLQA 4QMPA 3GCPA 4TYHB 3O50A 4W9WA 4EI4A 5ACKA 3WE8A 4UMRA 5IQEA 3S4QA 3GP0A 5M53A 4MXCA 4HGSA 4QTCA 4O81A 2BFYA 2VTPA 4C61A 2PULA 1XBAA 4Y95A 2C1BA 2JEDA 5CI7A 4NEUA 5AP1A 4MAOA 2YAAA 3ZFXA 4AW0A 4DTKA 5EG3A 2E2BA 3RJCA 2XF0A 3CTJA 3FBVA 4NT4A 2KTYA 2BALA 3U9NA 4RWIA 3DBQA 4D1XA 2JDRA 1WVXA 2UZVA 3KGAA 3L1SA 2ERKA 4H3QA 5CAOA 3NMUF 4M14A 2XIXA 4AZTA 3LPBA 4YJPA 1UVRA 2XVDA 4X3FC 4RWLA 5FXRA 1P2AA 5KKRB 3AC1A 3TUBA 5M4FA 5GNKA 4O7NA 1R3CA 3QGYA 2XNBA 4DLIA 4LL5A 2UZEA 3V5TA 5CU4A 4EYJA 3GCVA 3GOPA 3F9NA 2VWXA 2Z7QA 1FMKA 2C5YA 2PZ5A 4FV1A 4PX6A 5B0XA 3OY3A 3LJ2A 3GU6A 3I7CA 3UIUA 3KREA 4QP4A 4YGAA 1W83A 4W4WA 5DOSA 3A4OX 1H0WA 4WA9A 4YP8A 4DT9A 4QMYA 5G6VA 4E1ZA 3F3ZA 3HA6A 4FTKA 5E8UA 2YHVA 2W17A 5HE1A 2ZMDA 3QYWA 5I3RA 2VTHA 1KE9A 2IVVA 5H2UA 2UW5A 4R7IA 3GC8A 3ZEWA 4FIJA 3HMNA 4RBLA 1A48A 4PDPA 2IVUA 4Z55A 1JNKA 2GS2A 3HUBA 4E7WA 4MF1A 2E9UA 2WQEA 5A54A 3FMLA 4XUFA 3FYKX 2ZV7A 3ZSGA 5HBJA 3ZC6A 3EZRA 3MPAA 3CPBA 2QCSA 3C4EA 4DEDA 4IAZA 4DGGA 4WUAA 1FINA 3RAIA 1BYGA 2QVSE 5LMAA 2J0MB 2VUWA 5E9EA 3D7TA 2UZWE 2WMXA 4A9UA 2WTKC 1NY3A 4BY9E 4ZJVA 3HV7A 3C1XA 3PG1A 4QQJA 3W2QA 4EHZA 2P4IA 5HTBA 4X2KA 4MCVA 1F3MC 3K2LA 3K54A 3UO4A 1O6LA 2CN5A 3FWQA 3RNIA 1FOTA 3CY3A 1U54A 1OITA 4XS2A 3LQ3A 4FV9A 4ZZMA 2OJFE 4FNYA 4AFJA 2GNIA 4G9RA 3LFDA 4O1PA 4A4OA 5L4QA 4A07A 4L68A 4ZEGA 3C0HA 3VUGA 3KVWA 3QTQA 2R7IA 4H39A 2OJJA 4MXZA 5L8JA 4NTSA 3BEGA 5CAUA 4PMTA 4NKSA 4F7SA 4HPUE 3WI6A 2RFNA 5IUHA 3EN4A 3Q5ZA 3ZSIA 1KUTA 3R01A 1S9IA 3EYGA 4OLIA 5AP2A 5KMLA 2BTSA 3R9RA 3RAKA 2YABA 5FUTA 2BRBA 2YWPA 4L6QA 1PF8A 3R63A 2VTQA 5AFVA 3ZRKA 4BTJA 2GHLA 2OF2A 2YIXA 1IA8A 2PMOX 2RGPA 4ZY4A 4DE4A 3LJ0A 2B9FA 3DV3A 4S33A 4A9RA 3D5WA 5EDPA 1JKKA 3ZUVA 4ZS4A 2CNUA 3FZTA 3BBWA 4H58A 4BF2A 3PPJA 4M0YA 2PZIA 3R9HA 2OF4A 1BL6A 4B8LA 4GT3A 5DH3A 4F7JA 5BYZA 1JKTA 5CSHA 5KMOA 3MIAA 3I7BA 3ZM9A 5IMEA 3A7HA 2GFSA 2OJ9A 3DOGA 3II5A 3NGAA 1YDTE 4FEQA 3OWJA 3ULZA 4PPBA 4BR3A 1PMNA 2H9VA 3KKVA 3ZLWA 4X3JA 3SQQA 3R1SA 3S1HA 4M69A 3M1SA 5BVWA 3V01A 2ITUA 5J87A 3FZRA 4BWXA 3NNVA 4XHKB 2XCHA 3B2TA 4U3YA 3ROYA 3ZO1A 4R8QA 4WG3A 4JQ7A 3H9FA 4R1YA 3UNJA 2DYLA 4L8MA 2QOOA 4ZSGA 4IAFA 3G0EA 2BUJA 5AEPA 4KINA 2QOCA 2VD5A 3IDBA 4FEUA 1OL2A 3DQXA 2J90A 4M66A 2OXXA 3SX9A 2VWYA 4GL9A 4AF3A 3NUAA 4DA5A 2W5BA 4S32A 3VUKA 3EYHA 3ORIA 4C62A 3QCSA 2VNYA 2PVYA 4B4LA 3TT0A 2WNTA 2NRUA 2ZB1A 4YC8A 4O7RA 4DEEA 1IRKA 3LJ1A 5GHVA 5C8KA 3RZBA 1NT2A 4RZWA 2UW7A 4FKPA 4D2TA 4O82A 3GBZA 2YACA 4OW8A 5HTCA 4JOAA 4AQCA 3F3WA 4L00A 4EKKA 2IZSA 2OG8A 2V5QA 3Q6WA 3ODZX 3ULIA 4GW8A 4EHGA 4O86A 3EN7A 4RIWA 2R7BA 4DGOA 5LWMA 4MWHA 3DY7A 3NR9A 5A3XA 1KE7A 2FO0A 4J52A 3QA0A 2I40A 4MVFA 1VYWA 3F88A 4IZ5A 3LMGA 2ITPA 3F5XA 3NYOA 4RWKA 2Z7RA 2ZOQA 5HCYA 4G1WA 2QC6A 3DBFA 3QAME 4AW5A 4L3LA 2R5TA 3HV3A 2AC3A 1BUHA 2W06A 4EH8A 3KRLA 4L44A 2R3RA 3QTWA 5HG5A 4AN9A 3NIEA 4WO5A 3OCGA 1UWJA 1QPEA 4XRJA 4XV1A 3TZ9A 5EM7A 2WXVA 1UU9A 3OOGA 1J7LA 4MEDA 4C3PA 3Q9WA 4XBRA 1FPUA 3RAHA 3Q2MA 4A06A 3TKIA 3VJOA 4KBCA 3NUSA 4G2FA 2XK8A 4HNFA 3SDJA 2WEIA 3L8PA 5DA3A 3C5IA 5TT7A 2BPMA 2GDOA 1OBGA 5EOLA 3ANRA 2UZUE 3L9NA 5AV1A 3DFAA 4D0XA 3A60A 4F0FA 1AD5A 4FTAA 3VVHA 2WTDA 4X7QA 4RSSA 5CU2A 2R3OA 4L45A 4CSVA 3OCBA 5AAGA 5ETFA 1L8TA 1YHVA 1YOJA 3QUEA 1GAGA 2G15A 4J8NA 3BLRA 3HLLA 5TO8A 1Q3WA 3OF0A 3PJCA 3BYVA 1DAYA 1LPUA 4G5PA 2X2LA 5HNIX 2X4FA 4BGGA 4CZTA 3IOPA 4FIIA 1O6YA 3OCSA 3RP9A 2HIWA 3QCQA 3PLSA 3FHIA 5KNJA 2YWVA 5EI6A 2O65A 3OW3A 3EQCA 3QRIA 5EM8A 3TNIA 2CKPA 5LMKA 1YWNA 2OIBA 3FKNA 3KY2A 4QPSA 4YTHA 3ZUUA 2WTIA 4FIHA 3ORTA 4JS8A 2E9OA 5ANGA 2YZLA 4IFGA 5AP0A 5AAEA 2PVJA 3DB6A 3BYMA 1OL1A 2BIKB 5HKMA 2F2UA 2FSOX 4O0WA 3HV4A 2ZM1A 3R9DA 4ASEA 4ASZA 2CHLA 2QQ7A 3BYSA 3VAPA 3VW6A 2BZKB 4FUXA 4LV5A 1WVWA 3KMMA 3VUTA 3W16A 4ASDA 4O7YA 2XRWA 4L46A 3JYAA 2J0IA 2YDIA 1BMKA 4HPTE 3W1FA 3PE1A 3R6XA 4IC8A 4YJTA 2JC6A 3CQWA 2Z7LA 3SXSA 4AA0A 5JK3A 3ZS5A 2P2IA 2PVMA 4ARKA 2ZV8A 3G90X 4FTTA 4EC9A 3D94A 5DGZA 4BDGA 4D2VA 3PXRA 4WBBB 4FUYA 3FMEA 3EQIA 3L8VA 3MFUA 4WOVA 4XCUA 4EC8A 2JITA 1WMKA 4G3DA 4BRXA 4F6SA 1NVRA 4CYJA 4JR3A 3R2BA 4DFZE 1ZYJA 3LFQA 3SXFA 4BYIA 4ZTMA 5ITAA 5LVNA 4BWKA 4M0ZA 4GIHA 5JSMA 5HD4A 4GKIA 4XOYA 4EL9A 2JAMA 2OH4A 3EN9A 4IM0A 4XG7A 2VX0A 3RK5A 4OTDA 4XLIA 1J1CA 4F7NA 4N4SA 2HZ4A 3E64A 2ZM3A 3P9JA 4BTKA 5EM6A 4QNAA 3T3UA 3BGZA 4PPCA 4C4IA 4QMLA 4DLJA 3ZFMA 2C6EA 4YURA 3A8WA 3G6HA 4FKRA 1H8FA 4FODA 1VYZA 5L2QA 4L3JA 5LARA 1NW1A 3D83A 4MYGA 3ZRLA 2X1NA 3QXOA 1XJDA 2F9GA 3WARA 2J0LA 4IB1A 2PUIA 2VWWA 4H1MA 4IX3A 4LL0A 5HLNA 3T9TA 3NPCA 3MBLA 3P78A 3TZMA 4BDKA 5LVPA 5EQPA 4QMTA 5J1VA 5FLFA 4U3ZA 3QUPA 4FIFA 5T3QA 1U59A 4DFUA 2HAKA 2OGVA 3FLNC 1V0BA 3LQ8A 1Z57A 3PXQA 5K4JA 3PLAE 3WF8A 3QA8A 5AR2A 3RM7A 4AU8A 1PMEA 3GFWA 2XNNA 3IS5A 4A4LA 4PUZA 1CTPE 4I4FA 4X6QC 4ERWA 1P5EA 5C9CA 1UU7A 5DRDA 3O23A 3E8NA 3WE4A 4E5AX 4YJOA 5IDPA 3V5JA 2PK9A 5LMKC 3Q3BA 4RIYB 2R3MA 4KD1A 1JKSA 3UQGA 5D7VA 1YXUA 3ALNA 4HCVA 4MBLA 4YJSA 2PVFA 4JR7A 5HGIA 4Y72A 2ITXA 2X39A 4YO4A 2I6LA 4QPAA 2BKKA 4CV9A 5A46A 4R3RA 5CNNA 4FKWA 4F9BA 1REJA 4ACHA 2X6EA 3BHHA 2WTVA 4KIKA 1OL6A 1W82A 3M2WA 4QOXA 5AUZA 3VS3A 3KULA 1J1BA 2W1ZA 4APCA 4UWBA 2XYNA 4PPAA 3VULA 2R9SA 3R8PA 4Y46A 4CLJA 4UN0C 1HCKA 1EH4A 1CSNA 3G6GA 3C4FA 1A06A 2BAQA 4FSQA 4FX3A 2XK9A 4K33A 2B1PA 5JQ5A 4FTUA 2W99B 1Q8YA 1Y6AA 3K5UA 1WFCA 5KUPA 1Q5KA 5ANIA 3DBCA 4U42A 4FSYA 5E1SA 2B4SB 4FV3A 3OROA 4U9AA 4YTIA 3TN8A 4FF8A 4LMUA 3O17A 3WZEA 3COKA 2C3JA 4RJ3A 1UU8A 3LAUA 4KSPA 4UYAA 2VO7A 4UXLA 3ZZEA 5AUXA 5K5NA 1L3RE 3RM6A 2PVKA 4QMWA 2B7AA 3R0TA 4FKOA 1FMOE 2F4JA 4CXAA 4FIGA 4QTAA 1Q24A 5AV2A 3H0ZA 2WMBA 2XK6A 4KIPA 3TWJA 5J5TA 2OU7A 3W8QA 3RPSA 3FL5A 2BDWA 4AGDA 3V8TA 3G33A 1NVSA 3LXKA 3SRVA 4DN5A 2WHBA 3R04A 4FSUA 3DJ6A 2Y6OA 3H10A 4EYMA 5EQEA 5FM3A 3BHVA 2YERA 4GMYA 4GG7A 5FBOA 5LVLA 3NNUA 1JSVA 5HLWA 3TTIA 3BU6A 4RX5A 3QQGA 4EHEA 2OK1A 4LUDA 3R9OA 5DR6A 3WZUA 4QP9A 2EXMA 3KU2A 3I1AA 4KWPA 4GFOA 3BE2A 4MTAA 1OL7A 1TQIA 2F7EE 4GUEA 4ENXA 3ZBFA 3GC7A 4AZWA 4D2WA 2XEYA 5A4TA 3W2SA 1BI7A 2C6LA 3FQHA 1JOWB 3E8CA 3LCOA 4PF4A 5LWNA 3TKHA 3VUHA 4R5SA 2WTCA 4OBQA 2BROA 3SKCA 4C4FA 3Q5IA 3MESA 4HVIA 4L53A 1KE8A 4HCTA 4JQEA 4W4VA 4CQGA 2Z8CA 3MPTA 4M97A 3H0YA 3DU8A 3MPMA 4U5JA 5BVOA 4EH7A 4O7SA 3UIMA 1H1WA 3DLSA 4C3FA 3QX4A 3ZO3A 1R0EA 3ZLSA 5TOZA 3EL7A 2W7XA 3DA6A 4ASXA 3UMWA 3SGCA 4PTCA 4Q2AA 4FI1A 5FBNC 4R1VA 5JMSA 4ZTLA 3R1QA 4G16A 4EOLA 2ERZE 3OUKA 4IDTA 4RIXA 5E8TA 5JKGA 1UA2A 4HVGA 2ESMA 5HICA 1FBNA 4II5A 5HQ0A 3UOLA 4X2JA 5C4LA 4KKEA 4YNOA 1FQ1B 3I0OA 2R3KA 3CGFA 1ZY4A 4BIDA 5FP6A 5HE2A 4CG9A 3QKMA 1U5RA 1YOLA 5TE0A 3KRWA 3FYJX 4EK4A 4NFNA 1WBNA 4DFXE 4F9YA 2W9FB 1XBBA 3RK9A 4O0YA 5KHWA 3DK6A 2W1HA 3HRFA 3I5NA 3MN3A 5IU2A 4G6NA 3TM0A 5AADA 3HMMA 4HYUA 3O7LB 4CRSA 5LCJA 3H9RA 3FY0A 2RL5A 2VU3A 3LFNA 4O0TA 5IA4A 5CT7A 4I41A 4ZK5A 3GQLA 3Q4TA 4I1ZA 1TKIA 3NEWA 4OT6A 2REIA 2VTOA 3CTHA 4D1ZA 3F69A 4IX6A 5C1QB 3TUCA 1M14A 2QOKA 4FL3A 5J8IA 3RTPA 3KMWA 2XKFA 4QD6A 4A7CA 4PNKA 4F1TA 4LRJA 2YM5A 3CP9A 2C3KA 2G1TA 3IDPA 4NWMA 3FAAA 5FXQA 3R8VA 3ZHPC 4DG3E 1UU3A 3CJGA 3MFSA 5CAVA 2F57A 3PIXA 4DFBA 2BZJA 5AP7A 3OOMA 5CWZA 2A2AA 2YZAA 2FH9A 3EN6A 3GC9A 4D9UA 1IAHA 3CJFA 4I0SA 4YZNA 3DTWA 4IVBA 3AC8A 1K2PA 4GK2A 4J99A 4Q5HA 4TWNA 2BCJA 2X9FA 3EQGA 3PIZA 2YITA 5H8BA 1OI9A 3NUPA 3R83A 1OBDA 2VTLA 1PXNA 1APME 2RSVA 2YFXA 5E8ZA 1G8AA 4U81A 4ZOGA 4JI9A 4FV5A 3JVSA 4CCBA 3TZ7A 3GUBA 4OTPA 4O7VA 4YZMA 1WBPA 3DKGA 3PSDA 5AV3A 3W2PA 3BHYA 2OWBA 2BAKA 4E4LA 2EU9A 5CVFA 4FTQA 3AG9A 5LMBA 2JKKA 5LCKA 4IMYA 4IQ6A 1H4LA 5DT3A 5TKDA 4FK3A 4HVDA 2OZAB 4XV3A 5H9BA 1H07A 3HNGA 5BNJA 2BIYA 4MXXA 3EQBA 1WAKA 1Q8WA 1HCLA 4YSMA 3JY0A 2WMTA 5AUTA 3SW7A 2G2HA 4FKJA 2PZRA 4TWPA 4CEGA 3L9PA 3ORKA 1RJBA 2QOFA 3E7VA 4OUCA 4UWYA 4X3FB 3SLSA 3OXZA 3VBYA 3MFTA 4E3CA 1VR2A 4AUAA 5BUJA 2CGXA 3MH0A 4BCHA 5CEIA 4NUSA 2IVTA 2RF9A 4O6EA 3IW5A 1H01A 2CMWA 2LAVA 2BZHB 3QXPA 4ZZOA 4K77A 2JBPA 4B99A 2RFDA 5F4NA 2WB8A 3I6UA 3DJ7A 4ONAA 5EW8A 1PY5A 3PJ1A 1GIHA 2PVRA 3R73A 4F65A 2V62A 3ORXA 2HENA 5M4CA 3KXZA 4QYGA 3EH9A 4X0MA 2EVAA 5HEZA 4JBQA 3P4KA 3GCQA 3U51A 4C35A 5IA3A 5E1EA 3W55A 4ANNA 2FSLX 3ORLA 4Q9ZA 4S34A 3R8UA 3GNIB 2OJIA 3QWKA 3S3IA 4D2SA 2WD1A 4EOSA 4BHZA 5HO7A 4QPMA 3RWQA 5CASA 5JRQA 4KIOA 2NPQA 2WQMA 2A0CX 3SV0A 2P33A 4M84A 4LG4A 5DT0A 2R3GA 4JXFA 3UNKA 1P14A 2R3IA 3MVLA 4YLJA 4MHAA 3TV7A 4QP8A 5EOBA 4DCEA 2QOHA 4UZDA 4JG6A 3V3VA 4S31A 5M57A 3W2CA 3NW5A 5AV4A 2UW0A 4I0TA 2V7OA 4IAYA 1U46A 4QP2A 2CPKE 2WTKB 3QRJA 3QD2B 2SRCA 3PP0A 4K9YA 4E4XA 5L2SA 3MY5A 3MB6A 3NVKI 4IFCA 1URWA 4CYIA 2EWAA 3FQEA 1OKWA 5HBEA 2CKEA 3FXXA 1ZOGA 3VUMA 1FGKA 2IW9A 3OHTA 1BX6A 2JKQA 4U6RA 4IHPA 4M13A 5DN3A 4I4EA 5FTGA 3WZJA 5EM5A 2XK4A 4BCNA 1Y8GA 5CU0A 4B0GA 4DINA 4Z3VA 3HAMA 4LGHA 5IQBA 4DTBA 4B8MA 2JDVA 4YHTA 3KXXA 2YISA 4EOIA 1PMUA 5ANKA 2VAGA 3LXLA 3VHEA 3LVPA 3UIBA 2B9JA 4M7IA 5AMNA 5EYMA 3Q53A 3WOWA 4CLIA 5CAPA 4PL3A 3DZQA 3QLGA 3FI8A 4FVQA 1QPCA 3OWPA 4N6YA 3MJ1A 3KB7A 4BL1A 3KL8A 2HZIA 5F20A 4DEIA 2CGVA 4CT2A 4AOJA 2VTMA 2IPXA 1IASA 1STCE 2HOGA 2LGCA 3QC4A 4G3FA 4IADA 4U79A 5C03A 2IG7A 5M07A 4FVRA 5IA5A 1YXSA 3DNEA 3NAXA 3C7QA 3BE9A 3LFSA 4MQ2A 3OY1A 5DFPA 5AR3A 1RE8A 4E20A 4FBXA 4QRCA 3AD6A 3KQ7A 4TWOA 5HBHA 3NSZA 5K4IA 2W0JA 3OWLA 3HECA 1OGUA 2WOUA 3ERKA 1MQBA 4Q5EA 4EUUA 2YM3A 4DEGA 3FQSA 4RQVA 1PW2A 4HYIA 2O2UA 4WSQA 5M56A 3NWWA 4FKQA 3CKXA 1PMVA 4YJRA 1LEWA 2PMIA 1SYKA 1V0PA 3F3VA 5E8YA 3LCSA 3KA0A 3ZOSA 3FC2A 5CALA 3DFCB 5D10A 3UODA 4DEAA 2JIUA 1OIRA 3BBTB 4M15A 3PPZA 3UVQA 2H8HA 4P5ZA 4EK3A 4RJ5A 3E87A 2GU8A 1KSWA 1KWPA 2WMUA 4G6LA 3R8MA 4C4EA 2GS7A 3HL7A 5KMNA 3DJ5A 5KZ0A 5EW3A 3WF6A 2Y8OA 4ALUA 3E7OA 5EHLA 3DKFA 3OVVA 4DG2E 4GG5A 3H4JA 1W98A 3QCXA 4BI2A 4HNIA 5IA1A 4RJ8A 2C69A 2CNVA 3L9LA 5J7HA 4EEVA 4J97A 1XH6A 2ZV9A 3F5GA 1OKVA 3GCSA 4CFMA 3W33A 2FVDA 4R5YA 4UMTA 2OBJA 2W1CA 2XK3A 5DPVA 4BBMA 5D11A 3RPRA 5HORA 4XLVA 1SM2A 4D58A 4XG9A 4IAKA 4K1BA 3TIYA 3HA8A 4A9TA 3GU5A 2X81A 3UE4A 2P55A 3EFJA 1JSUA 5B2MA 4Z7GA 4LRKA 5E90A 2IZRA 3W2RA 3PP1A 5DR9A 5D12A 4W8DA 5AR4A 3QQHA 3CPCA 3FI3A 4FSMA 5BX0A 4BB4A 1WBOA 4ZMFA 1AQ1A 4D5KA 3D0EA 3EKKA 5L6OA 3EWHA 3O8TA 4E6DA 4QTBA 4D2RA 4JX7A 2VRXA 3TACA 2HY81 1H1SA 1LEZA 2Q0NA 2QONA 3A7JA 5KKRC 4XV2A 3IGGA 4GYGA 2XEZA 4QYEA 3V6SA 4BDCA 2BDFA 2UUEA 4IVCA 4NJDA 2O8YA 3ALOA 1H25A 5EYKA 5BPYA 2XMYA 1WZYA 2GMXA 4UZHA 4EQMA 4BDDA 1RW8A 1JQHA 4FGRA 5IA0A 1Q3DA 4NH1A 4V0GA 2GQSA 3DLZA 3OP5A 3OG7A 3F2NA 3P7CA 4J1RA 4XG2A 2QOBA 1WBTA 1M2RA 3WBLA 1WVYA 5J7BA 3U6JA 2B52A 3U9CA 1CKPA 3OBJA 3Q9YA 3FZ1A 3F7ZA 4CKIA 4YJUA 5EHOA 2WTWA 3K3IA 3F5PA 2VV9A 4XH6A 4EOPA 3MH1A 3UYSA 3V6RA 2PE0A 2WQOA 4KKHA 2J5EA 4ZLZA 3ZYAA 3W32A 3BQRA 3DKCA 4JT3A 5M06A 3JY9A 3QTSA 2NP8A 2W1IA 3UQFA 4G6OA 5EH0A 3VS0A 3D5XA 5KO1A 5IH6A 3MSSA 3TNWA 3ID6C 1H1RA 3KRXA 5GJFA 5AA9A 4JJRA 3V51A 5IF1A 4FOCA 4GJ3A 5J5SA 4CD0A 4D0WA 5A6OA 3FE3A 4O91A 3POOA 5JGAA 2QR7A 4HCUA 5CNOA 2R0UA 3ZXTA 5D41A 3PWYA 5A9UA 4O0RA 5JQ8A 4MNEA 5CEMA 1BI8A 4O1OA 2X8IA 3TKUA 4P5QA 4UB7A 3QRTA 4PL4A 3ATSA 2VX1A 4BDHA 4C2VA 2GFCA 4OGRA 3EQHA 5I0BA 5IISA 1OIYA 4E26A 2CN8A 2YM4A 3V8SA 1O6KA 1JPAA 4GT4A 4U43A 3PRFA 4RC3A 4V04A 1Q97A 1ZZLA 3UZPA 3AC5A 3ELJA 5BMMA 3PSBA 4X6RA 1REKA 3RCDA 5CF6A 3CD3A 3QTUA 3C5UA 2I7QA 4A9SA 2UZLA 4RIWB 2PVLA 4UBAA 4IWOA 5EW9A 3R7IA 1PKDA 3NW6A 1UKHA 1YWRA 3PXFA 2UW8A 5EI2A 4BFMA 2JDSA 4F9WA 2YIQA 3VS5A 3U6HA 4AWIA 4BICA 5LXMA 1B39A 4E6QA 4E8AA 4AZVA 4CFFA 3DXPA 4CMTA 1HOWA 2IW8A 4DGLC 2OFVA 1E9HA 5HX8A 2QU6A 4HZRA 3ZDUA 5D1JA 1ZMVA 2PZYA 3EKNA 5HU9A 3Q4UA 4BCKA 4QMOA 3JS2A 5BVFA 2CCIA 4W4XA 4ZTHA 4RA4A 2QU5A 2X4ZA 3KXNA 5EKNA 2HWOA 3U87A 1Q41A 1SZMA 5JFWA 2JKOA 3SXRA 5HTIA 5BVNA 4AGUA 2VWIA 4IAAA 4KABA 4RGJA 1CM8A 4J71A 4WRGA 4XJ0A 3FY2A 4I5PA 5FEDA 4D1SA 2OFUA 3DXQA 4FE2A 2VTIA 1ZY5A 4ANMA 5BQ0A 5GIPE 1ZYLA 4WUNA 1QPJA 3IKAA 2XNPA 1BKXA 2R64A 3MH3A 1XHAA 2BRMA 2JIVA 4JIAA 3IW6A 4BKJA 4DFLA 4ITJA 4EBVA 4I5CA 3ZCLA 5KMKA 3NYVA 2WGJA 5ETAA 1H1PA 5IKWA 3MW1A 5AV0A 4E93A 4NFMA 5EK7A 3RALA 4ERKA 4OAUC 2OXDA 3KXGA 2RFSA 3U6IA 4BHNA 4DC2A 2W4OA 3EQDA 3F66A 1M7QA 4IB0A 5KZIA 4D28A 4EQUA 5JZJA 4TRLA 2R3QA 3FZPA 4PP9A 5ETCA 4D55A 4EBWA 3VJNA 4EZ7A 3MIYA 5FDPA 2IW6A 4O7ZA 2XA4A 5C8MA 1PXMA 4RZVA 4AP7A 4FMQA 5GZAA 3WF9A 1W8CA 2QOLA 3RI1A 3CLYA 4FEXA 3I4BA 3VUIA 2R3FA 3AT3A 3LOKA 3DQWA 4LOPA 4LYNA 5CZHA 3R7UA 4YU2A 2QOQA 2BHHA 3A8XA 4GVJA 4L52A 4AOIA 4FA2A 4BZNA 4FEVA 2VWUA 3NRMA 5KBRA 3EOCA 4HVSA 4JLCA 3S2PA 1G3NA 4AACA 4RC2A 2V22A 4LUEA 1R78A 3PWDA 4HYHA 5CSVA 4BCFA 1A9UA 4B9DA 2WIPA 4L67A 4IIRA 4AS0A 5F94A 3TNQB 3MTLA 2GS6A 2GNHA 1ZOEA 4J98A 5DWRA 4WHZA 3BU3A 4FV2A 4PY1A 3ET7A 4RFYA 3TV6A 4ZSJA 1T46A 4D2PA 2J9MA 3S00A 3KC3A 4CGAA 4RJ6A 3C4WA 3FC1X 3UYTA 4ZLOA 4ZSAA 5ACBC 3RKBA 4ZY5A 5L2IA 1MQ4A 2PVNA 3LCTA 3AOXA 4F4PA 2Z02A 2UZOA 2XH5A 3AC2A 4RWJA 4I94A 2UVYA 3SD0A 3W18A 5JH6A 2X0GA 4FYNA 3CE3A 5DG5A 4DFYA 4XG4A 4O27B 2NNWB 1OIQA 4FSWA 2QNJA 2YM6A 3LXNA 2XNOA 4WNKA 3TV4A 3OEFX 3R9NA 1VZOA 3RINA 1OECA 1WBVA 2Z2WA 2C5OA 5CF4A 4GJ2A 5L2TA 2XS0A 4XNEA 5IEVA 3LMHA 3UPZA 4F64A 4J95A 3RVGA 4HW7A 5BVEA 1M2QA 2E9VA 3CY2A 3MA6A 2IZUA 4GEOA 3QD0A 5CX9A 3RHKA 5ANDA 1YRPA 4IVAA 2ETMA 5DEYA 5J95A 3CTQA 4FZAB 4EK8A 2JKMA 4BDEA 3R7OA 4ALWA 3BWFA 1P4OA 2G2IA 2ONLA 1GIJA 4IZ7A 1PHKA 4FSTA 3OXIA 4ZAUA 3UC4A 3EFWA 5AR7A 3OW4A 3GB2A 3OD6X 3F6XA 2I0VA 4WNOA 4I24A 2V7AA 3FMKA 3FPQA 5JZNA 4L9IA 4FNZA 3HP2A 3UC3A 1ZLTA 4QMVA 4GSBA 4U45A 1GNGA 2YDKA 4C4HA 5I9WA 1ZYCA 3E88A 1URCA 3QGWA 4C36A 4RJ7A 3G51A 3MA3A 4FG8A 2WKMA 5C27A 4C59A 3I0QA 3O0GA 4QMXA 3AC4A 4I6QA 5ETIA 4U44A 1H08A 1OUYA 3UMXA 2C1AA 4O2ZA 3HV5A 4C57A 4OAVB 3D15A 5DYJA 2CLQA 4CFUA 3FLQA 5IZFA 4O6LA 3LHJA 4OT5A 1ATPE 1J91A 2FSTX 4L43A 1XR1A 3QWJA 2QOIA 4QMMA 4Y73A 4BDJA 2UVZA 4O83A 3UVRA 3PTGA 4DT8A 2JDOA 3PXKA 3MTFA 3QALE 4LGGA 3W10A 3KRRA 5AWMA 3NDMA 1E1VA 5IQIA 2DQ7X 3QD4A 3VBVA 2WELA 2VN9A 4I93A 2RIOA 2VWVA 3ODYX 3LXPA 1H00A 4KIKB 3ZC5A 2FB8A 1XKKA 4S30A 5K0XA 3KULB 3NX8A 4AN2A 2PPQA 2VO0A 2GHMA 3UNZA 3E3PA 3D9VA 3JXWA 4ANLA 2UW6A 5AX9A 5GJDA 4QQCA 4I0RA 4F99A 2C30A 3P0MA 4V05A 3Q32A 4AFEA 4TKSA 2C3IB 3POZA 3ITZA 3GVUA 4D4SA 4DH8A 2B9IA 2J2IB 5I3OA 1YI3A 5GINE 1ZWSA 3TIZA 4EZ3A 4DTAA 4GFGA 4I23A 4P90A 5EI8A 3SAYA 4DH5A 2QODA 4EH6A 2C0IA 3UP2A 4F1OA 5FTQA 4FEWA 3BKBA 4IDVA 5CQWA 2FSMX 3IONA 3Q4ZA 4CZUA 3ZFYA 4FV6A 4EK5A 3K3JA 1DI9A 3LZBA 2BFXA 3ZMMA 2HY0A 3P7BA 4GRBA 4UEUA 5AP6A 3U4UA 3QQJA 1I44A 5AP3A 4EH5A 5B7VA 2BR1A 3NCGA 4G9CA 3QRKA 4QT1A 2YJSA 4MQ1A 5HNBA 4B7TA 4EORA 3OUNB 3TJCA 3W8LA 2XP2A 2XNEA 2CSNA 3CC6A 4FT7A 5B2KA 3U8WA 4O84A 5CEPA 4GFMA 4JRVA 4QTEA 5ANJA 3DAJA 4HZSA 5L8KA 3LE6A 5CS6A 3GC0A 4I20A 1U5QA 3Q04A 2P3GX 4I6FA 2VTRA 2OO8X 4PNIA 5HG8A 1OKZA 2ONLC 3NUYA 4HGTA 4AE6A 4BDAA 4O2PA 2J7TA 2WZJA 5AUYA 5KE0A 4BDIA 4YTFA 4Z7HA 1ND4A 3N4VA 3AXWA 2UZTA 3HEGA 5FP5A 2XKDA 3QBNA 4RFZA 4ZTNA 4YMJA 3QTZA 3TJDA 3HX4A 3OWKA 4Z16A 4USEA 4LQMA 2HXQA 2DWBA 4FL1A 4DGNA 4R3PA 4A9YA 3QTRA 3NUNA 5CSWA 5CQUA 4YPDA 2ZMCA 3UVPA 2HK5A 4FKVA 2R3NA 3HGKA 2Q0BA 3G5DA 3UJGA 1OZ1A 3G9NA 4XP0A 5KCVA 4XP3A 2EXEA 4S2ZA 3OBGA 2G9XA 3MVJA 3LW0A 1NA7A 3HYHA 1M52A 4X2GA 4BTFA 4J7BA 4KRCA 4EOMA 1R1WA 2R0IA 1CMKE 2X9EA 4F1MA 3FLSA 3GI3A 3SVVA 3F3TA 2C5NA 4BBFA 5I4NA 2C47A 3UBDA 4BWPA 2C6TA 2GPHA 3R21A 5H3QA 3ZBXA 4J96A 4FTMA 1M7NA 4MF0A 3PUPA 5KBQA 4K18A 3COHA 4IWQA 4BBEA 3GOKA 5BUEA 1IA9A 4H1JA 2NRYA 2X2MA 4NIFA 1J7IA 3IW8A 3GXLA 1H0VA 3EHAA 2OIQA 4U0IA 4DEBA 3CBLA 2UZNA 3EMGA 4H05A 3IGOA 3V5WA 5DE2A 2BAJA 5BUIA 4RIXB 3MDYA 4Y83A 3ENMA 4FVPA 4FZDB 3LFFA 4BZDA 4IEBA 4CT1A 1CKJA 3KMUA 4K2RA 4UY9A 2FGIA 5LVOA 3IOKA 4FT0A 3QQLA 2DUVA 4IANA 4OTWA 1JWHA 2ZB0A 4AT5A 4AGCA 4FKUA 4GKHA 5HO8A 2VTNA 5IDNA 4AA4A 5HD7A 1GJOA 3FMHA 4B6LA 4EJNA 3AC3A 3DTCA 1YVJA 3V5LA 3ZU7A 3TDVA 1PKGA 3CSVA 2QURA 5IEYA 1ZZ2A 4PL5A 2XRUA 3S95A 3NNWA 3TDWA 1AGWA 2XIZA 1SVEA 2VX3A 1YI4A 3GCUA 4K8AA 4UXQA 3FXZA 2HW6A 4JRNA 1KV1A 1XWSA 3I6WA 4ACGA 4JBPA 2J4ZA 2FYSA 1NXKA 3ZUTA 1H1QA 3BIZA 4E4MA 3QX2A 4TYGA 4ITHA 5LJJA 3F5UA 1DAWA 1K3AA 2WEVA 4L3PA 3KF7A 4YZ9A 4LRMA 1UKIA 4E5WA 4TL0A 4R77A 5HX6A 1X8BA 5H8EA 1NVQA 3LCDA 5CU6A 5AAFA 5IA2A 4JL9A 3MY0A 1QL6A 5HIBA 3R8ZA 2F7ZE 3JPVA 3HRBA 4YNEA 3VS2A 1FVRA 3ZO4A 3DS6A 3R2YA 4DFNA 2P0CA 4QTDA 4ANQA 2X7GA 4X21A 4BC6A 2VTAA 1YOMA 4FT3A 3QHWA 2I0HA 1ZARA 3CCNA 3JVRA 1XO2B 1ZMUA 2OKRA 1FVVA 2IZTA 4EQCA 5FTOA 4HJOA 2GNJA 3RK7A 1W0XC 4USDA 4MD9E 3UGCA 4YJVA 4RVMA 1SNUA 2VWZA 3UDBA 3VBXA 4AA5A 3O8PA 1Z9XA 2EB3A 2J50A 3RMFA 1V0OA 4MX9A 2CNQA 2PUPA 3PY0A 3EN5A 3K5VA 5DR2A 4F0IA 1Z5MA 4C4JA 2OW3A 1SVGA 4U8ZA 3LLTA 4O22A 4FNXA 2X8DA 4RVTA 4U97A 4YZDA 3BLQA 4EH9A 3N4TA 5AX3A 4ANSA 4O38A 4ITIA 4O0UA 4QMZA 4PTEA 5C01A 2R3JA 2XM9A 3T9IA 5FGKA 4ZZNA 4QP1A 3UQCA 3V5PA 4N57A 4TNBA 3P23A 4HGLA 1IR3A 5AIKA 4NM3A 3SW4A 3VF8A 4AN3A 5EQYA 1J3HA 4FTRA 4AZFA 4BN1A 4JG7A 2GNGA 1CKIA 1TVOA 4L7FA 4GCJA 1OIUA 3PA4A 4ENYA 3ZZWA 5E4HA 4DCAA 4FV0A 4N0SA 3O51A 3FLZA 4FT5A 4LOOA 1QPDA 4RIOA 4YTCA 3FXWA 4CFVA 2XJ0A 3KXMA 3MJ2A 4YJQA 3OS3A 4M67A 5HIEA 2W5AA 2YJRA 3ACKA 3A7FA 2Y0AA 3PVGA 4PDSA 3KVXA 3NIZA 5CU3A 3HAVA 2VZ6A 3GQIA 3ZEPA 4XMOA 2C0OA 2ZYBA 1MRYA 4TW9A 2B55A 5CANA 1MP8A 5AUUA 3FMJA 3TUDA 5EKOA 5M51A 4KSQA 4FZFB 5BVKA 3DZOA 5AJQA 5IH4A 2O63A 3HMPA 3WIGA 4PMPA 5ICPA 3KK9A 4O7WA 3PJ8A 2OXYA 1TQPA 5K9IA 3FUPA 1PXKA 4UMPA 5BVDA 2H34A 2XJ2A 4JIKA 4OTRA 4ACMA 4YO6A 3LQ5A 5CEQA 2UVXA 5E92A 4PMSA 4XG3A 2IJMA 3MYGA 1UNGA 3LFCA 3CXWA 3B2WA 4RX7A 3C13A 3C50A 4GIIA 5AR8A 4TYHA 3D7ZA 4ZJJA 3RGFA 2HCKA 3QKLA 2A27A 4BYJA 1ZAOA 3FI4A 4OBOA 3JUHA 2OICA 5HNGA 3I5ZA 3Q4CA 4RFMA 3FI2A 4GU6A 5DT4A 3UZRA 3QTXA 3BYOA 4UX9A 4M3QA 3MV5A 2YM8A 2Y4IC 1XH8A 3DNDA 4TNDA 2YM7A 1G5SA 3QKKA 4RX9A 1M17A 2PUUA 4DBXA 4K6ZA 2BZIB 2VTJA 4NW6A 4EH2A 3EB0A 1YDRE 3FDNA 3A7IA 2WMAA 3PRIA 1WBWA 3DAKA 2VTTA 5J1WA 4R6VA 4WG5A 3DXNA 4AXAA 2UV2A 4OTIA 2C5XA 4O7LA 4QMNA 4XRLA 5DVRA 4ZMEA 1OPKA 4R3CA 3CR0A 1BLXA 3EIDA 3R1YA 2R3HA 5K0KA 4TXCA 1OB3A 1XH4A 3GU7A 3OTUA 4XX9A 4Y5HA 2QKRA 3NNXA 4HGEA 3HRCA 5E8WA 3VBTA 4RRVA 3RPYA 3QQFA 4C33A 3EQFA 4MD7E 4AZEA 4FZ7A 5AP4A 4GT5A 5F1ZA 4F7LA 3TG1A 2ITYA 4MD8E 2AUHA 4EOOA 3DBEA 3VRZA 2JFMA 3DK7A 1IG1A 1UNLA 3IDCA 3NYXA 4MBJA 4EKLA 5JFXA 5HG7A 2AC5A 2XIRA 2JLDA 3BRBA 4IE9A 4GU9A 5DBXA 4EOQA 4ZXTA 1DS5A 3R7VA 3SOAA 2A19B 2RFEA 4DYMA 4QP7A 4ANOA 2DS1A 3DDQA 3EZVA 4YZBA 4EZ5A 4FTIA 4I5MA 2WQBA 3LM5A 4BCOA 2A1AB 5DNRA 2JIIA 3IG7A 4E73A 3OFMA 4IC7A 5HLPA 4IAIA 2EXCX 2GSFA 4EOKA 2VWBA 4X2NA 3I81A 3ATTA 4D4YA 3P79A 4R7BA 3DB8A 4RLLA 4ZLYA 4UWCA 2H96A 4O0VA 2QR8A 5GZ9A 2QD9A 3OXTA 3NUUA 1OKYA 4I21A 3WF7A 3EQPA 1YKRA 3R1NA 4C7TA 3VHKA 1R0PA 3UOHA 2YCFA 2UW9A 2PY3A 3PYYA 2VTSA 2XIKA 4ZTRA 3RAWA 4F08A 1WBSA 4F6WA 5C4KA 4FV8A 2XNMA 3G2FA 1VJYA 2E9NA 3ORNA 2XKEA 4Y85A 3T8OA 2R2PA 4QMQA 3EJ1A 1J7UA 3AT4A 3BX5A 3D7TB 4G3EA 3O71A 1MUOA 3NZ0A 3FZSA 3GEQA 4MNFA 3WYYA 3PJ3A 4C58A 5IQHA 4QP3A 2ETRA 4AW2A 5K5XA 3B8QA 4ZJIA 4YBKA 1XH7A 1DI8A 2C6MA 4N6ZA 4BCQA 3F2RA 1U54B 3TTJA 4ACDA 4E4NA 2RG6A 4LGDA 4BDBA 5A4EA 2W05A 1SNXA 3AGLA 4NL0A 4IXPA 1RQQA 3M11A 1H24A 5CTPA 5CSXA 3R7YA 5LOHA 4U80A 4HYSA 4YSJA 4IVDA 5M4UA 3S0OA 3BI6A 5L6WL 4KB8A 4ACCA 1YXTA 4CVAA 2IVSA 2OSCA 4MH7A 5BMSA 2ZAZA 4YC6A 3WZDA 5IEXA 4NM7A 5HVJA 5DHJA 4TYEA 3ZTXA 2CKQA 3U54A 2W1DA 4IB3A 2YLEA 4AG8A 3DBDA 5DRBA 3VWAA 5TF9A 4AAAA 2JDTA 4C4GA 1PRYA 4MWIA 5M55A 4ALVA 2Z60A 4TWCA 4FSRA 5C26A 5IPJA 4WIHA 3PZHA 5EDRA 2FUMA 2OH0E 4LMNA 3FZOA 4P2KA 4YZCA 4WBOA 3NLBA 5LQFA 1I09A 3EFKA 4BGHA 3FLYA 3QZHA 3VN9A 3FJQE 3RHXA 3UIXA 5B2LA 5L6PA 2PHKA 2I0YA 3PVUA 3UOKA 1LP4A 3LKMA 2JD5A 2PZPA 2W1GA 3VS1A 4WKQA 3KCKA 4NK9A 5CT0A 1GOLA 4G3GA 1H26A 4PDOA 2J6MA 4NSTA 3T3VA 1YXXA 4EWHA 4CTBA 5A4CA 4J53A 4WRSA 5L8LA 4XYFA 5I9UA 5AUVA 5HHWA 4TPTA 5HVYA 3KF4A 2PMNX 4GV1A 4UMQA 3TEIA 1PYEA 4QQTA 3UPXA 4O0SA 2CKOA 4I92A 1Q99A 3OZ6A 3TI1A 4LOQA 2W9ZB 1SVHA 4V0GB 2OJGA 4M69B 1U4DA 3Q6UA 4RA5A 1GIIA 3TZ8A 3P7AA 4G3CA 3IECA 5IQFA 5J9ZA 2WU6A 4CMOA 4ZP5A 4F70A 4H3PA 1PXJA 3DAEA 3TNPC 2VGOA 4DG0E 3AQVA 1GZNA 4G31A 4BI0A 5M08A 2C6KA 3LM0A 4U40A 5HVKA 4U41A 3SOCA 2Y7JA 5M44A 4EK6A 3R7EA 4N70A 3OCTA 5FD2A 3MVMA 2ITOA 3ZSHA 1W7HA 3FSKA 4RT7A 2PL0A 5EFQA 3ANQA 4E6CA 4AX8A 2GNFA 4J8MA 3ZLXA 3V04A 4JVGA 1JSTA 3R7GA 5TR6A 3W2OA 3N51A 4OTFA 3V5QA 4ANBA 4DH7A 4MNEB 5CENA 3OTVA 4LI5A 4XBUA 4PP7A 3FKLA 2XM8A 3LMIA 2C68A 4YLKA 2B53A 1V1KA 2QHNA 3QU0A 4RC4A 3PJ2A 4FKTA 4JX3A 4RJ4A 3BCEA 4KNBA 3RNYA 2B9HA 4FTJA 4D5HA 3VF9A 3UOJA 3V8WA 4YR8A 2XCKA 3WZKA 4K0YA 2W96B 3IW7A 4O7TA 3AMAA 3IW4A 5CXZA 5IQGA 4QMSA 4JDKA 3NS9A 4TN6A 5LVMA 3DKOA 3QZFA 3M42A 2C0TA 4GUBA 5DI1A 2YCQA 4KUJA 1OPLA 5EHYA 1F0QA 1FVTA 3OT3A 2JAVA 5BYYA 3CGOA 4JBVA 5FXSA 4HVHA 2WOTA 3VW8A 1H28A 2CCHA 3D14A 5JEBA 2F7XE 1Y57A 1WCCA 2YAKA 4IWPA 2VO6A 5FWKK 4G34A 3HKOA 4OTQA 2PYWA 3L9MA 2J5FA 2ZM4A 4WT6A 3BHTA 2XIYA 3N4UA 2HZNA 4ZSEA 3REPA 3TCPA 3QD3A 4AE9A 3L8SA 1PXLA 4IM2A 1M2PA 3Q60A 1KE6A 3FMMA 3TNHA 5DLSA 3A4PA 4AZSA 4CKJA 3NYNA 4G17A 3BZ3A 3VUDA 3QFVA 4QO9A 2X2KA 3AD5A 4FZ6A 4YHFA 4AW1A 3MY1A 3QTIA 2BRGA 2BDJA 2XKCA 1JBPE 3C4ZA 3E5AA 2QLUA 4IACA 4FKSA 4QQ5A 3RWPA 4V01A 3R28A 3E62A 3BEAA 2GNLA 1KOBA 4RPVA 2XB7A 2XBAA 3FPMA 3QUDA 4NKAA 4FOBA 2XZSA 3CQUA 4YHJA 2ZDUA 1PJKA 1JAMA 4GH2A 4KS8A 1VEBA 2C6DA 3KN5A 2WO6A 3G0FA 2WIHA 3HVCA 2WAJA 5FRIA 2BRHA 1GZKA 2CGUA 2IO6A 1ZYDA 2PTKA 3DPKA 3CQEA 3AT2A 1YWVA 5J9LA 3QRUA 3R22A 4YBJA 2BVAA 2WU7A 3A99A 4HOKA 4USFA 4RMZA 4JDHA 2XUUA 4EOJA 3ZH8A 3DGKA 4Z9LA 1PXPA 2HWPA
chains in the Genus database with same CATH superfamily
3BPRA 2ITNA 2BKZA 1Y6BA 5D9HA 3UTOA 3SC1A 2X7FA 4GS6A 1T45A 3F3UA 5CF5A 2F49A 2W4KA 4LM5A 5CYIA 2BILB 4BCPA 3R02A 3G9LX 2OI4X 5A4QA 3KEXA 2AYPA 4XOZA 2WMRA 3ETAA 5KMMA 1MRUA 2C6OA 2I1MA 2QO2A 2C4GA 3ORZA 3E92A 3FMDA 3H3CA 4NCTA 1YDSE 3R30A 2XANA 3VS6A 2GTNA 3BV2A 4IWDA 4ZTSA 3ACJA 1H27A 1E1XA 3E63A 3QC9A 4KAOA 5GJGA 5JGBA 2YIWA 1PYXA 2GQRA 1KE5A 4A4XA 3PPKA 4P7EA 4P4CA 2IF8A 3AGMA 2YA9A 5CVGA 4W4YA 1TQMA 2YN8A 4RX8A 3OMVA 3C0GA 2O5KA 3D4QA 4XG6A 4PMMA 4I5HA 3D5VA 3R71A 2W5HA 5AP5A 3VBQA 4NJ3A 2W4JA 3A61A 4OTGA 5HCZA 1P4FA 3MS9A 4FRFA 4IB5A 4K11A 3VNTA 4BVUA 4C3RA 4DEHA 4E6AA 5KX8A 5E8XA 3JR1A 2PE1A 2E9PA 5IQCA 5HOAA 2JBOA 4H3BA 5AUWA 3HDMA 4FTLA 3ZXZA 4KKGA 1KV2A 3QZGA 2HXLA 4NW5A 4WNPA 4O0XA 2CGWA 2UW4A 4KRDA 5E91A 5T68A 4R78A 4I6BA 4GVAA 4ZSLA 2GQGA 3O8UA 2JGZA 1JKLA 4FV4A 4XV9A 3IQ7A 4F0GA 3HMIA 4U7ZA 4YJNA 3HUCA 3PE2A 5ANOA 5D7AA 5HE0A 2WTJA 3KFAA 2WMVA 3PXYA 1XH5A 2CLXA 4XG8A 3VQHA 4BI1A 4XEYA 4AT3A 4CV8A 4EUTA 1W2FA 1RDQE 3KCFA 3PFQA 1OUKA 5I9VA 5IUIA 2X0PA 2QG7A 3BV3A 4WG4A 2G01A 2EB2A 1YHSA 3Q9ZA 5CI6A 1G8SA 4FC0A 1XH9A 4ZS0A 3C4XA 5JT2A 2ITTA 4RIYA 3KXHA 5E8SA 3NCZA 4W9XA 2KULA 3H9OA 1Q8ZA 2BTRA 2B0QA 4DHIB 2B54A 3FEGA 1O9UA 4F09A 2OZOA 4RVLA 4L42A 5JFVA 4YLLA 3IO7A 3P86A 5JGDA 2OLCA 3PIYA 2V0DA 1YQJA 2YIYA 3C0IA 2ZV2A 3FLWA 5HU3A 2CDZA 3Q52A 5I9ZA 2R3PA 4FT9A 3GGFA 3RZFA 5K3YA 4TT7A 4DITA 4TYIA 4GK4A 2Z7SA 2XBJA 3BU5A 4AT4A 5J9YA 5T6KA 3LCKA 2ZDTA 4IJPA 4AGWA 4IW0A 4OR5A 2BHEA 4CTCA 5AM7A 5A6NA 5IQAA 3NW7A 4XP2A 5H8GA 2WPAA 3O96A 2W1FA 4EHVA 3ORMA 1OM1A 2WMQA 4W8EA 2YDJA 5JN2A 4FTCA 2F2CB 3O7LD 3U4WA 1ERKA 4CMUA 3EFLA 2X8EA 1YHWA 1R39A 3C51A 2ITZA 5HZNA 3O2MA 3P1AA 4NCTC 3A62A 5E7RA 4AOTA 2J0JA 5M4IA 3RCJA 3D2KA 4RLKA 4C38A 4IZAA 2HYYA 1CDKA 3BGQA 3UO6A 3PSCA 4FTNA 3FHRA 5ANEA 4DGMA 4UMUA 3CD8A 4BCGA 4BDFA 2ACXA 3MFRA 5KHXA 3VRYA 4CFNA 3LLAA 3ZRMA 3FSFA 5KMIA 4QMUA 5AM6A 5FDXA 2R4BA 2ETKA 4C2WA 4M8TA 5HE3A 3ZO2A 4CZYB 5CVHA 4MXYA 3D2IA 3GT8A 1OGYA 4G5JA 4PRJA 3UDTA 4GYIA 1B6CB 5A14A 4FSNA 3VIDA 3QF9A 3N9XA 1XQZA 3OT8A 5EDQA 4F9AA 1K9AA 5EYCA 4CRLA 3LFAA 4NM5A 3LIJA 4I6HA 1OL5A 5CY3A 3Q9XA 5F95A 4TZRA 3SRVB 3WILA 4EH3A 2XYUA 3NVMB 3UP7A 4TYJA 2OIDA 2YCRA 4MKCA 1Q8UA 3GENA 3PXZA 3QLFA 4JG8A 3E8EA 3E3BX 5E8VA 3VBWA 5CF8A 2IN6A 3MH2A 2HW7A 3QZIA 3RBWA 2O0UA 4BKZA 1IEPA 4KBAA 3PA5A 4RQKA 4I22A 3UG2A 4D4RA 1GY3A 2I0EA 5IUGA 5HIDA 1Y91A 4WSYA 5CXHA 2QKWB 4UV0A 5M09A 4APPA 3VONA 4PTGA 4UALA 1GZOA 2GHGA 1ZXEA 3GU4A 2J51A 2X6DA 3AD4A 2C6IA 1QMZA 3VC4A 3Q2JA 3BYUA 4L01A 4C34A 3R8LA 1XMMA 4C37A 3HMOA 4BCMA 4F6UA 2IEWA 1B38A 2C3LA 3E93A 2RG5A 4NTTA 4RG0A 5J79A 2YEXA 3CKWA 4FNWA 4CFXA 5DMZA 5I9YA 4BCIA 4CKRA 1YW2A 5CSPA 3F7WA 1KOAA 4KA3A 1F5QA 1S9JA 4UYNA 2Q83A 2G2FA 3COMA 4MXAA 3ZDIA 3DDPA 1DM2A 3PA3A 4FL2A 4F9CA 3KN6A 2RKUA 4IX4A 4WNMA 4OBPA 3SG9A 4JAIA 3TL8A 2R3LA 4QYYA 5BYLA 2PVHA 4MBIA 3UG1A 3P08A 4NU1A 2H6DA 3GFEA 3DK3A 2GTMA 3PZEA 3QCYA 4FKGA 2P2HA 5EYDA 4YUQA 2QG5A 4FSZA 4KS7A 4IZYA 4L7SA 4ZIMA 5CEOA 4FG7A 3E8DA 3BLHA 3FKOA 3I79A 3BWJA 2A4LA 5C8NA 3ZLYA 4DAWA 4MUQA 4EWQA 4X2FA 2UZBA 3EQRA 3OC1A 2PSQA 4KBKA 4NIFB 4F63A 4DH1A 1MRVA 4CNHA 5HCXA 4FV7A 1BL7A 3QHRA 1UWHA 4TTHB 5FEEA 4AXDA 3A7GA 4KIQA 1QCFA 1ZRZA 5CEKA 5JFSA 3C4CA 4Y8DA 4PV0A 2C5VA 2BRNA 3LFBA 3AMBA 4ZY6A 3OEZA 2XK7A 1YI6A 2GCDA 2Y9QA 3IK3A 4IX5A 1GZ8A 4FGBA 4YPSA 1UNHA 3COIA 3KK8A 3ORPA 3NAYA 4FG9A 3NFGB 2XNGA 3BGPA 4IH8A 4H36A 4M68A 3VQUA 2PMLX 1W2DA 3D5UA 3IPHA 4C02A 3BQCA 5GZ8A 1OVEA 4FKIA 2YCSA 4ID7A 4Y5QA 5F9EA 4FR4A 2XJ1A 3C9WA 2QHMA 5FQDC 3LFEA 4CG8A 3PG3A 2VNWA 4FICA 3B8RA 1OMWA 1Y8YA 4CFWA 5DIAA 3FL4A 5G1XA 3RPOA 4QNYA 4JBOA 5GIOE 5HG9A 2PWLA 2J0KA 1FGIA 4FKLA 4FTOA 4TY1A 3UZTA 5FM2A 3PY1A 5CZIA 2PUNA 4JDIA 4E5BA 4R7HA 4IJ9A 3HV6A 3QQKA 4YC3A 4JNWA 3MGYA 4QP6A 5IG1A 3QQUA 2VGPA 4ZTQA 5IMXA 3P5KA 4QYHA 2Y4IB 4CQEA 1Q4LA 5AR5A 3F61A 4DF3A 2OZAA 1PXIA 3NUXA 1ZOHA 2Y4PA 4DH3A 2VO3A 2WFYA 5AA8A 1LR4A 1JLUE 3DCVA 4EONA 4NZWB 1LUFA 1Q8TA 5AIRA 3AMYA 3VS4A 2QO7A 4EJ7A 4D4VA 4ORKA 3PVWA 3ZONA 2YLFA 4O21A 2IWIA 3ENHA 5IH5A 1UV5A 2QO9A 3BHUA 3F2AA 3SA0A 3U55A 4BKYA 4O4BB 3QL8A 4BIBA 3UO5A 4X3FA 4BGQA 5A4LA 2ITWA 3L8XA 4CCUA 2HELA 4OTHA 1Q62A 5I9XA 2EUFB 5CAQA 1JVPP 2Y6MA 4PQNA 3I60A 1ZMWA 1IAJA 2O64A 5HI2A 4GK3A 4LDTA 2FA2A 3QYZA 3DT1A 3G15A 1SMHA 3HP5A 4FIEA 4QYFA 4BTMA 4C8BA 2CJMA 3FMNA 4JAJA 4WD5A 4DHFA 2UZDA 1PXOA 4JQ8A 3CEKA 4O4CA 3TXOA 3CS9A 3VO3A 5JRSA 4DBNA 3PY3A 4BIEA 4MK0A 2ITQA 3Q96A 3PDTA 4LFIA 5FG8A 1XMLA 3BELA 4PWNA 5L3AA 3ZM4A 4FK6A 4M12A 2QI8A 3MB7A 4O4DA 3VS7A 3KRJA 5KMJA 1ZYSA 5HESA 4IBMA 3SG8A 2JFLA 3MWUA 4BZOA 3F82A 3MVHA 3THBA 4EH4A 2UW3A 3FV8A 2WMWA 4NM0A 4NYEA 5IQDA 2NO3A 1W84A 4Q9SA 3WIKA 1VLRA 5DEWA 2W1EA 2V55A 1Q61A 4C0TA 4IM3A 2PE2A 2X7OA 2ZJWA 4RVKA 3A2CA 5FEQA 5I5ZA 4AXFA 3SHEA 4JDJA 3CIKA 3EL8A 1YXVA 4FYOA 1OPJA 3GU8A 2BMCA 2HZ0A 3HDNA 3R00A 4MXOA 3WF5A 5L2WA 3H30A 4I3ZA 3MI9A 2ZVAA 4LV8A 2ITVA 4D9TA 5HO6A 3ROCA 1XBCA 2PU8A 5CLPA 4O96A 4PDYA 3PVBA 3WYXA 2WQNA 2O3PA 3HZTA 3RPVA 4BCJA 2WMSA 2YIRA 2QLQA 4QMPA 3GCPA 4TYHB 3O50A 4W9WA 4EI4A 5ACKA 3WE8A 4UMRA 5IQEA 3S4QA 3GP0A 5M53A 4MXCA 4HGSA 4QTCA 4O81A 4O4EA 2BFYA 2VTPA 4C61A 2PULA 1XBAA 4Y95A 2C1BA 2JEDA 5CI7A 4NEUA 5AP1A 4MAOA 2YAAA 3ZFXA 4AW0A 4DTKA 5EG3A 2E2BA 3RJCA 2XF0A 3CTJA 3FBVA 4NT4A 2KTYA 2BALA 3U9NA 4RWIA 3DBQA 4D1XA 2JDRA 1WVXA 2UZVA 3KGAA 3L1SA 2ERKA 4H3QA 5CAOA 3NMUF 4M14A 2XIXA 4AZTA 3LPBA 4YJPA 1UVRA 2XVDA 4X3FC 4RWLA 5FXRA 1P2AA 5KKRB 3AC1A 3TUBA 5M4FA 5GNKA 4O7NA 1R3CA 3QGYA 2XNBA 4DLIA 4LL5A 2UZEA 3V5TA 5CU4A 4EYJA 3GCVA 3GOPA 3F9NA 2VWXA 2Z7QA 1FMKA 2C5YA 2PZ5A 4FV1A 4PX6A 3W0PA 5B0XA 3OY3A 3LJ2A 3GU6A 3I7CA 3UIUA 3KREA 4BJJA 4QP4A 4YGAA 1W83A 4W4WA 5DOSA 3A4OX 1H0WA 4WA9A 4YP8A 4DT9A 4QMYA 5G6VA 4E1ZA 3F3ZA 3HA6A 4FTKA 5E8UA 2YHVA 2W17A 5HE1A 2ZMDA 3QYWA 5I3RA 2VTHA 1KE9A 2IVVA 5H2UA 2UW5A 4R7IA 3GC8A 3ZEWA 4FIJA 3HMNA 4RBLA 1A48A 4PDPA 2IVUA 4Z55A 1JNKA 2GS2A 3HUBA 4E7WA 4MF1A 2E9UA 2WQEA 5A54A 3FMLA 4XUFA 3FYKX 2ZV7A 3ZSGA 5HBJA 3BLAA 3ZC6A 3EZRA 3MPAA 3CPBA 2QCSA 3C4EA 4DEDA 4IAZA 4DGGA 4WUAA 1FINA 3RAIA 1BYGA 2QVSE 5LMAA 2J0MB 2VUWA 3AKJA 5E9EA 3D7TA 2UZWE 2WMXA 4A9UA 2WTKC 1NY3A 4BY9E 4ZJVA 3HV7A 3C1XA 3PG1A 4QQJA 3W2QA 4EHZA 2P4IA 5HTBA 3W0MA 4X2KA 4MCVA 1F3MC 3K2LA 3K54A 3UO4A 1O6LA 2CN5A 3FWQA 3RNIA 1FOTA 1U54A 3CY3A 1OITA 4XS2A 3LQ3A 4FV9A 4ZZMA 2OJFE 4FNYA 4AFJA 2GNIA 4G9RA 3LFDA 4O1PA 4A4OA 5L4QA 4A07A 4L68A 4ZEGA 3C0HA 3VUGA 3KVWA 3QTQA 2R7IA 4H39A 2OJJA 4MXZA 5L8JA 4NTSA 3BEGA 5CAUA 4PMTA 4NKSA 4F7SA 4HPUE 3WI6A 2RFNA 5IUHA 3EN4A 3Q5ZA 3ZSIA 1KUTA 3R01A 1S9IA 3EYGA 4OLIA 5AP2A 5KMLA 2BTSA 3R9RA 3RAKA 2YABA 5FUTA 2BRBA 2YWPA 4L6QA 1PF8A 3R63A 2VTQA 5AFVA 3ZRKA 4BTJA 2GHLA 2OF2A 2YIXA 1IA8A 2PMOX 2RGPA 4ZY4A 4DE4A 3LJ0A 2B9FA 3DV3A 4S33A 4A9RA 3D5WA 5EDPA 1JKKA 3ZUVA 4ZS4A 2CNUA 3FZTA 3BBWA 4H58A 4BF2A 3PPJA 4M0YA 2PZIA 3R9HA 2OF4A 1BL6A 4B8LA 4GT3A 5DH3A 4F7JA 5BYZA 1JKTA 5CSHA 5KMOA 3MIAA 3I7BA 3ZM9A 5IMEA 3A7HA 2GFSA 2OJ9A 3DOGA 3II5A 3NGAA 1YDTE 4FEQA 3OWJA 3ULZA 4PPBA 4BR3A 3BL7A 1PMNA 2H9VA 3KKVA 3ZLWA 4X3JA 3SQQA 3R1SA 3S1HA 4M69A 3M1SA 5BVWA 3V01A 2ITUA 5J87A 3FZRA 4BWXA 3NNVA 4XHKB 2XCHA 3B2TA 4U3YA 3ROYA 3ZO1A 4R8QA 4WG3A 4JQ7A 3H9FA 4R1YA 3UNJA 2DYLA 4L8MA 2QOOA 4ZSGA 4IAFA 3G0EA 2BUJA 5AEPA 4KINA 2QOCA 2VD5A 3IDBA 2XARA 4FEUA 1OL2A 3DQXA 2J90A 4M66A 2OXXA 3SX9A 2VWYA 4GL9A 4AF3A 3NUAA 4DA5A 2W5BA 4S32A 3VUKA 3EYHA 3ORIA 4C62A 3QCSA 2VNYA 2PVYA 4B4LA 3TT0A 2WNTA 2NRUA 2ZB1A 4YC8A 4O7RA 4DEEA 2X0OA 1IRKA 3LJ1A 5GHVA 5C8KA 3RZBA 1NT2A 4RZWA 2UW7A 4FKPA 4D2TA 4O82A 3GBZA 2YACA 4OW8A 5HTCA 4JOAA 4AQCA 3F3WA 4L00A 4EKKA 2IZSA 2OG8A 2V5QA 3Q6WA 3ODZX 3ULIA 4GW8A 4EHGA 4O86A 3EN7A 4RIWA 2R7BA 4DGOA 5LWMA 4MWHA 3DY7A 3NR9A 5A3XA 1KE7A 2FO0A 4J52A 3QA0A 2I40A 4MVFA 1VYWA 3F88A 4IZ5A 3LMGA 2ITPA 3F5XA 3NYOA 4RWKA 2Z7RA 2ZOQA 5HCYA 4G1WA 2QC6A 3DBFA 3QAME 4AW5A 4L3LA 2R5TA 3HV3A 2AC3A 1BUHA 2W06A 4EH8A 3KRLA 4L44A 2R3RA 3QTWA 5HG5A 1TFFA 4AN9A 3NIEA 4WO5A 3OCGA 1UWJA 1QPEA 4XRJA 4XV1A 3TZ9A 5EM7A 2WXVA 1UU9A 3OOGA 1J7LA 4MEDA 4C3PA 3Q9WA 4XBRA 1FPUA 3RAHA 3Q2MA 4A06A 3TKIA 3VJOA 4KBCA 3NUSA 4AAYA 4G2FA 2XK8A 4HNFA 3SDJA 2WEIA 3L8PA 5DA3A 3C5IA 5TT7A 2BPMA 2GDOA 1OBGA 5EOLA 3ANRA 2UZUE 3L9NA 5AV1A 3DFAA 4D0XA 3A60A 4F0FA 4LV7A 1AD5A 4FTAA 3VVHA 2WTDA 4X7QA 4RSSA 3ML1A 5CU2A 2R3OA 4L45A 4CSVA 3OCBA 5AAGA 5ETFA 1L8TA 1YHVA 1YOJA 3QUEA 1GAGA 2G15A 4J8NA 3BLRA 3HLLA 5TO8A 1Q3WA 3OF0A 3PJCA 3BYVA 1DAYA 1LPUA 4G5PA 2X2LA 5HNIX 2X4FA 4BGGA 4CZTA 3IOPA 4FIIA 1O6YA 3OCSA 3RP9A 2HIWA 3QCQA 3PLSA 3FHIA 5KNJA 2YWVA 5EI6A 2O65A 3OW3A 3EQCA 3QRIA 5EM8A 3TNIA 2CKPA 5LMKA 1YWNA 2OIBA 3FKNA 3KY2A 4QPSA 4YTHA 3ZUUA 2WTIA 4FIHA 3ORTA 4JS8A 2E9OA 5ANGA 2YZLA 4IFGA 5AP0A 5AAEA 2PVJA 3DB6A 3BYMA 1OL1A 2BIKB 5HKMA 2F2UA 2FSOX 4O0WA 3HV4A 2ZM1A 3R9DA 4ASEA 4ASZA 2CHLA 2QQ7A 3W0QA 3BYSA 3VAPA 3VW6A 2BZKB 4FUXA 4LV5A 1WVWA 3KMMA 3VUTA 3W16A 4ASDA 4O7YA 2XRWA 4L46A 3JYAA 2J0IA 2YDIA 1BMKA 4HPTE 3W1FA 3PE1A 3R6XA 4IC8A 4YJTA 2JC6A 3CQWA 2Z7LA 3SXSA 4AA0A 5JK3A 3ZS5A 2P2IA 2PVMA 4ARKA 2ZV8A 3G90X 4FTTA 4EC9A 3D94A 5DGZA 4BDGA 4D2VA 3PXRA 3UDSA 4WBBB 4FUYA 3FMEA 3EQIA 3L8VA 3MFUA 4WOVA 4XCUA 4EC8A 4F78A 2JITA 1WMKA 4G3DA 4BRXA 4F6SA 1NVRA 4CYJA 4JR3A 3R2BA 4DFZE 1ZYJA 3LFQA 3SXFA 4BYIA 4ZTMA 5ITAA 5LVNA 4BWKA 4M0ZA 4GIHA 5JSMA 5HD4A 4GKIA 4XOYA 4EL9A 2JAMA 2OH4A 3EN9A 4IM0A 4XG7A 2VX0A 3RK5A 4OTDA 4XLIA 1J1CA 4F7NA 4N4SA 2HZ4A 3E64A 2ZM3A 3P9JA 4BTKA 5EM6A 4QNAA 3T3UA 3BGZA 4PPCA 4C4IA 4QMLA 4DLJA 3ZFMA 2C6EA 4YURA 3A8WA 3G6HA 4FKRA 1H8FA 4FODA 1VYZA 5L2QA 4L3JA 5LARA 1NW1A 3D83A 4MYGA 3ZRLA 2X1NA 3QXOA 1XJDA 2F9GA 3WARA 2J0LA 4IB1A 2PUIA 2VWWA 4H1MA 4IX3A 4LL0A 5HLNA 3T9TA 3NPCA 3MBLA 3P78A 3TZMA 4BDKA 5LVPA 5EQPA 4QMTA 5J1VA 5FLFA 4U3ZA 3QUPA 4FIFA 5T3QA 1U59A 4DFUA 2HAKA 2OGVA 3FLNC 1V0BA 3LQ8A 1Z57A 3PXQA 5K4JA 3PLAE 3WF8A 3QA8A 5AR2A 3RM7A 4AU8A 1PMEA 3GFWA 2XNNA 3IS5A 4A4LA 4PUZA 1CTPE 4I4FA 4X6QC 4ERWA 1P5EA 5C9CA 1UU7A 5DRDA 3O23A 3E8NA 3WE4A 4E5AX 4YJOA 5IDPA 3V5JA 2PK9A 5LMKC 3Q3BA 4RIYB 2R3MA 4KD1A 1JKSA 3UQGA 5D7VA 1YXUA 3ALNA 4HCVA 4MBLA 4YJSA 2PVFA 4JR7A 5HGIA 4Y72A 2ITXA 2X39A 4YO4A 2I6LA 4QPAA 4AXEA 2BKKA 4CV9A 5A46A 4R3RA 5CNNA 4FKWA 4F9BA 1REJA 4ACHA 2X6EA 3BHHA 2WTVA 4KIKA 1OL6A 1W82A 3M2WA 4QOXA 5AUZA 3VS3A 3KULA 1J1BA 2W1ZA 4APCA 4UWBA 2XYNA 4PPAA 3VULA 2R9SA 3R8PA 4Y46A 4CLJA 4UN0C 1HCKA 1EH4A 1CSNA 3G6GA 3C4FA 1A06A 2BAQA 4FSQA 1ST0A 4FX3A 2XK9A 4K33A 2B1PA 5JQ5A 4FTUA 2W99B 1Q8YA 1Y6AA 3K5UA 1WFCA 5KUPA 1Q5KA 5ANIA 3DBCA 4U42A 4FSYA 5E1SA 2B4SB 4FV3A 3OROA 4U9AA 4YTIA 3TN8A 4FF8A 4LMUA 3O17A 3WZEA 3COKA 2C3JA 4RJ3A 1UU8A 3LAUA 4KSPA 4UYAA 2VO7A 4UXLA 3ZZEA 5AUXA 5K5NA 1L3RE 3RM6A 2PVKA 4QMWA 2B7AA 3R0TA 4FKOA 1FMOE 2F4JA 4CXAA 4FIGA 4QTAA 1Q24A 5AV2A 3H0ZA 2WMBA 2XK6A 4KIPA 3TWJA 5J5TA 2OU7A 3W8QA 3RPSA 3FL5A 2BDWA 4AGDA 3V8TA 3G33A 1NVSA 3LXKA 3SRVA 4DN5A 2WHBA 3R04A 4FSUA 3DJ6A 2Y6OA 3H10A 4EYMA 5EQEA 3TMOA 5FM3A 3BHVA 2YERA 4GMYA 4GG7A 5FBOA 5LVLA 2AEGA 3NNUA 1JSVA 5HLWA 3TTIA 3BU6A 4RX5A 3QQGA 4EHEA 2OK1A 4LUDA 3R9OA 5DR6A 3WZUA 4QP9A 2EXMA 3KU2A 3I1AA 4KWPA 4GFOA 3W0NA 3BE2A 4MTAA 1OL7A 1TQIA 2F7EE 2XALA 4GUEA 4ENXA 3ZBFA 3GC7A 4AZWA 4D2WA 2XEYA 5A4TA 3W2SA 1BI7A 2C6LA 3FQHA 1JOWB 3E8CA 3LCOA 4PF4A 5LWNA 3TKHA 3VUHA 4R5SA 2WTCA 4OBQA 2BROA 3SKCA 4C4FA 3Q5IA 3MESA 4HVIA 4L53A 1KE8A 4HCTA 4JQEA 4W4VA 4CQGA 2Z8CA 3MPTA 4M97A 3H0YA 3DU8A 3MPMA 4U5JA 5BVOA 4EH7A 4O7SA 3UIMA 1H1WA 3DLSA 4C3FA 3QX4A 3ZO3A 1R0EA 3ZLSA 5TOZA 3EL7A 2W7XA 3DA6A 4ASXA 3UMWA 3SGCA 4PTCA 4Q2AA 4FI1A 5FBNC 4R1VA 5JMSA 4ZTLA 3R1QA 2XAMA 4G16A 4EOLA 2ERZE 3OUKA 4IDTA 4RIXA 5E8TA 5JKGA 1UA2A 4HVGA 2ESMA 5HICA 1FBNA 4II5A 5HQ0A 3UOLA 4X2JA 5C4LA 4KKEA 4YNOA 1FQ1B 3I0OA 2R3KA 3CGFA 1ZY4A 4BIDA 5FP6A 5HE2A 4CG9A 3QKMA 1U5RA 1YOLA 5TE0A 3KRWA 3FYJX 4EK4A 4NFNA 1WBNA 4DFXE 4F9YA 2W9FB 1XBBA 3RK9A 4O0YA 5KHWA 3DK6A 2W1HA 3HRFA 3I5NA 3MN3A 5IU2A 4G6NA 3TM0A 5AADA 3HMMA 4HYUA 3O7LB 4CRSA 5LCJA 3H9RA 3FY0A 2RL5A 2VU3A 3LFNA 4O0TA 5IA4A 5CT7A 4I41A 4ZK5A 3GQLA 3Q4TA 4I1ZA 1TKIA 3NEWA 4OT6A 2REIA 2VTOA 3CTHA 4D1ZA 3F69A 4IX6A 5C1QB 3TUCA 1M14A 2QOKA 4FL3A 5J8IA 3RTPA 3KMWA 2XKFA 4QD6A 4A7CA 4PNKA 4F1TA 4LRJA 2YM5A 3CP9A 2C3KA 2G1TA 3IDPA 4NWMA 3FAAA 5FXQA 3R8VA 3ZHPC 4DG3E 1UU3A 3CJGA 3MFSA 5CAVA 4QDEA 2F57A 3PIXA 4DFBA 2BZJA 5AP7A 3OOMA 5CWZA 2A2AA 2YZAA 2FH9A 3EN6A 3GC9A 4D9UA 1IAHA 3CJFA 4I0SA 4YZNA 3DTWA 4IVBA 3AC8A 1K2PA 4GK2A 4J99A 4Q5HA 4TWNA 2BCJA 2X9FA 3EQGA 3PIZA 2YITA 5H8BA 1OI9A 3NUPA 3R83A 1OBDA 2VTLA 1PXNA 1APME 2RSVA 2YFXA 5E8ZA 1G8AA 4U81A 4ZOGA 4JI9A 3P5JC 4FV5A 3JVSA 4CCBA 3TZ7A 3GUBA 4OTPA 4O7VA 4YZMA 1WBPA 3DKGA 3PSDA 5AV3A 3W2PA 3BHYA 2OWBA 2BAKA 4E4LA 2EU9A 5CVFA 4FTQA 3AG9A 5LMBA 2JKKA 5LCKA 4IMYA 4IQ6A 1H4LA 5DT3A 5TKDA 4FK3A 4HVDA 2OZAB 4XV3A 5H9BA 1H07A 3HNGA 5BNJA 2BIYA 4MXXA 3EQBA 1WAKA 1Q8WA 1HCLA 4YSMA 3JY0A 2WMTA 5AUTA 3SW7A 2G2HA 4FKJA 2PZRA 4TWPA 4CEGA 3L9PA 3ORKA 1RJBA 2QOFA 3E7VA 4OUCA 4UWYA 4X3FB 3SLSA 3OXZA 3VBYA 3MFTA 4E3CA 1VR2A 4AUAA 5BUJA 2CGXA 3MH0A 4BCHA 5CEIA 4NUSA 2IVTA 2RF9A 4O6EA 3IW5A 1H01A 2CMWA 2LAVA 2BZHB 3QXPA 4ZZOA 4K77A 2JBPA 4B99A 2RFDA 5F4NA 2WB8A 3I6UA 3DJ7A 4ONAA 5EW8A 1PY5A 3PJ1A 1GIHA 2PVRA 3R73A 4F65A 2V62A 3ORXA 2HENA 5M4CA 3KXZA 4QYGA 3EH9A 4X0MA 2EVAA 5HEZA 4JBQA 3P4KA 3GCQA 3U51A 4C35A 5IA3A 5E1EA 3W55A 4ANNA 2FSLX 1TZDA 3ORLA 4Q9ZA 4S34A 3R8UA 3GNIB 2OJIA 3QWKA 3S3IA 4D2SA 2WD1A 4EOSA 4BHZA 5HO7A 4QPMA 3RWQA 5CASA 5JRQA 4KIOA 2NPQA 2WQMA 2A0CX 3SV0A 2P33A 4M84A 4LG4A 4O4FA 2R3GA 4JXFA 5DT0A 3UNKA 1P14A 2R3IA 3MVLA 4YLJA 4MHAA 3TV7A 4QP8A 5EOBA 4DCEA 2QOHA 4UZDA 4JG6A 2X0QA 3V3VA 4S31A 5M57A 3W2CA 3NW5A 5AV4A 2UW0A